1VQNZ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqnZ00
1M902 1VQN1 1YITZ 1YI2Z 3G71Z 1W2BZ 2OTL1 3CMAZ 1Q861 1KC81 1YJNZ 1S72Z 2OTLZ 1M1K1 3CCUZ 3CPWZ 1KC82 1VQ9Z 1VQ41 1KD12 1QVFZ 3CC2Z 3CCV1 1VQ7Z 3I551 1QVFY 3CC71 2OTJ1 3I561 1S721 1Q822 1JJ2Y 3CCRZ 3G711 1VQ5Z 1VQ8Z 2QA41 1YI21 1VQM1 1Q7Y2 1VQ81 1YHQZ 3CME1 1Q812 3CC41 1YHQ1 1YJWZ 1YJ9Z 3CCM1 1VQMZ 1Q821 3CD6Z 1W2BY 3CXCZ 3G4SZ 2QEX1 1KQSY 1YJ91 1JJ2Z 1VQ51 3CC4Z 1K9M1 3CCR1 3CMEZ 1VQ4Z 1Q7Y1 2OTJZ 3CC21 3CCSZ 3CCVZ 3CCQZ 1Q811 3G6E1 1K731 3CCQ1 3I55Z 1NJI1 3CCU1 1KQSZ 1QVGY 1VQK1 1KD11 1QVGZ 1K732 1VQ61 3G6EZ 3CCEZ 1VQNZ 3CCS1 3CCLZ 3CCE1 1YIT1 1NJI2 1VQL1 1Q862 1N8R1 1VQ6Z 1YIJZ 3CMA1 1YJW1 1VQKZ 1VQP1 3G4S1 3CCJ1 2QA4Z 1VQO1 3CPWY 1K9M2 2QEXZ 1N8R2 3I56Z 3CD61 1M901 1K8A2 1VQ91 3CCJZ 1VQLZ 1VQPZ 3CXCY 3CC7Z 3CCL1 1VQ71 3CCMZ 3OW2Y 1YIJ1 1YJN1 1VQOZ 1K8A1 3OW2Z 1M1K2
chains in the Genus database with same CATH superfamily
1YI2Z 2PK7A 2WAQA 4RV9A 1Q861 1WZNA 2R7ZI 4MXUA 4HGZA 1DL6A 3J80f 2OOYB 2H85A 3TE5B 2IZ4A 3S14I 3NH8A 3CC2Z 3CCV1 1ZB9A 2VPZA 1Q822 3IFUA 5LL6f 4NBEA 1WJ2A 2R92I 1ZB8A 3F3PC 1VQ5Z 1YUAA 5D1PA 2E7ZA 3CME1 4X6AI 4DGLA 1LQLA 1YJWZ 1YJ91 4A3GI 4MH4A 1VQ4Z 2OTJZ 1Y1VS 2J6AA 3S1MI 3D2LA 5IT9b 3CCSZ 5CM2M 4A3FI 4E31A 2W04A 3I55Z 1TFIA 4E30A 3M3YI 4RS4A 2QRDB 4NH1C 1K732 3K7AI 3TDHB 3H3VJ 3G6EZ 2V8IA 3CQZI 4DK1A 3CCLZ 4EWCA 2RBLA 2GTIA 1YJW1 1VLAA 2E2HI 4NFRA 2LFUA 2VPXA 3G4S1 2IV2X 3CCJ1 2QA4Z 4A3MI 1Z01A 2RT9A 3S2DI 1TWAI 2NAPA 2I3CA 2JA6I 3BG0B 2AKLA 3CCJZ 1VQLZ 1Y1WI 5C44I 2JMOA 1KRLA 5IP9I 3OW2Y 4CL1A 3HOXI 4NBHA 1M1K2 3IX0A 3MZLB 3U50C 3HKZA 1YITZ 1W2BZ 2OTL1 3CMAZ 2LIYA 2Y0SA 1X3ZA 3GTMS 3H0GI 5D1OB 3CPWZ 2YU9I 1PFTA 3S15I 4NBGA 1QVFZ 3S1QI 2R93I 1VQ7Z 3VMHA 2K3RA 2OTJ1 1RQFA 3J80b 2NVXI 2JIMA 5C4XI 4Y52I 2OZKA 2RPRA 2PMZA 4A3BI 3EEDA 1VQ81 3S16I 1YHQ1 4RVGA 3CCM1 3GTLI 3HOZI 2V8JA 2QREB 1WCMI 3D9XA 2QEX1 1KQSY 2DE5A 1FDOA 3NH4A 1VQ51 3GTPI 2Q4ZA 5T67A 2P3YA 2JUBA 2G2KA 2DE6A 2JIPA 1JWHC 1QXFA 1K731 1NP6A 2E2JI 5IT9f 1KQSZ 1VQK1 3PO3I 1QVGZ 1VQ61 3GTKI 1USPA 1QYPA 3CCEZ 3S1RI 3NFZA 1WIIA 4E2WA 1VQL1 