2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
1Q7LA 2C6PA 4DUKA 3SJFA 3JRUA 3SI1A 4R7MA 5LYDA 3NH5A 4MHYA 1YW4A 3KQXA 3PB7X 3FF3A 1CPSA 4NGRA 2CF4A 4DJLA 1VHOA 2CTCA 2AFZA 1F2PA 3S9MA 5HXDA 3CPXA 1CX8A 3FECA 4X2TA 1BAVA 2POKA 3D7FA 2BCOA 3CT9A 4IAVA 3IFEA 4PXCA 3CPAA 5HVGA 3PEIA 4UIAA 1BLLE 2PJBA 1NSAA 3KASA 1TKJA 4MCSA 3GB0A 5D8NA 3SI0A 4PPZA 5F09A 2ZEFA 4ZY2A 1BPNA 1LFWA 2NYQA 2PE3A 4RUHA 2PRQA 3S9NA 1Y7EA 4JYWA 5LRGA 4MHPA 1ZLHA 1YLOA 3PB8X 3V7ZA 1HDQA 4FUUA 4ZX9A 3WC7A 4F8ZA 2CTBA 4A94A 1ARLA 2O4HA 4PXDA 3FX6A 2ZOGA 4P6YA 1Z2LA 2GLFA 3WT4A 4JZ0A 4ZI6A 2AFXA 1BPMA 4P4JA 3IC1A 4OC0A 1FT7A 4NGNA 4OKOA 2PJ9A 3GUXA 1HEEA 1CPXA 5CPAA 4CPAA 3FEDA 2QYVA 1DTDA 3MRUA 3B3VA 2PJ0A 4WJBA 4R6TA 2ZEPA 1FNOA 3N5FA 4OP4A 1M4LA 4FAIA 3LWUA 2RB7A 4R76A 2C1CA 3BI1A 1TXRA 2ANPA 3ISXA 5K8NA 3D66A 2WYRA 3HUVA 5I4MA 2PJAA 3WC6A 3SJXA 1ELLP 4MCRA 3VARA 5K8OA 4P4IA 4H2KA 1CG2A 2AFUA 3H8FA 1GYTA 3GLJA 2EWBA 3PRTA 3B3CA 5LYLA 4NGPA 2ZEGA 4P4BA 1YMEA 1ZG9A 2ABZA 3KQZA 1XMBA 3D67A 2QVPA 3WABA 2NSMA 2ZELA 4MCPA 5DS0A 1HDUA 4EFDA 2AFWA 1PYTB 1Z8LA 3D7HA 4TNUA 4R8FA 8CPAA 2RFHA 2PVVA 4KSIA 5K8PA 2CIJA 2ZOFA 1XFOA 1Z5RA 3NFZA 4NJRA 4ZX8A 5JGFA 1TKHA 1CP6A 3SJEA 2PJ8A 4IHMA 2O53A 4OC2A 3FJUA 1XJOA 3BI0A 5JM6A 3NH4A 2AFMA 2Q4ZA 2IJZA 2PJ2A 7CPAA 2ZENA 5K8MA 2HC9A 1YW6A 3FEEA 2ZEOA 1LAMA 3K2KA 3SI2A 3KR5A 1VHEA 1PCAA 4A38A 1IGBA 2GU2A 4X3RA 3SJGA 5HVHA 2VL1A 4TWEA 2PJ1A 3PFEA 1QMUA 3KHXA 4Z65A 1TF8A 3D68A 4OC1A 2OOTA 3L2NA 3KGQA 4OIWA 4EMEA 2J9AA 1ARMA 3PB9X 1ELMP 4B6ZA 4FWUA 5LYIA 2Q43A 4NGMA 4AXVA 1UWYA 4OIDA 1ZLIA 1LOKA 5IB9A 2ZEMA 1R3NA 3B3WA 2ZEHA 1TF9A 2XEFA 3PBEA 1ZG7A 4ONWA 4MHNA 4K3NA 1VGYA 2OR4A 4UF4A 1F57A 1VIXA 3IIBA 4FBEA 4O23A 4OC4A 2F8HA 3S9LA 2PJ4A 4UIBA 2C6CA 2FVGA 3D7GA 4A39A 3B35A 2XEGA 5D29A 3ISZA 3PBBA 4UEFA 2PJ5A 1LANA 4NGQA 1AYEA 1F2OA 3LMSA 1LCPA 2JEWA 4ZY0A 4LQGA 4X8IA 3WC5A 4P45A 3RZAA 3IWWA 3RAMA 4EWTA 1TKFA 2XEJA 2I3CA 3CDXA 1OBRA 2QJ8A 2V8VA 4ZY1A 4UEZA 4WWVA 2BOAA 1RTQA 5THWA 3KR4A 3D7DA 3BHXA 4F9UA 2AFSA 2AFOA 4OC3A 3I1UA 5J1QA 3V38A 5HVFA 5LYFA 3FVLA 5LRKA 4P4DA 6CPAA 2ZEDA 4BD9A 2PIZA 4P10A 2IMOA 4OC5A 4A37A 3T8WA 2ZEEA 4W9YA 4IK2A 2GLJA 1R43A 2IQ6A 5LRJA 2Q51A 4NFRA 4F9VA 3DGVA 2PIYA 4YU9A 4P4EA 3TC8A 2EK9A 3DLJA 3HLPA 1YSJA 1H8LA 4P4FA 4MRIA 3KHZA 2HB6A 1DE4C 3B3SA 2PVWA 3K9TA 4PQAA 5JH9A 1AMPA 3KL9A 2PJCA 3PB4X 4NJQA 3RBUA 1EE3P 4NGTA 4MMOA 3TX8A 3IEHA 2DEAA 1XRYA 4MXUA 3PB6X 4OMEA 1XBUA 2BO9A 4UEEA 3B3TA 3PFOA 1KWMA 3FH4A 1CBXA 2V8DA 2PJ6A 3NH8A 1CP7A 3H8GA 3BXMA 1JQGA 3KI9A 4PXBA 2WZNA 2G9DA 3IJ3A 4NGSA 2XEIA 2PCUA 3NA6A 4G1PA 1QQ9A 2V8HA 3QNVA 3FMCA 1Y0RA 3KZWA 4Q7AA 4PXEA 3MN8A 4MHZA 1ZG8A 2C6GA 2V77A 5ELYA 4YWYA 5CBMA 4ZYQA 2EK8A 3B7IA 3D4UA 4P44A 4MCQA 3VATA 1IY7A 4GM5A 1Y0YA 2JBJA 3IO1A 2PJ3A 3H8EA 3VH9A 2PJ7A 2JBKA 4DYOA 1LAPA 2GREA 2V8GA 2F7VA 3B2YA
chains in the Genus database with same CATH superfamily
5T67A 1Q7LA 1YREA 3VB9A 3SJFA 3EXNA 2Z3OA 1YJW1 1WCMI 1IB1E 3GY9A 3JUWA 4MHYA 3A9LA 1VQN1 3PB7X 2R93I 1USPB 3S9MA 3SXOA 1OZPA 2QR1B 3I56Z 2RBLA 1J4JA 3D7FA 3GIUA 4CYQA 4MFZA 3IFEA 3CCQ1 3R9GA 4CGMA 3CPAA 4E2YA 1WIIA 1YX0A 4C2ZA 2OZGA 5C3EI 4RI1A 1RQFA 1KQSZ 2LFUA 2ZPAA 4EWCA 3I551 3MZKB 3S9NA 4KLVA 4JYWA 1YLOA 3V7ZA 4ZX9A 1QXFA 2HV2A 2O4HA 4PXDA 3FX6A 2OH1A 1CJWA 1VQMZ 3T9YA 1M1K1 2Z3KA 2DF5A 1M44A 4DNCA 1L0CA 3GUXA 1HEEA 2JA8I 1TIQA 4II9A 1S72Z 3D9XA 3FEDA 2QYVA 2NVYI 1DTDA 3RZDI 3PO2I 3NDJA 2D4PA 1DL6A 5AG6A 4WJBA 1K8A2 5CM2M 2OB0A 2R1IA 2PRBA 1RO4A 2PDOA 3W91A 2VI7A 4XPKA 3TDHB 2RB7A 4R76A 1M4IA 3BI1A 1N8R1 4F0XA 4M85A 3D66A 1ZO0A 1PFTA 3QAYA 3WC6A 1YHQZ 3GTMS 4UBRA 1QVFZ 4H2KA 3CCEZ 2YNEA 4P4BA 1YK3A 4OLLA 2ABZA 1XMBA 2GIVA 2QVPA 3WABA 2NSMA 2ZELA 4MCPA 2J6AA 4A33A 2W04A 3S6GA 1HDUA 1KD12 2AFWA 4JJXA 1TFIA 1VQLZ 3IWEA 4B5PB 4TNUA 1PUAA 4KSIA 1KRLA 1X3ZA 1XFOA 3HOUI 4CRZB 1QSNA 4BY7I 4ZX8A 2OOXB 3BG0B 3SJEA 1YVKA 3FJUA 3EY5A 1U6MA 3BI0A 4KSAA 4A3BI 2REFA 2LEXA 2H5MA 1I50I 3FEEA 2AE6A 4E33A 2VQYA 1P0HA 1YJ9Z 3I9SA 2VL1A 3CXSA 4TWEA 4NBDA 1QMUA 1KUXA 3CCVZ 2OOTA 2R7ZI 3KGQA 2OZHA 1MJ9A 1M901 1YLEA 1Y7RA 4FWUA 4NSQA 3IU1A 3BLNA 4OIDA 5F46A 5IB9A 2ZEMA 2OTJZ 1R3NA 5F47A 3PBEA 4UF4A 4KORA 1Z4RA 3QB8A 4FBEA 3VMIA 4A3FI 3VWDA 3S9LA 1NP6A 4UIBA 4CRYB 2QEXZ 2QMLA 3ISZA 3PBBA 2VBQA 3D3SA 1LANA 3JVNA 5T6BA 4A31A 1FDIA 4CAWA 4P45A 2JUBA 1FY7A 2XEJA 2IL4A 2JR6A 1VQL1 4MFLA 3DR6A 1RO0A 5EMIA 5FLXf 3H4QA 5IB0A 1RTQA 3KR4A 4L89A 3QWUA 1WWZA 1YIJ1 3CXPA 3PP9A 2JEVA 1Z8WA 1X3WA 5LYFA 2DE6A 4UFXA 2J8RA 4AYBA 1Z4EA 4BD9A 3TE5B 3TCVA 1XF8A 2NMTA 1SQHA 4K30A 1PU9A 2IMOA 3F8KA 2NVTI 4CGPA 1KUYA 1Z01A 1R43A 4F9VA 3DGVA 4B12A 1YJ91 2P6FA 2DPSA 4P4EA 4XX2A 1IIDA 3HLPA 1Q812 1YSJA 4B5OA 1S7NA 2OTLZ 2BSWA 1DE4C 3B3SA 1R9TI 2PVWA 5JH9A 1AMPA 5D1OB 3HOXI 1KZFA 1VKCA 1EE3P 2ZW4A 4CAFA 4NEXA 3D2MA 4ZBGA 4HGZA 2B3UA 1XBUA 2OTJ1 1QSRA 1VQ41 3H5ZA 3B3TA 1YJN1 3FH4A 1CBXA 1CP7A 1JQGA 3KIFA 2XEIA 1P4NA 3S15I 4MJ8A 1QSOA 4M6HA 1WJ2A 1Z8TA 4Q7AA 4PXEA 1ZG8A 2QEX1 1K732 1MK4A 2FSRA 4YWYA 4FD4A 5CBMA 2EK8A 3GYAA 2NAPA 3LD2A 2BJOA 2DXQA 1NJI1 2VUMI 3R9FA 3G71Z 1YUAA 5FLXb 1BO4A 4DYOA 2V8GA 1YJWZ 4AVBA 1VQNZ 4E31A 3CC7Z 4R7MA 3NH5A 5J8CA 3KQXA 1S7FA 5HXDA 3FECA 1CX8A 4AG9A 2F4MA 3BG1B 3VMHA 2BCOA 4BBRI 2B63I 3T4NB 4A3CI 1JJ2Y 2QIRA 3PEIA 1BLLE 5IX3A 3DSBA 4UCPA 1NSAA 3KASA 3DNSA 2AYDA 1YI2Z 3GB0A 3SI0A 5F09A 2ZEFA 4ZY2A 4HPSA 2NYQA 2PE3A 1YIT1 4A95A 2PRQA 2YNCA 2JMOA 4IUSA 3M4OI 4F6AA 2P28A 2QECA 4FUUA 2CNTA 4F8ZA 3R95A 4QC6A 1VQ91 2EUIA 4PK2A 2OTL1 1I21A 2R7HA 3IC1A 4UWJA 3FYNA 4OKOA 4CPAA 2P3YA 