2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
b'EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
4P10A 2C6GA 4NGMA 4YWYA 1Z8LA 1AMPA 4WWVA 2PJBA 4AXVA 1LCPA 1TXRA 3SI2A 4MCRA 2ZEPA 4EMEA 2V8VA 3KZWA 4CPAA 1M4LA 2CTCA 4PQAA 1R43A 2BOAA 2EK8A 2GU2A 2NSMA 4UIBA 3D7HA 3GUXA 4F9UA 1LAPA 2CF4A 4P44A 1HEEA 5D29A 1ZG9A 3DGVA 5HVFA 4IHMA 5CPAA 1YSJA 2AFOA 4FUUA 4NGPA 2RFHA 8CPAA 3FVLA 3WT4A 3V38A 3BI1A 4NGTA 4Q7AA 3FECA 2I3CA 1BLLE 5LRJA 1CP7A 4X2TA 1CX8A 2QJ8A 2ZOFA 1Y7EA 4MCSA 4MHPA 3FEEA 1XBUA 3GB0A 1UWYA 1YMEA 2ZENA 2AFUA 3K2KA 3LWUA 4NGNA 2F7VA 4JYWA 5HVGA 4OC5A 3VH9A 1ZLHA 5ELYA 2PJ6A 1FNOA 1CG2A 2ZOGA 4MRIA 3SJGA 3D7DA 1F2OA 1ZLIA 3B3SA 4BD9A 2GLJA 4P4FA 2XEFA 1RTQA 3S9NA 4OC1A 1R3NA 1F57A 4ZX9A 2PVWA 2NYQA 4OKOA 2OOTA 3D4UA 2Q43A 3CPAA 2JBKA 3SI0A 3VATA 2QVPA 3V7ZA 2ZEHA 4B6ZA 4MHNA 1VIXA 5K8PA 1LANA 3IIBA 2RB7A 2WYRA 4P4IA 1ZG8A 4MHYA 3IJ3A 1GYTA 1CP6A 3B3VA 2PJ4A 2PJCA 3D67A 2Q51A 1ELLP 4P6YA 4R7MA 2ZEGA 3D7FA 4PPZA 3RZAA 3PB6X 3QNVA 4UIAA 3BHXA 3FEDA 2C6PA 4EWTA 1OBRA 4PXDA 1ARMA 4P4JA 4FAIA 4YU9A 4MCPA 5D8NA 2XEGA 2PE3A 2PJ8A 2PJ9A 2IJZA 2POKA 3H8EA 1FT7A 2PIZA 4P45A 3SJEA 4NGQA 2V8GA 4GM5A 1PYTB 2PIYA 5DS0A 3D66A 4UEZA 3T8WA 3PRTA 3KHZA 4X3RA 2IMOA 2HC9A 5JM6A 3IC1A 4K3NA 4MCQA 4ZY2A 3BXMA 5J1QA 2PJAA 4DJLA 3NH4A 3RAMA 3SI1A 2PJ5A 4KSIA 2ZEMA 2JBJA 3N5FA 4OIWA 4TWEA 4NJQA 1KWMA 4MMOA 2WZNA 1YLOA 2PCUA 1Y0RA 4ZI6A 2OR4A 2BO9A 4DUKA 3D7GA 1XMBA 4ONWA 2PJ2A 1Z5RA 3IEHA 1VGYA 3KL9A 4A94A 3FF3A 1TKFA 4EFDA 7CPAA 5IB9A 2PVVA 4NJRA 3KR4A 2AFXA 4TNUA 1LFWA 4O23A 3PFEA 2ABZA 1ZG7A 1XRYA 4A39A 2V8DA 4FBEA 5CBMA 4MXUA 2GLFA 3B35A 3WC7A 1HDUA 2PJ1A 1BPNA 3KQZA 1CPXA 3L2NA 3LMSA 4FWUA 1VHOA 2ZEEA 4OMEA 5HVHA 5I4MA 3PB4X 1AYEA 4R6TA 1CPSA 3MN8A 2ZELA 2ZEFA 1LOKA 5HXDA 5F09A 3MRUA 3GLJA 2XEIA 3VARA 3PEIA 5LRKA 1Z2LA 1VHEA 4UF4A 4OC4A 3IO1A 3WABA 1Q7LA 3K9TA 2DEAA 3HUVA 1ARLA 4PXEA 2O4HA 3NFZA 1HDQA 2CTBA 1ELMP 3S9MA 1TKJA 1XJOA 4H2KA 3PFOA 1EE3P 1H8LA 4ZX8A 3B3WA 1LAMA 1DTDA 4P4DA 4UEFA 2VL1A 3SJFA 2AFWA 3PB8X 3RBUA 3D68A 3KHXA 3IFEA 2XEJA 2QYVA 2PJ3A 3FH4A 2F8HA 3B7IA 5JH9A 1NSAA 4UEEA 1YW6A 2PJ0A 3KASA 4P4EA 1TF9A 3I1UA 3PBBA 3KGQA 2ANPA 2HB6A 4R8FA 3CT9A 1DE4C 4IAVA 2AFMA 5LYLA 2ZEDA 4W9YA 2GREA 5K8OA 1XFOA 1IGBA 3PB9X 1QMUA 1PCAA 2AFSA 3ISXA 4IK2A 4PXBA 1TKHA 1CBXA 5LYFA 2CIJA 2AFZA 3ISZA 3WC5A 4X8IA 1Y0YA 1F2PA 3NH8A 2J9AA 3KQXA 3NH5A 3S9LA 4G1PA 2O53A 3KR5A 2V77A 4F9VA 2C6CA 3KI9A 1TF8A 2FVGA 4WJBA 2Q4ZA 3FJUA 3PB7X 2JEWA 1QQ9A 3JRUA 3H8FA 2EK9A 2ZEOA 2EWBA 3B3TA 3NA6A 4ZY1A 3TX8A 3HLPA 2G9DA 3IWWA 3TC8A 4A37A 5K8MA 3FMCA 2PJ7A 5THWA 4ZY0A 3DLJA 4F8ZA 4NGSA 1BPMA 4JZ0A 4OC0A 5LYIA 6CPAA 5JGFA 2PRQA 4OC2A 4RUHA 3H8GA 4OP4A 4LQGA 1BAVA 4ZYQA 1IY7A 4MHZA 4Z65A 5LRGA 3PBEA 4OC3A 3CPXA 3B3CA 4A38A 4DYOA 2BCOA 1YW4A 2V8HA 3FX6A 4P4BA 4R76A 2C1CA 3BI0A 4NGRA 3CDXA 5K8NA 1JQGA 4OIDA 2IQ6A 5LYDA 4PXCA 4NFRA 3SJXA 3B2YA 3WC6A
chains in the Genus database with same CATH superfamily
1Z8LA 2Y0SA 5F46A 1QVGY 4Y7NI 1TXRA 5AG6A 3SI2A 4BBSI 4MCRA 2ZEPA 4CPAA 3RZOI 2BOAA 3G8WA 2X7BA 3PP9A 3JUWA 4C7IA 2VXKA 2V45A 2JS4A 4P44A 1JJ2Z 4S1TA 2DPTA 2P6GA 4IHMA 5CPAA 4OADA 2AFOA 2JDCA 4FUUA 2JUBA 4CRZB 2Z0ZA 5FLXf 3CCE1 1TWHI 2PK7A 4FD4A 1Q7Y1 4IF5A 5LRJA 2WSAA 3GKRA 4RN7A 1LRZA 4H6UA 4KVME 5IP9I 1WWZA 4EWCA 1QVFY 5G21A 3J81b 4HNWB 2FSRA 2J8MA 3I4MI 3D2MA 3RZDI 4MRIA 2NVXI 2VUGA 2QA4Z 5IT9b 3R9FA 1S7LA 3PO2I 2EGTA 1S3ZA 4OC1A 4PK3A 4M3SA 3P2FA 3E0KA 1F57A 4ZX9A 4BBHA 1K9M2 3CCL1 4CL1A 5J8CA 2Q0YA 2Q43A 4RVHA 2ZEHA 4MHNA 3CCQZ 4C2ZA 1ZB8A 3T90A 2B4DA 2PJ4A 2PJCA 3D67A 1IYKA 4P6YA 1M1K1 2NAPA 3GTKI 3KIFA 3EERA 3G4SZ 1QSOA 3PB6X 2Z10A 4UIAA 2ATRA 4ZBGA 1L1OC 4AG7A 3BHXA 3D3SA 2K5TA 3MGDA 4XNHC 2C6PA 4XPDC 1I3QI 1VQ8Z 3SXNA 4A93I 4FAIA 1IB1E 2JLMA 2M6NA 3CMA1 3H8EA 3FYNA 3VTNA 3TO7A 2PIZA 5JQ4A 2OU2A 3GIUA 2PIYA 4CYPA 3DNSA 4A3KI 3G3SA 2YGWA 3PRTA 2HC9A 4OLLA 3JTKA 1AA6A 4X6AI 3BXMA 4DK1A 2DE7A 3NH4A 2Z3OA 3IU2A 4KSIA 2FS5A 2ZEMA 4OIWA 2OZKA 2QLVB 4MMOA 2WZNA 3S1NI 5BWAB 3S16I 2OR4A 3S1RI 4RS2A 3H5ZA 2PJ2A 4FD6A 1Z5RA 3IEHA 4NBFA 4CGOA 4JXRA 4BBRI 2GIVA 3FIXA 7CPAA 1XF8A 3CQZI 3IWGA 4CAXA 5IB9A 2PVVA 4NJRA 1VQ6Z 3KR4A 3GTMS 3K9UA 4QTUA 2H5MA 1ZG7A 3WR7A 3VWDA 4QUSA 3H3VJ 2GLFA 2HUZA 4X5KA 2RT9A 3CCQ1 2REEA 4MH4A 5LL6f 4BMHA 4DQYB 2VPXA 1AYEA 2HF1A 1VQ9Z 4R6TA 1CPSA 5T6BA 2AKLA 1Z4RA 2ZELA 3NE8A 1K8A1 4DNCA 3G4S1 1SQHA 3GLJA 2VI7A 3J80b 3HOXI 1YX0A 2YNDA 4OC4A 1VQ81 1M4IA 3IO1A 2Z11A 4MHDA 4MY0A 4PXEA 3CD61 1VQNZ 1LAMA 4A3BI 1DTDA 4P4DA 1TWCI 2I00A 2VL1A 4E2XA 2AFWA 1YJN1 2FE7A 2REFA 3D68A 2O28A 2PDOA 3IFEA 4RI1A 2PR8A 3CZXA 3GTLI 4XPLA 2PJ3A 3FH4A 2F8HA 4KVOE 5JH9A 1NSAA 1KZFA 1TF9A 3CCSZ 3I1UA 2VBQA 2R93I 3HOUI 2HB6A 1S72Z 4HPSA 4IAVA 1FDIA 3T9YA 1Q821 2VEZA 1N71A 1WK4A 2OH1A 2EVNA 2CIJA 1JWQA 5F47A 3WC5A 1USPA 5EBVA 1QSRA 2J9AA 1UFHA 2OZGA 3W6XA 3CC4Z 2O53A 3S17I 1SIWA 3IGRA 4NOZA 1IOFA 1RO2A 2F4MA 3FJUA 4KSAA 1VQK1 2EWBA 2V8KA 4LQ6A 3HLPA 2G9DA 2RHBA 3FQQA 3TC8A 1MK4A 3S6KA 2LFUA 3S14I 3FMCA 4NB9A 2PJ7A 1WCMI 4ZY0A 3F8KA 1BPMA 4OC2A 4RUHA 1YVOA 3G6EZ 1Z8TA 1YVKA 2DE6A 3T4NB 3B8GA 1NP6A 1IY7A 2R98A 4MHZA 2W03A 1CJWA 1S60A 4Z65A 3CPXA 3B3CA 4A32A 4AG9A 1VQMZ 3TCVA 1VQN1 1P9NA 2Y0MA 4NGRA 1VQ41 3CDXA 3DR6A 4NFRA 2IZ4A 1M4DA 5H86A 4P10A 1YIJ1 1AMPA 5G22A 4R57A 4AXVA 3EXNA 1N8R1 3F0AA 2R8VA 3ZZIA 3QB8A 4EMEA 2W04A 2V8VA 3CCS1 1M4LA 1K732 4PQAA 1R43A 4M6GA 2CY2A 2EK8A 2GU2A 2B4BA 1S721 4FD5A 3GCFA 2R92I 4A33A 1Q822 3GUXA 4F9UA 4MFLA 4NBGA 1HEEA 1ZG9A 5HVFA 4NGPA 2G3TA 3A9LA 8CPAA 3V38A 4Q7AA 2FIAA 1Y8CA 