2QR1B 3FQMA 1YIJZ 2Q51A 4BBRI 1FDIA 4E2YA 4BY7I 2VUMI 1P9NA 4NOZA 3QWUA 1Z03A 3I4NI 2P28A 3D6WA 4E33A 2V3VA 5FLMI 3GKQA 4RVHA 1VQPZ 1K83I 4NBAA 4E2ZA 1Z02A 1RO4A 2RIQA 3ESWA 3S2HI 2JA7I 2NVTI 4MONA 2DE7A 1SIWA 4NBFA 1YJN1 3GTMI 4MD8A 2RHBA 3GTJI 4QTTA 1R9TI 3KIHA 1Y8CA 2YADA 2GU2A 2W03A 2JIOA 1KC81 2IZ3A 1RO2A 3IF8A 3JAMb 1M1K1 3CCUZ 5FLXf 4MD9A 1X3WA 1TWFI 1VQ41 2OOXB 5AN9F 3I551 1TWHI 3I561 4RVFA 4BBSI 2KI7B 3I4MI 3HOWI 3HOYI 2JR6A 1TWGI 2V8KA 2QA41 1VQM1 1YI21 5FLXb 3HOUI 1YHQZ 1Q812 3MZKB 1YJ9Z 2QKDA 1Q821 3CXCZ 1Y1VI 4AYBA 1K9M1 3CCR1 3CMEZ 3T4NB 4Y7NI 5A2Qb 1L1OC 3F3FC 2JA5I 2F4OA 2O53A 3Q87A 2WB1A 1NJI1 5C4JI 2NVYI 5T6BA 4DQYB 2B63I 1N2FA 5A2Qf 2PM9A 3MONA 2V45A 4NB8A 3P5JB 1VQNZ 4NB9A 3CCE1 1YIT1 1Q862 1VQ6Z 3FKII 4A3EI 4BXXI 1VQKZ 3M4OI 1X0TA 4S1TA 1USPB 2VUGA 1I3QI 3PO3S 5C3EI 1VQO1 2F4MA 1WW9A 3CPWY 1I50I 1N8R2 3I56Z 4A93I 1M901 1K8A2 3S17I 2R6MA 3J7A4 3CXCY 3PO2I 3CC7Z 1YUKA 1VQ71 1QF8A 3CCMZ 3GTQI 3RZDI 1K8A1 3OW2Z 2LEXA 4BY1I 1ML8A 1SFOI 1M902 1VQN1 4A3JI 1RO0A 3IR7A 3G71Z 4MD7A 1YJNZ 1S72Z 4A3LI 3FQQA 2OTLZ 3EERA 3NDJA 1AA6A 4XX2A 1KC82 1VQ9Z 1KD12 2HU9A 2M48A 3JAMf 3BG1B 2ZAEB 4HGYA 4NBBA 1QVFY 3CC71 1RLYA 3LUSA 1S721 2VPYA 1JJ2Y 2KPIA 5D1OA 3CCRZ 3HOVI 3G711 4A3II 1VQ8Z 3VTNA 4A3CI 1Q7Y2 4E2XA 3CC41 2BJOA 4TNUA 1VQMZ 3CD6Z 1W2BY 3G4SZ 2JIRA 1JJ2Z 3CC4Z 2JS4A 2EGTA 2JIQA 1Q7Y1 3KIFA 2NVQI 3RZOI 3CC21 1TWCI 4MRIA 3CCVZ 1RNIA 3J81f 3CCQZ 3G6E1 1Q811 3I07A 3CCQ1 3CCU1 5IP7I 1QVGY 2E2II 4A3DI 1KD11 1Q16A 2HF1A 1NUIA 2M6NA 4NBCA 3CCS1 1ZH1A 3GTGI 4RVDA 3J81b 1NJI2 1N8R1 3CMA1 2JA8I 2GTHA 3GTOI 1I6HI 4QTUA 4NBDA 3VMIA 1VQP1 2QRCB 3VMGA 3VB9A 3S1NI 2O4HA 1K9M2 3GCFA 2QEXZ 3NH5A 3CD61 2QLVB 2E9HA 2K5RA 2JNYA 1VQ91 2AYDA 5T64A 1S7MA 2VPWA 2VF1A 4HH4A 4A3KI 4E32A 3CCL1 3NDIA 1YIJ1 1VQOZ
chains in the Genus database with same CATH topology