3CZXA 1KC81 4AVCA 1Q861 3MRUA 3B3VA 1AUGA 4RVGA 2VPZA 1M4LA 4E2WA 4CS0B 4X6AI 3H3VJ 3NE7A 1YQEA 4QUSA 5FLMI 5I4MA 3NE8A 3FB3A 2ZXVA 4P4IA 2ZW6A 3CCLZ 1RXTA 1CG2A 2AFUA 1GYTA 2EWBA 4HNXB 3PRTA 4M3SA 2Z10A 2A4NA 4I49A 2OZKA 1VHSA 1N71A 3KQZA 5DS0A 4A3II 3CC71 1PYTB 3K9UA 1UFHA 3D7HA 3CD61 4R8FA 2RFHA 4KLWA 5K8PA 2ZOFA 3D2PA 4Q36A 4DGLA 3CCJ1 1Z5RA 2Z3NA 1Q2DA 1TKHA 2ZAEB 3G4SZ 2O53A 3MONA 1ZB8A 3VWEA 5JM6A 3W6XA 3RO0A 3S17I 3CCUZ 4MFKA 2IJZA 2PJ2A 2JS4A 1YI21 4FD5A 2ZENA 1VQ7Z 1WK4A 1JWQA 5K8MA 5C44I 1Q822 1QVGY 1YW6A 3CCR1 1K8A1 2ZEOA 1VLAA 2E2HI 4NF1A 3KR5A 5A28A 2Q7BA 2AKLA 3PO3S 3MZLB 1PCAA 4NCZA 3E0KA 3CCMZ 4A38A 2VZZA 2JIPA 4X3RA 2I79A 2PSWA 4KOXA 3PFEA 4C2YA 2BEIA 3CXCZ 2VF1A 4Z65A 3FBUA 4KOTA 3D68A 1XIXA 4OIWA 3S1NI 1I12A 2B4DA 5AN9F 3PB9X 3I4NI 5H84A 3GTOI 4ORFA 1K83I 1ZLIA 5H86A 4XPLA 3TE4A 1KD11 2O28A 5IV0A 2Q4VA 1TF9A 2XEFA 1RNIA 1Y1WI 4MHNA 3CC41 4L8AA 4YFJA 2ARHA 4O23A 4MFJA 3P5JB 4Y52I 2PJ4A 4MY3A 1Z9UA 2C6CA 3D7GA 2G2KA 4MONA 1K9M2 3EFAA 3CCL1 4A2ZA 4UEFA 4HKFA 4OAEA 1S7MA 4NBFA 3LMSA 3GCFA 2JEWA 1ZH1A 1W2BY 3WC5A 2G3AA 4EWTA 2Q7SA 3I07A 3CXQA 2NVXI 1OBRA 4E8OA 3KIHA 2JDDA 1YIJZ 3D7DA 1N8R2 1S5KA 1S7LA 5AG5A 2VPXA 4CGLA 3D2LA 5J1QA 3BJ7A 3G4S1 5T64A 4MI4A 5HVFA 2IZ4A 3T90A 3FVLA 5LRKA 2R6MA 3FQQA 4PSXA 2ZEDA 3FQMA 3CCU1 4P10A 3S2HI 1VQP1 1VQ71 1M1DA 5A27A 2FL4A 2REEA 5C4XI 2IQ6A 3CCM1 2Q51A 4AB7A 2VPWA 4C2XA 1NE9A 3JAMf 3DLJA 3VTNA 2YNDA 4ZGYB 4P4FA 4NJQA 1TWCI 3RBUA 1Z02A 1Q7Y2 3N7ZA 4A3DI 4MXUA 1VQ4Z 5A2Qf 1YJNZ 1S7KA 3BJ8A 2EVNA 5E96A 3UY5A 2V8DA 2WZNA 2G9DA 3IJ3A 2Y0MA 2CNMA 4H6UA 2W03A 1NUIA 3IX0A 1QQ9A 2V8HA 3M3YI 3KZWA 3C26A 3CQZI 2QRCB 2C6GA 4GS4A 5G21A 5ELYA 4F0YA 3D4UA 4Y7NI 2K5TA 4RVFA 1SFOI 1IY7A 1Y1VS 2QKDA 1Y0YA 2PR8A 4KUBA 2BUEA 2RIQA 4HNWB 1B87A 4NBCA 1M902 1IYKA 4MFQA 1M4GA 1ML8A 3JRUA 3SI1A 5LYDA 3I4MI 1YW4A 3FF3A 1CPSA 5HMNA 1VHOA 2CTCA 1F2PA 3CPXA 5DWNA 3CMA1 1BAVA 1VQ51 4X2TA 1Q811 2QA41 5I0CA 3CT9A 2Q04A 5HVGA 2GANA 5IT9f 2EO8A 1TKJA 1Y9WA 4MCSA 1GHEA 1YITZ 1RO5A 3JAMb 1LQLA 4RUHA 5LRGA 5LL6f 4MHPA 1SIWA 3PB8X 1VQ9Z 1HDQA 2D4OA 3TOBA 2V8KA 3WC7A 3PGPA 1IICA 2CTBA 3TO7A 4A94A 1ARLA 1FDOA 2G3TA 1VQ8Z 1VQ6Z 2GLFA 1K731 3WT4A 5A2Qb 4ZI6A 1BPMA 2JIOA 2JA6I 4P4JA 3S14I 3CMEZ 4OC0A 4XNHB 4UWIA 1FT7A 4NGNA 3JTKA 3F0AA 4JXRA 5CPAA 5FVJA 4KSFA 2OOYB 2PJ0A 2ZEPA 3N5FA 3QAHA 4OP4A 1NSLA 3P2FA 1QSTA 2C1CA 2JIQA 1KQSY 1TXRA 2ANPA 3ISXA 2WYRA 3HUVA 4Y49B 2JIMA 4MD7A 5EC4A 2PJAA 2JDCA 2AJ6A 5C82A 4MCRA 3VARA 4A3KI 4NBBA 3H8FA 1I1DA 3GLJA 4NBHA 4B14A 5LYLA 5AGEA 1YMEA 4CYOA 4DQYB 3D67A 1P9NA 1VQOZ 2JNYA 4UA3A 2GTIA 3TFYA 1MJAA 3CD6Z 3S2DI 1X10A 1Z8LA 2V45A 3GTKI 1LRZA 4QBJA 4R3LA 3CCJZ 2B4BA 8CPAA 5IT9b 4AVAA 1CP6A 2H85A 2PJ8A 4IHMA 3G6EZ 2NVQI 4BINA 1XJOA 3NH4A 2AFMA 4H89A 2Q4ZA 1Y9KA 3CCRZ 4GXHA 7CPAA 1CM0A 3PO3I 2HC9A 1QVFY 4QVTA 2HUZA 3Q87A 3SI2A 3G3SA 4RS4A 4U9YA 1RO2A 4RS2A 2QRDB 1WZNA 2GU2A 3D8PA 4QTUA 1VQ81 1VQ61 2B4DB 4OC1A 3CME1 4KUAA 4HNYB 4CYNA 4EMEA 2J9AA 1ARMA 2CXAA 3S1MI 1IU8A 5LYIA 4A93I 2Q43A 4NGMA 4AXVA 2G0BA 3RZOI 1LOKA 4AG7A 3HKZA 5CNPA 3B3WA 2ZEHA 4JWPA 3CC4Z 2J8MA 1ZG7A 4ONWA 2RT9A 3GTMI 1NMTA 2ODFA 2OR4A 1VIXA 4OC4A 4KOSA 2F8HA 3W6SA 3B8GA 1QSMA 4UFWA 4KZTA 4Q38A 4CYPA 2E2JI 2HF1A 3TOAA 3OW2Y 3S1RI 2KPIA 5D29A 3TO9A 2E2II 5JQ4A 2WUUA 4EVYA 2PJ5A 3R9EA 4E2XA 3TO6A 1AYEA 2V8JA 3LODA 3U50C 3EERA 4MHDA 4LQGA 1VQO1 4X8IA 1Q821 3RAMA 1KC82 1Q862 3ESWA 1BOBA 5AG4A 3IU2A 2FS5A 4KOVA 2KCWA 2QJ8A 2B3VA 2QLVB 4UEZA 2K3RA 2PR1A 2BOAA 2KI7B 5THWA 1YVOA 3MGDA 4F9UA 2GTHA 4UCNA 2AFOA 4KS9A 4XPDB 3I1UA 4NB8A 3V38A 4QB9A 3G6E1 4HGYA 4BBSI 4CL1A 1VQPZ 2M48A 2Z3PA 3H0GI 2PIZA 3J80f 2YU9I 5HH1A 2B5GA 2Z3MA 2DE5A 2YADA 4OC5A 2J8NA 4MBUA 3F5BA 3I3GA 3T8WA 1TWFI 2ZEEA 1M4DA 2FXFA 5G22A 2FCKA 3S1QI 5LRJA 1Q2YA 4NFRA 2IV2X 2WAQA 2Q4YA 3K7AI 4E30A 4C7HA 4A3MI 5ISVA 3WR7A 4HH4A 2QREB 3G8WA 4RVHA 2HU9A 4MRIA 2HB6A 1B6BA 3F3PC 1K9M1 3K9TA 3IGRA 3PB4X 3CPWY 2DEAA 2CY2A 3PB6X 4OMEA 1S3ZA 1QF8A 1XMTA 3FRMA 4UEEA 3EC4A 3OWCA 2ZW7A 3CCS1 3BXMA 4CGOA 1JJ2Z 4NOZA 3FMCA 1VQK1 2EBJA 2E9HA 4NH1C 2Q0YA 2V3VA 3R1KA 1Y1VI 2V77A 4M6GA 3KKWA 4ZYQA 1M1K2 4R57A 4E2ZA 3B7IA 2Z11A 4RN7A 4B10A 2CNSA 4MCQA 4GM5A 3FNCA 2V8IA 3H8EA 2PJ7A 3GTLI 3LACA 2F7VA 3B2YA 4B13A 2C6PA 4DUKA 4KVXA 2YGWA 4DK1A 4LX9A 4NGRA 2CF4A 4DJLA 3GKQA 3CMAZ 1VQ5Z 1X0TA 2AFZA 4S1TA 1USPA 2DE7A 4NBGA 2QA4Z 3J80b 3P2HA 2VZYA 2POKA 4CAXA 1Q2CA 4A32A 1RLYA 4IAVA 2VUGA 4PXCA 3I561 4UIAA 2PJBA 3S16I 1Q7Y1 3IR7A 4R87A 3IF8A 1IOFA 5G20A 5D8NA 1K4JA 4PPZA 2P0WA 1BPNA 1LFWA 4JLYA 2YNCC 4U5YA 1Y7EA 2PK7A 4ONUA 4M6IA 1ZLHA 1XEBA 2M6NA 3OW2Z 2PMZA 2ZOGA 4P6YA 3HOZI 2ZW5A 1Z2LA 4JZ0A 2AFXA 2P6GA 3CC2Z 1VQM1 4XNHC 2PJ9A 3D6WA 5IP9I 2OZUA 1CPXA 4B11A 2JA5I 5EBVA 1ON0A 3FIXA 1S721 4R6TA 1FNOA 1S60A 2GE3A 4PK3A 4FAIA 3LWUA 4MD9A 1V0CA 1TWAI 3HOVI 5F49A 2RHBA 5IP7I 5K8NA 4NBAA 4YRHA 4Y49C 5G1ZA 2Z0ZA 3SJXA 1ELLP 1QVGZ 5K8OA 1YHQ1 5J8FA 3CCE1 1ZB9A 3B3CA 4NGPA 2ZEGA 1ZG9A 3R96A 2Q44A 3TTHA 2JLMA 4EFDA 3RYOA 3V8IA 2R98A 4LUAA 2K5RA 3S6KA 4C68A 1A2ZA 2PVVA 1JWHC 2CIJA 4KOUA 4B5PA 1IOIA 4KVOE 3NFZA 4MD8A 3CPWZ 2BL1A 4NJRA 5JGFA 3EO4A 3LUSA 1YGHA 4OC2A 4A3LI 2F4OA 4RV9A 3S6FA 1IYLA 2IZ3A 1Y8CA 2OU2A 2Z3LA 1I3QI 1LAMA 3K2KA 1WW9A 4MY0A 1VHEA 3GTPI 1IGBA 1AA6A 3GTGI 3SJGA 2FT0A 5HVHA 2PJ1A 4UCMA 4KOWA 3J7A4 3KHXA 2LIYA 1TF8A 5C4JI 2FIAA 1W2BZ 2DPTA 3CC21 3L2NA 3NDIA 3CCV1 4KVME 1ELMP 5DWMA 4B6ZA 3DR8A 2X7BA 3J81f 4E2AA 1UWYA 4RVDA 2PC1A 1R57A 2FIWA 4CAVA 1XOVA 4K3NA 4A3EI 3GTQI 4C7IA 1VGYA 1F57A 1KUVA 3IIBA 4R9MA 4BBHA 2ATRA 1Z8XA 5D1PA 2FVGA 