3CCV1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccv100
1VQO1 1VQNZ 1VQN1 1VQ8Z 1VQ81 1VQLZ 3G71Z 1Q812 1KC81 1VQ5Z 1VQL1 3G711 3CMEZ 2OTJZ 1VQ51 1VQKZ 3CME1 2OTJ1 3I55Z 1VQK1 3CC4Z 3CCVZ 3I551 3CCRZ 3CC41 3CCV1 1YHQZ 3CCR1 1VQ7Z 1VQ9Z 3I56Z 1YJ9Z 1YHQ1 2OTLZ 1KD11 1VQ71 1VQ91 1YIJZ 3I561 1YJ91 1NJI1 1M1K2 2OTL1 1N8R2 1YIJ1 1YITZ 3CCUZ 1YIT1 3CC7Z 3CCU1 3CC71 1K732 3CMAZ 3G6EZ 1W2BY 1Q861 3CMA1 1Q822 3G6E1 3G4SZ 3G4S1 3CXCY 1Q811 1KC82 1K9M1 1M902 1Q7Y2 3OW2Y 3CCLZ 1QVFY 3CCL1 1W2BZ 1VQ6Z 3CD6Z 3CCEZ 1YJWZ 1VQ61 3CD61 1KD12 3CCE1 3CXCZ 1M1K1 1YJW1 1N8R1 1K8A2 2QA4Z 3OW2Z 2QA41 1QVFZ 1VQMZ 1S72Z 1QVGZ 1VQM1 1S721 1JJ2Y 1K731 1YI2Z 1Q821 3CCQZ 1Q862 3CCMZ 1KQSY 1VQPZ 1YI21 3CCSZ 3CCQ1 3CCM1 1VQP1 1VQ4Z 3CCS1 3CCJZ 1QVGY 1VQ41 3CPWY 3CCJ1 1K9M2 1M901 2QEXZ 1Q7Y1 1NJI2 3CC2Z 2QEX1 1JJ2Z 3CC21 1KQSZ 1YJNZ 1YJN1 1K8A1 1VQOZ 3CPWZ
chains in the Genus database with same CATH superfamily
2V8JA 4RVHA 1VQO1 2NVTI 1WIIA 2VUMI 3MZLB 1VQN1 1Q16A 3FQQA 1TWHI 2QREB 1KC81 2JIPA 3G711 3VMIA 3CMEZ 1VQ51 2F4OA 4NB8A 3P5JB 2OTJ1 3CC4Z 1YUKA 2HF1A 4MH4A 3CQZI 2P3YA 1YHQZ 3CCR1 1VQ71 3I561 3GKQA 1NJI1 1M1K2 4NBFA 2E2II 2OZKA 2PM9A 1Y1WI 3F3PC 4A93I 2E9HA 4EWCA 2WB1A 1Q861 1Q822 1I6HI 4A3DI 3CXCY 2RHBA 1K9M1 2QR1B 3OW2Y 3CCLZ 1QVFY 3S1MI 1RQFA 1W2BZ 2RIQA 3CCEZ 2OOXB 1I50I 2JA6I 1KD12 1YJW1 1K8A2 3I4MI 3HOUI 2VPXA 3JAMf 4E2WA 2E7ZA 2R92I 1FDIA 3JAMb 1USPB 1X3ZA 1QVGZ 3GTLI 2V45A 1S721 4E33A 1LQLA 4TNUA 3H3VJ 2K5RA 1KQSY 1VQPZ 5A2Qb 3K7AI 4MD9A 3HOYI 1QXFA 4Y52I 3J7A4 3CCS1 1TWGI 3CCJZ 4E2ZA 3CPWY 4MONA 3J80b 1M901 3NDJA 2M6NA 1JJ2Z 3HOWI 2Q4ZA 3IX0A 4RVGA 2EGTA 3T4NB 3S16I 1QYPA 1YJN1 4NBDA 2JUBA 1VQOZ 5FLXb 3NH8A 2AKLA 2NVXI 1VQNZ 4HGZA 1DL6A 2IZ3A 1WJ2A 3NFZA 4DK1A 1VQ81 2Y0SA 3G71Z 1Q812 1VQ5Z 5LL6f 2OTJZ 3MZKB 2GTIA 5T64A 1RO0A 2VF1A 5D1OA 1ZH1A 3CCRZ 2P28A 3CCV1 4X6AI 2JIRA 1VQ7Z 3I56Z 2KPIA 2YADA 1N8R2 4A3MI 2DE7A 1YIJ1 2JA7I 3GTGI 4HH4A 4NBCA 4NBBA 3NDIA 3D2LA 1W2BY 3G6E1 4E2XA 2QRCB 2JA8I 1KC82 2F4MA 1R9TI 2LFUA 1TFIA 3KIFA 4A3LI 3GTPI 2G2KA 1YUAA 1YJWZ 1VLAA 4QTUA 1M1K1 2YU9I 4A3EI 2JS4A 