1YI2Z 2PK7A 2WAQA 4RV9A 1Q861 2R7ZI 4MXUA 4HGZA 1DL6A 3J80f 2OOYB 2H85A 3TE5B 2IZ4A 3S14I 3NH8A 3CC2Z 3CCV1 1ZB9A 1Q822 3IFUA 5LL6f 4NBEA 2R92I 1ZB8A 3F3PC 1VQ5Z 1YUAA 5D1PA 3CME1 4X6AI 4DGLA 1LQLA 1YJWZ 1YJ91 4A3GI 4MH4A 1VQ4Z 2OTJZ 1Y1VS 2J6AA 3S1MI 5IT9b 3CCSZ 5CM2M 4A3FI 4E31A 2W04A 3I55Z 1TFIA 4E30A 3M3YI 4RS4A 2QRDB 4NH1C 1K732 3K7AI 3TDHB 3H3VJ 3G6EZ 2V8IA 3CQZI 4DK1A 3CCLZ 4EWCA 2RBLA 2GTIA 1YJW1 1VLAA 2E2HI 4NFRA 2LFUA 3G4S1 3CCJ1 2QA4Z 4A3MI 1Z01A 2RT9A 3S2DI 1TWAI 2I3CA 2JA6I 3BG0B 2AKLA 3CCJZ 1VQLZ 1Y1WI 5C44I 1KRLA 2JMOA 5IP9I 3OW2Y 4CL1A 3HOXI 4NBHA 1M1K2 3IX0A 3MZLB 3U50C 3HKZA 1YITZ 1W2BZ 2OTL1 3CMAZ 2LIYA 2Y0SA 1X3ZA 3GTMS 3H0GI 5D1OB 3CPWZ 2YU9I 1PFTA 3S15I 4NBGA 1QVFZ 3S1QI 2R93I 1VQ7Z 3VMHA 2K3RA 2OTJ1 1RQFA 3J80b 2NVXI 5C4XI 4Y52I 2OZKA 2RPRA 2PMZA 4A3BI 3EEDA 1VQ81 3S16I 1YHQ1 4RVGA 3CCM1 3GTLI 3HOZI 2V8JA 2QREB 1WCMI 3D9XA 2QEX1 1KQSY 2DE5A 3NH4A 1VQ51 3GTPI 2Q4ZA 5T67A 2P3YA 2JUBA 2G2KA 2DE6A 1JWHC 1K731 1NP6A 2E2JI 5IT9f 1KQSZ 1VQK1 3PO3I 1QVGZ 1VQ61 3GTKI 1USPA 1QYPA 3CCEZ 3S1RI 3NFZA 1WIIA 4E2WA 1VQL1 2QR1B 3FQMA 1YIJZ 2Q51A 4BBRI 4E2YA 4BY7I 2VUMI 1P9NA 4NOZA 3QWUA 1Z03A 3I4NI 2P28A 3D6WA 4E33A 5FLMI 3GKQA 4RVHA 1VQPZ 1K83I 4NBAA 4E2ZA 1Z02A 1RO4A 2RIQA 3ESWA 3S2HI 2JA7I 2NVTI 4MONA 2DE7A 4NBFA 1YJN1 3GTMI 4MD8A 2RHBA 3GTJI 4QTTA 1R9TI 3KIHA 2YADA 2GU2A 2W03A 1KC81 2IZ3A 1RO2A 3IF8A 3JAMb 1M1K1 3CCUZ 5FLXf 4MD9A 1X3WA 1TWFI 1VQ41 2OOXB 5AN9F 3I551 1TWHI 3I561 4RVFA 4BBSI 2KI7B 3I4MI 3HOWI 3HOYI 2JR6A 1TWGI 2V8KA 2QA41 1VQM1 1YI21 5FLXb 3HOUI 1YHQZ 1Q812 3MZKB 1YJ9Z 2QKDA 1Q821 3CXCZ 1Y1VI 4AYBA 1K9M1 3CCR1 3CMEZ 3T4NB 4Y7NI 5A2Qb 1L1OC 3F3FC 2JA5I 2F4OA 2O53A 3Q87A 2WB1A 1NJI1 5C4JI 2NVYI 5T6BA 4DQYB 2B63I 1N2FA 5A2Qf 2PM9A 3MONA 4NB8A 3P5JB 1VQNZ 4NB9A 3CCE1 1YIT1 1Q862 1VQ6Z 3FKII 4A3EI 4BXXI 1VQKZ 3M4OI 1X0TA 4S1TA 1USPB 2VUGA 1I3QI 3PO3S 5C3EI 1VQO1 2F4MA 1WW9A 3CPWY 1I50I 1N8R2 3I56Z 4A93I 1M901 1K8A2 3S17I 2R6MA 3J7A4 3CXCY 3PO2I 3CC7Z 1YUKA 1VQ71 1QF8A 3CCMZ 3GTQI 3RZDI 1K8A1 3OW2Z 4BY1I 1ML8A 1SFOI 1M902 1VQN1 4A3JI 1RO0A 3G71Z 4MD7A 1YJNZ 1S72Z 4A3LI 3FQQA 2OTLZ 3EERA 3NDJA 4XX2A 1KC82 1VQ9Z 1KD12 2HU9A 2M48A 3JAMf 3BG1B 2ZAEB 4HGYA 4NBBA 1QVFY 3CC71 1RLYA 3LUSA 1S721 1JJ2Y 2KPIA 5D1OA 3CCRZ 3HOVI 3G711 4A3II 1VQ8Z 3VTNA 4A3CI 1Q7Y2 4E2XA 3CC41 2BJOA 4TNUA 1VQMZ 3CD6Z 1W2BY 