5KTCA 4A39A 3B35A 2XEGA 4J3GA 4A3GI 4E32A 4NGQA 4PSWA 4JD6A 5F48A 2WPWA 3RNZA 2EGTA 1TWGI 1F2OA 3CXCY 1LCPA 4ZY0A 3IFUA 2JA7I 1X12A 3TT2A 4PV6A 3RZAA 3IWWA 2HQYA 4MFPA 1TKFA 4R3KA 2F5IA 4NXYA 2I3CA 3CDXA 4CAEA 2PM9A 2V8VA 3ZZIA 4ZY1A 3SXNA 3PZJA 4WWVA 3DDDA 2PQ8A 1YR0A 1Q16A 3BHXA 2JIRA 1L1OC 2AFSA 3HOWI 4OC3A 4XPDC 2WB1A 2VPYA 4LQ6A 4OADA 5KTAA 3CCQZ 1NJI2 3GKRA 4P4DA 2B5GB 4BMHA 6CPAA 1N2FA 5JPHA 2WSAA 4U9ZA 4BXXI 2Y0SA 4NB9A 3I55Z 4YGOA 2C27A 4A37A 5AG7A 4W9YA 4IK2A 4FD6A 2GLJA 2I00A 3HOYI 2PIYA 2R92I 3FXTA 4NBEA 2R8VA 4YU9A 3TC8A 2EK9A 2RC4A 4X5KA 3J81b 1H8LA 4UFVA 1TWHI 4KOYA 1YUKA 3VMGA 3KHZA 3SHPA 3EEDA 4CGNA 1QYPA 4PQAA 3KL9A 3S6HA 2PJCA 4MH4A 4NGTA 4MMOA 3TX8A 3IEHA 5D1OA 2E7ZA 1MJBA 1XRYA 2FE7A 4A30A 3GTJI 4IF5A 2BO9A 2P6EA 3CCSZ 4QTTA 2VEZA 2VXKA 3PFOA 1KWMA 4JXQA 2PJ6A 3NH8A 3H8GA 3KI9A 1VQKZ 4PXBA 1I6HI 4NGSA 2PCUA 5GCNA 4G1PA 3NA6A 4E0AA 3QNVA 3F3FC 1Y0RA 2WPXA 3MN8A 4MHZA 1Z03A 3ZJ0A 5KTDA 4A3JI 3IWGA 4P44A 5BWAB 4FD7A 3VATA 4BY1I 2RPRA 2JBJA 3IO1A 2PJ3A 3VH9A 2JBKA 2GFQA 5C88A 1LAPA 2GREA 3G711 3FKII 1XE4A 2B58A 4H6ZA
chains in the Genus database with same CATH topology
5T67A 1VQNZ 1Q7LA 2C6PA 4DUKA 3VB9A 4E31A 3JRUA 3SI1A 3SJFA 3CC7Z 4R7MA 1YJW1 5LYDA 1WCMI 3NH5A 3I4MI 1YW4A 4MHYA 1VQN1 3KQXA 3PB7X 4DK1A 3FF3A 1CPSA 4NGRA 2R93I 1USPB 2CF4A 4DJLA 3GKQA 3CMAZ 1VQ5Z 1X0TA 1VHOA 2CTCA 2AFZA 1F2PA 4S1TA 3S9MA 1USPA 2DE7A 5HXDA 4NBGA 2QA4Z 3CPXA 1CX8A 3FECA 3CMA1 1BAVA 1VQ51 3J80b 4X2TA 1Q811 2POKA 2F4MA 1RLYA 2QR1B 3BG1B 2RBLA 3I56Z 2QA41 3VMHA 3D7FA 2BCOA 3CT9A 4BBRI 2VUGA 3CCQ1 2B63I 3IFEA 4IAVA 4PXCA 3CPAA 3T4NB 4A3CI 4E2YA 1JJ2Y 5HVGA 3B2YA 3I561 3PEIA 1WIIA 4UIAA 1BLLE 5C3EI 2PJBA 3S16I 1NSAA 3KASA 5IT9f 1Q7Y1 1TKJA 1RQFA 4MCSA 1KQSZ 3IF8A 1YI2Z 3GB0A 2LFUA 4EWCA 5D8NA 1YITZ 3I551 4PPZA 3SI0A 5F09A 2ZEFA 3JAMb 4ZY2A 1LQLA 1BPNA 1LFWA 2NYQA 3MZKB 2PE3A 1YIT1 4RUHA 2PRQA 3S9NA 1Y7EA 4JYWA 2PK7A 5LRGA 2JMOA 5LL6f 3M4OI 1ZLHA 4MHPA 1YLOA 3PB8X 3V7ZA 1VQ9Z 1HDQA 2P28A 4FUUA 2V8KA 4ZX9A 3WC7A 4F8ZA 2CTBA 2M6NA 3OW2Z 1ARLA 1VQ91 4A94A 2O4HA 4PXDA 2PMZA 3FX6A 2ZOGA 4P6YA 1VQ8Z 3HOZI 1VQ6Z 1Z2LA 2GLFA 1K731 2OTL1 3WT4A 5A2Qb 1VQMZ 4JZ0A 2AFXA 4ZI6A 1M1K1 1BPMA 2JA6I 3CC2Z 4P4JA 3S14I 3IC1A 3CMEZ 4OC0A 1VQM1 1FT7A 4NGNA 4OKOA 2PJ9A 3D6WA 5IP9I 1HEEA 3GUXA 2JA8I 1CPXA 5CPAA 1S72Z 3D9XA 2JA5I 4CPAA 3FEDA 2QYVA 2NVYI 2P3YA 1DTDA 3RZDI 3PO2I 1KC81 2OOYB 1Q861 3MRUA 3NDJA 1DL6A 3B3VA 2PJ0A 4WJBA 1S721 4R6TA 4RVGA 1K8A2 2ZEPA 1FNOA 5CM2M 3N5FA 4OP4A 1M4LA 4FAIA 4E2WA 1RO4A 3LWUA 4X6AI 4MD9A 3TDHB 2RB7A 3H3VJ 4R76A 1TWAI 2C1CA 1KQSY 3HOVI 1N8R1 1TXRA 3BI1A 2ANPA 3ISXA 2RHBA 5IP7I 5FLMI 5K8NA 3D66A 4NBAA 2WYRA 3HUVA 4MD7A 5I4MA 1PFTA 2PJAA 3WC6A 3SJXA 1YHQZ 1ELLP 3GTMS 4MCRA 3VARA 4A3KI 1QVGZ 1QVFZ 5K8OA 4P4IA 4H2KA 3CCEZ 3CCLZ 1YHQ1 1CG2A 4NBBA 2AFUA 3H8FA 3CCE1 1GYTA 3GLJA 2EWBA 1ZB9A 3PRTA 4NBHA 3B3CA 5LYLA 4NGPA 2ZEGA 4P4BA 1YMEA 1ZG9A 2ABZA 2OZKA 3KQZA 4DQYB 1XMBA 3D67A 2QVPA 3WABA 1P9NA 1VQOZ 2JNYA 2NSMA 2ZELA 4MCPA 2GTIA 5DS0A 2J6AA 2W04A 1HDUA 1KD12 4EFDA 4A3II 2AFWA 3CC71 3CD6Z 1PYTB 3S2DI 1TFIA 1VQLZ 1Z8LA 3GTKI 2K5RA 3D7HA 3CD61 4TNUA 3CCJZ 4R8FA 8CPAA 2RFHA 2PVVA 4KSIA 1JWHC 5K8PA 1KRLA 2CIJA 2ZOFA 1X3ZA 5IT9b 1XFOA 4DGLA 3CCJ1 3HOUI 1Z5RA 3NFZA 4MD8A 3CPWZ 4BY7I 4NJRA 4ZX8A 5JGFA 1TKHA 2OOXB 1CP6A 2H85A 2ZAEB 3BG0B 3SJEA 2PJ8A 4IHMA 3G4SZ 3LUSA 2O53A 3G6EZ 2NVQI 4OC2A 3FJUA 3MONA 1XJOA 3BI0A 1ZB8A 5JM6A 4A3BI 3NH4A 4A3LI 2AFMA 2F4OA 3S17I 3CCUZ 2Q4ZA 2IJZA 2PJ2A 4RV9A 3CCRZ 2JS4A 7CPAA 1YI21 2ZENA 1VQ7Z 3PO3I 5K8MA 2IZ3A 2HC9A 1I50I 5C44I 1Q822 1QVGY 1QVFY 1YW6A 3FEEA 1I3QI 3CCR1 1K8A1 2ZEOA 1VLAA 2E2HI 1LAMA 3K2KA 3Q87A 3SI2A 3KR5A 1WW9A 2AKLA 4RS4A 3PO3S 1RO2A 3MZLB 1VHEA 1PCAA 4A38A 4E33A 3CCMZ 2QRDB 3GTPI 1IGBA 2GU2A 4X3RA 3GTGI 1YJ9Z 3SJGA 5HVHA 2VL1A 4QTUA 4TWEA 2PJ1A 3PFEA 4NBDA 3J7A4 1QMUA 3KHXA 1VQ81 3CXCZ 2VF1A 1VQ61 4Z65A 2LIYA 1TF8A 5C4JI 1W2BZ 3CCVZ 3D68A 4OC1A 2OOTA 3CC21 2R7ZI 3L2NA 3NDIA 3CME1 3KGQA 4OIWA 3S1NI 4EMEA 3CCV1 2J9AA 1ARMA 5AN9F 3PB9X 1ELMP 4B6ZA 1M901 3S1MI 4FWUA 5LYIA 3I4NI 4A93I 2Q43A 4NGMA 3J81f 3GTOI 4AXVA 1K83I 4RVDA 1UWYA 1ZLIA 4OIDA 3RZOI 1LOKA 3HKZA 5IB9A 1KD11 2ZEMA 2OTJZ 1R3NA 3B3WA 2ZEHA 3CC4Z 1TF9A 2XEFA 3PBEA 1ZG7A 1RNIA 4ONWA 1Y1WI 2RT9A 3GTMI 4K3NA 4A3EI 4MHNA 3GTQI 1VGYA 2OR4A 3CC41 4UF4A 1F57A 1VIXA 3IIBA 4FBEA 3VMIA 4O23A 4A3FI 3P5JB 4OC4A 4Y52I 2F8HA 3S9LA 1NP6A 2PJ4A 4UIBA 5D1PA 2QEXZ 2C6CA 2E2JI 2HF1A 2G2KA 4MONA 2FVGA 3D7GA 1K9M2 4A39A 3OW2Y 3B35A 3S1RI 3CCL1 2KPIA 2XEGA 5D29A 2E2II 3ISZA 3PBBA 4UEFA 2PJ5A 4A3GI 4E32A 1LANA 1S7MA 4NGQA 4E2XA 1AYEA 4NBFA 2V8JA 2EGTA 5T6BA 1TWGI 1F2OA 3CXCY 3LMSA 3U50C 3GCFA 1LCPA 1ZH1A 3EERA 2JEWA 4ZY0A 1W2BY 4LQGA 3IFUA 1VQO1 2JA7I 4X8IA 1Q821 3WC5A 4P45A 2JUBA 3RZAA 3IWWA 3RAMA 1KC82 1TKFA 1Q862 3ESWA 3I07A 4EWTA 2XEJA 2NVXI 2JR6A 1VQL1 2I3CA 3CDXA 2PM9A 1OBRA 1RO0A 2QJ8A 2V8VA 5FLXf 2QLVB 3KIHA 4UEZA 2K3RA 4ZY1A 4WWVA 2BOAA 1RTQA 2KI7B 5THWA 1YIJZ 3KR4A 3D7DA 1N8R2 3BHXA 4F9UA 3QWUA 1L1OC 2GTHA 2AFSA 2AFOA 3HOWI 1YIJ1 3I1UA 4OC3A 2WB1A 4NB8A 5J1QA 3V38A 3G4S1 5T64A 5HVFA 3CCQZ 2IZ4A 3G6E1 1X3WA 4HGYA 5LYFA 1NJI2 4BBSI 4CL1A 3FVLA 5LRKA 2R6MA 2DE6A 4P4DA 1VQPZ 4AYBA 6CPAA 1N2FA 2M48A 3FQQA 2ZEDA 3FQMA 4BD9A 3H0GI 3CCU1 2PIZA 3J80f 4P10A 3TE5B 2YU9I 3S2HI 4BXXI 1VQP1 2Y0SA 4NB9A 1VQ71 2DE5A 3I55Z 2YADA 2IMOA 4OC5A 4A37A 3T8WA 2NVTI 1TWFI 2ZEEA 4W9YA 5C4XI 4IK2A 2GLJA 1Z01A 3S1QI 1R43A 2IQ6A 3CCM1 5LRJA 2Q51A 3HOYI 4NFRA 4F9VA 3DGVA 1YJ91 2WAQA 2PIYA 2R92I 4NBEA 4YU9A 4P4EA 3K7AI 4XX2A 