3CCV1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccv100
1KD12 3CXCY 3CCMZ 3CCRZ 3CCR1 3CMA1 1VQ9Z 1VQ91 1VQ4Z 1VQ41 3G6E1 1QVFY 1YHQZ 1YHQ1 1QVGY 1N8R1 1VQM1 1K8A2 1VQKZ 3G71Z 3G711 1KQSY 1VQLZ 3G4SZ 3G4S1 3CCEZ 1M902 1K731 3CCUZ 3CCU1 1W2BY 3I55Z 3I551 3CXCZ 3CCLZ 3CC21 3CCSZ 1VQ6Z 1VQOZ 1VQO1 1QVFZ 3CMAZ 3CCV1 3G6EZ 1KQSZ 3I561 1VQMZ 2OTL1 1KC81 1S72Z 3CCJZ 3CCJ1 1S721 1M901 1JJ2Z 1YIT1 1M1K2 1NJI2 3CC2Z 1Q821 1Q811 3OW2Y 2OTJZ 2OTJ1 3CC4Z 3CC41 1Q7Y2 1KD11 1YI21 3CPWY 1VQP1 1YJWZ 1YJN1 3CCVZ 1YJW1 1QVGZ 1N8R2 3CD6Z 3I56Z 3CD61 2QA4Z 2QA41 1Q862 3CME1 1K9M2 2QEX1 1K8A1 2OTLZ 1VQN1 1W2BZ 1K732 3OW2Z 3CCQ1 1VQ71 1M1K1 1YITZ 3CPWZ 3CCM1 3CC7Z 3CC71 1Q7Y1 1YI2Z 1VQPZ 1YJNZ 1VQK1 1Q861 1VQL1 1YJ9Z 1YJ91 1K9M1 3CMEZ 3CCE1 2QEXZ 1VQ5Z 1VQ51 1KC82 1VQ8Z 1VQ81 1VQNZ 3CCL1 3CCS1 3CCQZ 1Q822 1Q812 1VQ7Z 1YIJZ 1YIJ1 1NJI1 1VQ61 1JJ2Y
chains in the Genus database with same CATH superfamily
1KD12 3CCMZ 3CCRZ 3CCR1 3D2LA 3IR7A 1FDOA 2JIMA 2QR1B 4A3II 1VQ4Z 1SFOI 1VQ41 1TWAI 3EERA 1K8A2 1VQKZ 2E2JI 2JS4A 2IZ3A 1Q16A 4MXUA 2IZ4A 2QREB 2JA8I 1Z02A 4MD9A 2Q51A 3PO3I 4E30A 4A3JI 3EEDA 3CCV1 2QRDB 2DE7A 5FLMI 2AKLA 5FLXf 1QYPA 4A3EI 1Y1VS 4DGLA 3GTKI 4NOZA 1KC81 4AYBA 2RHBA 4MONA 4RVGA 2PM9A 2HU9A 2P3YA 5FLXb 1X0TA 1M1K2 3CC2Z 1Q821 3PO2I 1Y1VI 2E2II 1QXFA 2W04A 2V8IA 3CPWY 1VQP1 3NFZA 3GTJI 2QA4Z 2QA41 2JA7I 2QEX1 3F3FC 4DK1A 2OZKA 4E2WA 3IFUA 2JA6I 1VQ71 3CPWZ 3NH5A 2JIRA 1Q7Y1 2YADA 4RVDA 5A2Qf 4A3FI 4BY1I 1YUAA 3CMEZ 2OOXB 5A2Qb 2I3CA 1KC82 3VTNA 3M3YI 3S14I 1TWHI 2NAPA 3CCQZ 3CCS1 1Q822 1YIJZ 1YIJ1 4NBBA 1TWGI 2BJOA 1R9TI 2K5RA 3G6E1 3BG0B 1QVGY 3K7AI 2NVQI 1VQLZ 3G4SZ 3G4S1 3CCEZ 3KIFA 4A3BI 1VLAA 2J6AA 1K731 1W2BY 3I55Z 3I551 3HOWI 2V3VA 3HOYI 3VMIA 4X6AI 4E31A 2NVXI 3T4NB 4BBRI 4RVHA 2E7ZA 3M4OI 2JMOA 2E2HI 3P5JB 2F4MA 3I561 4HGYA 3PO3S 3GTGI 2OTL1 5IT9f 4A3DI 4A93I 2VPXA 1M901 4S1TA 4NBDA 5LL6f 4A3CI 3QWUA 3U50C 3I4MI 3GKQA 3NH8A 5IT9b 3S17I 1FDIA 2IV2X 2JUBA 2OTJZ 2OTJ1 3CC4Z 3CC41 4NB8A 3S1RI 3S15I 1ML8A 1YJWZ 1YJW1 3CCVZ 3D9XA 2JIOA 5C4JI 1QF8A 5D1OA 4MRIA 3GTQI 1Q862 1SIWA 1I6HI 