4BY7I 1S72Z 2J6AA 1JJ2Y 2JA5I 2R6MA 1RLYA 2DE5A 1RO2A 2QKDA 1Q821 3BG0B 3QWUA 1Q862 3HKZA 1YI21 3CCSZ 4E31A 3S15I 4MXUA 3FKII 5D1PA 4NOZA 1P9NA 1Y1VI 3TDHB 1K9M2 2QEX1 2E2HI 2V3VA 2V8KA 2VUGA 4E30A 5C4JI 3S1NI 1YJNZ 3HOXI 5IP9I 2AYDA 2NVYI 5IT9f 1K8A1 1Y1VS 2IV2X 4NH1C 4NBGA 4BBSI 3IR7A 4A3II 4QTTA 1VQ8Z 4RS4A 4RV9A 1VQL1 3S2DI 5T67A 1VQK1 3CCVZ 3MONA 3I551 1S7MA 3I4NI 3TE5B 3VTNA 3IFUA 5D1OB 1N2FA 1VQ91 2JMOA 4A3JI 1YIJZ 1YJ91 2OTL1 3I07A 3ESWA 1ZB9A 1RNIA 2JIQA 2IZ4A 1YIT1 2V8IA 3CCU1 2M48A 5FLMI 3CC71 2PMZA 1K732 3G6EZ 2O4HA 2JR6A 2W04A 3CMA1 2B63I 3G4S1 1Q811 4NBAA 1SIWA 1Q7Y2 5AN9F 1KRLA 4MRIA 4RVDA 4RVFA 4Y7NI 3PO3I 1VQ61 3CD61 4AYBA 1Z02A 1N8R1 2O53A 5C44I 2RBLA 1TWCI 4DQYB 2QA41 1NUIA 1QF8A 3F3FC 3GTJI 1JWHC 3PO3S 1VQM1 2RPRA 2DE6A 1FDOA 5CM2M 2R7ZI 2GTHA 3GTOI 1YI2Z 3CCQ1 3CCM1 3PO2I 3GTMI 1TWAI 1QVGY 1VQ41 1ZB8A 2Q51A 4A3KI 4NBHA 3M3YI 2QEXZ 2LIYA 5IP7I 4NB9A 4DGLA 1NJI2 3CC21 3H0GI 5T6BA 3GTMS 5C4XI 2W03A 2KI7B 1WCMI 3KIHA 4XX2A 1WW9A 3S17I 4E2YA 3S1QI 3U50C 2JIMA 1Z01A 4MD8A 1PFTA 3J81f 3M4OI 3S14I 2VPWA 2LEXA 1VQLZ 2NVQI 3D6WA 2QLVB 3J81b 2H85A 1VQKZ 3HOVI 3CME1 3I55Z 2VPZA 3S2HI 3CC41 2K3RA 1VQ9Z 1TWFI 1Y8CA 1YHQ1 1YJ9Z 1WZNA 2OTLZ 1KD11 1ML8A 4S1TA 3VMHA 1YITZ 5IT9b 3LUSA 3CCUZ 2WAQA 4NFRA 3D9XA 2BJOA 3CC7Z 3GTQI 1RO4A 4A3GI 1L1OC 2PK7A 2RT9A 3CMAZ 3NH4A 1AA6A 3S1RI 3G4SZ 1X0TA 1I3QI 3NH5A 5A2Qf 4BBRI 1M902 3EEDA 2JIOA 2JNYA 3CCL1 3J80f 3BG1B 2HU9A 1VQ6Z 3RZOI 4A3BI 3CD6Z 1K83I 1NP6A 5C3EI 3CCE1 3CXCZ 2R93I 4CL1A 1USPA 2QA4Z 2I3CA 3OW2Z 1QVFZ 2ZAEB 5FLXf 1VQMZ 1SFOI 4A3CI 3FQMA 1K731 4NBEA 3CCQZ 3CCMZ 3EERA 2GU2A 2OOYB 3VMGA 1VQP1 3VB9A 1VQ4Z 1X3WA 1Z03A 3CCJ1 4MD7A 4E32A 3IF8A 1Q7Y1 3HOZI 3CC2Z 3GCFA 4BXXI 2VPYA 4BY1I 2NAPA 4HGYA 2QRDB 3GTKI 1KQSZ 2E2JI 4A3FI 3RZDI 3CPWZ 3Q87A
chains in the Genus database with same CATH topology