4E30A 3JAMf 2EK9A 3TC8A 3DLJA 4A3MI 3HLPA 3VTNA 1Q812 1YSJA 3J81b 1H8LA 4HH4A 1TWHI 2QREB 4P4FA 4RVHA 1YUKA 2OTLZ 2HU9A 4MRIA 3VMGA 2HB6A 3KHZA 3F3PC 1K9M1 1DE4C 3B3SA 1R9TI 2PVWA 3K9TA 3EEDA 1QYPA 4PQAA 5JH9A 1AMPA 5D1OB 2PJCA 3HOXI 3KL9A 1TWCI 3PB4X 4NJQA 4MH4A 3CPWY 3RBUA 1Z02A 1EE3P 4NGTA 4MMOA 3TX8A 3IEHA 5D1OA 1Q7Y2 2DEAA 1XRYA 4HGZA 4MXUA 4A3DI 3PB6X 3GTJI 1VQ4Z 4OMEA 5A2Qf 1QF8A 1XBUA 1YJNZ 2BO9A 3CCSZ 2OTJ1 4QTTA 1VQ41 4UEEA 3B3TA 3PFOA 1YJN1 1KWMA 3FH4A 1CBXA 2V8DA 3CCS1 2PJ6A 3NH8A 1CP7A 3H8GA 3BXMA 1JQGA 1VQKZ 3KI9A 2WZNA 2G9DA 3KIFA 3IJ3A 4PXBA 1I6HI 4NGSA 2XEIA 2PCUA 2W03A 1JJ2Z 3NA6A 4G1PA 1NUIA 3IX0A 3S15I 1QQ9A 2V8HA 3QNVA 4NOZA 3M3YI 3FMCA 3F3FC 1VQK1 1Y0RA 3KZWA 2E9HA 3CQZI 4NH1C 4Q7AA 4PXEA 2QRCB 3MN8A 4MHZA 1ZG8A 1Z03A 2C6GA 2QEX1 1Y1VI 1K732 2V77A 5ELYA 4YWYA 4A3JI 4ZYQA 5CBMA 2EK8A 1M1K2 2BJOA 4E2ZA 3B7IA 3D4UA 1NJI1 4Y7NI 2VUMI 4P44A 4MCQA 4RVFA 3VATA 1SFOI 1IY7A 4BY1I 1Y1VS 2QKDA 2RPRA 4GM5A 1Y0YA 2JBJA 3G71Z 1YUAA 3IO1A 2PJ3A 2RIQA 2V8IA 4NBCA 5FLXb 3H8EA 2PJ7A 3VH9A 2JBKA 1M902 3GTLI 4DYOA 1LAPA 2GREA 2V8GA 3G711 3FKII 1YJWZ 2F7VA 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7L A;  2C6P A;  4DUK A;  3SJF A;  3JRU A;  3SI1 A;  4R7M A;  5LYD A;  3NH5 A;  4MHY A;  1YW4 A;  3KQX A;  3PB7 X;  3FF3 A;  1CPS A;  4NGR A;  2CF4 A;  4DJL A;  1VHO A;  2CTC A;  2AFZ A;  1F2P A;  3S9M A;  5HXD A;  3CPX A;  1CX8 A;  3FEC A;  4X2T A;  1BAV A;  2POK A;  3D7F A;  2BCO A;  3CT9 A;  4IAV A;  3IFE A;  4PXC A;  3CPA A;  5HVG A;  3PEI A;  4UIA A;  1BLL E;  2PJB A;  1NSA A;  3KAS A;  1TKJ A;  4MCS A;  3GB0 A;  5D8N A;  3SI0 A;  4PPZ A;  5F09 A;  2ZEF A;  4ZY2 A;  1BPN A;  1LFW A;  2NYQ A;  2PE3 A;  4RUH A;  2PRQ A;  3S9N A;  1Y7E A;  4JYW A;  5LRG A;  4MHP A;  1ZLH A;  1YLO A;  3PB8 X;  3V7Z A;  1HDQ A;  4FUU A;  4ZX9 A;  3WC7 A;  4F8Z A;  2CTB A;  4A94 A;  1ARL A;  2O4H A;  4PXD A;  3FX6 A;  2ZOG A;  4P6Y A;  1Z2L A;  2GLF A;  3WT4 A;  4JZ0 A;  4ZI6 A;  2AFX A;  1BPM A;  4P4J A;  3IC1 A;  4OC0 A;  1FT7 A;  4NGN A;  4OKO A;  2PJ9 A;  3GUX A;  1HEE A;  1CPX A;  5CPA A;  4CPA A;  3FED A;  2QYV A;  1DTD A;  3MRU A;  3B3V A;  2PJ0 A;  4WJB A;  4R6T A;  2ZEP A;  1FNO A;  3N5F A;  4OP4 A;  1M4L A;  4FAI A;  3LWU A;  2RB7 A;  4R76 A;  2C1C A;  3BI1 A;  1TXR A;  2ANP A;  3ISX A;  5K8N A;  3D66 A;  2WYR A;  3HUV A;  5I4M A;  2PJA A;  3WC6 A;  3SJX A;  1ELL P;  4MCR A;  3VAR A;  5K8O A;  4P4I A;  4H2K A;  1CG2 A;  2AFU A;  3H8F A;  1GYT A;  3GLJ A;  2EWB A;  3PRT A;  3B3C A;  5LYL A;  4NGP A;  2ZEG A;  4P4B A;  1YME A;  1ZG9 A;  2ABZ A;  3KQZ A;  1XMB A;  3D67 A;  2QVP A;  3WAB A;  2NSM A;  2ZEL A;  4MCP A;  5DS0 A;  1HDU A;  4EFD A;  2AFW A;  1PYT B;  1Z8L A;  3D7H A;  4TNU A;  4R8F A;  8CPA A;  2RFH A;  2PVV A;  4KSI A;  5K8P A;  2CIJ A;  2ZOF A;  1XFO A;  1Z5R A;  3NFZ A;  4NJR A;  4ZX8 A;  5JGF A;  1TKH A;  1CP6 A;  3SJE A;  2PJ8 A;  4IHM A;  2O53 A;  4OC2 A;  3FJU A;  1XJO A;  3BI0 A;  5JM6 A;  3NH4 A;  2AFM A;  2Q4Z A;  2IJZ A;  2PJ2 A;  7CPA A;  2ZEN A;  5K8M A;  2HC9 A;  1YW6 A;  3FEE A;  2ZEO A;  1LAM A;  3K2K A;  3SI2 A;  3KR5 A;  1VHE A;  1PCA A;  4A38 A;  1IGB A;  2GU2 A;  4X3R A;  3SJG A;  5HVH A;  2VL1 A;  4TWE A;  2PJ1 A;  3PFE A;  1QMU A;  3KHX A;  4Z65 A;  1TF8 A;  3D68 A;  4OC1 A;  2OOT A;  3L2N A;  3KGQ A;  4OIW A;  4EME A;  2J9A A;  1ARM A;  3PB9 X;  1ELM P;  4B6Z A;  4FWU A;  5LYI A;  2Q43 A;  4NGM A;  4AXV A;  1UWY A;  4OID A;  1ZLI A;  1LOK A;  5IB9 A;  2ZEM A;  1R3N A;  3B3W A;  2ZEH A;  1TF9 A;  2XEF A;  3PBE A;  1ZG7 A;  4ONW A;  4MHN A;  4K3N A;  1VGY A;  2OR4 A;  4UF4 A;  1F57 A;  1VIX A;  3IIB A;  4FBE A;  4O23 A;  4OC4 A;  2F8H A;  3S9L A;  2PJ4 A;  4UIB A;  2C6C A;  2FVG A;  3D7G A;  4A39 A;  3B35 A;  2XEG A;  5D29 A;  3ISZ A;  3PBB A;  4UEF A;  2PJ5 A;  1LAN A;  4NGQ A;  1AYE A;  1F2O A;  3LMS A;  1LCP A;  2JEW A;  4ZY0 A;  4LQG A;  4X8I A;  3WC5 A;  4P45 A;  3RZA A;  3IWW A;  3RAM A;  4EWT A;  1TKF A;  2XEJ A;  2I3C A;  3CDX A;  1OBR A;  2QJ8 A;  2V8V A;  4ZY1 A;  4UEZ A;  4WWV A;  2BOA A;  1RTQ A;  5THW A;  3KR4 A;  3D7D A;  3BHX A;  4F9U A;  2AFS A;  2AFO A;  4OC3 A;  3I1U A;  5J1Q A;  3V38 A;  5HVF A;  5LYF A;  3FVL A;  5LRK A;  4P4D A;  6CPA A;  2ZED A;  4BD9 A;  2PIZ A;  4P10 A;  2IMO A;  4OC5 A;  4A37 A;  3T8W A;  2ZEE A;  4W9Y A;  4IK2 A;  2GLJ A;  1R43 A;  2IQ6 A;  5LRJ A;  2Q51 A;  4NFR A;  4F9V A;  3DGV A;  2PIY A;  4YU9 A;  4P4E A;  3TC8 A;  2EK9 A;  3DLJ A;  3HLP A;  1YSJ A;  1H8L A;  4P4F A;  4MRI A;  3KHZ A;  2HB6 A;  1DE4 C;  3B3S A;  2PVW A;  3K9T A;  4PQA A;  5JH9 A;  1AMP A;  3KL9 A;  2PJC A;  3PB4 X;  4NJQ A;  3RBU A;  1EE3 P;  4NGT A;  4MMO A;  3TX8 A;  3IEH A;  2DEA A;  1XRY A;  4MXU A;  3PB6 X;  4OME A;  1XBU A;  2BO9 A;  4UEE A;  3B3T A;  3PFO A;  1KWM A;  3FH4 A;  1CBX A;  2V8D A;  2PJ6 A;  3NH8 A;  1CP7 A;  3H8G A;  3BXM A;  1JQG A;  3KI9 A;  4PXB A;  2WZN A;  2G9D A;  3IJ3 A;  4NGS A;  2XEI A;  2PCU A;  3NA6 A;  4G1P A;  1QQ9 A;  2V8H A;  3QNV A;  3FMC A;  1Y0R A;  3KZW A;  4Q7A A;  4PXE A;  3MN8 A;  4MHZ A;  1ZG8 A;  2C6G A;  2V77 A;  5ELY A;  4YWY A;  5CBM A;  4ZYQ A;  2EK8 A;  3B7I A;  3D4U A;  4P44 A;  4MCQ A;  3VAT A;  1IY7 A;  4GM5 A;  1Y0Y A;  2JBJ A;  3IO1 A;  2PJ3 A;  3H8E A;  3VH9 A;  2PJ7 A;  2JBK A;  4DYO A;  1LAP A;  2GRE A;  2V8G A;  2F7V A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 5T67 A;  1Q7L A;  1YRE A;  3VB9 A;  3SJF A;  3EXN A;  2Z3O A;  1YJW 1;  1WCM I;  1IB1 E;  3GY9 A;  3JUW A;  4MHY A;  