2I3CA 3CC41 1TWGI 1RQFA 4R9MA 4UFWA 1W2BZ 4MHPA 1M902 2QREB 1XBUA 4GXHA 3CXCY 1YMEA 3CXPA 4L89A 3K2KA 3LWUA 2F7VA 4JYWA 5HVGA 5KTDA 2PJ6A 1CG2A 2ZOGA 3D7DA 5KTCA 1YI2Z 2XEFA 1YR0A 4R87A 1B87A 1RTQA 4B5PB 3EY5A 2PR1A 3LODA 3S9NA 1Z01A 1WW9A 2JA5I 3G6E1 1P0HA 1BOBA 2NYQA 4OKOA 4I49A 1Q811 5JPHA 4H6ZA 3CCJ1 5F48A 3SI0A 1VIXA 1VQM1 1LANA 3IIBA 1XEBA 1ZG8A 3MONA 3IJ3A 1CP6A 1IOIA 2BJOA 4CGNA 2J6AA 2ZEGA 4JLYA 2P3YA 3D2PA 3F3PC 1MJBA 4HH4A 3W91A 4E2AA 2JA8I 3FEDA 3OW2Y 3BG0B 2KCWA 1LQLA 3R96A 3JVNA 4MCPA 2XEGA 1YLEA 1Q2DA 2PJ8A 5T67A 3CMAZ 3FNCA 2JIQA 2FT0A 1VKCA 5DS0A 3D66A 4UEZA 3T8WA 3GTGI 4CAEA 4MCQA 4UWJA 2P0WA 4ZY2A 5J1QA 2PJAA 1I1DA 3RAMA 4F6AA 3UY5A 3N5FA 3CPWZ 4TWEA 4NJQA 2PRBA 2JIOA 2ZW5A 3FBUA 4E32A 3D7GA 1XMBA 2E7ZA 2PSWA 3KL9A 1YI21 2CXAA 5A2Qb 3MZLB 4M85A 4TNUA 3PFEA 1XRYA 2YNCA 2OTL1 1YK3A 1Q812 5CBMA 1MJ9A 2J8NA 2K5RA 3I4NI 3WC7A 1KQSY 3L2NA 4A3JI 2R7ZI 1KD11 1VHOA 5HVHA 2ZW4A 4MFPA 1I21A 4MFZA 3I07A 3OWCA 2NMTA 3K7AI 1AUGA 1LOKA 5HXDA 5F09A 4Q36A 4GS4A 1KUYA 3VARA 3R95A 5LRKA 1Z2LA 1B6BA 2VF1A 4QTTA 2LEXA 2DEAA 4RVDA 2GTIA 3HUVA 4KLWA 3NFZA 4F0YA 1ELMP 1XJOA 3KKWA 4MD8A 3CD6Z 4ZX8A 1Q2YA 2VPZA 1NSLA 3TT2A 4C2XA 3SJFA 2VUMI 2P6FA 3RBUA 2QRCB 5AGEA 4B13A 1DL6A 4B5PA 5IV0A 1Y1VS 1K4JA 1YJNZ 2E9HA 1YUAA 1Q7Y2 1U6MA 3B7IA 2PJ0A 3EEDA 2Q7SA 1RO4A 2ANPA 4XPKA 1PU9A 3HKZA 5LYLA 4E8OA 2ZEDA 4AVBA 5K8OA 5FLXb 4MJ8A 1XFOA 1IGBA 2B5GB 5KTAA 1QMUA 5IP7I 2AFSA 5T64A 4Y49C 4PXBA 2B3VA 2AFZA 3ISZA 1Z02A 1YREA 4X8IA 3GKQA 4HKFA 1F2PA 2D4OA 3NH8A 3KQXA 3S9LA 1Z03A 4FD7A 1ON0A 4QBJA 3KR5A 2V77A 1X12A 2KPIA 2YNCC 2FVGA 5H84A 2Q4ZA 3VMIA 2JEWA 5C4JI 3H8FA 3B3TA 3NA6A 4AB7A 4ZY1A 1A2ZA 2JNYA 1VQKZ 3CC7Z 4NBEA 1QVGZ 3IWWA 1FY7A 2QIRA 3ESWA 4JWPA 1QF8A 5K8MA 3TE4A 5AG5A 1KC81 1M1K2 4OC0A 1GHEA 5LYIA 4MY3A 4MI4A 4L8AA 3TE5B 2Z3PA 4OP4A 3MZKB 4LQGA 4ZYQA 5C44I 5LRGA 4OC3A 4A38A 2YNEA 2A4NA 3CCM1 2V8HA 4A3MI 2C1CA 3PZJA 3BI0A 2H85A 3NE7A 4UCMA 1BO4A 3ZJ0A 1KUXA 4MBUA 5K8NA 1KRLA 1NUIA 1VQ4Z 3WC6A 2C6GA 4NGMA 2RC4A 3BJ8A 4YWYA 1Y9KA 1QVFZ 1Z4EA 3I55Z 4A3CI 4WWVA 2PJBA 4NCZA 3JAMf 1RO5A 1LCPA 5FLMI 1YIJZ 1TWFI 4HNYB 4E0AA 1FDOA 2VZYA 3KZWA 4KSFA 5EC4A 2CTCA 2JDDA 3D6WA 1TFIA 2BL1A 3S6HA 3D7HA 2GFQA 4NBBA 4NH1C 5D29A 3DGVA 5E96A 3DDDA 1Y1VI 4RV9A 2RFHA 2ZPAA 3BI1A 4NGTA 2EUIA 3TO9A 4ONUA 2RPRA 3FECA 1S5KA 1BLLE 1QYPA 4RS4A 1CP7A 4X2TA 2WUUA 2QJ8A 4AVAA 2DXQA 2ZOFA 4MCSA 3GY9A 2OOXB 1N2FA 2ZENA 2AFUA 4NGNA 1YJWZ 1OZPA 3TOAA 3CC71 4OC5A 3VH9A 1ZLHA 5ELYA 3RO0A 2CNTA 1FNOA 3FKII 3SJGA 4H89A 2GLJA 5AG4A 2CNSA 3GTOI 1K8A2 1Y7RA 5D1PA 1SFOI 4NBDA 1R3NA 5G20A 4MD7A 1JJ2Y 2PVWA 4NXYA 3CPAA 4MONA 2QVPA 3V7ZA 5K8PA 3CCJZ 5I0CA 2WYRA 2E2II 4P4IA 4J3GA 3IWEA 4OAEA 4MHYA 4NSQA 1GYTA 4KOSA 2C27A 3GTQI 2B5GA 2G0BA 3S6FA 1ELLP 4BY7I 4U9YA 4K30A 4PPZA 3CCU1 4U9ZA 3I551 4HGYA 1KUVA 2G3AA 4A2ZA 2V8JA 1OBRA 4PXDA 1ARMA 4YU9A 5IX3A 2YU9I 3FB3A 2PE3A 2POKA 4UCNA 2ZXVA 1FT7A 4AYBA 1X3WA 4P45A 2EBJA 5GCNA 4MD9A 4NGQA 1WZNA 3HOYI 2V8GA 1NE9A 4GM5A 3FQMA 3IU1A 2P28A 1MJAA 4X3RA 3R1KA 2IMOA 1VQPZ 2E2HI 4K3NA 2QECA 2LIYA 1Q861 3SI1A 4JJXA 5D1OB 2OOYB 4KOXA 2IV2X 1YQEA 4E31A 2PCUA 1Y0RA 1YJW1 2BO9A 4DUKA 1M44A 3CXSA 5A27A 4KOWA 1VGYA 1WJ2A 3J81f 3FF3A 4EFDA 3D9XA 1YITZ 4YFJA 1PFTA 4AVCA 1LFWA 4RVFA 2ABZA 4M6IA 4A39A 5IT9f 2V8DA 2F4OA 2Q44A 2OTLZ 4A95A 3R9EA 2FXFA 3VB9A 1I12A 1X0TA 2NVYI 2PJ1A 5CM2M 1BPNA 3KQZA 2KI7B 1CPXA 2R7HA 4FWUA 2ZEEA 4OMEA 3SHPA 3HOWI 3Q87A 4YGOA 4MFQA 2ZEFA 2ZW6A 1Z9UA 3C26A 1S7FA 5A28A 1K9M1 1I6HI 2JIMA 1VHEA 1RNIA 1YUKA 4KLVA 1N8R2 3I3GA 1Q7LA 2G2KA 4NBAA 2ZAEB 3BLNA 1VQ5Z 2O4HA 2Z3NA 2QMLA 1HDQA 1QSTA 4CYNA 4HGZA 1TKJA 4C68A 3PFOA 1EE3P 3B3WA 4QC6A 4E2WA 3CC2Z 4BXXI 4CAFA 4UEFA 1ZH1A 2OB0A 1VQP1 3PB8X 3KHXA 3M4OI 1Q862 2OTJZ 2XEJA 4E2YA 1ZB9A 4BINA 1YW6A 3KASA 2JR6A 3D8PA 3KGQA 2Z3KA 4R8FA 3CT9A 3QWUA 4W9YA 2GREA 5FVJA 1IICA 3S1MI 1YHQZ 3ISXA 2BUEA 3NDJA 1S7NA 2WAQA 3I56Z 1CBXA 1V0CA 2VQYA 5C4XI 1YIT1 2K3RA 2DE5A 1PUAA 4ORFA 4UA3A 4F9VA 3N7ZA 4NEXA 4CYOA 3P2HA 3JRUA 1P4NA 4A30A 4UCPA 2ZEOA 4JXQA 4KOVA 3TX8A 5C82A 4KUAA 2Z3MA 4PSWA 4EVYA 4UWIA 4A37A 1M1DA 3V8IA 1QSMA 1VQL1 3DLJA 4F8ZA 2FIWA 6CPAA 5JGFA 2PRQA 3H8GA 5D1OA 3VMGA 2R1IA 2DF5A 3J80f 2B3UA 1VQ51 2EO8A 3PBEA 2Q4YA 4DYOA 3FX6A 4P4BA 1JWHC 4BY1I 5C88A 3P5JB 1WIIA 3CCMZ 1JQGA 3GTPI 3CC21 2CNMA 1USPB 4UBRA 2IQ6A 1X10A 4PSXA 3PGPA 4B5OA 4CAVA 3G71Z 2J8RA 3S15I 3IFUA 3PO3S 2R6MA 2ARHA 1ZO0A 4RVGA 3GTJI 3CXCZ 2HU9A 3CCVZ 1TIQA 2OTJ1 4B12A 2VPWA 1J4JA 2B58A 1K83I 4JD6A 4E2ZA 2NSMA 4UIBA 1LAPA 2CF4A 1YHQ1 3BG1B 3HOZI 3S1QI 3I561 4R3KA 4MFKA 1YSJA 3FVLA 3WT4A 3M3YI 1QXFA 4CGPA 4YRHA 4CYQA 4KVXA 1CX8A 1Y7EA 2Q7BA 3FEEA 3GB0A 1UWYA 3CCRZ 3GYAA 5IB0A 2Q04A 2F5IA 5ISVA 4CRYB 2QA41 4CGMA 3OW2Z 1XE4A 1KD12 2WPWA 2JIRA 3LUSA 1F2OA 1ZLIA 3B3SA 3DR8A 4BD9A 3EFAA 4NBCA 4P4FA 1YJ9Z 1I50I 3KIHA 2GE3A 3VMHA 1XOVA 3LACA 4MFJA 2AE6A 3TTHA 3D2LA 2OOTA 1R9TI 3EC4A 3D4UA 3TDHB 2OZUA 3TO6A 2JBKA 4XX2A 3VATA 2JA6I 4B6ZA 3H0GI 2RB7A 2V3VA 3CMEZ 3B3VA 1W2BY 2Q51A 2IZ3A 3NDIA 5DWMA 3G711 4R7MA 2JMOA 3D7FA 1Z8XA 3RZAA 3QNVA 3CCV1 3I9SA 3CCUZ 3U50C 2AJ6A 2PC1A 2E2JI 1IYLA 4EWTA 4P4JA 5D8NA 1M4GA 2QRDB 2PJ9A 2IJZA 4PV6A 2QEXZ 3TOBA 2BEIA 4B10A 4II9A 4KOTA 2VZZA 4M6HA 3SJEA 4KZTA 3PO3I 3EO4A 1NJI1 1PYTB 2ZW7A 5HMNA 3BJ7A 3J7A4 3KHZA 3TFYA 5JM6A 3F5BA 3IC1A 1VQ7Z 4A3II 1KQSZ 4DJLA 3RYOA 3S6GA 1S7MA 2PJ5A 2JBJA 4KOYA 4LX9A 4B14A 2V8IA 1K731 1KWMA 1YLOA 3CCR1 4ZI6A 1Y9WA 4CAWA 4PK2A 4ZGYB 1Y1WI 4E30A 2FCKA 1VQOZ 4ONWA 2QR1B 1VQ61 2Q4VA 4A94A 1YJ91 1TKFA 4XNHB 2B63I 4XPDB 2AFXA 1S7KA 