2V8JA 4RVHA 1VQO1 2NVTI 1WIIA 2VUMI 3MZLB 1VQN1 3FQQA 1TWHI 2QREB 1KC81 3G711 3VMIA 3CMEZ 1VQ51 2F4OA 4NB8A 3P5JB 2OTJ1 3CC4Z 1YUKA 2HF1A 4MH4A 3CQZI 2P3YA 1YHQZ 3CCR1 1VQ71 3I561 3GKQA 1NJI1 1M1K2 4NBFA 2E2II 2OZKA 2PM9A 1Y1WI 3F3PC 4A93I 2E9HA 4EWCA 2WB1A 1Q861 1Q822 1I6HI 4A3DI 3CXCY 2RHBA 1K9M1 2QR1B 3OW2Y 3CCLZ 1QVFY 3S1MI 1RQFA 1W2BZ 2RIQA 3CCEZ 2OOXB 1I50I 2JA6I 1KD12 1YJW1 1K8A2 3I4MI 3HOUI 3JAMf 4E2WA 2R92I 3JAMb 1USPB 1X3ZA 1QVGZ 3GTLI 1S721 4E33A 1LQLA 4TNUA 3H3VJ 2K5RA 1KQSY 1VQPZ 5A2Qb 3K7AI 4MD9A 3HOYI 4Y52I 3J7A4 3CCS1 1TWGI 3CCJZ 4E2ZA 3CPWY 4MONA 3J80b 1M901 3NDJA 2M6NA 1JJ2Z 3HOWI 2Q4ZA 3IX0A 4RVGA 2EGTA 3T4NB 3S16I 1QYPA 1YJN1 4NBDA 2JUBA 1VQOZ 5FLXb 3NH8A 2AKLA 2NVXI 1VQNZ 4HGZA 1DL6A 2IZ3A 3NFZA 4DK1A 1VQ81 2Y0SA 3G71Z 1Q812 1VQ5Z 5LL6f 2OTJZ 3MZKB 2GTIA 5T64A 1RO0A 2VF1A 5D1OA 1ZH1A 3CCRZ 2P28A 3CCV1 4X6AI 1VQ7Z 3I56Z 2KPIA 2YADA 1N8R2 4A3MI 2DE7A 1YIJ1 2JA7I 3GTGI 4HH4A 4NBCA 4NBBA 3NDIA 1W2BY 3G6E1 4E2XA 2QRCB 2JA8I 1KC82 2F4MA 1R9TI 2LFUA 1TFIA 3KIFA 4A3LI 3GTPI 2G2KA 1YUAA 1YJWZ 1VLAA 4QTUA 1M1K1 2YU9I 4A3EI 2JS4A 4BY7I 1S72Z 2J6AA 1JJ2Y 2JA5I 2R6MA 1RLYA 2DE5A 1RO2A 2QKDA 1Q821 3BG0B 3QWUA 1Q862 3HKZA 1YI21 3CCSZ 4E31A 3S15I 4MXUA 3FKII 5D1PA 4NOZA 1P9NA 1Y1VI 3TDHB 1K9M2 2QEX1 2E2HI 5C4JI 2V8KA 2VUGA 4E30A 3S1NI 1YJNZ 3HOXI 5IP9I 2NVYI 5IT9f 1K8A1 1Y1VS 4NH1C 4NBGA 4BBSI 4A3II 4QTTA 1VQ8Z 4RS4A 4RV9A 1VQL1 3S2DI 5T67A 1VQK1 3CCVZ 3MONA 3I551 1S7MA 3I4NI 3TE5B 3VTNA 3IFUA 5D1OB 1N2FA 1VQ91 2JMOA 4A3JI 1YIJZ 1YJ91 2OTL1 3I07A 3ESWA 1ZB9A 1RNIA 2IZ4A 1YIT1 2V8IA 3CCU1 2M48A 5FLMI 3CC71 2PMZA 1K732 3G6EZ 2O4HA 2JR6A 2W04A 3CMA1 2B63I 3G4S1 1Q811 4NBAA 1Q7Y2 5AN9F 1KRLA 4MRIA 4RVDA 4RVFA 4Y7NI 3PO3I 1VQ61 3CD61 4AYBA 1Z02A 1N8R1 2O53A 5C44I 2RBLA 1TWCI 4DQYB 2QA41 1NUIA 1QF8A 3F3FC 3GTJI 1JWHC 3PO3S 1VQM1 2RPRA 2DE6A 5CM2M 2R7ZI 2GTHA 3GTOI 1YI2Z 3CCQ1 3CCM1 3PO2I 3GTMI 1TWAI 1QVGY 1VQ41 1ZB8A 2Q51A 4A3KI 4NBHA 3M3YI 2QEXZ 2LIYA 5IP7I 4NB9A 4DGLA 1NJI2 3CC21 3H0GI 5T6BA 3GTMS 5C4XI 2W03A 2KI7B 1WCMI 3KIHA 4XX2A 1WW9A 3S17I 4E2YA 3S1QI 3U50C 1Z01A 4MD8A 1PFTA 3J81f 3M4OI 3S14I 1VQLZ 2NVQI 3D6WA 2QLVB 3J81b 2H85A 1VQKZ 3HOVI 3CME1 3I55Z 3S2HI 3CC41 2K3RA 1VQ9Z 1TWFI 1YJ9Z 1YHQ1 2OTLZ 1KD11 1ML8A 4S1TA 3VMHA 1YITZ 5IT9b 3LUSA 3CCUZ 2WAQA 4NFRA 3D9XA 2BJOA 3CC7Z 3GTQI 1RO4A 4A3GI 1L1OC 2PK7A 