1S7MA 3J7A4 1USPA 3CQZI 1X3ZA 4NBCA 1RQFA 1K732 5CM2M 3GTLI 5IP9I 3MONA 2GU2A 3BG1B 1N2FA 2PK7A 3J80f 3VMHA 2VUMI 2O4HA 4NBGA 1I3QI 3FQQA 2JR6A 1VQPZ 3S16I 1TFIA 4A3GI 3J80b 3HOVI 2R7ZI 2YU9I 3MZLB 1K9M1 2QEXZ 1VQ5Z 1VQ51 3HKZA 1VQ8Z 1VQ81 4TNUA 4A3MI 3GTPI 3CCL1 2M6NA 1VQ7Z 1NJI1 1VQ61 1JJ2Y 4BY7I 3CMA1 2PMZA 3RZDI 3GTOI 1VQ9Z 2VPWA 2VUGA 1VQ91 1NUIA 2V8JA 1QVFY 1YHQZ 1YHQ1 2JIPA 3NH4A 1N8R1 1PFTA 1VQM1 4NBHA 2LFUA 2ZAEB 3CCUZ 3CCU1 2R6MA 3KIHA 3JAMf 3CCSZ 1RNIA 1RLYA 4NBFA 1QVFZ 4E32A 2QKDA 5T64A 3JAMb 3G6EZ 3S1MI 1RO4A 1DL6A 5D1OB 1Y1WI 4A3KI 4E33A 4MD8A 1Y8CA 1YUKA 4HGZA 1LQLA 3CCJ1 1USPB 2KPIA 3TE5B 3CCJZ 4E2XA 3Q87A 1YIT1 1NJI2 2Q4ZA 4QTTA 5C44I 3OW2Y 1ZB9A 4QTUA 1Q7Y2 1YI21 2Y0SA 1YJN1 1QVGZ 2E9HA 1N8R2 3F3PC 3CD6Z 3I56Z 3CD61 2P28A 2OTLZ 4RVFA 2DE6A 2AYDA 4MD7A 1VQN1 1W2BZ 3HOXI 4NBEA 3OW2Z 2R93I 1M1K1 5IP7I 3FKII 2O53A 3CCM1 3HOZI 1WZNA 2R92I 5C3EI 1K83I 4NH1C 2G2KA 3J81f 1VQK1 1Z01A 1YJ9Z 1YJ91 4NB9A 1KRLA 2WAQA 3ESWA 5AN9F 3S2HI 4E2ZA 2LEXA 3HOUI 3J81b 2WB1A 3I07A 2DE5A 2F4OA 3CXCY 4DQYB 2JNYA 4EWCA 2V8KA 1AA6A 1RO2A 1X3WA 5C4XI 1JWHC 2RBLA 2GTHA 3G71Z 3G711 4Y52I 1KQSY 3TDHB 2JIQA 2W03A 4NBAA 1M902 3CCLZ 2RT9A 4XX2A 3CXCZ 3CC21 1WJ2A 2QLVB 1VQ6Z 2H85A 1VQOZ 1VQO1 3H3VJ 3CMAZ 3NDIA 3S1NI 1I50I 1KQSZ 3RZOI 2B63I 1ZB8A 1L1OC 3I4NI 4HH4A 1VQMZ 2V45A 3H0GI 2NVTI 1NP6A 1S72Z 1S721 1WW9A 1JJ2Z 1WCMI 1Q811 2JA5I 2VPZA 2RPRA 1Z03A 1WIIA 1KD11 1ZH1A 4Y7NI 3S2DI 5T6BA 4MH4A 3VB9A 3VMGA 2VPYA 3S1QI 3CME1 1K9M2 2VF1A 4RS4A 1K8A1 5D1PA 4RV9A 3FQMA 4BBSI 2HF1A 2EGTA 4A3LI 4BXXI 3D6WA 3CCQ1 2QRCB 1YITZ 2KI7B 2LIYA 5T67A 3CC7Z 3CC71 3NDJA 1YI2Z 3GTMS 3MZKB 1YJNZ 3GCFA 3IF8A 1Q861 1VQL1 2K3RA 3CCE1 4CL1A 2M48A 4E2YA 4NFRA 2RIQA 1VQNZ 3GTMI 1P9NA 2NVYI 1Q812 3IX0A 2OOYB 2GTIA 1RO0A 3LUSA 1TWFI 1TWCI
chains in the Genus database with same CATH topology