1KC82 1Z8WA 2P6EA 4O23A 4E33A 1CM0A 4FBEA 1M901 4MXUA 4HNXB 2GANA 1IU8A 1X3ZA 3B35A 4R3LA 1RO0A 1HDUA 2VPYA 4IUSA 1Q16A 1VQ91 3LMSA 5I4MA 3GTMI 3CME1 2IL4A 2ODFA 3PB4X 3CPWY 3H4QA 3MN8A 2FL4A 2Z3LA 3MRUA 2M48A 2XEIA 3QAHA 1IIDA 4KOUA 3PEIA 4C2YA 2JEVA 4A3LI 4UF4A 4Y52I 4CS0B 3WABA 3K9TA 4Y49B 4NBHA 2OZHA 1L0CA 1ARLA 2QEX1 2PMZA 2CTBA 4KS9A 3S9MA 5J8FA 4H2KA 3W6SA 1NJI2 2JIPA 1H8LA 2QKDA 3JAMb 2RBLA 4NB8A 1VLAA 2BSWA 4NF1A 1VQ71 4QVTA 2AYDA 2NVTI 4KORA 3F3FC 2QYVA 4C7HA 1TWAI 2I79A 3QAYA 3RNZA 2YADA 4Q38A 4UEEA 4P4EA 3PBBA 5G1ZA 2GTHA 1RXTA 1DE4C 2NVQI 2AFMA 3R9GA 1RLYA 1VHSA 1YGHA 3CXQA 2B4DB 4A3GI 3PB9X 1VQO1 1PCAA 4KUBA 4LUAA 4IK2A 1TKHA 2PQ8A 4UFVA 5LYFA 5F49A 3FXTA 4B11A 3CCEZ 1Y0YA 3IR7A 5AN9F 3NH5A 4DGLA 1XMTA 4CGLA 1Q2CA 2WB1A 4G1PA 4A3DI 3S2HI 3DSBA 5A2Qf 5HH1A 5CNPA 1XIXA 3KI9A 2C6CA 1TF8A 4WJBA 1NMTA 2HV2A 3PB7X 1QQ9A 2D4PA 2EK9A 3LD2A 4U5YA 4F0XA 5EMIA 2JA7I 5C3EI 2RIQA 4UFXA 5DWNA 5THWA 1QSNA 4NGSA 3VWEA 4JZ0A 3S2DI 1VQLZ 4A31A 4A3FI 2PM9A 1ML8A 3CCLZ 5AG7A 1R57A 3IF8A 3IX0A 1BAVA 3SXOA 3FRMA 2BCOA 1YW4A 4R76A 3HOVI 4OIDA 2HQYA 4QB9A 5LYDA 4A3EI 4PXCA 3SJXA 3B2YA 2DPSA 2WPXA
chains in the Genus database with same CATH topology
4P10A 4RVGA 3GTJI 2C6GA 3CXCZ 4NGMA 2HU9A 4YWYA 1Z8LA 3CCVZ 2Y0SA 1QVFZ 1YIJ1 3I55Z 1AMPA 4A3CI 2OTJ1 4WWVA 2PJBA 1QVGY 3JAMf 4AXVA 1N8R1 4Y7NI 1LCPA 1TXRA 5FLMI 1YIJZ 4BBSI 3SI2A 1TWFI 4MCRA 2ZEPA 4EMEA 2W04A 2V8VA 3CCS1 3KZWA 4CPAA 1M4LA 2CTCA 1K732 4PQAA 1R43A 3RZOI 3D6WA 2BOAA 1K83I 1TFIA 2GU2A 1S721 2EK8A 4E2ZA 2NSMA 4UIBA 3GCFA 2R92I 3D7HA 1Q822 3GUXA 4F9UA 2JS4A 1LAPA 2CF4A 4P44A 4NBBA 4NH1C 4NBGA 1YHQ1 1HEEA 5D29A 1ZG9A 1JJ2Z 4S1TA 3DGVA 5HVFA 3BG1B 3HOZI 3S1QI 4IHMA 5CPAA 3I561 1YSJA 2AFOA 1Y1VI 4FUUA 4NGPA 4RV9A 2JUBA 2RFHA 8CPAA 3FVLA 3WT4A 3V38A 5FLXf 3CCE1 3BI1A 1TWHI 3M3YI 4NGTA 4Q7AA 2PK7A 1Q7Y1 2RPRA 3FECA 2I3CA 1BLLE 3CC41 1QYPA 4RS4A 1CP7A 5LRJA 4X2TA 1CX8A 2QJ8A 1TWGI 1RQFA 2ZOFA 1Y7EA 1W2BZ 4MCSA 4MHPA 3FEEA 1M902 2OOXB 2QREB 1XBUA 3GB0A 5IP9I 1UWYA 1N2FA 3CXCY 1YMEA 3CCRZ 2ZENA 4EWCA 1QVFY 2AFUA 3K2KA 3LWUA 4NGNA 1YJWZ 3J81b 2F7VA 4JYWA 5HVGA 3CC71 2QA41 3I4MI 3OW2Z 4OC5A 3VH9A 1ZLHA 5ELYA 2PJ6A 1KD12 1FNOA 3RZDI 1CG2A 3LUSA 3FKII 2ZOGA 4MRIA 2NVXI 3SJGA 2VUGA 3D7DA 1F2OA 2QA4Z 1ZLIA 5IT9b 3B3SA 4BD9A 1YI2Z 2GLJA 4NBCA 4P4FA 1YJ9Z 3PO2I 1I50I 3KIHA 3GTOI 2XEFA 2EGTA 3VMHA 1K8A2 1RTQA 3S9NA 1Z01A 4OC1A 5D1PA 1SFOI 4NBDA 1R3NA 1F57A 1WW9A 4ZX9A 4MD7A 1K9M2 2JA5I 1JJ2Y 3G6E1 3CCL1 4CL1A 2PVWA 2NYQA 4OKOA 2OOTA 1Q811 1R9TI 3D4UA 3TDHB 2Q43A 3CPAA 3CCJ1 4RVHA 2JBKA 3SI0A 4XX2A 3VATA 2JA6I 4MONA 2QVPA 2ZEHA 3V7ZA 4B6ZA 4MHNA 1VIXA 5K8PA 3H0GI 1VQM1 1LANA 3IIBA 3CCJZ 3CCQZ 2RB7A 2WYRA 2E2II 4P4IA 1ZG8A 4MHYA 3MONA 3IJ3A 1ZB8A 1GYTA 1CP6A 3CMEZ 3B3VA 3GTQI 2BJOA 1W2BY 2PJ4A 2PJCA 3D67A 2Q51A 2IZ3A 1ELLP 3NDIA 4BY7I 4P6YA 3G711 4R7MA 1M1K1 2J6AA 2ZEGA 3GTKI 2P3YA 3KIFA 2JMOA 3D7FA 3EERA 3G4SZ 4PPZA 3CCU1 3RZAA 3PB6X 3F3PC 3QNVA 4UIAA 4HH4A 3CCV1 1L1OC 2JA8I 3I551 3BHXA 3CCUZ 3FEDA 3U50C 3OW2Y 3BG0B 4HGYA 2E2JI 2C6PA 1I3QI 1VQ8Z 2V8JA 4EWTA 1OBRA 4PXDA 1ARMA 1LQLA 4P4JA 4A93I 4FAIA 4YU9A 4MCPA 2YU9I 5D8NA 2XEGA 2M6NA 2PE3A 2PJ8A 3CMA1 2QRDB 2PJ9A 2IJZA 2POKA 2QEXZ 3H8EA 1FT7A 4AYBA 3VTNA 1X3WA 5T67A 3CMAZ 2PIZA 4P45A 4MD9A 3SJEA 4NGQA 3PO3I 3HOYI 1NJI1 2V8GA 4GM5A 1PYTB 2PIYA 5DS0A 3D66A 4UEZA 3FQMA 4A3KI 3T8WA 2P28A 3PRTA 3GTGI 3J7A4 3KHZA 4X3RA 2IMOA 2HC9A 5JM6A 1VQPZ 3IC1A 2E2HI 4K3NA 4MCQA 1VQ7Z 4A3II 4X6AI 3BXMA 4ZY2A 1KQSZ 2PJAA 4DJLA 4DK1A 2DE7A 5J1QA 3NH4A 2LIYA 1Q861 3RAMA 1S7MA 3SI1A 2PJ5A 4KSIA 2ZEMA 5D1OB 2JBJA 3N5FA 4OIWA 2OOYB 3CPWZ 2OZKA 2QLVB 2V8IA 1K731 4TWEA 4NJQA 1KWMA 4MMOA 2WZNA 3S1NI 4E31A 1YLOA 2PCUA 3CCR1 1Y0RA 4ZI6A 3S16I 2OR4A 1YJW1 2BO9A 3S1RI 1Y1WI 4DUKA 4E30A 4E32A 3D7GA 1VQOZ 1XMBA 4ONWA 2PJ2A 2QR1B 1Z5RA 3IEHA 1VGYA 4NBFA 1VQ61 3KL9A 3J81f 1YI21 3FF3A 4BBRI 4A94A 1YJ91 1TKFA 4EFDA 3D9XA 1YITZ 3CQZI 5A2Qb 7CPAA 5IB9A 2B63I 2PVVA 3MZLB 4NJRA 1VQ6Z 3KR4A 2AFXA 4TNUA 1PFTA 3GTMS 1LFWA 1KC82 4O23A 3PFEA 4RVFA 4QTUA 2ABZA 4E33A 1ZG7A 1XRYA 4A39A 5IT9f 2OTL1 2V8DA 1Q812 1M901 4FBEA 5CBMA 2F4OA 4MXUA 3H3VJ 2OTLZ 2GLFA 1X3ZA 2K5RA 3B35A 3VB9A 3I4NI 3WC7A 1KQSY 1RO0A 2RT9A 1HDUA 1X0TA 2NVYI 2PJ1A 3CCQ1 4MH4A 5CM2M 1BPNA 1VQ91 3KQZA 2KI7B 5LL6f 1CPXA 3L2NA 3LMSA 4A3JI 2R7ZI 4FWUA 1KD11 1VHOA 3GTMI 2ZEEA 3CME1 4OMEA 5HVHA 4DQYB 5I4MA 3PB4X 3CPWY 1AYEA 3I07A 2HF1A 1VQ9Z 4R6TA 1CPSA 3MN8A 3HOWI 3K7AI 5T6BA 3Q87A 2AKLA 2ZELA 2ZEFA 1LOKA 1K8A1 5HXDA 3G4S1 5F09A 3MRUA 3GLJA 2M48A 2XEIA 3VARA 3J80b 3HOXI 1K9M1 1I6HI 3PEIA 5LRKA 1Z2LA 1VHEA 1RNIA 4A3LI 4UF4A 4OC4A 1YUKA 4Y52I 2VF1A 4QTTA 1VQ81 3IO1A 1N8R2 3WABA 1Q7LA 3K9TA 2G2KA 4NBHA 4NBAA 2ZAEB 2DEAA 4RVDA 2GTIA 3HUVA 1ARLA 2QEX1 1VQ5Z 2O4HA 4PXEA 3NFZA 1HDQA 2PMZA 3CD61 2CTBA 1ELMP 3S9MA 1VQNZ 4HGZA 1TKJA 1XJOA 4H2KA 3PFOA 1EE3P 4MD8A 1NJI2 3CD6Z 1H8LA 4ZX8A 3B3WA 1LAMA 4A3BI 2QKDA 4E2WA 3CC2Z 1DTDA 4BXXI 4P4DA 1TWCI 4UEFA 1ZH1A 3JAMb 2RBLA 2VL1A 3SJFA 4NB8A 1VLAA 4E2XA 2AFWA 1VQP1 1YJN1 2VUMI 3PB8X 1VQ71 3RBUA 2QRCB 3D68A 3KHXA 2NVTI 3M4OI 1DL6A 1Q862 1Y1VS 3IFEA 2OTJZ 1YJNZ 2XEJA 2E9HA 1YUAA 3F3FC 1Q7Y2 3GTLI 2QYVA 2PJ3A 1TWAI 2F8HA 3FH4A 4E2YA 1ZB9A 3B7IA 5JH9A 1NSAA 2YADA 4UEEA 1YW6A 2PJ0A 3KASA 4P4EA 1TF9A 3CCSZ 3I1UA 2JR6A 3PBBA 3EEDA 3KGQA 1RO4A 2R93I 2ANPA 2GTHA 3HOUI 2HB6A 1S72Z 4R8FA 3CT9A 1DE4C 4IAVA 2NVQI 3HKZA 2AFMA 5LYLA 3QWUA 2ZEDA 4W9YA 1RLYA 2GREA 5K8OA 5FLXb 1Q821 1XFOA 4A3GI 1IGBA 3PB9X 1VQO1 1QMUA 1PCAA 3S1MI 1YHQZ 5IP7I 2AFSA 3ISXA 5T64A 4IK2A 4PXBA 