2RT9A 3CMAZ 3NH4A 3S1RI 3G4SZ 1X0TA 1I3QI 3NH5A 5A2Qf 4BBRI 1M902 3EEDA 2JNYA 3CCL1 3J80f 3BG1B 2HU9A 1VQ6Z 3RZOI 4A3BI 3CD6Z 1K83I 1NP6A 5C3EI 3CCE1 3CXCZ 2R93I 4CL1A 1USPA 2QA4Z 2I3CA 3OW2Z 1QVFZ 2ZAEB 5FLXf 1VQMZ 1SFOI 4A3CI 3FQMA 1K731 4NBEA 3CCQZ 3CCMZ 3EERA 2GU2A 2OOYB 3VMGA 1VQP1 3VB9A 1VQ4Z 1X3WA 1Z03A 3CCJ1 4MD7A 4E32A 3IF8A 1Q7Y1 3HOZI 3CC2Z 3GCFA 4BXXI 4BY1I 4HGYA 2QRDB 3GTKI 1KQSZ 2E2JI 4A3FI 3RZDI 3CPWZ 3Q87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO 1;  1VQN Z;  1VQN 1;  1VQ8 Z;  1VQ8 1;  1VQL Z;  3G71 Z;  1Q81 2;  1KC8 1;  1VQ5 Z;  1VQL 1;  3G71 1;  3CME Z;  2OTJ Z;  1VQ5 1;  1VQK Z;  3CME 1;  2OTJ 1;  3I55 Z;  1VQK 1;  3CC4 Z;  3CCV Z;  3I55 1;  3CCR Z;  3CC4 1;  3CCV 1;  1YHQ Z;  3CCR 1;  1VQ7 Z;  1VQ9 Z;  3I56 Z;  1YJ9 Z;  1YHQ 1;  2OTL Z;  1KD1 1;  1VQ7 1;  1VQ9 1;  1YIJ Z;  3I56 1;  1YJ9 1;  1NJI 1;  1M1K 2;  2OTL 1;  1N8R 2;  1YIJ 1;  1YIT Z;  3CCU Z;  1YIT 1;  3CC7 Z;  3CCU 1;  3CC7 1;  1K73 2;  3CMA Z;  3G6E Z;  1W2B Y;  1Q86 1;  3CMA 1;  1Q82 2;  3G6E 1;  3G4S Z;  3G4S 1;  3CXC Y;  1Q81 1;  1KC8 2;  1K9M 1;  1M90 2;  1Q7Y 2;  3OW2 Y;  3CCL Z;  1QVF Y;  3CCL 1;  1W2B Z;  1VQ6 Z;  3CD6 Z;  3CCE Z;  1YJW Z;  1VQ6 1;  3CD6 1;  1KD1 2;  3CCE 1;  3CXC Z;  1M1K 1;  1YJW 1;  1N8R 1;  1K8A 2;  2QA4 Z;  3OW2 Z;  2QA4 1;  1QVF Z;  1VQM Z;  1S72 Z;  1QVG Z;  1VQM 1;  1S72 1;  1JJ2 Y;  1K73 1;  1YI2 Z;  1Q82 1;  3CCQ Z;  1Q86 2;  3CCM Z;  1KQS Y;  1VQP Z;  1YI2 1;  3CCS Z;  3CCQ 1;  3CCM 1;  1VQP 1;  1VQ4 Z;  3CCS 1;  3CCJ Z;  1QVG Y;  1VQ4 1;  3CPW Y;  3CCJ 1;  1K9M 2;  1M90 1;  2QEX Z;  1Q7Y 1;  1NJI 2;  3CC2 Z;  2QEX 1;  1JJ2 Z;  3CC2 1;  1KQS Z;  1YJN Z;  1YJN 1;  1K8A 1;  1VQO Z;  3CPW Z; 
#chains in the Genus database with same CATH topology
 2V8J A;  4RVH A;  1VQO 1;  2NVT I;  1WII A;  2VUM I;  3MZL B;  1VQN 1;  1Q16 A;  3FQQ A;  1TWH I;  2QRE B;  1KC8 1;  2JIP A;  3G71 1;  3VMI A;  3CME Z;  1VQ5 1;  2F4O A;  4NB8 A;  3P5J B;  2OTJ 1;  3CC4 Z;  1YUK A;  2HF1 A;  4MH4 A;  3CQZ I;  2P3Y A;  1YHQ Z;  3CCR 1;  1VQ7 1;  3I56 1;  3GKQ A;  1NJI 1;  1M1K 2;  4NBF