3G4SZ 1JJ2Z 3CC4Z 2JS4A 2EGTA 1Q7Y1 3KIFA 2NVQI 3RZOI 3CC21 1TWCI 4MRIA 3CCVZ 1RNIA 3J81f 3CCQZ 3G6E1 1Q811 3I07A 3CCQ1 3CCU1 5IP7I 1QVGY 2E2II 4A3DI 1KD11 2HF1A 1NUIA 2M6NA 4NBCA 3CCS1 1ZH1A 3GTGI 4RVDA 3J81b 1NJI2 1N8R1 3CMA1 2JA8I 2GTHA 3GTOI 1I6HI 4QTUA 4NBDA 3VMIA 1VQP1 2QRCB 3VMGA 3VB9A 3S1NI 2O4HA 1K9M2 3GCFA 2QEXZ 3NH5A 3CD61 2QLVB 2E9HA 2K5RA 2JNYA 1VQ91 5T64A 1S7MA 2VF1A 4HH4A 4A3KI 4E32A 3CCL1 3NDIA 1YIJ1 1VQOZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 2;  1VQN 1;  1YIT Z;  1YI2 Z;  3G71 Z;  1W2B Z;  2OTL 1;  3CMA Z;  1Q86 1;  1KC8 1;  1YJN Z;  1S72 Z;  2OTL Z;  1M1K 1;  3CCU Z;  3CPW Z;  1KC8 2;  1VQ9 Z;  1VQ4 1;  1KD1 2;  1QVF Z;  3CC2 Z;  3CCV 1;  1VQ7 Z;  3I55 1;  1QVF Y;  3CC7 1;  2OTJ 1;  3I56 1;  1S72 1;  1Q82 2;  1JJ2 Y;  3CCR Z;  3G71 1;  1VQ5 Z;  1VQ8 Z;  2QA4 1;  1YI2 1;  1VQM 1;  1Q7Y 2;  1VQ8 1;  1YHQ Z;  3CME 1;  1Q81 2;  3CC4 1;  1YHQ 1;  1YJW Z;  1YJ9 Z;  3CCM 1;  1VQM Z;  1Q82 1;  3CD6 Z;  1W2B Y;  3CXC Z;  3G4S Z;  2QEX 1;  1KQS Y;  1YJ9 1;  1JJ2 Z;  1VQ5 1;  3CC4 Z;  1K9M 1;  3CCR 1;  3CME Z;  1VQ4 Z;  1Q7Y 1;  2OTJ Z;  3CC2 1;  3CCS Z;  3CCV Z;  3CCQ Z;  1Q81 1;  3G6E 1;  1K73 1;  3CCQ 1;  3I55 Z;  1NJI 1;  3CCU 1;  1KQS Z;  1QVG Y;  1VQK 1;  1KD1 1;  1QVG Z;  1K73 2;  1VQ6 1;  3G6E Z;  3CCE Z;  1VQN Z;  3CCS 1;  3CCL Z;  3CCE 1;  1YIT 1;  1NJI 2;  1VQL 1;  1Q86 2;  1N8R 1;  1VQ6 Z;  1YIJ Z;  3CMA 1;  1YJW 1;  1VQK Z;  1VQP 1;  3G4S 1;  3CCJ 1;  2QA4 Z;  1VQO 1;  3CPW Y;  1K9M 2;  2QEX Z;  1N8R 2;  3I56 Z;  3CD6 1;  1M90 1;  1K8A 2;  1VQ9 1;  3CCJ Z;  1VQL Z;  1VQP Z;  3CXC Y;  3CC7 Z;  3CCL 1;  1VQ7 1;  3CCM Z;  3OW2 Y;  1YIJ 1;  1YJN 1;  1VQO Z;  1K8A 1;  3OW2 Z;  1M1K 2; 
#chains in the Genus database with same CATH topology
 1YI2 Z;  2PK7 A;  2WAQ A;  4RV9 A;  1Q86 1;  1WZN A;  2R7Z I;  4MXU A;  4HGZ A;  1DL6 A;  3J80 f;  2OOY B;  2H85 A;  3TE5 B;  2IZ4 A;  3S14 I;  3NH8 A;  3CC2 Z;  3CCV 1;  1ZB9 A;  2VPZ A;  1Q82 2;  3IFU A;  5LL6 f;  4NBE A;  1WJ2 A;  2R92 I;  1ZB8 A;  3F3P C;  1VQ5 Z;  1YUA A;  5D1P A;  2E7Z A;  3CME 1;  4X6A I;  4DGL