3NDJA 2WAQA 1TKHA 3I56Z 1CBXA 5LYFA 2CIJA 2AFZA 3ISZA 1Z02A 5C4XI 1YIT1 3WC5A 4X8IA 3GKQA 1USPA 3CCEZ 1Y0YA 2K3RA 1F2PA 2DE5A 3NH8A 2J9AA 5AN9F 3KQXA 3NH5A 3S9LA 4DGLA 2WB1A 3CC4Z 4G1PA 1Z03A 4A3DI 2O53A 3S17I 3S2HI 5A2Qf 3KR5A 4NOZA 2V77A 4F9VA 1RO2A 2F4MA 2KPIA 2C6CA 3KI9A 1TF8A 2FVGA 4WJBA 2Q4ZA 3FJUA 3PB7X 3VMIA 2JEWA 1QQ9A 3JRUA 5C4JI 3H8FA 3SJXA 2EK9A 1VQK1 2ZEOA 2EWBA 3B3TA 3NA6A 2V8KA 4ZY1A 3TX8A 3HLPA 2JNYA 1VQKZ 3CC7Z 4NBEA 1QVGZ 2G9DA 2RHBA 3FQQA 3IWWA 2JA7I 5C3EI 3TC8A 2LFUA 2RIQA 3ESWA 3S14I 4A37A 1QF8A 5K8MA 3FMCA 4NB9A 2PJ7A 1VQL1 1WCMI 1KC81 1M1K2 5THWA 3DLJA 4ZY0A 4F8ZA 4NGSA 1BPMA 4JZ0A 4OC0A 5LYIA 6CPAA 3S2DI 5JGFA 2PRQA 1VQLZ 4OC2A 4RUHA 4A3FI 2PM9A 3TE5B 1ML8A 3G6EZ 3CCLZ 3H8GA 2DE6A 3T4NB 5D1OA 4OP4A 3VMGA 3MZKB 3IF8A 4LQGA 3IX0A 1BAVA 4ZYQA 1NP6A 5C44I 3J80f 1IY7A 4MHZA 2W03A 1VQ51 3PBEA 5LRGA 4OC3A 4Z65A 3CPXA 3B3CA 4A38A 1VQMZ 1VQN1 4DYOA 2BCOA 3CCM1 1YW4A 2V8HA 3FX6A 4P4BA 4R76A 4A3MI 1JWHC 4BY1I 2C1CA 1P9NA 2H85A 3BI0A 3HOVI 4NGRA 3P5JB 1WIIA 1VQ41 3CDXA 5K8NA 3CCMZ 1JQGA 3GTPI 3CC21 1KRLA 1USPB 4OIDA 2IQ6A 5LYDA 3G71Z 4A3EI 4PXCA 4NFRA 2IZ4A 3S15I 3IFUA 1NUIA 1VQ4Z 3PO3S 3B2YA 3WC6A 2R6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P10 A;  2C6G A;  4NGM A;  4YWY A;  1Z8L A;  1AMP A;  4WWV A;  2PJB A;  4AXV A;  1LCP A;  1TXR A;  3SI2 A;  4MCR A;  2ZEP A;  4EME A;  2V8V A;  3KZW A;  4CPA A;  1M4L A;  2CTC A;  4PQA A;  1R43 A;  2BOA A;  2EK8 A;  2GU2 A;  2NSM A;  4UIB A;  3D7H A;  3GUX A;  4F9U A;  1LAP A;  2CF4 A;  4P44 A;  1HEE A;  5D29 A;  1ZG9 A;  3DGV A;  5HVF A;  4IHM A;  5CPA A;  1YSJ A;  2AFO A;  4FUU A;  4NGP A;  2RFH A;  8CPA A;  3FVL A;  3WT4 A;  3V38 A;  3BI1 A;  4NGT A;  4Q7A A;  3FEC A;  2I3C A;  1BLL E;  5LRJ A;  1CP7 A;  4X2T A;  1CX8 A;  2QJ8 A;  2ZOF A;  1Y7E A;  4MCS A;  4MHP A;  3FEE A;  1XBU A;  3GB0 A;  1UWY A;  1YME A;  2ZEN A;  2AFU A;  3K2K A;  3LWU A;  4NGN A;  2F7V A;  4JYW A;  5HVG A;  4OC5 A;  3VH9 A;  1ZLH A;  5ELY A;  2PJ6 A;  1FNO A;  1CG2 A;  2ZOG A;  4MRI A;  3SJG A;  3D7D A;  1F2O A;  1ZLI A;  3B3S A;  4BD9 A;  2GLJ A;  4P4F A;  2XEF A;  1RTQ A;  3S9N A;  4OC1 A;  1R3N A;  1F57 A;  4ZX9 A;  2PVW A;  2NYQ A;  4OKO A;  2OOT A;  3D4U A;  2Q43 A;  3CPA A;  2JBK A;  3SI0 A;  3VAT A;  2QVP A;  3V7Z A;  2ZEH A;  4B6Z A;  4MHN A;  1VIX A;  5K8P A;  1LAN A;  3IIB A;  2RB7 A;  2WYR A;  4P4I A;  1ZG8 A;  4MHY A;  3IJ3 A;  1GYT A;  1CP6 A;  3B3V A;  2PJ4 A;  2PJC A;  3D67 A;  2Q51 A;  1ELL P;  4P6Y A;  4R7M A;  2ZEG A;  3D7F A;  4PPZ A;  3RZA A;  3PB6 X;  3QNV A;  4UIA A;  3BHX A;  3FED A;  2C6P A;  4EWT A;  1OBR A;  4PXD A;  1ARM A;  4P4J A;  4FAI A;  4YU9 A;  4MCP A;  5D8N A;  2XEG A;  2PE3 A;  2PJ8 A;  2PJ9 A;  2IJZ A;  2POK A;  3H8E A;  1FT7 A;  2PIZ A;  4P45 A;  3SJE A;  4NGQ A;  2V8G A;  4GM5 A;  1PYT B;  2PIY A;  5DS0 A;  3D66 A;  4UEZ A;  3T8W A;  3PRT A;  3KHZ A;  4X3R A;  2IMO A;  2HC9 A;  5JM6 A;  3IC1 A;  4K3N A;  4MCQ A;  4ZY2 A;  3BXM A;  5J1Q A;  2PJA A;  4DJL A;  3NH4 A;  3RAM A;  3SI1 A;  2PJ5 A;  4KSI A;  2ZEM A;  2JBJ A;  3N5F A;  4OIW A;  4TWE A;  4NJQ A;  1KWM A;  4MMO A;  2WZN A;  1YLO A;  2PCU A;  1Y0R A;  4ZI6 A;  2OR4 A;  2BO9 A;  4DUK A;  3D7G A;  1XMB A;  4ONW A;  2PJ2 A;  1Z5R A;  3IEH A;  1VGY A;  3KL9 A;  4A94 A;  3FF3 A;  1TKF A;  4EFD A;  7CPA A;  5IB9 A;  2PVV A;  4NJR A;  3KR4 A;  2AFX A;  4TNU A;  1LFW A;  4O23 A;  3PFE A;  2ABZ A;  1ZG7 A;  1XRY A;  4A39 A;  2V8D A;  4FBE A;  5CBM A;  4MXU A;  2GLF A;  3B35 A;  3WC7 A;  1HDU A;  2PJ1 A;  1BPN A;  3KQZ A;  1CPX A;  3L2N A;  3LMS A;  4FWU A;  1VHO A;  2ZEE A;  4OME A;  5HVH A;  5I4M A;  3PB4 X;  1AYE A;  4R6T A;  1CPS A;  3MN8 A;  2ZEL A;  2ZEF A;  1LOK A;  5HXD A;  5F09 A;  3MRU A;  3GLJ A;  2XEI A;  3VAR A;  3PEI A;  5LRK A;  1Z2L A;  1VHE A;  4UF4 A;  4OC4 A;  3IO1 A;  3WAB A;  1Q7L A;  3K9T A;  2DEA A;  3HUV A;  1ARL A;  4PXE A;  2O4H A;  3NFZ A;  1HDQ A;  2CTB A;  1ELM P;  3S9M A;  1TKJ A;  1XJO A;  4H2K A;  3PFO A;  1EE3 P;  1H8L A;  4ZX8 A;  3B3W A;  1LAM A;  1DTD A;  4P4D A;  4UEF A;  2VL1 A;  3SJF A;  2AFW A;  3PB8 X;  3RBU A;  3D68 A;  3KHX A;  3IFE A;  2XEJ A;  2QYV A;  2PJ3 A;  3FH4 A;  2F8H A;  3B7I A;  5JH9 A;  1NSA A;  4UEE A;  1YW6 A;  2PJ0 A;  3KAS A;  4P4E A;  1TF9 A;  3I1U A;  3PBB A;  3KGQ A;  2ANP A;  2HB6 A;  4R8F A;  3CT9 A;  1DE4 C;  4IAV A;  2AFM A;  5LYL A;  2ZED A;  4W9Y A;  2GRE A;  5K8O A;  1XFO A;  1IGB A;  3PB9 X;  1QMU A;  1PCA A;  2AFS A;  3ISX A;  4IK2 A;  4PXB A;  1TKH A;  1CBX A;  5LYF A;  2CIJ A;  2AFZ A;  3ISZ A;  3WC5 A;  4X8I A;  1Y0Y A;  1F2P A;  3NH8 A;  2J9A A;  3KQX A;  3NH5 A;  3S9L A;  4G1P A;  2O53 A;  3KR5 A;  2V77 A;  4F9V A;  2C6C A;  3KI9 A;  1TF8 A;  2FVG A;  4WJB A;  2Q4Z A;  3FJU A;  3PB7 X;  2JEW A;  1QQ9 A;  3JRU A;  3H8F A;  2EK9 A;  2ZEO A;  2EWB A;  3B3T A;  3NA6 A;  4ZY1 A;  3TX8 A;  3HLP A;  2G9D A;  3IWW A;  3TC8 A;  4A37 A;  5K8M A;  3FMC A;  2PJ7 A;  5THW A;  4ZY0 A;  3DLJ A;  4F8Z A;  4NGS A;  1BPM A;  4JZ0 A;  4OC0 A;  5LYI A;  6CPA A;  5JGF A;  2PRQ A;  4OC2 A;  4RUH A;  3H8G A;  4OP4 A;  4LQG A;  1BAV A;  4ZYQ A;  1IY7 A;  4MHZ A;  4Z65 A;  5LRG A;  3PBE A;  4OC3 A;  3CPX A;  3B3C A;  4A38 A;  4DYO A;  2BCO A;  1YW4 A;  2V8H A;  3FX6 A;  4P4B A;  4R76 A;  2C1C A;  3BI0 A;  4NGR A;  3CDX A;  5K8N A;  1JQG A;  4OID A;  2IQ6 A;  5LYD A;  4PXC A;  4NFR A;  3SJX A;  3B2Y A;  3WC6 A; 
#chains in the Genus database with same CATH topology