1KD12 3CCMZ 3CCRZ 3CCR1 2QR1B 4A3II 1VQ4Z 1SFOI 1VQ41 1TWAI 3EERA 1K8A2 1VQKZ 2E2JI 2JS4A 2IZ3A 4MXUA 2IZ4A 2QREB 2JA8I 1Z02A 4MD9A 2Q51A 3PO3I 4E30A 4A3JI 3EEDA 3CCV1 2QRDB 2DE7A 5FLMI 2AKLA 5FLXf 1QYPA 4A3EI 1Y1VS 4DGLA 3GTKI 4NOZA 1KC81 4AYBA 2RHBA 4MONA 4RVGA 2PM9A 2HU9A 2P3YA 5FLXb 1X0TA 1M1K2 3CC2Z 1Q821 3PO2I 1Y1VI 2E2II 2W04A 2V8IA 3CPWY 1VQP1 3NFZA 3GTJI 2QA4Z 2QA41 2JA7I 2QEX1 3F3FC 4DK1A 2OZKA 4E2WA 3IFUA 2JA6I 1VQ71 3CPWZ 3NH5A 1Q7Y1 2YADA 4RVDA 5A2Qf 4A3FI 4BY1I 1YUAA 3CMEZ 2OOXB 5A2Qb 2I3CA 1KC82 3VTNA 3M3YI 3S14I 1TWHI 3CCS1 3CCQZ 1Q822 1YIJZ 1YIJ1 4NBBA 1TWGI 2BJOA 1R9TI 2K5RA 3G6E1 3BG0B 1QVGY 3K7AI 2NVQI 1VQLZ 3G4SZ 3G4S1 3CCEZ 3KIFA 4A3BI 1VLAA 2J6AA 1K731 1W2BY 3I55Z 3I551 3HOWI 3HOYI 3VMIA 4X6AI 4E31A 2NVXI 3T4NB 4BBRI 4RVHA 3M4OI 2JMOA 2E2HI 3P5JB 2F4MA 3I561 4HGYA 3PO3S 3GTGI 2OTL1 5IT9f 4A3DI 4A93I 1M901 4S1TA 4NBDA 5LL6f 4A3CI 3QWUA 3U50C 3I4MI 3GKQA 3NH8A 5IT9b 3S17I 2JUBA 2OTJZ 2OTJ1 3CC4Z 3CC41 4NB8A 3S1RI 3S15I 1ML8A 1YJWZ 1YJW1 3CCVZ 3D9XA 5C4JI 1QF8A 5D1OA 4MRIA 3GTQI 1Q862 1I6HI 1S7MA 3J7A4 1USPA 3CQZI 1X3ZA 4NBCA 1RQFA 1K732 5CM2M 3GTLI 5IP9I 3MONA 2GU2A 3BG1B 1N2FA 2PK7A 3J80f 3VMHA 2VUMI 2O4HA 4NBGA 1I3QI 3FQQA 2JR6A 1VQPZ 3S16I 1TFIA 4A3GI 3J80b 3HOVI 2R7ZI 2YU9I 3MZLB 1K9M1 2QEXZ 1VQ5Z 1VQ51 3HKZA 1VQ8Z 1VQ81 4TNUA 4A3MI 3GTPI 3CCL1 2M6NA 1VQ7Z 1NJI1 1VQ61 1JJ2Y 4BY7I 3CMA1 2PMZA 3RZDI 3GTOI 1VQ9Z 1VQ91 2VUGA 1NUIA 2V8JA 1QVFY 1YHQZ 1YHQ1 3NH4A 1N8R1 1PFTA 1VQM1 4NBHA 2LFUA 2ZAEB 3CCUZ 3CCU1 2R6MA 3KIHA 3JAMf 3CCSZ 1RNIA 1RLYA 4NBFA 1QVFZ 4E32A 2QKDA 5T64A 3JAMb 3G6EZ 3S1MI 1RO4A 1DL6A 5D1OB 1Y1WI 4A3KI 4E33A 4MD8A 1YUKA 4HGZA 1LQLA 3CCJ1 1USPB 2KPIA 3TE5B 3CCJZ 4E2XA 3Q87A 1YIT1 1NJI2 2Q4ZA 4QTTA 5C44I 3OW2Y 1ZB9A 4QTUA 1Q7Y2 1YI21 2Y0SA 1YJN1 1QVGZ 2E9HA 1N8R2 3F3PC 3CD6Z 3I56Z 3CD61 2P28A 2OTLZ 4RVFA 2DE6A 4MD7A 1VQN1 1W2BZ 3HOXI 4NBEA 3OW2Z 2R93I 1M1K1 5IP7I 3FKII 2O53A 3CCM1 3HOZI 2R92I 5C3EI 1K83I 4NH1C 2G2KA 3J81f 1VQK1 1Z01A 1YJ9Z 1YJ91 4NB9A 1KRLA 2WAQA 3ESWA 5AN9F 3S2HI 4E2ZA 3HOUI 3J81b 2WB1A 3I07A 2DE5A 2F4OA 3CXCY 4DQYB 2JNYA 4EWCA 2V8KA 1RO2A 1X3WA 5C4XI 1JWHC 2RBLA 2GTHA 3G71Z 3G711 4Y52I 1KQSY 3TDHB 2W03A 4NBAA 1M902 3CCLZ 2RT9A 4XX2A 3CXCZ 3CC21 2QLVB 1VQ6Z 2H85A 1VQOZ 1VQO1 3H3VJ 3CMAZ 3NDIA 3S1NI 1I50I 1KQSZ 3RZOI 2B63I 1ZB8A 1L1OC 3I4NI 4HH4A 1VQMZ 3H0GI 