A;  2E2I I;  2OZK A;  2PM9 A;  1Y1W I;  3F3P C;  4A93 I;  2E9H A;  4EWC A;  2WB1 A;  1Q86 1;  1Q82 2;  1I6H I;  4A3D I;  3CXC Y;  2RHB A;  1K9M 1;  2QR1 B;  3OW2 Y;  3CCL Z;  1QVF Y;  3S1M I;  1RQF A;  1W2B Z;  2RIQ A;  3CCE Z;  2OOX B;  1I50 I;  2JA6 I;  1KD1 2;  1YJW 1;  1K8A 2;  3I4M I;  3HOU I;  2VPX A;  3JAM f;  4E2W A;  2E7Z A;  2R92 I;  1FDI A;  3JAM b;  1USP B;  1X3Z A;  1QVG Z;  3GTL I;  2V45 A;  1S72 1;  4E33 A;  1LQL A;  4TNU A;  3H3V J;  2K5R A;  1KQS Y;  1VQP Z;  5A2Q b;  3K7A I;  4MD9 A;  3HOY I;  1QXF A;  4Y52 I;  3J7A 4;  3CCS 1;  1TWG I;  3CCJ Z;  4E2Z A;  3CPW Y;  4MON A;  3J80 b;  1M90 1;  3NDJ A;  2M6N A;  1JJ2 Z;  3HOW I;  2Q4Z A;  3IX0 A;  4RVG A;  2EGT A;  3T4N B;  3S16 I;  1QYP A;  1YJN 1;  4NBD A;  2JUB A;  1VQO Z;  5FLX b;  3NH8 A;  2AKL A;  2NVX I;  1VQN Z;  4HGZ A;  1DL6 A;  2IZ3 A;  1WJ2 A;  3NFZ A;  4DK1 A;  1VQ8 1;  2Y0S A;  3G71 Z;  1Q81 2;  1VQ5 Z;  5LL6 f;  2OTJ Z;  3MZK B;  2GTI A;  5T64 A;  1RO0 A;  2VF1 A;  5D1O A;  1ZH1 A;  3CCR Z;  2P28 A;  3CCV 1;  4X6A I;  2JIR A;  1VQ7 Z;  3I56 Z;  2KPI A;  2YAD A;  1N8R 2;  4A3M I;  2DE7 A;  1YIJ 1;  2JA7 I;  3GTG I;  4HH4 A;  4NBC A;  4NBB A;  3NDI A;  3D2L A;  1W2B Y;  3G6E 1;  4E2X A;  2QRC B;  2JA8 I;  1KC8 2;  2F4M A;  1R9T I;  2LFU A;  1TFI A;  3KIF A;  4A3L I;  3GTP I;  2G2K A;  1YUA A;  1YJW Z;  1VLA A;  4QTU A;  1M1K 1;  2YU9 I;  4A3E I;  2JS4 A;  4BY7 I;  1S72 Z;  2J6A A;  1JJ2 Y;  2JA5 I;  2R6M A;  1RLY A;  2DE5 A;  1RO2 A;  2QKD A;  1Q82 1;  3BG0 B;  3QWU A;  1Q86 2;  3HKZ A;  1YI2 1;  3CCS Z;  4E31 A;  3S15 I;  4MXU A;  3FKI I;  5D1P A;  4NOZ A;  1P9N A;  1Y1V I;  3TDH B;  1K9M 2;  2QEX 1;  2E2H I;  2V3V A;  2V8K A;  2VUG A;  4E30 A;  5C4J I;  3S1N I;  1YJN Z;  3HOX I;  5IP9 I;  2AYD A;  2NVY I;  5IT9 f;  1K8A 1;  1Y1V S;  2IV2 X;  4NH1 C;  4NBG A;  4BBS I;  3IR7 A;  4A3I I;  4QTT A;  1VQ8 Z;  4RS4 A;  4RV9 A;  1VQL 1;  3S2D I;  5T67 A;  1VQK 1;  3CCV Z;  3MON A;  3I55 1;  1S7M A;  3I4N I;  3TE5 B;  3VTN A;  3IFU A;  5D1O B;  1N2F A;  1VQ9 1;  2JMO A;  4A3J I;  1YIJ Z;  1YJ9 1;  2OTL 1;  