A;  1LQL A;  1YJW Z;  1YJ9 1;  4A3G I;  4MH4 A;  1VQ4 Z;  2OTJ Z;  1Y1V S;  2J6A A;  3S1M I;  3D2L A;  5IT9 b;  3CCS Z;  5CM2 M;  4A3F I;  4E31 A;  2W04 A;  3I55 Z;  1TFI A;  4E30 A;  3M3Y I;  4RS4 A;  2QRD B;  4NH1 C;  1K73 2;  3K7A I;  3TDH B;  3H3V J;  3G6E Z;  2V8I A;  3CQZ I;  4DK1 A;  3CCL Z;  4EWC A;  2RBL A;  2GTI A;  1YJW 1;  1VLA A;  2E2H I;  4NFR A;  2LFU A;  2VPX A;  3G4S 1;  2IV2 X;  3CCJ 1;  2QA4 Z;  4A3M I;  1Z01 A;  2RT9 A;  3S2D I;  1TWA I;  2NAP A;  2I3C A;  2JA6 I;  3BG0 B;  2AKL A;  3CCJ Z;  1VQL Z;  1Y1W I;  5C44 I;  2JMO A;  1KRL A;  5IP9 I;  3OW2 Y;  4CL1 A;  3HOX I;  4NBH A;  1M1K 2;  3IX0 A;  3MZL B;  3U50 C;  3HKZ A;  1YIT Z;  1W2B Z;  2OTL 1;  3CMA Z;  2LIY A;  2Y0S A;  1X3Z A;  3GTM S;  3H0G I;  5D1O B;  3CPW Z;  2YU9 I;  1PFT A;  3S15 I;  4NBG A;  1QVF Z;  3S1Q I;  2R93 I;  1VQ7 Z;  3VMH A;  2K3R A;  2OTJ 1;  1RQF A;  3J80 b;  2NVX I;  2JIM A;  5C4X I;  4Y52 I;  2OZK A;  2RPR A;  2PMZ A;  4A3B I;  3EED A;  1VQ8 1;  3S16 I;  1YHQ 1;  4RVG A;  3CCM 1;  3GTL I;  3HOZ I;  2V8J A;  2QRE B;  1WCM I;  3D9X A;  2QEX 1;  1KQS Y;  2DE5 A;  1FDO A;  3NH4 A;  1VQ5 1;  3GTP I;  2Q4Z A;  5T67 A;  2P3Y A;  2JUB A;  2G2K A;  2DE6 A;  2JIP A;  1JWH C;  1QXF A;  1K73 1;  1NP6 A;  2E2J I;  5IT9 f;  1KQS Z;  1VQK 1;  3PO3 I;  1QVG Z;  1VQ6 1;  3GTK I;  1USP A;  1QYP A;  3CCE Z;  3S1R I;  3NFZ A;  1WII A;  4E2W A;  1VQL 1;  2QR1 B;  3FQM A;  1YIJ Z;  2Q51 A;  4BBR I;  1FDI A;  4E2Y A;  4BY7 I;  2VUM I;  1P9N A;  4NOZ A;  3QWU A;  1Z03 A;  3I4N I;  2P28 A;  3D6W A;  4E33 A;  2V3V A;  5FLM I;  3GKQ A;  4RVH A;  1VQP Z;  1K83 I;  4NBA A;  4E2Z A;  1Z02 A;  1RO4 A;  2RIQ A;  3ESW A;  3S2H I;  2JA7 I;  2NVT I;  4MON A;  2DE7 A;  1SIW A;  4NBF A;  1YJN 1;  3GTM I;  4MD8 A;  2RHB A;  3GTJ I;  4QTT A;  1R9T I;  3KIH A;  1Y8C A;  2YAD A;  2GU2 A;  2W03 A;  2JIO A;  1KC8 1;  2IZ3 A;  1RO2 A;  3IF8 A;  3JAM b;  1M1K 1;  3CCU Z;  5FLX f;  4MD9 A;  1X3W A;  1TWF I;  1VQ4 1;  2OOX B;  5AN9 F;  3I55 1;  1TWH I;  3I56 1;  4RVF A;  4BBS I;  2KI7 B;  3I4M I;  3HOW I;  3HOY I;  2JR6 A;  