2NVTI 1NP6A 1S72Z 1S721 1WW9A 1JJ2Z 1WCMI 1Q811 2JA5I 2RPRA 1Z03A 1WIIA 1KD11 1ZH1A 4Y7NI 3S2DI 5T6BA 4MH4A 3VB9A 3VMGA 3S1QI 3CME1 1K9M2 2VF1A 4RS4A 1K8A1 5D1PA 4RV9A 3FQMA 4BBSI 2HF1A 2EGTA 4A3LI 4BXXI 3D6WA 3CCQ1 2QRCB 1YITZ 2KI7B 2LIYA 5T67A 3CC7Z 3CC71 3NDJA 1YI2Z 3GTMS 3MZKB 1YJNZ 3GCFA 3IF8A 1Q861 1VQL1 2K3RA 3CCE1 4CL1A 2M48A 4E2YA 4NFRA 2RIQA 1VQNZ 3GTMI 1P9NA 2NVYI 1Q812 3IX0A 2OOYB 2GTIA 1RO0A 3LUSA 1TWFI 1TWCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 2;  3CXC Y;  3CCM Z;  3CCR Z;  3CCR 1;  3CMA 1;  1VQ9 Z;  1VQ9 1;  1VQ4 Z;  1VQ4 1;  3G6E 1;  1QVF Y;  1YHQ Z;  1YHQ 1;  1QVG Y;  1N8R 1;  1VQM 1;  1K8A 2;  1VQK Z;  3G71 Z;  3G71 1;  1KQS Y;  1VQL Z;  3G4S Z;  3G4S 1;  3CCE Z;  1M90 2;  1K73 1;  3CCU Z;  3CCU 1;  1W2B Y;  3I55 Z;  3I55 1;  3CXC Z;  3CCL Z;  3CC2 1;  3CCS Z;  1VQ6 Z;  1VQO Z;  1VQO 1;  1QVF Z;  3CMA Z;  3CCV 1;  3G6E Z;  1KQS Z;  3I56 1;  1VQM Z;  2OTL 1;  1KC8 1;  1S72 Z;  3CCJ Z;  3CCJ 1;  1S72 1;  1M90 1;  1JJ2 Z;  1YIT 1;  1M1K 2;  1NJI 2;  3CC2 Z;  1Q82 1;  1Q81 1;  3OW2 Y;  2OTJ Z;  2OTJ 1;  3CC4 Z;  3CC4 1;  1Q7Y 2;  1KD1 1;  1YI2 1;  3CPW Y;  1VQP 1;  1YJW Z;  1YJN 1;  3CCV Z;  1YJW 1;  1QVG Z;  1N8R 2;  3CD6 Z;  3I56 Z;  3CD6 1;  2QA4 Z;  2QA4 1;  1Q86 2;  3CME 1;  1K9M 2;  2QEX 1;  1K8A 1;  2OTL Z;  1VQN 1;  1W2B Z;  1K73 2;  3OW2 Z;  3CCQ 1;  1VQ7 1;  1M1K 1;  1YIT Z;  3CPW Z;  3CCM 1;  3CC7 Z;  3CC7 1;  1Q7Y 1;  1YI2 Z;  1VQP Z;  1YJN Z;  1VQK 1;  1Q86 1;  1VQL 1;  1YJ9 Z;  1YJ9 1;  1K9M 1;  3CME Z;  3CCE 1;  2QEX Z;  1VQ5 Z;  1VQ5 1;  1KC8 2;  1VQ8 Z;  1VQ8 1;  1VQN Z;  3CCL 1;  3CCS 1;  3CCQ Z;  1Q82 2;  1Q81 2;  1VQ7 Z;  1YIJ Z;  1YIJ 1;  1NJI 1;  1VQ6 1;  1JJ2 Y; 
#chains in the Genus database with same CATH topology
 1KD1 2;  3CCM Z;  3CCR Z;  3CCR 1;  3D2L A;  3IR7 A;  1FDO A;  2JIM A;  2QR1 B;  4A3I I;  1VQ4 Z;  1SFO I;  1VQ4 1;  1TWA I;  3EER A;  1K8A 2;  1VQK Z;  2E2J I;  2JS4 A;  2IZ3 A;  1Q16 A;  4MXU A;  2IZ4 A;  2QRE B;  2JA8 I;  1Z02 A;  4MD9 A;  2Q51 A;  3PO3 I;  4E30 A;  4A3J I;  3EED A;  3CCV 1;  2QRD B;  2DE7 A;  5FLM