 1Z8L A;  2Y0S A;  5F46 A;  1QVG Y;  4Y7N I;  1TXR A;  5AG6 A;  3SI2 A;  4BBS I;  4MCR A;  2ZEP A;  4CPA A;  3RZO I;  2BOA A;  3G8W A;  2X7B A;  3PP9 A;  3JUW A;  4C7I A;  2VXK A;  2V45 A;  2JS4 A;  4P44 A;  1JJ2 Z;  4S1T A;  2DPT A;  2P6G A;  4IHM A;  5CPA A;  4OAD A;  2AFO A;  2JDC A;  4FUU A;  2JUB A;  4CRZ B;  2Z0Z A;  5FLX f;  3CCE 1;  1TWH I;  2PK7 A;  4FD4 A;  1Q7Y 1;  4IF5 A;  5LRJ A;  2WSA A;  3GKR A;  4RN7 A;  1LRZ A;  4H6U A;  4KVM E;  5IP9 I;  1WWZ A;  4EWC A;  1QVF Y;  5G21 A;  3J81 b;  4HNW B;  2FSR A;  2J8M A;  3I4M I;  3D2M A;  3RZD I;  4MRI A;  2NVX I;  2VUG A;  2QA4 Z;  5IT9 b;  3R9F A;  1S7L A;  3PO2 I;  2EGT A;  1S3Z A;  4OC1 A;  4PK3 A;  4M3S A;  3P2F A;  3E0K A;  1F57 A;  4ZX9 A;  4BBH A;  1K9M 2;  3CCL 1;  4CL1 A;  5J8C A;  2Q0Y A;  2Q43 A;  4RVH A;  2ZEH A;  4MHN A;  3CCQ Z;  4C2Z A;  1ZB8 A;  3T90 A;  2B4D A;  2PJ4 A;  2PJC A;  3D67 A;  1IYK A;  4P6Y A;  1M1K 1;  2NAP A;  3GTK I;  3KIF A;  3EER A;  3G4S Z;  1QSO A;  3PB6 X;  2Z10 A;  4UIA A;  2ATR A;  4ZBG A;  1L1O C;  4AG7 A;  3BHX A;  3D3S A;  2K5T A;  3MGD A;  4XNH C;  2C6P A;  4XPD C;  1I3Q I;  1VQ8 Z;  3SXN A;  4A93 I;  4FAI A;  1IB1 E;  2JLM A;  2M6N A;  3CMA 1;  3H8E A;  3FYN A;  3VTN A;  3TO7 A;  2PIZ A;  5JQ4 A;  2OU2 A;  3GIU A;  2PIY A;  4CYP A;  3DNS A;  4A3K I;  3G3S A;  2YGW A;  3PRT A;  2HC9 A;  4OLL A;  3JTK A;  1AA6 A;  4X6A I;  3BXM A;  4DK1 A;  2DE7 A;  3NH4 A;  2Z3O A;  3IU2 A;  4KSI A;  2FS5 A;  2ZEM A;  4OIW A;  2OZK A;  2QLV B;  4MMO A;  2WZN A;  3S1N I;  5BWA B;  3S16 I;  2OR4 A;  3S1R I;  4RS2 A;  3H5Z A;  2PJ2 A;  4FD6 A;  1Z5R A;  3IEH A;  4NBF A;  4CGO A;  4JXR A;  4BBR I;  2GIV A;  3FIX A;  7CPA A;  1XF8 A;  3CQZ I;  3IWG A;  4CAX A;  5IB9 A;  2PVV A;  4NJR A;  1VQ6 Z;  3KR4 A;  3GTM S;  3K9U A;  4QTU A;  2H5M A;  1ZG7 A;  3WR7 A;  3VWD A;  4QUS A;  3H3V J;  2GLF A;  2HUZ A;  4X5K A;  2RT9 A;  3CCQ 1;  2REE A;  4MH4 A;  5LL6 f;  4BMH A;  4DQY B;  2VPX A;  1AYE A;  2HF1 A;  1VQ9 Z;  4R6T A;  1CPS A;  5T6B A;  2AKL A;  1Z4R A;  2ZEL A;  3NE8 A;  1K8A 1;  4DNC A;  3G4S 1;  1SQH A;  3GLJ A;  2VI7 A;  3J80 b;  3HOX I;  1YX0 A;  2YND A;  4OC4 A;  1VQ8 1;  1M4I A;  3IO1 A;  2Z11 A;  4MHD A;  4MY0 A;  4PXE A;  3CD6 1;  1VQN Z;  1LAM A;  4A3B I;  1DTD A;  4P4D A;  1TWC I;  2I00 A;  2VL1 A;  4E2X A;  2AFW A;  1YJN 1;  2FE7 A;  2REF A;  3D68 A;  2O28 A;  2PDO A;  3IFE A;  4RI1 A;  2PR8 A;  3CZX A;  3GTL I;  4XPL A;  2PJ3 A;  3FH4 A;  2F8H A;  4KVO E;  5JH9 A;  1NSA A;  1KZF A;  1TF9 A;  3CCS Z;  3I1U A;  2VBQ A;  2R93 I;  3HOU I;  2HB6 A;  1S72 Z;  4HPS A;  4IAV A;  1FDI A;  3T9Y A;  1Q82 1;  2VEZ A;  1N71 A;  1WK4 A;  2OH1 A;  2EVN A;  2CIJ A;  1JWQ A;  5F47 A;  3WC5 A;  1USP A;  5EBV A;  1QSR A;  2J9A A;  1UFH A;  2OZG A;  3W6X A;  3CC4 Z;  2O53 A;  3S17 I;  1SIW A;  3IGR A;  4NOZ A;  1IOF A;  1RO2 A;  2F4M A;  3FJU A;  4KSA A;  1VQK 1;  2EWB A;  2V8K A;  4LQ6 A;  3HLP A;  2G9D A;  2RHB A;  3FQQ A;  3TC8 A;  1MK4 A;  3S6K A;  2LFU A;  3S14 I;  3FMC A;  4NB9 A;  2PJ7 A;  1WCM I;  4ZY0 A;  3F8K A;  1BPM A;  4OC2 A;  4RUH A;  1YVO A;  3G6E Z;  1Z8T A;  1YVK A;  2DE6 A;  3T4N B;  3B8G A;  1NP6 A;  1IY7 A;  2R98 A;  4MHZ A;  2W03 A;  1CJW A;  1S60 A;  4Z65 A;  3CPX A;  3B3C A;  4A32 A;  4AG9 A;  1VQM Z;  3TCV A;  1VQN 1;  1P9N A;  2Y0M A;  4NGR A;  1VQ4 1;  3CDX A;  3DR6 A;  4NFR A;  2IZ4 A;  1M4D A;  5H86 A;  4P10 A;  1YIJ 1;  1AMP A;  5G22 A;  4R57 A;  4AXV A;  3EXN A;  1N8R 1;  3F0A A;  2R8V A;  3ZZI A;  3QB8 A;  4EME A;  2W04 A;  2V8V A;  3CCS 1;  1M4L A;  1K73 2;  4PQA A;  1R43 A;  4M6G A;  2CY2 A;  2EK8 A;  2GU2 A;  2B4B A;  1S72 1;  4FD5 A;  3GCF A;  2R92 I;  4A33 A;  1Q82 2;  3GUX A;  4F9U A;  4MFL A;  4NBG A;  1HEE A;  1ZG9 A;  5HVF A;  4NGP A;  2G3T A;  3A9L A;  8CPA A;  3V38 A;  4Q7A A;  2FIA A;  1Y8C A;  2I3C A;  3CC4 1;  1TWG I;  1RQF A;  4R9M A;  4UFW A;  1W2B Z;  4MHP A;  1M90 2;  2QRE B;  1XBU A;  4GXH A;  3CXC Y;  1YME A;  3CXP A;  4L89 A;  3K2K A;  3LWU A;  2F7V A;  4JYW A;  5HVG A;  5KTD A;  2PJ6 A;  1CG2 A;  2ZOG A;  3D7D A;  5KTC A;  1YI2 Z;  2XEF A;  1YR0 A;  4R87 A;  1B87 A;  1RTQ A;  4B5P B;  3EY5 A;  2PR1 A;  3LOD A;  3S9N A;  1Z01 A;  1WW9 A;  2JA5 I;  3G6E 1;  1P0H A;  1BOB A;  2NYQ A;  4OKO A;  4I49 A;  1Q81 1;  5JPH A;  4H6Z A;  3CCJ 1;  5F48 A;  3SI0 A;  1VIX A;  1VQM 1;  1LAN A;  3IIB A;  1XEB A;  1ZG8 A;  3MON A;  3IJ3 A;  1CP6 A;  1IOI A;  2BJO A;  4CGN A;  2J6A A;  2ZEG A;  4JLY A;  2P3Y A;  3D2P A;  3F3P C;  1MJB A;  4HH4 A;  3W91 A;  4E2A A;  2JA8 I;  3FED A;  3OW2 Y;  3BG0 B;  2KCW A;  1LQL A;  3R96 A;  3JVN A;  4MCP A;  2XEG A;  1YLE A;  1Q2D A;  2PJ8 A;  5T67 A;  3CMA Z;  3FNC A;  2JIQ A;  2FT0 A;  1VKC A;  5DS0 A;  3D66 A;  4UEZ A;  3T8W A;  3GTG I;  4CAE A;  4MCQ A;  4UWJ A;  2P0W A;  4ZY2 A;  5J1Q A;  2PJA A;  1I1D A;  3RAM A;  4F6A A;  3UY5 A;  3N5F A;  3CPW Z;  4TWE A;  4NJQ A;  2PRB A;  2JIO A;  2ZW5 A;  3FBU A;  4E32 A;  3D7G A;  1XMB A;  2E7Z A;  2PSW A;  3KL9 A;  1YI2 1;  2CXA A;  5A2Q b;  3MZL B;  4M85 A;  4TNU A;  3PFE A;  1XRY A;  2YNC A;  2OTL 1;  1YK3 A;  1Q81 2;  5CBM A;  1MJ9 A;  2J8N A;  2K5R A;  3I4N I;  3WC7 A;  1KQS Y;  3L2N A;  4A3J I;  2R7Z I;  1KD1 1;  1VHO A;  5HVH A;  2ZW4 A;  4MFP A;  1I21 A;  4MFZ A;  3I07 A;  3OWC A;  2NMT A;  3K7A I;  1AUG A;  1LOK A;  5HXD A;  5F09 A;  4Q36 A;  4GS4 A;  1KUY A;  3VAR A;  3R95 A;  5LRK A;  1Z2L A;  1B6B A;  2VF1 A;  4QTT A;  2LEX A;  2DEA A;  4RVD A;  2GTI A;  3HUV A;  4KLW A;  3NFZ A;  4F0Y A;  1ELM P;  1XJO A;  3KKW A;  4MD8 A;  