1TWG I;  2V8K A;  2QA4 1;  1VQM 1;  1YI2 1;  5FLX b;  3HOU I;  1YHQ Z;  1Q81 2;  3MZK B;  1YJ9 Z;  2QKD A;  1Q82 1;  3CXC Z;  1Y1V I;  4AYB A;  1K9M 1;  3CCR 1;  3CME Z;  3T4N B;  4Y7N I;  5A2Q b;  1L1O C;  3F3F C;  2JA5 I;  2F4O A;  2O53 A;  3Q87 A;  2WB1 A;  1NJI 1;  5C4J I;  2NVY I;  5T6B A;  4DQY B;  2B63 I;  1N2F A;  5A2Q f;  2PM9 A;  3MON A;  2V45 A;  4NB8 A;  3P5J B;  1VQN Z;  4NB9 A;  3CCE 1;  1YIT 1;  1Q86 2;  1VQ6 Z;  3FKI I;  4A3E I;  4BXX I;  1VQK Z;  3M4O I;  1X0T A;  4S1T A;  1USP B;  2VUG A;  1I3Q I;  3PO3 S;  5C3E I;  1VQO 1;  2F4M A;  1WW9 A;  3CPW Y;  1I50 I;  1N8R 2;  3I56 Z;  4A93 I;  1M90 1;  1K8A 2;  3S17 I;  2R6M A;  3J7A 4;  3CXC Y;  3PO2 I;  3CC7 Z;  1YUK A;  1VQ7 1;  1QF8 A;  3CCM Z;  3GTQ I;  3RZD I;  1K8A 1;  3OW2 Z;  2LEX A;  4BY1 I;  1ML8 A;  1SFO I;  1M90 2;  1VQN 1;  4A3J I;  1RO0 A;  3IR7 A;  3G71 Z;  4MD7 A;  1YJN Z;  1S72 Z;  4A3L I;  3FQQ A;  2OTL Z;  3EER A;  3NDJ A;  1AA6 A;  4XX2 A;  1KC8 2;  1VQ9 Z;  1KD1 2;  2HU9 A;  2M48 A;  3JAM f;  3BG1 B;  2ZAE B;  4HGY A;  4NBB A;  1QVF Y;  3CC7 1;  1RLY A;  3LUS A;  1S72 1;  2VPY A;  1JJ2 Y;  2KPI A;  5D1O A;  3CCR Z;  3HOV I;  3G71 1;  4A3I I;  1VQ8 Z;  3VTN A;  4A3C I;  1Q7Y 2;  4E2X A;  3CC4 1;  2BJO A;  4TNU A;  1VQM Z;  3CD6 Z;  1W2B Y;  3G4S Z;  2JIR A;  1JJ2 Z;  3CC4 Z;  2JS4 A;  2EGT A;  2JIQ A;  1Q7Y 1;  3KIF A;  2NVQ I;  3RZO I;  3CC2 1;  1TWC I;  4MRI A;  3CCV Z;  1RNI A;  3J81 f;  3CCQ Z;  3G6E 1;  1Q81 1;  3I07 A;  3CCQ 1;  3CCU 1;  5IP7 I;  1QVG Y;  2E2I I;  4A3D I;  1KD1 1;  1Q16 A;  2HF1 A;  1NUI A;  2M6N A;  4NBC A;  3CCS 1;  1ZH1 A;  3GTG I;  4RVD A;  3J81 b;  1NJI 2;  1N8R 1;  3CMA 1;  2JA8 I;  2GTH A;  3GTO I;  1I6H I;  4QTU A;  4NBD A;  3VMI A;  1VQP 1;  2QRC B;  3VMG A;  3VB9 A;  3S1N I;  2O4H A;  1K9M 2;  3GCF A;  2QEX Z;  3NH5 A;  3CD6 1;  2QLV B;  2E9H A;  2K5R A;  2JNY A;  1VQ9 1;  2AYD A;  5T64 A;  1S7M A;  2VPW A;  2VF1 A;  4HH4 A;  4A3K I;  4E32 A;  3CCL 1;  3NDI A;  1YIJ 1;  1VQO Z; 
#chains in the Genus database with same CATH homology