I;  2AKL A;  5FLX f;  1QYP A;  4A3E I;  1Y1V S;  4DGL A;  3GTK I;  4NOZ A;  1KC8 1;  4AYB A;  2RHB A;  4MON A;  4RVG A;  2PM9 A;  2HU9 A;  2P3Y A;  5FLX b;  1X0T A;  1M1K 2;  3CC2 Z;  1Q82 1;  3PO2 I;  1Y1V I;  2E2I I;  1QXF A;  2W04 A;  2V8I A;  3CPW Y;  1VQP 1;  3NFZ A;  3GTJ I;  2QA4 Z;  2QA4 1;  2JA7 I;  2QEX 1;  3F3F C;  4DK1 A;  2OZK A;  4E2W A;  3IFU A;  2JA6 I;  1VQ7 1;  3CPW Z;  3NH5 A;  2JIR A;  1Q7Y 1;  2YAD A;  4RVD A;  5A2Q f;  4A3F I;  4BY1 I;  1YUA A;  3CME Z;  2OOX B;  5A2Q b;  2I3C A;  1KC8 2;  3VTN A;  3M3Y I;  3S14 I;  1TWH I;  2NAP A;  3CCQ Z;  3CCS 1;  1Q82 2;  1YIJ Z;  1YIJ 1;  4NBB A;  1TWG I;  2BJO A;  1R9T I;  2K5R A;  3G6E 1;  3BG0 B;  1QVG Y;  3K7A I;  2NVQ I;  1VQL Z;  3G4S Z;  3G4S 1;  3CCE Z;  3KIF A;  4A3B I;  1VLA A;  2J6A A;  1K73 1;  1W2B Y;  3I55 Z;  3I55 1;  3HOW I;  2V3V A;  3HOY I;  3VMI A;  4X6A I;  4E31 A;  2NVX I;  3T4N B;  4BBR I;  4RVH A;  2E7Z A;  3M4O I;  2JMO A;  2E2H I;  3P5J B;  2F4M A;  3I56 1;  4HGY A;  3PO3 S;  3GTG I;  2OTL 1;  5IT9 f;  4A3D I;  4A93 I;  2VPX A;  1M90 1;  4S1T A;  4NBD A;  5LL6 f;  4A3C I;  3QWU A;  3U50 C;  3I4M I;  3GKQ A;  3NH8 A;  5IT9 b;  3S17 I;  1FDI A;  2IV2 X;  2JUB A;  2OTJ Z;  2OTJ 1;  3CC4 Z;  3CC4 1;  4NB8 A;  3S1R I;  3S15 I;  1ML8 A;  1YJW Z;  1YJW 1;  3CCV Z;  3D9X A;  2JIO A;  5C4J I;  1QF8 A;  5D1O A;  4MRI A;  3GTQ I;  1Q86 2;  1SIW A;  1I6H I;  1S7M A;  3J7A 4;  1USP A;  3CQZ I;  1X3Z A;  4NBC A;  1RQF A;  1K73 2;  5CM2 M;  3GTL I;  5IP9 I;  3MON A;  2GU2 A;  3BG1 B;  1N2F A;  2PK7 A;  3J80 f;  3VMH A;  2VUM I;  2O4H A;  4NBG A;  1I3Q I;  3FQQ A;  2JR6 A;  1VQP Z;  3S16 I;  1TFI A;  4A3G I;  3J80 b;  3HOV I;  2R7Z I;  2YU9 I;  3MZL B;  1K9M 1;  2QEX Z;  1VQ5 Z;  1VQ5 1;  3HKZ A;  1VQ8 Z;  1VQ8 1;  4TNU A;  4A3M I;  3GTP I;  3CCL 1;  2M6N A;  1VQ7 Z;  1NJI 1;  1VQ6 1;  1JJ2 Y;  4BY7 I;  3CMA 1;  2PMZ A;  3RZD I;  3GTO I;  1VQ9 Z;  2VPW A;  2VUG A;  1VQ9 1;  1NUI A;  2V8J A;  1QVF Y;  1YHQ Z;  1YHQ 1;  2JIP A;  3NH4 A;  1N8R 1;  1PFT A;  1VQM 1;  4NBH A;  2LFU A;  2ZAE B;  3CCU Z;  3CCU 1;  