3CD6 Z;  4ZX8 A;  1Q2Y A;  2VPZ A;  1NSL A;  3TT2 A;  4C2X A;  3SJF A;  2VUM I;  2P6F A;  3RBU A;  2QRC B;  5AGE A;  4B13 A;  1DL6 A;  4B5P A;  5IV0 A;  1Y1V S;  1K4J A;  1YJN Z;  2E9H A;  1YUA A;  1Q7Y 2;  1U6M A;  3B7I A;  2PJ0 A;  3EED A;  2Q7S A;  1RO4 A;  2ANP A;  4XPK A;  1PU9 A;  3HKZ A;  5LYL A;  4E8O A;  2ZED A;  4AVB A;  5K8O A;  5FLX b;  4MJ8 A;  1XFO A;  1IGB A;  2B5G B;  5KTA A;  1QMU A;  5IP7 I;  2AFS A;  5T64 A;  4Y49 C;  4PXB A;  2B3V A;  2AFZ A;  3ISZ A;  1Z02 A;  1YRE A;  4X8I A;  3GKQ A;  4HKF A;  1F2P A;  2D4O A;  3NH8 A;  3KQX A;  3S9L A;  1Z03 A;  4FD7 A;  1ON0 A;  4QBJ A;  3KR5 A;  2V77 A;  1X12 A;  2KPI A;  2YNC C;  2FVG A;  5H84 A;  2Q4Z A;  3VMI A;  2JEW A;  5C4J I;  3H8F A;  3B3T A;  3NA6 A;  4AB7 A;  4ZY1 A;  1A2Z A;  2JNY A;  1VQK Z;  3CC7 Z;  4NBE A;  1QVG Z;  3IWW A;  1FY7 A;  2QIR A;  3ESW A;  4JWP A;  1QF8 A;  5K8M A;  3TE4 A;  5AG5 A;  1KC8 1;  1M1K 2;  4OC0 A;  1GHE A;  5LYI A;  4MY3 A;  4MI4 A;  4L8A A;  3TE5 B;  2Z3P A;  4OP4 A;  3MZK B;  4LQG A;  4ZYQ A;  5C44 I;  5LRG A;  4OC3 A;  4A38 A;  2YNE A;  2A4N A;  3CCM 1;  2V8H A;  4A3M I;  2C1C A;  3PZJ A;  3BI0 A;  2H85 A;  3NE7 A;  4UCM A;  1BO4 A;  3ZJ0 A;  1KUX A;  4MBU A;  5K8N A;  1KRL A;  1NUI A;  1VQ4 Z;  3WC6 A;  2C6G A;  4NGM A;  2RC4 A;  3BJ8 A;  4YWY A;  1Y9K A;  1QVF Z;  1Z4E A;  3I55 Z;  4A3C I;  4WWV A;  2PJB A;  4NCZ A;  3JAM f;  1RO5 A;  1LCP A;  5FLM I;  1YIJ Z;  1TWF I;  4HNY B;  4E0A A;  1FDO A;  2VZY A;  3KZW A;  4KSF A;  5EC4 A;  2CTC A;  2JDD A;  3D6W A;  1TFI A;  2BL1 A;  3S6H A;  3D7H A;  2GFQ A;  4NBB A;  4NH1 C;  5D29 A;  3DGV A;  5E96 A;  3DDD A;  1Y1V I;  4RV9 A;  2RFH A;  2ZPA A;  3BI1 A;  4NGT A;  2EUI A;  3TO9 A;  4ONU A;  2RPR A;  3FEC A;  1S5K A;  1BLL E;  1QYP A;  4RS4 A;  1CP7 A;  4X2T A;  2WUU A;  2QJ8 A;  4AVA A;  2DXQ A;  2ZOF A;  4MCS A;  3GY9 A;  2OOX B;  1N2F A;  2ZEN A;  2AFU A;  4NGN A;  1YJW Z;  1OZP A;  3TOA A;  3CC7 1;  4OC5 A;  3VH9 A;  1ZLH A;  5ELY A;  3RO0 A;  2CNT A;  1FNO A;  3FKI I;  3SJG A;  4H89 A;  2GLJ A;  5AG4 A;  2CNS A;  3GTO I;  1K8A 2;  1Y7R A;  5D1P A;  1SFO I;  4NBD A;  1R3N A;  5G20 A;  4MD7 A;  1JJ2 Y;  2PVW A;  4NXY A;  3CPA A;  4MON A;  2QVP A;  3V7Z A;  5K8P A;  3CCJ Z;  5I0C A;  2WYR A;  2E2I I;  4P4I A;  4J3G A;  3IWE A;  4OAE A;  4MHY A;  4NSQ A;  1GYT A;  4KOS A;  2C27 A;  3GTQ I;  2B5G A;  2G0B A;  3S6F A;  1ELL P;  4BY7 I;  4U9Y A;  4K30 A;  4PPZ A;  3CCU 1;  4U9Z A;  3I55 1;  4HGY A;  1KUV A;  2G3A A;  4A2Z A;  2V8J A;  1OBR A;  4PXD A;  1ARM A;  4YU9 A;  5IX3 A;  2YU9 I;  3FB3 A;  2PE3 A;  2POK A;  4UCN A;  2ZXV A;  1FT7 A;  4AYB A;  1X3W A;  4P45 A;  2EBJ A;  5GCN A;  4MD9 A;  4NGQ A;  1WZN A;  3HOY I;  2V8G A;  1NE9 A;  4GM5 A;  3FQM A;  3IU1 A;  2P28 A;  1MJA A;  4X3R A;  3R1K A;  2IMO A;  1VQP Z;  2E2H I;  4K3N A;  2QEC A;  2LIY A;  1Q86 1;  3SI1 A;  4JJX A;  5D1O B;  2OOY B;  4KOX A;  2IV2 X;  1YQE A;  4E31 A;  2PCU A;  1Y0R A;  1YJW 1;  2BO9 A;  4DUK A;  1M44 A;  3CXS A;  5A27 A;  4KOW A;  1VGY A;  1WJ2 A;  3J81 f;  3FF3 A;  4EFD A;  3D9X A;  1YIT Z;  4YFJ A;  1PFT A;  4AVC A;  1LFW A;  4RVF A;  2ABZ A;  4M6I A;  4A39 A;  5IT9 f;  2V8D A;  2F4O A;  2Q44 A;  2OTL Z;  4A95 A;  3R9E A;  2FXF A;  3VB9 A;  1I12 A;  1X0T A;  2NVY I;  2PJ1 A;  5CM2 M;  1BPN A;  3KQZ A;  2KI7 B;  1CPX A;  2R7H A;  4FWU A;  2ZEE A;  4OME A;  3SHP A;  3HOW I;  3Q87 A;  4YGO A;  4MFQ A;  2ZEF A;  2ZW6 A;  1Z9U A;  3C26 A;  1S7F A;  5A28 A;  1K9M 1;  1I6H I;  2JIM A;  1VHE A;  1RNI A;  1YUK A;  4KLV A;  1N8R 2;  3I3G A;  1Q7L A;  2G2K A;  4NBA A;  2ZAE B;  3BLN A;  1VQ5 Z;  2O4H A;  2Z3N A;  2QML A;  1HDQ A;  1QST A;  4CYN A;  4HGZ A;  1TKJ A;  4C68 A;  3PFO A;  1EE3 P;  3B3W A;  4QC6 A;  4E2W A;  3CC2 Z;  4BXX I;  4CAF A;  4UEF A;  1ZH1 A;  2OB0 A;  1VQP 1;  3PB8 X;  3KHX A;  3M4O I;  1Q86 2;  2OTJ Z;  2XEJ A;  4E2Y A;  1ZB9 A;  4BIN A;  1YW6 A;  3KAS A;  2JR6 A;  3D8P A;  3KGQ A;  2Z3K A;  4R8F A;  3CT9 A;  3QWU A;  4W9Y A;  2GRE A;  5FVJ A;  1IIC A;  3S1M I;  1YHQ Z;  3ISX A;  2BUE A;  3NDJ A;  1S7N A;  2WAQ A;  3I56 Z;  1CBX A;  1V0C A;  2VQY A;  5C4X I;  1YIT 1;  2K3R A;  2DE5 A;  1PUA A;  4ORF A;  4UA3 A;  4F9V A;  3N7Z A;  4NEX A;  4CYO A;  3P2H A;  3JRU A;  1P4N A;  4A30 A;  4UCP A;  2ZEO A;  4JXQ A;  4KOV A;  3TX8 A;  5C82 A;  4KUA A;  2Z3M A;  4PSW A;  4EVY A;  4UWI A;  4A37 A;  1M1D A;  3V8I A;  1QSM A;  1VQL 1;  3DLJ A;  4F8Z A;  2FIW A;  6CPA A;  5JGF A;  2PRQ A;  3H8G A;  5D1O A;  3VMG A;  2R1I A;  2DF5 A;  3J80 f;  2B3U A;  1VQ5 1;  2EO8 A;  3PBE A;  2Q4Y A;  4DYO A;  3FX6 A;  4P4B A;  1JWH C;  4BY1 I;  5C88 A;  3P5J B;  1WII A;  3CCM Z;  1JQG A;  3GTP I;  3CC2 1;  2CNM A;  1USP B;  4UBR A;  2IQ6 A;  1X10 A;  4PSX A;  3PGP A;  4B5O A;  4CAV A;  3G71 Z;  2J8R A;  3S15 I;  3IFU A;  3PO3 S;  2R6M A;  2ARH A;  1ZO0 A;  4RVG A;  3GTJ I;  3CXC Z;  2HU9 A;  3CCV Z;  1TIQ A;  2OTJ 1;  4B12 A;  2VPW A;  1J4J A;  2B58 A;  1K83 I;  4JD6 A;  4E2Z A;  2NSM A;  4UIB A;  1LAP A;  2CF4 A;  1YHQ 1;  3BG1 B;  3HOZ I;  3S1Q I;  3I56 1;  4R3K A;  4MFK A;  1YSJ A;  3FVL A;  3WT4 A;  3M3Y I;  1QXF A;  4CGP A;  4YRH A;  4CYQ A;  4KVX A;  1CX8 A;  1Y7E A;  2Q7B A;  3FEE A;  3GB0 A;  1UWY A;  3CCR Z;  3GYA A;  5IB0 A;  2Q04 A;  2F5I A;  5ISV A;  4CRY B;  2QA4 1;  4CGM A;  3OW2 Z;  1XE4 A;  1KD1 2;  2WPW A;  2JIR A;  3LUS A;  1F2O A;  1ZLI A;  3B3S A;  3DR8 A;  4BD9 A;  3EFA A;  4NBC A;  4P4F A;  1YJ9 Z;  1I50 I;  3KIH A;  2GE3 A;  3VMH A;  1XOV A;  3LAC A;  