3I07 A;  3ESW A;  1ZB9 A;  1RNI A;  2JIQ A;  2IZ4 A;  1YIT 1;  2V8I A;  3CCU 1;  2M48 A;  5FLM I;  3CC7 1;  2PMZ A;  1K73 2;  3G6E Z;  2O4H A;  2JR6 A;  2W04 A;  3CMA 1;  2B63 I;  3G4S 1;  1Q81 1;  4NBA A;  1SIW A;  1Q7Y 2;  5AN9 F;  1KRL A;  4MRI A;  4RVD A;  4RVF A;  4Y7N I;  3PO3 I;  1VQ6 1;  3CD6 1;  4AYB A;  1Z02 A;  1N8R 1;  2O53 A;  5C44 I;  2RBL A;  1TWC I;  4DQY B;  2QA4 1;  1NUI A;  1QF8 A;  3F3F C;  3GTJ I;  1JWH C;  3PO3 S;  1VQM 1;  2RPR A;  2DE6 A;  1FDO A;  5CM2 M;  2R7Z I;  2GTH A;  3GTO I;  1YI2 Z;  3CCQ 1;  3CCM 1;  3PO2 I;  3GTM I;  1TWA I;  1QVG Y;  1VQ4 1;  1ZB8 A;  2Q51 A;  4A3K I;  4NBH A;  3M3Y I;  2QEX Z;  2LIY A;  5IP7 I;  4NB9 A;  4DGL A;  1NJI 2;  3CC2 1;  3H0G I;  5T6B A;  3GTM S;  5C4X I;  2W03 A;  2KI7 B;  1WCM I;  3KIH A;  4XX2 A;  1WW9 A;  3S17 I;  4E2Y A;  3S1Q I;  3U50 C;  2JIM A;  1Z01 A;  4MD8 A;  1PFT A;  3J81 f;  3M4O I;  3S14 I;  2VPW A;  2LEX A;  1VQL Z;  2NVQ I;  3D6W A;  2QLV B;  3J81 b;  2H85 A;  1VQK Z;  3HOV I;  3CME 1;  3I55 Z;  2VPZ A;  3S2H I;  3CC4 1;  2K3R A;  1VQ9 Z;  1TWF I;  1Y8C A;  1YHQ 1;  1YJ9 Z;  1WZN A;  2OTL Z;  1KD1 1;  1ML8 A;  4S1T A;  3VMH A;  1YIT Z;  5IT9 b;  3LUS A;  3CCU Z;  2WAQ A;  4NFR A;  3D9X A;  2BJO A;  3CC7 Z;  3GTQ I;  1RO4 A;  4A3G I;  1L1O C;  2PK7 A;  2RT9 A;  3CMA Z;  3NH4 A;  1AA6 A;  3S1R I;  3G4S Z;  1X0T A;  1I3Q I;  3NH5 A;  5A2Q f;  4BBR I;  1M90 2;  3EED A;  2JIO A;  2JNY A;  3CCL 1;  3J80 f;  3BG1 B;  2HU9 A;  1VQ6 Z;  3RZO I;  4A3B I;  3CD6 Z;  1K83 I;  1NP6 A;  5C3E I;  3CCE 1;  3CXC Z;  2R93 I;  4CL1 A;  1USP A;  2QA4 Z;  2I3C A;  3OW2 Z;  1QVF Z;  2ZAE B;  5FLX f;  1VQM Z;  1SFO I;  4A3C I;  3FQM A;  1K73 1;  4NBE A;  3CCQ Z;  3CCM Z;  3EER A;  2GU2 A;  2OOY B;  3VMG A;  1VQP 1;  3VB9 A;  1VQ4 Z;  1X3W A;  1Z03 A;  3CCJ 1;  4MD7 A;  4E32 A;  3IF8 A;  1Q7Y 1;  3HOZ I;  3CC2 Z;  3GCF A;  4BXX I;  2VPY A;  4BY1 I;  2NAP A;  4HGY A;  2QRD B;  3GTK I;  1KQS Z;  2E2J I;  4A3F I;  3RZD I;  3CPW Z;  3Q87 A; 
#chains in the Genus database with same CATH homology