 1YI2 Z;  2PK7 A;  2WAQ A;  4RV9 A;  1Q86 1;  2R7Z I;  4MXU A;  4HGZ A;  1DL6 A;  3J80 f;  2OOY B;  2H85 A;  3TE5 B;  2IZ4 A;  3S14 I;  3NH8 A;  3CC2 Z;  3CCV 1;  1ZB9 A;  1Q82 2;  3IFU A;  5LL6 f;  4NBE A;  2R92 I;  1ZB8 A;  3F3P C;  1VQ5 Z;  1YUA A;  5D1P A;  3CME 1;  4X6A I;  4DGL A;  1LQL A;  1YJW Z;  1YJ9 1;  4A3G I;  4MH4 A;  1VQ4 Z;  2OTJ Z;  1Y1V S;  2J6A A;  3S1M I;  5IT9 b;  3CCS Z;  5CM2 M;  4A3F I;  4E31 A;  2W04 A;  3I55 Z;  1TFI A;  4E30 A;  3M3Y I;  4RS4 A;  2QRD B;  4NH1 C;  1K73 2;  3K7A I;  3TDH B;  3H3V J;  3G6E Z;  2V8I A;  3CQZ I;  4DK1 A;  3CCL Z;  4EWC A;  2RBL A;  2GTI A;  1YJW 1;  1VLA A;  2E2H I;  4NFR A;  2LFU A;  3G4S 1;  3CCJ 1;  2QA4 Z;  4A3M I;  1Z01 A;  2RT9 A;  3S2D I;  1TWA I;  2I3C A;  2JA6 I;  3BG0 B;  2AKL A;  3CCJ Z;  1VQL Z;  1Y1W I;  5C44 I;  1KRL A;  2JMO A;  5IP9 I;  3OW2 Y;  4CL1 A;  3HOX I;  4NBH A;  1M1K 2;  3IX0 A;  3MZL B;  3U50 C;  3HKZ A;  1YIT Z;  1W2B Z;  2OTL 1;  3CMA Z;  2LIY A;  2Y0S A;  1X3Z A;  3GTM S;  3H0G I;  5D1O B;  3CPW Z;  2YU9 I;  1PFT A;  3S15 I;  4NBG A;  1QVF Z;  3S1Q I;  2R93 I;  1VQ7 Z;  3VMH A;  2K3R A;  2OTJ 1;  1RQF A;  3J80 b;  2NVX I;  5C4X I;  4Y52 I;  2OZK A;  2RPR A;  2PMZ A;  4A3B I;  3EED A;  1VQ8 1;  3S16 I;  1YHQ 1;  4RVG A;  3CCM 1;  3GTL I;  3HOZ I;  2V8J A;  2QRE B;  1WCM I;  3D9X A;  2QEX 1;  1KQS Y;  2DE5 A;  3NH4 A;  1VQ5 1;  3GTP I;  2Q4Z A;  5T67 A;  2P3Y A;  2JUB A;  2G2K A;  2DE6 A;  1JWH C;  1K73 1;  1NP6 A;  2E2J I;  5IT9 f;  1KQS Z;  1VQK 1;  3PO3 I;  1QVG Z;  1VQ6 1;  3GTK I;  1USP A;  1QYP A;  3CCE Z;  3S1R I;  3NFZ A;  1WII A;  4E2W A;  1VQL 1;  2QR1 B;  3FQM A;  1YIJ Z;  2Q51 A;  4BBR I;  4E2Y A;  4BY7 I;  2VUM I;  1P9N A;  4NOZ A;  3QWU A;  1Z03 A;  3I4N I;  2P28 A;  3D6W A;  4E33 A;  5FLM I;  3GKQ A;  4RVH A;  1VQP Z;  1K83 I;  4NBA A;  4E2Z A;  1Z02 A;  1RO4 A;  2RIQ A;  3ESW A;  3S2H I;  2JA7 I;  2NVT I;  4MON A;  2DE7 A;  4NBF A;  1YJN 1;  3GTM I;  4MD8 A;  2RHB A;  3GTJ I;  4QTT A;  1R9T I;  3KIH A;  2YAD A;  2GU2 A;  2W03 A;  1KC8 1;  2IZ3 A;  1RO2 A;  3IF8 A;  3JAM b;  1M1K 1;  3CCU Z;  5FLX f;  4MD9 A;  1X3W A;  