2R6M A;  3KIH A;  3JAM f;  3CCS Z;  1RNI A;  1RLY A;  4NBF A;  1QVF Z;  4E32 A;  2QKD A;  5T64 A;  3JAM b;  3G6E Z;  3S1M I;  1RO4 A;  1DL6 A;  5D1O B;  1Y1W I;  4A3K I;  4E33 A;  4MD8 A;  1Y8C A;  1YUK A;  4HGZ A;  1LQL A;  3CCJ 1;  1USP B;  2KPI A;  3TE5 B;  3CCJ Z;  4E2X A;  3Q87 A;  1YIT 1;  1NJI 2;  2Q4Z A;  4QTT A;  5C44 I;  3OW2 Y;  1ZB9 A;  4QTU A;  1Q7Y 2;  1YI2 1;  2Y0S A;  1YJN 1;  1QVG Z;  2E9H A;  1N8R 2;  3F3P C;  3CD6 Z;  3I56 Z;  3CD6 1;  2P28 A;  2OTL Z;  4RVF A;  2DE6 A;  2AYD A;  4MD7 A;  1VQN 1;  1W2B Z;  3HOX I;  4NBE A;  3OW2 Z;  2R93 I;  1M1K 1;  5IP7 I;  3FKI I;  2O53 A;  3CCM 1;  3HOZ I;  1WZN A;  2R92 I;  5C3E I;  1K83 I;  4NH1 C;  2G2K A;  3J81 f;  1VQK 1;  1Z01 A;  1YJ9 Z;  1YJ9 1;  4NB9 A;  1KRL A;  2WAQ A;  3ESW A;  5AN9 F;  3S2H I;  4E2Z A;  2LEX A;  3HOU I;  3J81 b;  2WB1 A;  3I07 A;  2DE5 A;  2F4O A;  3CXC Y;  4DQY B;  2JNY A;  4EWC A;  2V8K A;  1AA6 A;  1RO2 A;  1X3W A;  5C4X I;  1JWH C;  2RBL A;  2GTH A;  3G71 Z;  3G71 1;  4Y52 I;  1KQS Y;  3TDH B;  2JIQ A;  2W03 A;  4NBA A;  1M90 2;  3CCL Z;  2RT9 A;  4XX2 A;  3CXC Z;  3CC2 1;  1WJ2 A;  2QLV B;  1VQ6 Z;  2H85 A;  1VQO Z;  1VQO 1;  3H3V J;  3CMA Z;  3NDI A;  3S1N I;  1I50 I;  1KQS Z;  3RZO I;  2B63 I;  1ZB8 A;  1L1O C;  3I4N I;  4HH4 A;  1VQM Z;  2V45 A;  3H0G I;  2NVT I;  1NP6 A;  1S72 Z;  1S72 1;  1WW9 A;  1JJ2 Z;  1WCM I;  1Q81 1;  2JA5 I;  2VPZ A;  2RPR A;  1Z03 A;  1WII A;  1KD1 1;  1ZH1 A;  4Y7N I;  3S2D I;  5T6B A;  4MH4 A;  3VB9 A;  3VMG A;  2VPY A;  3S1Q I;  3CME 1;  1K9M 2;  2VF1 A;  4RS4 A;  1K8A 1;  5D1P A;  4RV9 A;  3FQM A;  4BBS I;  2HF1 A;  2EGT A;  4A3L I;  4BXX I;  3D6W A;  3CCQ 1;  2QRC B;  1YIT Z;  2KI7 B;  2LIY A;  5T67 A;  3CC7 Z;  3CC7 1;  3NDJ A;  1YI2 Z;  3GTM S;  3MZK B;  1YJN Z;  3GCF A;  3IF8 A;  1Q86 1;  1VQL 1;  2K3R A;  3CCE 1;  4CL1 A;  2M48 A;  4E2Y A;  4NFR A;  2RIQ A;  1VQN Z;  3GTM I;  1P9N A;  2NVY I;  1Q81 2;  3IX0 A;  2OOY B;  2GTI A;  1RO0 A;  3LUS A;  1TWF I;  1TWC I; 
#chains in the Genus database with same CATH homology