 2V8J A;  4RVH A;  1VQO 1;  2NVT I;  1WII A;  2VUM I;  3MZL B;  1VQN 1;  3FQQ A;  1TWH I;  2QRE B;  1KC8 1;  3G71 1;  3VMI A;  3CME Z;  1VQ5 1;  2F4O A;  4NB8 A;  3P5J B;  2OTJ 1;  3CC4 Z;  1YUK A;  2HF1 A;  4MH4 A;  3CQZ I;  2P3Y A;  1YHQ Z;  3CCR 1;  1VQ7 1;  3I56 1;  3GKQ A;  1NJI 1;  1M1K 2;  4NBF A;  2E2I I;  2OZK A;  2PM9 A;  1Y1W I;  3F3P C;  4A93 I;  2E9H A;  4EWC A;  2WB1 A;  1Q86 1;  1Q82 2;  1I6H I;  4A3D I;  3CXC Y;  2RHB A;  1K9M 1;  2QR1 B;  3OW2 Y;  3CCL Z;  1QVF Y;  3S1M I;  1RQF A;  1W2B Z;  2RIQ A;  3CCE Z;  2OOX B;  1I50 I;  2JA6 I;  1KD1 2;  1YJW 1;  1K8A 2;  3I4M I;  3HOU I;  3JAM f;  4E2W A;  2R92 I;  3JAM b;  1USP B;  1X3Z A;  1QVG Z;  3GTL I;  1S72 1;  4E33 A;  1LQL A;  4TNU A;  3H3V J;  2K5R A;  1KQS Y;  1VQP Z;  5A2Q b;  3K7A I;  4MD9 A;  3HOY I;  4Y52 I;  3J7A 4;  3CCS 1;  1TWG I;  3CCJ Z;  4E2Z A;  3CPW Y;  4MON A;  3J80 b;  1M90 1;  3NDJ A;  2M6N A;  1JJ2 Z;  3HOW I;  2Q4Z A;  3IX0 A;  4RVG A;  2EGT A;  3T4N B;  3S16 I;  1QYP A;  1YJN 1;  4NBD A;  2JUB A;  1VQO Z;  5FLX b;  3NH8 A;  2AKL A;  2NVX I;  1VQN Z;  4HGZ A;  1DL6 A;  2IZ3 A;  3NFZ A;  4DK1 A;  1VQ8 1;  2Y0S A;  3G71 Z;  1Q81 2;  1VQ5 Z;  5LL6 f;  2OTJ Z;  3MZK B;  2GTI A;  5T64 A;  1RO0 A;  2VF1 A;  5D1O A;  1ZH1 A;  3CCR Z;  2P28 A;  3CCV 1;  4X6A I;  1VQ7 Z;  3I56 Z;  2KPI A;  2YAD A;  1N8R 2;  4A3M I;  2DE7 A;  1YIJ 1;  2JA7 I;  3GTG I;  4HH4 A;  4NBC A;  4NBB A;  3NDI A;  1W2B Y;  3G6E 1;  4E2X A;  2QRC B;  2JA8 I;  1KC8 2;  2F4M A;  1R9T I;  2LFU A;  1TFI A;  3KIF A;  4A3L I;  3GTP I;  2G2K A;  1YUA A;  1YJW Z;  1VLA A;  4QTU A;  1M1K 1;  2YU9 I;  4A3E I;  2JS4 A;  4BY7 I;  1S72 Z;  2J6A A;  1JJ2 Y;  2JA5 I;  2R6M A;  1RLY A;  2DE5 A;  1RO2 A;  2QKD A;  1Q82 1;  3BG0 B;  3QWU A;  1Q86 2;  3HKZ A;  1YI2 1;  3CCS Z;  4E31 A;  3S15 I;  4MXU A;  3FKI I;  5D1P A;  4NOZ A;  1P9N A;  1Y1V I;  3TDH B;  1K9M 2;  2QEX 1;  2E2H I;  5C4J I;  2V8K A;  2VUG A;  4E30 A;  3S1N I;  1YJN Z;  3HOX I;  5IP9 I;  2NVY I;  5IT9 f;  1K8A 1;  1Y1V S;  4NH1 C;  4NBG A;  4BBS I;  4A3I I;  4QTT A;  1VQ8 Z;  4RS4 A;  4RV9 A;  1VQL 1;  3S2D I;  5T67 A;  