4MFJ A;  2AE6 A;  3TTH A;  3D2L A;  2OOT A;  1R9T I;  3EC4 A;  3D4U A;  3TDH B;  2OZU A;  3TO6 A;  2JBK A;  4XX2 A;  3VAT A;  2JA6 I;  4B6Z A;  3H0G I;  2RB7 A;  2V3V A;  3CME Z;  3B3V A;  1W2B Y;  2Q51 A;  2IZ3 A;  3NDI A;  5DWM A;  3G71 1;  4R7M A;  2JMO A;  3D7F A;  1Z8X A;  3RZA A;  3QNV A;  3CCV 1;  3I9S A;  3CCU Z;  3U50 C;  2AJ6 A;  2PC1 A;  2E2J I;  1IYL A;  4EWT A;  4P4J A;  5D8N A;  1M4G A;  2QRD B;  2PJ9 A;  2IJZ A;  4PV6 A;  2QEX Z;  3TOB A;  2BEI A;  4B10 A;  4II9 A;  4KOT A;  2VZZ A;  4M6H A;  3SJE A;  4KZT A;  3PO3 I;  3EO4 A;  1NJI 1;  1PYT B;  2ZW7 A;  5HMN A;  3BJ7 A;  3J7A 4;  3KHZ A;  3TFY A;  5JM6 A;  3F5B A;  3IC1 A;  1VQ7 Z;  4A3I I;  1KQS Z;  4DJL A;  3RYO A;  3S6G A;  1S7M A;  2PJ5 A;  2JBJ A;  4KOY A;  4LX9 A;  4B14 A;  2V8I A;  1K73 1;  1KWM A;  1YLO A;  3CCR 1;  4ZI6 A;  1Y9W A;  4CAW A;  4PK2 A;  4ZGY B;  1Y1W I;  4E30 A;  2FCK A;  1VQO Z;  4ONW A;  2QR1 B;  1VQ6 1;  2Q4V A;  4A94 A;  1YJ9 1;  1TKF A;  4XNH B;  2B63 I;  4XPD B;  2AFX A;  1S7K A;  1KC8 2;  1Z8W A;  2P6E A;  4O23 A;  4E33 A;  1CM0 A;  4FBE A;  1M90 1;  4MXU A;  4HNX B;  2GAN A;  1IU8 A;  1X3Z A;  3B35 A;  4R3L A;  1RO0 A;  1HDU A;  2VPY A;  4IUS A;  1Q16 A;  1VQ9 1;  3LMS A;  5I4M A;  3GTM I;  3CME 1;  2IL4 A;  2ODF A;  3PB4 X;  3CPW Y;  3H4Q A;  3MN8 A;  2FL4 A;  2Z3L A;  3MRU A;  2M48 A;  2XEI A;  3QAH A;  1IID A;  4KOU A;  3PEI A;  4C2Y A;  2JEV A;  4A3L I;  4UF4 A;  4Y52 I;  4CS0 B;  3WAB A;  3K9T A;  4Y49 B;  4NBH A;  2OZH A;  1L0C A;  1ARL A;  2QEX 1;  2PMZ A;  2CTB A;  4KS9 A;  3S9M A;  5J8F A;  4H2K A;  3W6S A;  1NJI 2;  2JIP A;  1H8L A;  2QKD A;  3JAM b;  2RBL A;  4NB8 A;  1VLA A;  2BSW A;  4NF1 A;  1VQ7 1;  4QVT A;  2AYD A;  2NVT I;  4KOR A;  3F3F C;  2QYV A;  4C7H A;  1TWA I;  2I79 A;  3QAY A;  3RNZ A;  2YAD A;  4Q38 A;  4UEE A;  4P4E A;  3PBB A;  5G1Z A;  2GTH A;  1RXT A;  1DE4 C;  2NVQ I;  2AFM A;  3R9G A;  1RLY A;  1VHS A;  1YGH A;  3CXQ A;  2B4D B;  4A3G I;  3PB9 X;  1VQO 1;  1PCA A;  4KUB A;  4LUA A;  4IK2 A;  1TKH A;  2PQ8 A;  4UFV A;  5LYF A;  5F49 A;  3FXT A;  4B11 A;  3CCE Z;  1Y0Y A;  3IR7 A;  5AN9 F;  3NH5 A;  4DGL A;  1XMT A;  4CGL A;  1Q2C A;  2WB1 A;  4G1P A;  4A3D I;  3S2H I;  3DSB A;  5A2Q f;  5HH1 A;  5CNP A;  1XIX A;  3KI9 A;  2C6C A;  1TF8 A;  4WJB A;  1NMT A;  2HV2 A;  3PB7 X;  1QQ9 A;  2D4P A;  2EK9 A;  3LD2 A;  4U5Y A;  4F0X A;  5EMI A;  2JA7 I;  5C3E I;  2RIQ A;  4UFX A;  5DWN A;  5THW A;  1QSN A;  4NGS A;  3VWE A;  4JZ0 A;  3S2D I;  1VQL Z;  4A31 A;  4A3F I;  2PM9 A;  1ML8 A;  3CCL Z;  5AG7 A;  1R57 A;  3IF8 A;  3IX0 A;  1BAV A;  3SXO A;  3FRM A;  2BCO A;  1YW4 A;  4R76 A;  3HOV I;  4OID A;  2HQY A;  4QB9 A;  5LYD A;  4A3E I;  4PXC A;  3SJX A;  3B2Y A;  2DPS A;  2WPX A; 
#chains in the Genus database with same CATH homology
 4P10 A;  4RVG A;  3GTJ I;  2C6G A;  3CXC Z;  4NGM A;  2HU9 A;  4YWY A;  1Z8L A;  3CCV Z;  2Y0S A;  1QVF Z;  1YIJ 1;  3I55 Z;  1AMP A;  4A3C I;  2OTJ 1;  4WWV A;  2PJB A;  1QVG Y;  3JAM f;  4AXV A;  1N8R 1;  4Y7N I;  1LCP A;  1TXR A;  5FLM I;  1YIJ Z;  4BBS I;  3SI2 A;  1TWF I;  4MCR A;  2ZEP A;  4EME A;  2W04 A;  2V8V A;  3CCS 1;  3KZW A;  4CPA A;  1M4L A;  2CTC A;  1K73 2;  4PQA A;  1R43 A;  3RZO I;  3D6W A;  2BOA A;  1K83 I;  1TFI A;  2GU2 A;  1S72 1;  2EK8 A;  4E2Z A;  2NSM A;  4UIB A;  3GCF A;  2R92 I;  3D7H A;  1Q82 2;  3GUX A;  4F9U A;  2JS4 A;  1LAP A;  2CF4 A;  4P44 A;  4NBB A;  4NH1 C;  4NBG A;  1YHQ 1;  1HEE A;  5D29 A;  1ZG9 A;  1JJ2 Z;  4S1T A;  3DGV A;  5HVF A;  3BG1 B;  3HOZ I;  3S1Q I;  4IHM A;  5CPA A;  3I56 1;  1YSJ A;  2AFO A;  1Y1V I;  4FUU A;  4NGP A;  4RV9 A;  2JUB A;  2RFH A;  8CPA A;  3FVL A;  3WT4 A;  3V38 A;  5FLX f;  3CCE 1;  3BI1 A;  1TWH I;  3M3Y I;  4NGT A;  4Q7A A;  2PK7 A;  1Q7Y 1;  2RPR A;  3FEC A;  2I3C A;  1BLL E;  3CC4 1;  1QYP A;  4RS4 A;  1CP7 A;  5LRJ A;  4X2T A;  1CX8 A;  2QJ8 A;  1TWG I;  1RQF A;  2ZOF A;  1Y7E A;  1W2B Z;  4MCS A;  4MHP A;  3FEE A;  1M90 2;  2OOX B;  2QRE B;  1XBU A;  3GB0 A;  5IP9 I;  1UWY A;  1N2F A;  3CXC Y;  1YME A;  3CCR Z;  2ZEN A;  4EWC A;  1QVF Y;  2AFU A;  3K2K A;  3LWU A;  4NGN A;  1YJW Z;  3J81 b;  2F7V A;  4JYW A;  5HVG A;  3CC7 1;  2QA4 1;  3I4M I;  3OW2 Z;  4OC5 A;  3VH9 A;  1ZLH A;  5ELY A;  2PJ6 A;  1KD1 2;  1FNO A;  3RZD I;  1CG2 A;  3LUS A;  3FKI I;  2ZOG A;  4MRI A;  2NVX I;  3SJG A;  2VUG A;  3D7D A;  1F2O A;  2QA4 Z;  1ZLI A;  5IT9 b;  3B3S A;  4BD9 A;  1YI2 Z;  2GLJ A;  4NBC A;  4P4F A;  1YJ9 Z;  3PO2 I;  1I50 I;  3KIH A;  3GTO I;  2XEF A;  2EGT A;  3VMH A;  1K8A 2;  1RTQ A;  3S9N A;  1Z01 A;  4OC1 A;  5D1P A;  1SFO I;  4NBD A;  1R3N A;  1F57 A;  1WW9 A;  4ZX9 A;  4MD7 A;  1K9M 2;  2JA5 I;  1JJ2 Y;  3G6E 1;  3CCL 1;  4CL1 A;  2PVW A;  2NYQ A;  4OKO A;  2OOT A;  1Q81 1;  1R9T I;  3D4U A;  3TDH B;  2Q43 A;  3CPA A;  3CCJ 1;  4RVH A;  2JBK A;  3SI0 A;  4XX2 A;  3VAT A;  2JA6 I;  4MON A;  2QVP A;  2ZEH A;  3V7Z A;  4B6Z A;  4MHN A;  1VIX A;  5K8P A;  3H0G I;  1VQM 1;  1LAN A;  3IIB A;  3CCJ Z;  3CCQ Z;  2RB7 A;  2WYR A;  2E2I I;  4P4I A;  1ZG8 A;  4MHY A;  3MON A;  3IJ3 A;  1ZB8 A;  1GYT A;  1CP6 A;  3CME Z;  3B3V A;  3GTQ I;  2BJO A;  1W2B Y;  2PJ4 A;  2PJC A;  3D67 A;  2Q51 A;  2IZ3 A;  1ELL P;  3NDI A;  4BY7 I;  4P6Y A;  3G71 1;  4R7M A;  1M1K 1;  2J6A A;  2ZEG A;  3GTK I;  2P3Y A;  3KIF A;  2JMO A;  3D7F A;  3EER A;  3G4S Z;  4PPZ A;  3CCU 1;  3RZA A;  3PB6 X;  3F3P C;  3QNV A;  4UIA A;  4HH4 A;  3CCV 1;  1L1O C;  2JA8 I;  3I55 1;  3BHX A;  3CCU Z;  