1TWF I;  1VQ4 1;  2OOX B;  5AN9 F;  3I55 1;  1TWH I;  3I56 1;  4RVF A;  4BBS I;  2KI7 B;  3I4M I;  3HOW I;  3HOY I;  2JR6 A;  1TWG I;  2V8K A;  2QA4 1;  1VQM 1;  1YI2 1;  5FLX b;  3HOU I;  1YHQ Z;  1Q81 2;  3MZK B;  1YJ9 Z;  2QKD A;  1Q82 1;  3CXC Z;  1Y1V I;  4AYB A;  1K9M 1;  3CCR 1;  3CME Z;  3T4N B;  4Y7N I;  5A2Q b;  1L1O C;  3F3F C;  2JA5 I;  2F4O A;  2O53 A;  3Q87 A;  2WB1 A;  1NJI 1;  5C4J I;  2NVY I;  5T6B A;  4DQY B;  2B63 I;  1N2F A;  5A2Q f;  2PM9 A;  3MON A;  4NB8 A;  3P5J B;  1VQN Z;  4NB9 A;  3CCE 1;  1YIT 1;  1Q86 2;  1VQ6 Z;  3FKI I;  4A3E I;  4BXX I;  1VQK Z;  3M4O I;  1X0T A;  4S1T A;  1USP B;  2VUG A;  1I3Q I;  3PO3 S;  5C3E I;  1VQO 1;  2F4M A;  1WW9 A;  3CPW Y;  1I50 I;  1N8R 2;  3I56 Z;  4A93 I;  1M90 1;  1K8A 2;  3S17 I;  2R6M A;  3J7A 4;  3CXC Y;  3PO2 I;  3CC7 Z;  1YUK A;  1VQ7 1;  1QF8 A;  3CCM Z;  3GTQ I;  3RZD I;  1K8A 1;  3OW2 Z;  4BY1 I;  1ML8 A;  1SFO I;  1M90 2;  1VQN 1;  4A3J I;  1RO0 A;  3G71 Z;  4MD7 A;  1YJN Z;  1S72 Z;  4A3L I;  3FQQ A;  2OTL Z;  3EER A;  3NDJ A;  4XX2 A;  1KC8 2;  1VQ9 Z;  1KD1 2;  2HU9 A;  2M48 A;  3JAM f;  3BG1 B;  2ZAE B;  4HGY A;  4NBB A;  1QVF Y;  3CC7 1;  1RLY A;  3LUS A;  1S72 1;  1JJ2 Y;  2KPI A;  5D1O A;  3CCR Z;  3HOV I;  3G71 1;  4A3I I;  1VQ8 Z;  3VTN A;  4A3C I;  1Q7Y 2;  4E2X A;  3CC4 1;  2BJO A;  4TNU A;  1VQM Z;  3CD6 Z;  1W2B Y;  3G4S Z;  1JJ2 Z;  3CC4 Z;  2JS4 A;  2EGT A;  1Q7Y 1;  3KIF A;  2NVQ I;  3RZO I;  3CC2 1;  1TWC I;  4MRI A;  3CCV Z;  1RNI A;  3J81 f;  3CCQ Z;  3G6E 1;  1Q81 1;  3I07 A;  3CCQ 1;  3CCU 1;  5IP7 I;  1QVG Y;  2E2I I;  4A3D I;  1KD1 1;  2HF1 A;  1NUI A;  2M6N A;  4NBC A;  3CCS 1;  1ZH1 A;  3GTG I;  4RVD A;  3J81 b;  1NJI 2;  1N8R 1;  3CMA 1;  2JA8 I;  2GTH A;  3GTO I;  1I6H I;  4QTU A;  4NBD A;  3VMI A;  1VQP 1;  2QRC B;  3VMG A;  3VB9 A;  3S1N I;  2O4H A;  1K9M 2;  3GCF A;  2QEX Z;  3NH5 A;  3CD6 1;  2QLV B;  2E9H A;  2K5R A;  2JNY A;  1VQ9 1;  5T64 A;  1S7M A;  2VF1 A;  4HH4 A;  4A3K I;  4E32 A;  3CCL 1;  3NDI A;  1YIJ 1;  1VQO Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...