 1KD1 2;  3CCM Z;  3CCR Z;  3CCR 1;  2QR1 B;  4A3I I;  1VQ4 Z;  1SFO I;  1VQ4 1;  1TWA I;  3EER A;  1K8A 2;  1VQK Z;  2E2J I;  2JS4 A;  2IZ3 A;  4MXU A;  2IZ4 A;  2QRE B;  2JA8 I;  1Z02 A;  4MD9 A;  2Q51 A;  3PO3 I;  4E30 A;  4A3J I;  3EED A;  3CCV 1;  2QRD B;  2DE7 A;  5FLM I;  2AKL A;  5FLX f;  1QYP A;  4A3E I;  1Y1V S;  4DGL A;  3GTK I;  4NOZ A;  1KC8 1;  4AYB A;  2RHB A;  4MON A;  4RVG A;  2PM9 A;  2HU9 A;  2P3Y A;  5FLX b;  1X0T A;  1M1K 2;  3CC2 Z;  1Q82 1;  3PO2 I;  1Y1V I;  2E2I I;  2W04 A;  2V8I A;  3CPW Y;  1VQP 1;  3NFZ A;  3GTJ I;  2QA4 Z;  2QA4 1;  2JA7 I;  2QEX 1;  3F3F C;  4DK1 A;  2OZK A;  4E2W A;  3IFU A;  2JA6 I;  1VQ7 1;  3CPW Z;  3NH5 A;  1Q7Y 1;  2YAD A;  4RVD A;  5A2Q f;  4A3F I;  4BY1 I;  1YUA A;  3CME Z;  2OOX B;  5A2Q b;  2I3C A;  1KC8 2;  3VTN A;  3M3Y I;  3S14 I;  1TWH I;  3CCS 1;  3CCQ Z;  1Q82 2;  1YIJ Z;  1YIJ 1;  4NBB A;  1TWG I;  2BJO A;  1R9T I;  2K5R A;  3G6E 1;  3BG0 B;  1QVG Y;  3K7A I;  2NVQ I;  1VQL Z;  3G4S Z;  3G4S 1;  3CCE Z;  3KIF A;  4A3B I;  1VLA A;  2J6A A;  1K73 1;  1W2B Y;  3I55 Z;  3I55 1;  3HOW I;  3HOY I;  3VMI A;  4X6A I;  4E31 A;  2NVX I;  3T4N B;  4BBR I;  4RVH A;  3M4O I;  2JMO A;  2E2H I;  3P5J B;  2F4M A;  3I56 1;  4HGY A;  3PO3 S;  3GTG I;  2OTL 1;  5IT9 f;  4A3D I;  4A93 I;  1M90 1;  4S1T A;  4NBD A;  5LL6 f;  4A3C I;  3QWU A;  3U50 C;  3I4M I;  3GKQ A;  3NH8 A;  5IT9 b;  3S17 I;  2JUB A;  2OTJ Z;  2OTJ 1;  3CC4 Z;  3CC4 1;  4NB8 A;  3S1R I;  3S15 I;  1ML8 A;  1YJW Z;  1YJW 1;  3CCV Z;  3D9X A;  5C4J I;  1QF8 A;  5D1O A;  4MRI A;  3GTQ I;  1Q86 2;  1I6H I;  1S7M A;  3J7A 4;  1USP A;  3CQZ I;  1X3Z A;  4NBC A;  1RQF A;  1K73 2;  5CM2 M;  3GTL I;  5IP9 I;  3MON A;  2GU2 A;  3BG1 B;  1N2F A;  2PK7 A;  3J80 f;  3VMH A;  2VUM I;  2O4H A;  4NBG A;  1I3Q I;  3FQQ A;  2JR6 A;  1VQP Z;  3S16 I;  1TFI A;  4A3G I;  3J80 b;  3HOV I;  2R7Z I;  2YU9 I;  3MZL B;  1K9M 1;  2QEX Z;  1VQ5 Z;  1VQ5 1;  3HKZ A;  1VQ8 Z;  1VQ8 1;  4TNU A;  4A3M I;  3GTP I;  3CCL 1;  2M6N A;  1VQ7 Z;  1NJI 1;  1VQ6 1;  1JJ2 Y;  4BY7 I;  3CMA 1;  2PMZ A;  3RZD I;  3GTO I;  1VQ9 Z;  1VQ9 1;  2VUG A;  