3A9L A;  1VQN 1;  3PB7 X;  2R93 I;  1USP B;  3S9M A;  3SXO A;  1OZP A;  2QR1 B;  3I56 Z;  2RBL A;  1J4J A;  3D7F A;  3GIU A;  4CYQ A;  4MFZ A;  3IFE A;  3CCQ 1;  3R9G A;  4CGM A;  3CPA A;  4E2Y A;  1WII A;  1YX0 A;  4C2Z A;  2OZG A;  5C3E I;  4RI1 A;  1RQF A;  1KQS Z;  2LFU A;  2ZPA A;  4EWC A;  3I55 1;  3MZK B;  3S9N A;  4KLV A;  4JYW A;  1YLO A;  3V7Z A;  4ZX9 A;  1QXF A;  2HV2 A;  2O4H A;  4PXD A;  3FX6 A;  2OH1 A;  1CJW A;  1VQM Z;  3T9Y A;  1M1K 1;  2Z3K A;  2DF5 A;  1M44 A;  4DNC A;  1L0C A;  3GUX A;  1HEE A;  2JA8 I;  1TIQ A;  4II9 A;  1S72 Z;  3D9X A;  3FED A;  2QYV A;  2NVY I;  1DTD A;  3RZD I;  3PO2 I;  3NDJ A;  2D4P A;  1DL6 A;  5AG6 A;  4WJB A;  1K8A 2;  5CM2 M;  2OB0 A;  2R1I A;  2PRB A;  1RO4 A;  2PDO A;  3W91 A;  2VI7 A;  4XPK A;  3TDH B;  2RB7 A;  4R76 A;  1M4I A;  3BI1 A;  1N8R 1;  4F0X A;  4M85 A;  3D66 A;  1ZO0 A;  1PFT A;  3QAY A;  3WC6 A;  1YHQ Z;  3GTM S;  4UBR A;  1QVF Z;  4H2K A;  3CCE Z;  2YNE A;  4P4B A;  1YK3 A;  4OLL A;  2ABZ A;  1XMB A;  2GIV A;  2QVP A;  3WAB A;  2NSM A;  2ZEL A;  4MCP A;  2J6A A;  4A33 A;  2W04 A;  3S6G A;  1HDU A;  1KD1 2;  2AFW A;  4JJX A;  1TFI A;  1VQL Z;  3IWE A;  4B5P B;  4TNU A;  1PUA A;  4KSI A;  1KRL A;  1X3Z A;  1XFO A;  3HOU I;  4CRZ B;  1QSN A;  4BY7 I;  4ZX8 A;  2OOX B;  3BG0 B;  3SJE A;  1YVK A;  3FJU A;  3EY5 A;  1U6M A;  3BI0 A;  4KSA A;  4A3B I;  2REF A;  2LEX A;  2H5M A;  1I50 I;  3FEE A;  2AE6 A;  4E33 A;  2VQY A;  1P0H A;  1YJ9 Z;  3I9S A;  2VL1 A;  3CXS A;  4TWE A;  4NBD A;  1QMU A;  1KUX A;  3CCV Z;  2OOT A;  2R7Z I;  3KGQ A;  2OZH A;  1MJ9 A;  1M90 1;  1YLE A;  1Y7R A;  4FWU A;  4NSQ A;  3IU1 A;  3BLN A;  4OID A;  5F46 A;  5IB9 A;  2ZEM A;  2OTJ Z;  1R3N A;  5F47 A;  3PBE A;  4UF4 A;  4KOR A;  1Z4R A;  3QB8 A;  4FBE A;  3VMI A;  4A3F I;  3VWD A;  3S9L A;  1NP6 A;  4UIB A;  4CRY B;  2QEX Z;  2QML A;  3ISZ A;  3PBB A;  2VBQ A;  3D3S A;  1LAN A;  3JVN A;  5T6B A;  4A31 A;  1FDI A;  4CAW A;  4P45 A;  2JUB A;  1FY7 A;  2XEJ A;  2IL4 A;  2JR6 A;  1VQL 1;  4MFL A;  3DR6 A;  1RO0 A;  5EMI A;  5FLX f;  3H4Q A;  5IB0 A;  1RTQ A;  3KR4 A;  4L89 A;  3QWU A;  1WWZ A;  1YIJ 1;  3CXP A;  3PP9 A;  2JEV A;  1Z8W A;  1X3W A;  5LYF A;  2DE6 A;  4UFX A;  2J8R A;  4AYB A;  1Z4E A;  4BD9 A;  3TE5 B;  3TCV A;  1XF8 A;  2NMT A;  1SQH A;  4K30 A;  1PU9 A;  2IMO A;  3F8K A;  2NVT I;  4CGP A;  1KUY A;  1Z01 A;  1R43 A;  4F9V A;  3DGV A;  4B12 A;  1YJ9 1;  2P6F A;  2DPS A;  4P4E A;  4XX2 A;  1IID A;  3HLP A;  1Q81 2;  1YSJ A;  4B5O A;  1S7N A;  2OTL Z;  2BSW A;  1DE4 C;  3B3S A;  1R9T I;  2PVW A;  5JH9 A;  1AMP A;  5D1O B;  3HOX I;  1KZF A;  1VKC A;  1EE3 P;  2ZW4 A;  4CAF A;  4NEX A;  3D2M A;  4ZBG A;  4HGZ A;  2B3U A;  1XBU A;  2OTJ 1;  1QSR A;  1VQ4 1;  3H5Z A;  3B3T A;  1YJN 1;  3FH4 A;  1CBX A;  1CP7 A;  1JQG A;  3KIF A;  2XEI A;  1P4N A;  3S15 I;  4MJ8 A;  1QSO A;  4M6H A;  1WJ2 A;  1Z8T A;  4Q7A A;  4PXE A;  1ZG8 A;  2QEX 1;  1K73 2;  1MK4 A;  2FSR A;  4YWY A;  4FD4 A;  5CBM A;  2EK8 A;  3GYA A;  2NAP A;  3LD2 A;  2BJO A;  2DXQ A;  1NJI 1;  2VUM I;  3R9F A;  3G71 Z;  1YUA A;  5FLX b;  1BO4 A;  4DYO A;  2V8G A;  1YJW Z;  4AVB A;  1VQN Z;  4E31 A;  3CC7 Z;  4R7M A;  3NH5 A;  5J8C A;  3KQX A;  1S7F A;  5HXD A;  3FEC A;  1CX8 A;  4AG9 A;  2F4M A;  3BG1 B;  3VMH A;  2BCO A;  4BBR I;  2B63 I;  3T4N B;  4A3C I;  1JJ2 Y;  2QIR A;  3PEI A;  1BLL E;  5IX3 A;  3DSB A;  4UCP A;  1NSA A;  3KAS A;  3DNS A;  2AYD A;  1YI2 Z;  3GB0 A;  3SI0 A;  5F09 A;  2ZEF A;  4ZY2 A;  4HPS A;  2NYQ A;  2PE3 A;  1YIT 1;  4A95 A;  2PRQ A;  2YNC A;  2JMO A;  4IUS A;  3M4O I;  4F6A A;  2P28 A;  2QEC A;  4FUU A;  2CNT A;  4F8Z A;  3R95 A;  4QC6 A;  1VQ9 1;  2EUI A;  4PK2 A;  2OTL 1;  1I21 A;  2R7H A;  3IC1 A;  4UWJ A;  3FYN A;  4OKO A;  4CPA A;  2P3Y A;  3CZX A;  1KC8 1;  4AVC A;  1Q86 1;  3MRU A;  3B3V A;  1AUG A;  4RVG A;  2VPZ A;  1M4L A;  4E2W A;  4CS0 B;  4X6A I;  3H3V J;  3NE7 A;  1YQE A;  4QUS A;  5FLM I;  5I4M A;  3NE8 A;  3FB3 A;  2ZXV A;  4P4I A;  2ZW6 A;  3CCL Z;  1RXT A;  1CG2 A;  2AFU A;  1GYT A;  2EWB A;  4HNX B;  3PRT A;  4M3S A;  2Z10 A;  2A4N A;  4I49 A;  2OZK A;  1VHS A;  1N71 A;  3KQZ A;  5DS0 A;  4A3I I;  3CC7 1;  1PYT B;  3K9U A;  1UFH A;  3D7H A;  3CD6 1;  4R8F A;  2RFH A;  4KLW A;  5K8P A;  2ZOF A;  3D2P A;  4Q36 A;  4DGL A;  3CCJ 1;  1Z5R A;  2Z3N A;  1Q2D A;  1TKH A;  2ZAE B;  3G4S Z;  2O53 A;  3MON A;  1ZB8 A;  3VWE A;  5JM6 A;  3W6X A;  3RO0 A;  3S17 I;  3CCU Z;  4MFK A;  2IJZ A;  2PJ2 A;  2JS4 A;  1YI2 1;  4FD5 A;  2ZEN A;  1VQ7 Z;  1WK4 A;  1JWQ A;  5K8M A;  5C44 I;  1Q82 2;  1QVG Y;  1YW6 A;  3CCR 1;  1K8A 1;  2ZEO A;  1VLA A;  2E2H I;  4NF1 A;  3KR5 A;  5A28 A;  2Q7B A;  2AKL A;  3PO3 S;  3MZL B;  1PCA A;  4NCZ A;  3E0K A;  3CCM Z;  4A38 A;  2VZZ A;  2JIP A;  4X3R A;  2I79 A;  2PSW A;  4KOX A;  3PFE A;  4C2Y A;  2BEI A;  3CXC Z;  2VF1 A;  4Z65 A;  3FBU A;  4KOT A;  3D68 A;  1XIX A;  4OIW A;  3S1N I;  1I12 A;  2B4D A;  5AN9 F;  3PB9 X;  3I4N I;  5H84 A;  3GTO I;  4ORF A;  1K83 I;  1ZLI A;  5H86 A;  4XPL A;  3TE4 A;  1KD1 1;  2O28 A;  5IV0 A;  2Q4V A;  1TF9 A;  2XEF A;  1RNI A;  1Y1W I;  4MHN A;  3CC4 1;  4L8A A;  4YFJ A;  2ARH A;  4O23 A;  4MFJ A;  3P5J B;  4Y52 I;  2PJ4 A;  4MY3 A;  1Z9U A;  2C6C A;  3D7G A;  2G2K A;  4MON A;  1K9M 2;  3EFA A;  3CCL 1;  4A2Z A;  4UEF A;  4HKF A;  4OAE A;  1S7M A;  4NBF A;  3LMS A;  3GCF A;  2JEW A;  1ZH1 A;  1W2B Y;  3WC5 A;  2G3A A;  4EWT A;  2Q7S A;  3I07 A;  3CXQ A;  2NVX I;  1OBR A;  4E8O A;  3KIH