1VQK 1;  3CCV Z;  3MON A;  3I55 1;  1S7M A;  3I4N I;  3TE5 B;  3VTN A;  3IFU A;  5D1O B;  1N2F A;  1VQ9 1;  2JMO A;  4A3J I;  1YIJ Z;  1YJ9 1;  2OTL 1;  3I07 A;  3ESW A;  1ZB9 A;  1RNI A;  2IZ4 A;  1YIT 1;  2V8I A;  3CCU 1;  2M48 A;  5FLM I;  3CC7 1;  2PMZ A;  1K73 2;  3G6E Z;  2O4H A;  2JR6 A;  2W04 A;  3CMA 1;  2B63 I;  3G4S 1;  1Q81 1;  4NBA A;  1Q7Y 2;  5AN9 F;  1KRL A;  4MRI A;  4RVD A;  4RVF A;  4Y7N I;  3PO3 I;  1VQ6 1;  3CD6 1;  4AYB A;  1Z02 A;  1N8R 1;  2O53 A;  5C44 I;  2RBL A;  1TWC I;  4DQY B;  2QA4 1;  1NUI A;  1QF8 A;  3F3F C;  3GTJ I;  1JWH C;  3PO3 S;  1VQM 1;  2RPR A;  2DE6 A;  5CM2 M;  2R7Z I;  2GTH A;  3GTO I;  1YI2 Z;  3CCQ 1;  3CCM 1;  3PO2 I;  3GTM I;  1TWA I;  1QVG Y;  1VQ4 1;  1ZB8 A;  2Q51 A;  4A3K I;  4NBH A;  3M3Y I;  2QEX Z;  2LIY A;  5IP7 I;  4NB9 A;  4DGL A;  1NJI 2;  3CC2 1;  3H0G I;  5T6B A;  3GTM S;  5C4X I;  2W03 A;  2KI7 B;  1WCM I;  3KIH A;  4XX2 A;  1WW9 A;  3S17 I;  4E2Y A;  3S1Q I;  3U50 C;  1Z01 A;  4MD8 A;  1PFT A;  3J81 f;  3M4O I;  3S14 I;  1VQL Z;  2NVQ I;  3D6W A;  2QLV B;  3J81 b;  2H85 A;  1VQK Z;  3HOV I;  3CME 1;  3I55 Z;  3S2H I;  3CC4 1;  2K3R A;  1VQ9 Z;  1TWF I;  1YJ9 Z;  1YHQ 1;  2OTL Z;  1KD1 1;  1ML8 A;  4S1T A;  3VMH A;  1YIT Z;  5IT9 b;  3LUS A;  3CCU Z;  2WAQ A;  4NFR A;  3D9X A;  2BJO A;  3CC7 Z;  3GTQ I;  1RO4 A;  4A3G I;  1L1O C;  2PK7 A;  2RT9 A;  3CMA Z;  3NH4 A;  3S1R I;  3G4S Z;  1X0T A;  1I3Q I;  3NH5 A;  5A2Q f;  4BBR I;  1M90 2;  3EED A;  2JNY A;  3CCL 1;  3J80 f;  3BG1 B;  2HU9 A;  1VQ6 Z;  3RZO I;  4A3B I;  3CD6 Z;  1K83 I;  1NP6 A;  5C3E I;  3CCE 1;  3CXC Z;  2R93 I;  4CL1 A;  1USP A;  2QA4 Z;  2I3C A;  3OW2 Z;  1QVF Z;  2ZAE B;  5FLX f;  1VQM Z;  1SFO I;  4A3C I;  3FQM A;  1K73 1;  4NBE A;  3CCQ Z;  3CCM Z;  3EER A;  2GU2 A;  2OOY B;  3VMG A;  1VQP 1;  3VB9 A;  1VQ4 Z;  1X3W A;  1Z03 A;  3CCJ 1;  4MD7 A;  4E32 A;  3IF8 A;  1Q7Y 1;  3HOZ I;  3CC2 Z;  3GCF A;  4BXX I;  4BY1 I;  4HGY A;  2QRD B;  3GTK I;  1KQS Z;  2E2J I;  4A3F I;  3RZD I;  3CPW Z;  3Q87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...