1NUI A;  2V8J A;  1QVF Y;  1YHQ Z;  1YHQ 1;  3NH4 A;  1N8R 1;  1PFT A;  1VQM 1;  4NBH A;  2LFU A;  2ZAE B;  3CCU Z;  3CCU 1;  2R6M A;  3KIH A;  3JAM f;  3CCS Z;  1RNI A;  1RLY A;  4NBF A;  1QVF Z;  4E32 A;  2QKD A;  5T64 A;  3JAM b;  3G6E Z;  3S1M I;  1RO4 A;  1DL6 A;  5D1O B;  1Y1W I;  4A3K I;  4E33 A;  4MD8 A;  1YUK A;  4HGZ A;  1LQL A;  3CCJ 1;  1USP B;  2KPI A;  3TE5 B;  3CCJ Z;  4E2X A;  3Q87 A;  1YIT 1;  1NJI 2;  2Q4Z A;  4QTT A;  5C44 I;  3OW2 Y;  1ZB9 A;  4QTU A;  1Q7Y 2;  1YI2 1;  2Y0S A;  1YJN 1;  1QVG Z;  2E9H A;  1N8R 2;  3F3P C;  3CD6 Z;  3I56 Z;  3CD6 1;  2P28 A;  2OTL Z;  4RVF A;  2DE6 A;  4MD7 A;  1VQN 1;  1W2B Z;  3HOX I;  4NBE A;  3OW2 Z;  2R93 I;  1M1K 1;  5IP7 I;  3FKI I;  2O53 A;  3CCM 1;  3HOZ I;  2R92 I;  5C3E I;  1K83 I;  4NH1 C;  2G2K A;  3J81 f;  1VQK 1;  1Z01 A;  1YJ9 Z;  1YJ9 1;  4NB9 A;  1KRL A;  2WAQ A;  3ESW A;  5AN9 F;  3S2H I;  4E2Z A;  3HOU I;  3J81 b;  2WB1 A;  3I07 A;  2DE5 A;  2F4O A;  3CXC Y;  4DQY B;  2JNY A;  4EWC A;  2V8K A;  1RO2 A;  1X3W A;  5C4X I;  1JWH C;  2RBL A;  2GTH A;  3G71 Z;  3G71 1;  4Y52 I;  1KQS Y;  3TDH B;  2W03 A;  4NBA A;  1M90 2;  3CCL Z;  2RT9 A;  4XX2 A;  3CXC Z;  3CC2 1;  2QLV B;  1VQ6 Z;  2H85 A;  1VQO Z;  1VQO 1;  3H3V J;  3CMA Z;  3NDI A;  3S1N I;  1I50 I;  1KQS Z;  3RZO I;  2B63 I;  1ZB8 A;  1L1O C;  3I4N I;  4HH4 A;  1VQM Z;  3H0G I;  2NVT I;  1NP6 A;  1S72 Z;  1S72 1;  1WW9 A;  1JJ2 Z;  1WCM I;  1Q81 1;  2JA5 I;  2RPR A;  1Z03 A;  1WII A;  1KD1 1;  1ZH1 A;  4Y7N I;  3S2D I;  5T6B A;  4MH4 A;  3VB9 A;  3VMG A;  3S1Q I;  3CME 1;  1K9M 2;  2VF1 A;  4RS4 A;  1K8A 1;  5D1P A;  4RV9 A;  3FQM A;  4BBS I;  2HF1 A;  2EGT A;  4A3L I;  4BXX I;  3D6W A;  3CCQ 1;  2QRC B;  1YIT Z;  2KI7 B;  2LIY A;  5T67 A;  3CC7 Z;  3CC7 1;  3NDJ A;  1YI2 Z;  3GTM S;  3MZK B;  1YJN Z;  3GCF A;  3IF8 A;  1Q86 1;  1VQL 1;  2K3R A;  3CCE 1;  4CL1 A;  2M48 A;  4E2Y A;  4NFR A;  2RIQ A;  1VQN Z;  3GTM I;  1P9N A;  2NVY I;  1Q81 2;  3IX0 A;  2OOY B;  2GTI A;  1RO0 A;  3LUS A;  1TWF I;  1TWC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...