A;  2JDD A;  1YIJ Z;  3D7D A;  1N8R 2;  1S5K A;  1S7L A;  5AG5 A;  2VPX A;  4CGL A;  3D2L A;  5J1Q A;  3BJ7 A;  3G4S 1;  5T64 A;  4MI4 A;  5HVF A;  2IZ4 A;  3T90 A;  3FVL A;  5LRK A;  2R6M A;  3FQQ A;  4PSX A;  2ZED A;  3FQM A;  3CCU 1;  4P10 A;  3S2H I;  1VQP 1;  1VQ7 1;  1M1D A;  5A27 A;  2FL4 A;  2REE A;  5C4X I;  2IQ6 A;  3CCM 1;  2Q51 A;  4AB7 A;  2VPW A;  4C2X A;  1NE9 A;  3JAM f;  3DLJ A;  3VTN A;  2YND A;  4ZGY B;  4P4F A;  4NJQ A;  1TWC I;  3RBU A;  1Z02 A;  1Q7Y 2;  3N7Z A;  4A3D I;  4MXU A;  1VQ4 Z;  5A2Q f;  1YJN Z;  1S7K A;  3BJ8 A;  2EVN A;  5E96 A;  3UY5 A;  2V8D A;  2WZN A;  2G9D A;  3IJ3 A;  2Y0M A;  2CNM A;  4H6U A;  2W03 A;  1NUI A;  3IX0 A;  1QQ9 A;  2V8H A;  3M3Y I;  3KZW A;  3C26 A;  3CQZ I;  2QRC B;  2C6G A;  4GS4 A;  5G21 A;  5ELY A;  4F0Y A;  3D4U A;  4Y7N I;  2K5T A;  4RVF A;  1SFO I;  1IY7 A;  1Y1V S;  2QKD A;  1Y0Y A;  2PR8 A;  4KUB A;  2BUE A;  2RIQ A;  4HNW B;  1B87 A;  4NBC A;  1M90 2;  1IYK A;  4MFQ A;  1M4G A;  1ML8 A;  3JRU A;  3SI1 A;  5LYD A;  3I4M I;  1YW4 A;  3FF3 A;  1CPS A;  5HMN A;  1VHO A;  2CTC A;  1F2P A;  3CPX A;  5DWN A;  3CMA 1;  1BAV A;  1VQ5 1;  4X2T A;  1Q81 1;  2QA4 1;  5I0C A;  3CT9 A;  2Q04 A;  5HVG A;  2GAN A;  5IT9 f;  2EO8 A;  1TKJ A;  1Y9W A;  4MCS A;  1GHE A;  1YIT Z;  1RO5 A;  3JAM b;  1LQL A;  4RUH A;  5LRG A;  5LL6 f;  4MHP A;  1SIW A;  3PB8 X;  1VQ9 Z;  1HDQ A;  2D4O A;  3TOB A;  2V8K A;  3WC7 A;  3PGP A;  1IIC A;  2CTB A;  3TO7 A;  4A94 A;  1ARL A;  1FDO A;  2G3T A;  1VQ8 Z;  1VQ6 Z;  2GLF A;  1K73 1;  3WT4 A;  5A2Q b;  4ZI6 A;  1BPM A;  2JIO A;  2JA6 I;  4P4J A;  3S14 I;  3CME Z;  4OC0 A;  4XNH B;  4UWI A;  1FT7 A;  4NGN A;  3JTK A;  3F0A A;  4JXR A;  5CPA A;  5FVJ A;  4KSF A;  2OOY B;  2PJ0 A;  2ZEP A;  3N5F A;  3QAH A;  4OP4 A;  1NSL A;  3P2F A;  1QST A;  2C1C A;  2JIQ A;  1KQS Y;  1TXR A;  2ANP A;  3ISX A;  2WYR A;  3HUV A;  4Y49 B;  2JIM A;  4MD7 A;  5EC4 A;  2PJA A;  2JDC A;  2AJ6 A;  5C82 A;  4MCR A;  3VAR A;  4A3K I;  4NBB A;  3H8F A;  1I1D A;  3GLJ A;  4NBH A;  4B14 A;  5LYL A;  5AGE A;  1YME A;  4CYO A;  4DQY B;  3D67 A;  1P9N A;  1VQO Z;  2JNY A;  4UA3 A;  2GTI A;  3TFY A;  1MJA A;  3CD6 Z;  3S2D I;  1X10 A;  1Z8L A;  2V45 A;  3GTK I;  1LRZ A;  4QBJ A;  4R3L A;  3CCJ Z;  2B4B A;  8CPA A;  5IT9 b;  4AVA A;  1CP6 A;  2H85 A;  2PJ8 A;  4IHM A;  3G6E Z;  2NVQ I;  4BIN A;  1XJO A;  3NH4 A;  2AFM A;  4H89 A;  2Q4Z A;  1Y9K A;  3CCR Z;  4GXH A;  7CPA A;  1CM0 A;  3PO3 I;  2HC9 A;  1QVF Y;  4QVT A;  2HUZ A;  3Q87 A;  3SI2 A;  3G3S A;  4RS4 A;  4U9Y A;  1RO2 A;  4RS2 A;  2QRD B;  1WZN A;  2GU2 A;  3D8P A;  4QTU A;  1VQ8 1;  1VQ6 1;  2B4D B;  4OC1 A;  3CME 1;  4KUA A;  4HNY B;  4CYN A;  4EME A;  2J9A A;  1ARM A;  2CXA A;  3S1M I;  1IU8 A;  5LYI A;  4A93 I;  2Q43 A;  4NGM A;  4AXV A;  2G0B A;  3RZO I;  1LOK A;  4AG7 A;  3HKZ A;  5CNP A;  3B3W A;  2ZEH A;  4JWP A;  3CC4 Z;  2J8M A;  1ZG7 A;  4ONW A;  2RT9 A;  3GTM I;  1NMT A;  2ODF A;  2OR4 A;  1VIX A;  4OC4 A;  4KOS A;  2F8H A;  3W6S A;  3B8G A;  1QSM A;  4UFW A;  4KZT A;  4Q38 A;  4CYP A;  2E2J I;  2HF1 A;  3TOA A;  3OW2 Y;  3S1R I;  2KPI A;  5D29 A;  3TO9 A;  2E2I I;  5JQ4 A;  2WUU A;  4EVY A;  2PJ5 A;  3R9E A;  4E2X A;  3TO6 A;  1AYE A;  2V8J A;  3LOD A;  3U50 C;  3EER A;  4MHD A;  4LQG A;  1VQO 1;  4X8I A;  1Q82 1;  3RAM A;  1KC8 2;  1Q86 2;  3ESW A;  1BOB A;  5AG4 A;  3IU2 A;  2FS5 A;  4KOV A;  2KCW A;  2QJ8 A;  2B3V A;  2QLV B;  4UEZ A;  2K3R A;  2PR1 A;  2BOA A;  2KI7 B;  5THW A;  1YVO A;  3MGD A;  4F9U A;  2GTH A;  4UCN A;  2AFO A;  4KS9 A;  4XPD B;  3I1U A;  4NB8 A;  3V38 A;  4QB9 A;  3G6E 1;  4HGY A;  4BBS I;  4CL1 A;  1VQP Z;  2M48 A;  2Z3P A;  3H0G I;  2PIZ A;  3J80 f;  2YU9 I;  5HH1 A;  2B5G A;  2Z3M A;  2DE5 A;  2YAD A;  4OC5 A;  2J8N A;  4MBU A;  3F5B A;  3I3G A;  3T8W A;  1TWF I;  2ZEE A;  1M4D A;  2FXF A;  5G22 A;  2FCK A;  3S1Q I;  5LRJ A;  1Q2Y A;  4NFR A;  2IV2 X;  2WAQ A;  2Q4Y A;  3K7A I;  4E30 A;  4C7H A;  4A3M I;  5ISV A;  3WR7 A;  4HH4 A;  2QRE B;  3G8W A;  4RVH A;  2HU9 A;  4MRI A;  2HB6 A;  1B6B A;  3F3P C;  1K9M 1;  3K9T A;  3IGR A;  3PB4 X;  3CPW Y;  2DEA A;  2CY2 A;  3PB6 X;  4OME A;  1S3Z A;  1QF8 A;  1XMT A;  3FRM A;  4UEE A;  3EC4 A;  3OWC A;  2ZW7 A;  3CCS 1;  3BXM A;  4CGO A;  1JJ2 Z;  4NOZ A;  3FMC A;  1VQK 1;  2EBJ A;  2E9H A;  4NH1 C;  2Q0Y A;  2V3V A;  3R1K A;  1Y1V I;  2V77 A;  4M6G A;  3KKW A;  4ZYQ A;  1M1K 2;  4R57 A;  4E2Z A;  3B7I A;  2Z11 A;  4RN7 A;  4B10 A;  2CNS A;  4MCQ A;  4GM5 A;  3FNC A;  2V8I A;  3H8E A;  2PJ7 A;  3GTL I;  3LAC A;  2F7V A;  3B2Y A;  4B13 A;  2C6P A;  4DUK A;  4KVX A;  2YGW A;  4DK1 A;  4LX9 A;  4NGR A;  2CF4 A;  4DJL A;  3GKQ A;  3CMA Z;  1VQ5 Z;  1X0T A;  2AFZ A;  4S1T A;  1USP A;  2DE7 A;  4NBG A;  2QA4 Z;  3J80 b;  3P2H A;  2VZY A;  2POK A;  4CAX A;  1Q2C A;  4A32 A;  1RLY A;  4IAV A;  2VUG A;  4PXC A;  3I56 1;  4UIA A;  2PJB A;  3S16 I;  1Q7Y 1;  3IR7 A;  4R87 A;  3IF8 A;  1IOF A;  5G20 A;  5D8N A;  1K4J A;  4PPZ A;  2P0W A;  1BPN A;  1LFW A;  4JLY A;  2YNC C;  4U5Y A;  1Y7E A;  2PK7 A;  4ONU A;  4M6I A;  1ZLH A;  1XEB A;  2M6N A;  3OW2 Z;  2PMZ A;  2ZOG A;  4P6Y A;  3HOZ I;  2ZW5 A;  1Z2L A;  4JZ0 A;  2AFX A;  2P6G A;  3CC2 Z;  1VQM 1;  4XNH C;  2PJ9 A;  3D6W A;  5IP9 I;  2OZU A;  1CPX A;  4B11 A;  2JA5 I;  5EBV A;  1ON0 A;  3FIX A;  1S72 1;  4R6T A;  1FNO A;  1S60 A;  2GE3 A;  4PK3 A;  4FAI A;  3LWU A;  4MD9 A;  1V0C A;  1TWA I;  3HOV I;  5F49 A;  2RHB A;  5IP7 I;  5K8N A;  4NBA A;  4YRH A;  4Y49 C;  5G1Z A;  2Z0Z A;  3SJX A;  1ELL P;  1QVG Z;  5K8O A;  1YHQ 1;  5J8F A;  3CCE 1;  1ZB9 A;  3B3C A;  4NGP A;  2ZEG A;  1ZG9 A;  3R96 A;  2Q44 A;  3TTH A;  2JLM A;  4EFD A;  3RYO A;  3V8I A;  2R98 A;  4LUA A;  2K5R A;  3S6K A;  4C68 A;  1A2Z A;  2PVV A;  1JWH C;  2CIJ A;  4KOU A;  4B5P A;  1IOI A;  4KVO E;  3NFZ A;  4MD8 A;  3CPW Z;  2BL1 A;  4NJR A;  5JGF A;  3EO4 A;  3LUS A;  1YGH A;  4OC2 A;  4A3L I;  2F4O A;  4RV9 A;  3S6F A;  1IYL A;  2IZ3 A;  1Y8C A;  2OU2 A;  2Z3L A;  1I3Q I;  1LAM A;  3K2K A;  1WW9 A;  4MY0 A;  1VHE A;  3GTP I;  1IGB A;  1AA6 A;  3GTG I;  3SJG A;  2FT0 A;  5HVH A;  2PJ1 A;  4UCM A;  4KOW A;  3J7A 4;  3KHX A;  2LIY A;  1TF8 A;  5C4J I;  2FIA A;  1W2B Z;  2DPT A;  3CC2 1;  3L2N A;  3NDI A;  3CCV 1;  4KVM E;  1ELM P;  5DWM A;  4B6Z A;  3DR8 A;  2X7B A;  3J81 f;  4E2A A;  1UWY A;  4RVD A;  2PC1 A;  1R57 A;  2FIW A;  4CAV A;  1XOV A;  4K3N A;  4A3E I;  3GTQ I;  4C7I A;  1VGY A;  1F57 A;  1KUV A;  3IIB A;  4R9M A;  4BBH A;  2ATR A;  1Z8X A;  5D1P A;  2FVG A;  5KTC A;  4A39 A;  3B35 A;  2XEG A;  4J3G A;  4A3G I;  4E32 A;  4NGQ A;  4PSW A;  4JD6 A;  5F48 A;  2WPW A;  3RNZ A;  2EGT A;  1TWG I;  1F2O A;  3CXC Y;  1LCP A;  4ZY0 A;  3IFU A;  2JA7 I;  1X12 A;  3TT2 A;  4PV6 A;  3RZA A;  3IWW A;  2HQY A;  4MFP A;  1TKF A;  4R3K A;  2F5I A;  4NXY A;  2I3C A;  3CDX A;  4CAE A;  2PM9 A;  2V8V A;  3ZZI A;  4ZY1 A;  3SXN A;  3PZJ A;  4WWV A;  3DDD A;  2PQ8 A;  1YR0 A;  1Q16 A;  3BHX A;  2JIR A;  1L1O C;  2AFS A;  3HOW I;  4OC3 A;  4XPD C;  2WB1 A;  2VPY A;  4LQ6 A;  4OAD A;  5KTA A;  3CCQ Z;  1NJI 2;  3GKR A;  4P4D A;  2B5G B;  4BMH A;  6CPA A;  1N2F A;  5JPH A;  2WSA A;  4U9Z A;  4BXX I;  2Y0S A;  4NB9 A;  3I55 Z;  4YGO A;  2C27 A;  4A37 A;  5AG7 A;  4W9Y A;  4IK2 A;  4FD6 A;  2GLJ A;  2I00 A;  3HOY I;  2PIY A;  2R92 I;  3FXT A;  4NBE A;  2R8V A;  4YU9 A;  3TC8 A;  2EK9 A;  2RC4 A;  4X5K A;  3J81 b;  1H8L A;  4UFV A;  1TWH I;  4KOY A;  1YUK A;  3VMG A;  3KHZ A;  3SHP A;  3EED A;  4CGN A;  1QYP A;  4PQA A;  3KL9 A;  3S6H A;  2PJC A;  4MH4 A;  4NGT A;  4MMO A;  3TX8 A;  3IEH A;  5D1O A;  2E7Z A;  1MJB A;  1XRY A;  2FE7 A;  4A30 A;  3GTJ I;  4IF5 A;  2BO9 A;  2P6E A;  3CCS Z;  4QTT A;  2VEZ A;  2VXK A;  3PFO A;  1KWM A;  4JXQ A;  2PJ6 A;  3NH8 A;  3H8G A;  3KI9 A;  1VQK Z;  4PXB A;  1I6H I;  4NGS A;  2PCU A;  5GCN A;  4G1P A;  3NA6 A;  4E0A A;  3QNV A;  3F3F C;  1Y0R A;  2WPX A;  3MN8 A;  4MHZ A;  1Z03 A;  3ZJ0 A;  5KTD A;  4A3J I;  3IWG A;  4P44 A;  5BWA B;  4FD7 A;  3VAT A;  4BY1 I;  2RPR A;  2JBJ A;  3IO1 A;  2PJ3 A;  3VH9 A;  2JBK A;  2GFQ A;  5C88 A;  1LAP A;  2GRE A;  3G71 1;  3FKI I;  1XE4 A;  2B58 A;  4H6Z A; 
#chains in the Genus database with same CATH homology
 5T67 A;  1VQN Z;  1Q7L A;  2C6P A;  4DUK A;  3VB9 A;  4E31 A;  3JRU A;  3SI1 A;  3SJF A;  3CC7 Z;  4R7M A;  1YJW 1;  5LYD A;  1WCM I;  3NH5 A;  3I4M I;  1YW4 A;  4MHY A;  1VQN 1;  3KQX A;  3PB7 X;  4DK1 A;  3FF3 A;  1CPS A;  4NGR A;  2R93 I;  1USP B;  2CF4 A;  4DJL A;  3GKQ A;  3CMA Z;  1VQ5 Z;  1X0T A;  1VHO A;  2CTC A;  2AFZ A;  1F2P A;  4S1T A;  3S9M A;  1USP A;  2DE7 A;  5HXD A;  4NBG A;  2QA4 Z;  3CPX A;  1CX8 A;  3FEC A;  3CMA 1;  1BAV A;  1VQ5 1;  3J80 b;  4X2T A;  1Q81 1;  2POK A;  2F4M A;  1RLY A;  2QR1 B;  3BG1 B;  2RBL A;  3I56 Z;  2QA4 1;  3VMH A;  3D7F A;  2BCO A;  3CT9 A;  4BBR I;  2VUG A;  3CCQ 1;  2B63 I;  3IFE A;  4IAV A;  4PXC A;  3CPA A;  3T4N B;  4A3C I;  4E2Y A;  1JJ2 Y;  5HVG A;  3B2Y A;  3I56 1;  3PEI A;  1WII A;  4UIA A;  1BLL E;  5C3E I;  2PJB A;  3S16 I;  1NSA A;  3KAS A;  5IT9 f;  1Q7Y 1;  1TKJ A;  1RQF A;  4MCS A;  1KQS Z;  3IF8 A;  1YI2 Z;  3GB0 A;  2LFU A;  4EWC A;  5D8N A;  1YIT Z;  3I55 1;  4PPZ A;  3SI0 A;  5F09 A;  2ZEF A;  3JAM b;  4ZY2 A;  1LQL A;  1BPN A;  1LFW A;  2NYQ A;  3MZK B;  2PE3 A;  1YIT 1;  4RUH A;  2PRQ A;  3S9N A;  1Y7E A;  4JYW A;  2PK7 A;  5LRG A;  2JMO A;  5LL6 f;  3M4O I;  1ZLH A;  4MHP A;  1YLO A;  3PB8 X;  3V7Z A;  1VQ9 Z;  1HDQ A;  2P28 A;  4FUU A;  2V8K A;  4ZX9 A;  3WC7 A;  4F8Z A;  2CTB A;  2M6N A;  3OW2 Z;  1ARL A;  1VQ9 1;  4A94 A;  2O4H A;  4PXD A;  2PMZ A;  3FX6 A;  2ZOG A;  4P6Y A;  1VQ8 Z;  3HOZ I;  1VQ6 Z;  1Z2L A;  2GLF A;  1K73 1;  2OTL 1;  3WT4 A;  5A2Q b;  1VQM Z;  4JZ0 A;  2AFX A;  4ZI6 A;  1M1K 1;  1BPM A;  2JA6 I;  3CC2 Z;  4P4J A;  3S14 I;  3IC1 A;  3CME Z;  4OC0 A;  1VQM 1;  1FT7 A;  4NGN A;  4OKO A;  2PJ9 A;  3D6W A;  5IP9 I;  1HEE A;  3GUX A;  2JA8 I;  1CPX A;  5CPA A;  1S72 Z;  3D9X A;  2JA5 I;  4CPA A;  3FED A;  2QYV A;  2NVY I;  2P3Y A;  1DTD A;  3RZD I;  3PO2 I;  1KC8 1;  2OOY B;  1Q86 1;  3MRU A;  3NDJ A;  1DL6 A;  3B3V A;  2PJ0 A;  4WJB A;  1S72 1;  4R6T A;  4RVG A;  1K8A 2;  2ZEP A;  1FNO A;  5CM2 M;  3N5F A;  4OP4 A;  1M4L A;  4FAI A;  4E2W A;  1RO4 A;  3LWU A;  4X6A I;  4MD9 A;  3TDH B;  2RB7 A;  3H3V J;  4R76 A;  1TWA I;  2C1C A;  1KQS Y;  3HOV I;  1N8R 1;  1TXR A;  3BI1 A;  2ANP A;  3ISX A;  2RHB A;  5IP7 I;  5FLM I;  5K8N A;  3D66 A;  4NBA A;  2WYR A;  3HUV A;  4MD7 A;  5I4M A;  1PFT A;  2PJA A;  3WC6 A;  3SJX A;  1YHQ Z;  1ELL P;  3GTM S;  4MCR A;  3VAR A;  4A3K I;  1QVG Z;  1QVF Z;  5K8O A;  4P4I A;  4H2K A;  3CCE Z;  3CCL Z;  1YHQ 1;  1CG2 A;  4NBB A;  2AFU A;  3H8F A;  3CCE 1;  1GYT A;  3GLJ A;  2EWB A;  1ZB9 A;  3PRT A;  4NBH A;  3B3C A;  5LYL A;  4NGP A;  2ZEG A;  4P4B A;  1YME A;  1ZG9 A;  2ABZ A;  2OZK A;  3KQZ A;  4DQY B;  1XMB A;  3D67 A;  2QVP A;  3WAB A;  1P9N A;  1VQO Z;  2JNY A;  2NSM A;  2ZEL A;  4MCP A;  2GTI A;  5DS0 A;  2J6A A;  2W04 A;  1HDU A;  1KD1 2;  4EFD A;  4A3I I;  2AFW A;  3CC7 1;  3CD6 Z;  1PYT B;  3S2D I;  1TFI A;  1VQL Z;  1Z8L A;  3GTK I;  2K5R A;  3D7H A;  3CD6 1;  4TNU A;  3CCJ Z;  4R8F A;  8CPA A;  2RFH A;  2PVV A;  4KSI A;  1JWH C;  5K8P A;  1KRL A;  2CIJ A;  2ZOF A;  1X3Z A;  5IT9 b;  1XFO A;  4DGL A;  3CCJ 1;  3HOU I;  1Z5R A;  3NFZ A;  4MD8 A;  3CPW Z;  4BY7 I;  4NJR A;  4ZX8 A;  5JGF A;  1TKH A;  2OOX B;  1CP6 A;  2H85 A;  2ZAE B;  3BG0 B;  3SJE A;  2PJ8 A;  4IHM A;  3G4S Z;  3LUS A;  2O53 A;  3G6E Z;  2NVQ I;  4OC2 A;  3FJU A;  3MON A;  1XJO A;  3BI0 A;  1ZB8 A;  5JM6 A;  4A3B I;  3NH4 A;  4A3L I;  2AFM A;  2F4O A;  3S17 I;  3CCU Z;  2Q4Z A;  2IJZ A;  2PJ2 A;  4RV9 A;  3CCR Z;  2JS4 A;  7CPA A;  1YI2 1;  2ZEN A;  1VQ7 Z;  3PO3 I;  5K8M A;  2IZ3 A;  2HC9 A;  1I50 I;  5C44 I;  1Q82 2;  1QVG Y;  1QVF Y;  1YW6 A;  3FEE A;  1I3Q I;  3CCR 1;  1K8A 1;  2ZEO A;  1VLA A;  2E2H I;  1LAM A;  3K2K A;  3Q87 A;  3SI2 A;  3KR5 A;  1WW9 A;  2AKL A;  4RS4 A;  3PO3 S;  1RO2 A;  3MZL B;  1VHE A;  1PCA A;  4A38 A;  4E33 A;  3CCM Z;  2QRD B;  3GTP I;  1IGB A;  2GU2 A;  4X3R A;  3GTG I;  1YJ9 Z;  3SJG A;  5HVH A;  2VL1 A;  4QTU A;  4TWE A;  2PJ1 A;  3PFE A;  4NBD A;  3J7A 4;  1QMU A;  3KHX A;  1VQ8 1;  3CXC Z;  2VF1 A;  1VQ6 1;  4Z65 A;  2LIY A;  1TF8 A;  5C4J I;  1W2B Z;  3CCV Z;  3D68 A;  4OC1 A;  2OOT A;  3CC2 1;  2R7Z I;  3L2N A;  3NDI A;  3CME 1;  3KGQ A;  4OIW A;  3S1N I;  4EME A;  3CCV 1;  2J9A A;  1ARM A;  5AN9 F;  3PB9 X;  1ELM P;  4B6Z A;  1M90 1;  3S1M I;  4FWU A;  5LYI A;  3I4N I;  4A93 I;  2Q43 A;  4NGM A;  3J81 f;  3GTO I;  4AXV A;  1K83 I;  4RVD A;  1UWY A;  1ZLI A;  4OID A;  3RZO I;  1LOK A;  3HKZ A;  5IB9 A;  1KD1 1;  2ZEM A;  2OTJ Z;  1R3N A;  3B3W A;  2ZEH A;  3CC4 Z;  1TF9 A;  2XEF A;  3PBE A;  1ZG7 A;  1RNI A;  4ONW A;  1Y1W I;  2RT9 A;  3GTM I;  4K3N A;  4A3E I;  4MHN A;  3GTQ I;  1VGY A;  2OR4 A;  3CC4 1;  4UF4 A;  1F57 A;  1VIX A;  3IIB A;  4FBE A;  3VMI A;  4O23 A;  4A3F I;  3P5J B;  4OC4 A;  4Y52 I;  2F8H A;  3S9L A;  1NP6 A;  2PJ4 A;  4UIB A;  5D1P A;  2QEX Z;  2C6C A;  2E2J I;  2HF1 A;  2G2K A;  4MON A;  2FVG A;  3D7G A;  1K9M 2;  4A39 A;  3OW2 Y;  3B35 A;  3S1R I;  3CCL 1;  2KPI A;  2XEG A;  5D29 A;  2E2I I;  3ISZ A;  3PBB A;  4UEF A;  2PJ5 A;  4A3G I;  4E32 A;  1LAN A;  1S7M A;  4NGQ A;  4E2X A;  1AYE A;  4NBF A;  2V8J A;  2EGT A;  5T6B A;  1TWG I;  1F2O A;  3CXC Y;  3LMS A;  3U50 C;  3GCF A;  1LCP A;  1ZH1 A;  3EER A;  2JEW A;  4ZY0 A;  1W2B Y;  4LQG A;  3IFU A;  1VQO 1;  2JA7 I;  4X8I A;  1Q82 1;  3WC5 A;  4P45 A;  2JUB A;  3RZA A;  3IWW A;  3RAM A;  1KC8 2;  1TKF A;  1Q86 2;  3ESW A;  3I07 A;  4EWT A;  2XEJ A;  2NVX I;  2JR6 A;  1VQL 1;  2I3C A;  3CDX A;  2PM9 A;  1OBR A;  1RO0 A;  2QJ8 A;  2V8V A;  5FLX f;  2QLV B;  3KIH A;  4UEZ A;  2K3R A;  4ZY1 A;  4WWV A;  2BOA A;  1RTQ A;  2KI7 B;  5THW A;  1YIJ Z;  3KR4 A;  3D7D A;  1N8R 2;  3BHX A;  4F9U A;  3QWU A;  1L1O C;  2GTH A;  2AFS A;  2AFO A;  3HOW I;  1YIJ 1;  3I1U A;  4OC3 A;  2WB1 A;  4NB8 A;  5J1Q A;  3V38 A;  3G4S 1;  5T64 A;  5HVF A;  3CCQ Z;  2IZ4 A;  3G6E 1;  1X3W A;  4HGY A;  5LYF A;  1NJI 2;  4BBS I;  4CL1 A;  3FVL A;  5LRK A;  2R6M A;  2DE6 A;  4P4D A;  1VQP Z;  4AYB A;  6CPA A;  1N2F A;  2M48 A;  3FQQ A;  2ZED A;  3FQM A;  4BD9 A;  3H0G I;  3CCU 1;  2PIZ A;  3J80 f;  4P10 A;  3TE5 B;  2YU9 I;  3S2H I;  4BXX I;  1VQP 1;  2Y0S A;  4NB9 A;  1VQ7 1;  2DE5 A;  3I55 Z;  2YAD A;  2IMO A;  4OC5 A;  4A37 A;  3T8W A;  2NVT I;  1TWF I;  2ZEE A;  4W9Y A;  5C4X I;  4IK2 A;  2GLJ A;  1Z01 A;  3S1Q I;  1R43 A;  2IQ6 A;  3CCM 1;  5LRJ A;  2Q51 A;  3HOY I;  4NFR A;  4F9V A;  3DGV A;  1YJ9 1;  2WAQ A;  2PIY A;  2R92 I;  4NBE A;  4YU9 A;  4P4E A;  3K7A I;  4XX2 A;  4E30 A;  3JAM f;  2EK9 A;  3TC8 A;  3DLJ A;  4A3M I;  3HLP A;  3VTN A;  1Q81 2;  1YSJ A;  3J81 b;  1H8L A;  4HH4 A;  1TWH I;  2QRE B;  4P4F A;  4RVH A;  1YUK A;  2OTL Z;  2HU9 A;  4MRI A;  3VMG A;  2HB6 A;  3KHZ A;  3F3P C;  1K9M 1;  1DE4 C;  3B3S A;  1R9T I;  2PVW A;  3K9T A;  3EED A;  1QYP A;  4PQA A;  5JH9 A;  1AMP A;  5D1O B;  2PJC A;  3HOX I;  3KL9 A;  1TWC I;  3PB4 X;  4NJQ A;  4MH4 A;  3CPW Y;  3RBU A;  1Z02 A;  1EE3 P;  4NGT A;  4MMO A;  3TX8 A;  3IEH A;  5D1O A;  1Q7Y 2;  2DEA A;  1XRY A;  4HGZ A;  4MXU A;  4A3D I;  3PB6 X;  3GTJ I;  1VQ4 Z;  4OME A;  5A2Q f;  1QF8 A;  1XBU A;  1YJN Z;  2BO9 A;  3CCS Z;  2OTJ 1;  4QTT A;  1VQ4 1;  4UEE A;  3B3T A;  3PFO A;  1YJN 1;  1KWM A;  3FH4 A;  1CBX A;  2V8D A;  3CCS 1;  2PJ6 A;  3NH8 A;  1CP7 A;  3H8G A;  3BXM A;  1JQG A;  1VQK Z;  3KI9 A;  2WZN A;  2G9D A;  3KIF A;  3IJ3 A;  4PXB A;  1I6H I;  4NGS A;  2XEI A;  2PCU A;  2W03 A;  1JJ2 Z;  3NA6 A;  4G1P A;  1NUI A;  3IX0 A;  3S15 I;  1QQ9 A;  2V8H A;  3QNV A;  4NOZ A;  3M3Y I;  3FMC A;  3F3F C;  1VQK 1;  1Y0R A;  3KZW A;  2E9H A;  3CQZ I;  4NH1 C;  4Q7A A;  4PXE A;  2QRC B;  3MN8 A;  4MHZ A;  1ZG8 A;  1Z03 A;  2C6G A;  2QEX 1;  1Y1V I;  1K73 2;  2V77 A;  5ELY A;  4YWY A;  4A3J I;  4ZYQ A;  5CBM A;  2EK8 A;  1M1K 2;  2BJO A;  4E2Z A;  3B7I A;  3D4U A;  1NJI 1;  4Y7N I;  2VUM I;  4P44 A;  4MCQ A;  4RVF A;  3VAT A;  1SFO I;  1IY7 A;  4BY1 I;  1Y1V S;  2QKD A;  2RPR A;  4GM5 A;  1Y0Y A;  2JBJ A;  3G71 Z;  1YUA A;  3IO1 A;  2PJ3 A;  2RIQ A;  2V8I A;  4NBC A;  5FLX b;  3H8E A;  2PJ7 A;  3VH9 A;  2JBK A;  1M90 2;  3GTL I;  4DYO A;  1LAP A;  2GRE A;  2V8G A;  3G71 1;  3FKI I;  1YJW Z;  2F7V A;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...