3FED A;  3U50 C;  3OW2 Y;  3BG0 B;  4HGY A;  2E2J I;  2C6P A;  1I3Q I;  1VQ8 Z;  2V8J A;  4EWT A;  1OBR A;  4PXD A;  1ARM A;  1LQL A;  4P4J A;  4A93 I;  4FAI A;  4YU9 A;  4MCP A;  2YU9 I;  5D8N A;  2XEG A;  2M6N A;  2PE3 A;  2PJ8 A;  3CMA 1;  2QRD B;  2PJ9 A;  2IJZ A;  2POK A;  2QEX Z;  3H8E A;  1FT7 A;  4AYB A;  3VTN A;  1X3W A;  5T67 A;  3CMA Z;  2PIZ A;  4P45 A;  4MD9 A;  3SJE A;  4NGQ A;  3PO3 I;  3HOY I;  1NJI 1;  2V8G A;  4GM5 A;  1PYT B;  2PIY A;  5DS0 A;  3D66 A;  4UEZ A;  3FQM A;  4A3K I;  3T8W A;  2P28 A;  3PRT A;  3GTG I;  3J7A 4;  3KHZ A;  4X3R A;  2IMO A;  2HC9 A;  5JM6 A;  1VQP Z;  3IC1 A;  2E2H I;  4K3N A;  4MCQ A;  1VQ7 Z;  4A3I I;  4X6A I;  3BXM A;  4ZY2 A;  1KQS Z;  2PJA A;  4DJL A;  4DK1 A;  2DE7 A;  5J1Q A;  3NH4 A;  2LIY A;  1Q86 1;  3RAM A;  1S7M A;  3SI1 A;  2PJ5 A;  4KSI A;  2ZEM A;  5D1O B;  2JBJ A;  3N5F A;  4OIW A;  2OOY B;  3CPW Z;  2OZK A;  2QLV B;  2V8I A;  1K73 1;  4TWE A;  4NJQ A;  1KWM A;  4MMO A;  2WZN A;  3S1N I;  4E31 A;  1YLO A;  2PCU A;  3CCR 1;  1Y0R A;  4ZI6 A;  3S16 I;  2OR4 A;  1YJW 1;  2BO9 A;  3S1R I;  1Y1W I;  4DUK A;  4E30 A;  4E32 A;  3D7G A;  1VQO Z;  1XMB A;  4ONW A;  2PJ2 A;  2QR1 B;  1Z5R A;  3IEH A;  1VGY A;  4NBF A;  1VQ6 1;  3KL9 A;  3J81 f;  1YI2 1;  3FF3 A;  4BBR I;  4A94 A;  1YJ9 1;  1TKF A;  4EFD A;  3D9X A;  1YIT Z;  3CQZ I;  5A2Q b;  7CPA A;  5IB9 A;  2B63 I;  2PVV A;  3MZL B;  4NJR A;  1VQ6 Z;  3KR4 A;  2AFX A;  4TNU A;  1PFT A;  3GTM S;  1LFW A;  1KC8 2;  4O23 A;  3PFE A;  4RVF A;  4QTU A;  2ABZ A;  4E33 A;  1ZG7 A;  1XRY A;  4A39 A;  5IT9 f;  2OTL 1;  2V8D A;  1Q81 2;  1M90 1;  4FBE A;  5CBM A;  2F4O A;  4MXU A;  3H3V J;  2OTL Z;  2GLF A;  1X3Z A;  2K5R A;  3B35 A;  3VB9 A;  3I4N I;  3WC7 A;  1KQS Y;  1RO0 A;  2RT9 A;  1HDU A;  1X0T A;  2NVY I;  2PJ1 A;  3CCQ 1;  4MH4 A;  5CM2 M;  1BPN A;  1VQ9 1;  3KQZ A;  2KI7 B;  5LL6 f;  1CPX A;  3L2N A;  3LMS A;  4A3J I;  2R7Z I;  4FWU A;  1KD1 1;  1VHO A;  3GTM I;  2ZEE A;  3CME 1;  4OME A;  5HVH A;  4DQY B;  5I4M A;  3PB4 X;  3CPW Y;  1AYE A;  3I07 A;  2HF1 A;  1VQ9 Z;  4R6T A;  1CPS A;  3MN8 A;  3HOW I;  3K7A I;  5T6B A;  3Q87 A;  2AKL A;  2ZEL A;  2ZEF A;  1LOK A;  1K8A 1;  5HXD A;  3G4S 1;  5F09 A;  3MRU A;  3GLJ A;  2M48 A;  2XEI A;  3VAR A;  3J80 b;  3HOX I;  1K9M 1;  1I6H I;  3PEI A;  5LRK A;  1Z2L A;  1VHE A;  1RNI A;  4A3L I;  4UF4 A;  4OC4 A;  1YUK A;  4Y52 I;  2VF1 A;  4QTT A;  1VQ8 1;  3IO1 A;  1N8R 2;  3WAB A;  1Q7L A;  3K9T A;  2G2K A;  4NBH A;  4NBA A;  2ZAE B;  2DEA A;  4RVD A;  2GTI A;  3HUV A;  1ARL A;  2QEX 1;  1VQ5 Z;  2O4H A;  4PXE A;  3NFZ A;  1HDQ A;  2PMZ A;  3CD6 1;  2CTB A;  1ELM P;  3S9M A;  1VQN Z;  4HGZ A;  1TKJ A;  1XJO A;  4H2K A;  3PFO A;  1EE3 P;  4MD8 A;  1NJI 2;  3CD6 Z;  1H8L A;  4ZX8 A;  3B3W A;  1LAM A;  4A3B I;  2QKD A;  4E2W A;  3CC2 Z;  1DTD A;  4BXX I;  4P4D A;  1TWC I;  4UEF A;  1ZH1 A;  3JAM b;  2RBL A;  2VL1 A;  3SJF A;  4NB8 A;  1VLA A;  4E2X A;  2AFW A;  1VQP 1;  1YJN 1;  2VUM I;  3PB8 X;  1VQ7 1;  3RBU A;  2QRC B;  3D68 A;  3KHX A;  2NVT I;  3M4O I;  1DL6 A;  1Q86 2;  1Y1V S;  3IFE A;  2OTJ Z;  1YJN Z;  2XEJ A;  2E9H A;  1YUA A;  3F3F C;  1Q7Y 2;  3GTL I;  2QYV A;  2PJ3 A;  1TWA I;  2F8H A;  3FH4 A;  4E2Y A;  1ZB9 A;  3B7I A;  5JH9 A;  1NSA A;  2YAD A;  4UEE A;  1YW6 A;  2PJ0 A;  3KAS A;  4P4E A;  1TF9 A;  3CCS Z;  3I1U A;  2JR6 A;  3PBB A;  3EED A;  3KGQ A;  1RO4 A;  2R93 I;  2ANP A;  2GTH A;  3HOU I;  2HB6 A;  1S72 Z;  4R8F A;  3CT9 A;  1DE4 C;  4IAV A;  2NVQ I;  3HKZ A;  2AFM A;  5LYL A;  3QWU A;  2ZED A;  4W9Y A;  1RLY A;  2GRE A;  5K8O A;  5FLX b;  1Q82 1;  1XFO A;  4A3G I;  1IGB A;  3PB9 X;  1VQO 1;  1QMU A;  1PCA A;  3S1M I;  1YHQ Z;  5IP7 I;  2AFS A;  3ISX A;  5T64 A;  4IK2 A;  4PXB A;  3NDJ A;  2WAQ A;  1TKH A;  3I56 Z;  1CBX A;  5LYF A;  2CIJ A;  2AFZ A;  3ISZ A;  1Z02 A;  5C4X I;  1YIT 1;  3WC5 A;  4X8I A;  3GKQ A;  1USP A;  3CCE Z;  1Y0Y A;  2K3R A;  1F2P A;  2DE5 A;  3NH8 A;  2J9A A;  5AN9 F;  3KQX A;  3NH5 A;  3S9L A;  4DGL A;  2WB1 A;  3CC4 Z;  4G1P A;  1Z03 A;  4A3D I;  2O53 A;  3S17 I;  3S2H I;  5A2Q f;  3KR5 A;  4NOZ A;  2V77 A;  4F9V A;  1RO2 A;  2F4M A;  2KPI A;  2C6C A;  3KI9 A;  1TF8 A;  2FVG A;  4WJB A;  2Q4Z A;  3FJU A;  3PB7 X;  3VMI A;  2JEW A;  1QQ9 A;  3JRU A;  5C4J I;  3H8F A;  3SJX A;  2EK9 A;  1VQK 1;  2ZEO A;  2EWB A;  3B3T A;  3NA6 A;  2V8K A;  4ZY1 A;  3TX8 A;  3HLP A;  2JNY A;  1VQK Z;  3CC7 Z;  4NBE A;  1QVG Z;  2G9D A;  2RHB A;  3FQQ A;  3IWW A;  2JA7 I;  5C3E I;  3TC8 A;  2LFU A;  2RIQ A;  3ESW A;  3S14 I;  4A37 A;  1QF8 A;  5K8M A;  3FMC A;  4NB9 A;  2PJ7 A;  1VQL 1;  1WCM I;  1KC8 1;  1M1K 2;  5THW A;  3DLJ A;  4ZY0 A;  4F8Z A;  4NGS A;  1BPM A;  4JZ0 A;  4OC0 A;  5LYI A;  6CPA A;  3S2D I;  5JGF A;  2PRQ A;  1VQL Z;  4OC2 A;  4RUH A;  4A3F I;  2PM9 A;  3TE5 B;  1ML8 A;  3G6E Z;  3CCL Z;  3H8G A;  2DE6 A;  3T4N B;  5D1O A;  4OP4 A;  3VMG A;  3MZK B;  3IF8 A;  4LQG A;  3IX0 A;  1BAV A;  4ZYQ A;  1NP6 A;  5C44 I;  3J80 f;  1IY7 A;  4MHZ A;  2W03 A;  1VQ5 1;  3PBE A;  5LRG A;  4OC3 A;  4Z65 A;  3CPX A;  3B3C A;  4A38 A;  1VQM Z;  1VQN 1;  4DYO A;  2BCO A;  3CCM 1;  1YW4 A;  2V8H A;  3FX6 A;  4P4B A;  4R76 A;  4A3M I;  1JWH C;  4BY1 I;  2C1C A;  1P9N A;  2H85 A;  3BI0 A;  3HOV I;  4NGR A;  3P5J B;  1WII A;  1VQ4 1;  3CDX A;  5K8N A;  3CCM Z;  1JQG A;  3GTP I;  3CC2 1;  1KRL A;  1USP B;  4OID A;  2IQ6 A;  5LYD A;  3G71 Z;  4A3E I;  4PXC A;  4NFR A;  2IZ4 A;  3S15 I;  3IFU A;  1NUI A;  1VQ4 Z;  3PO3 S;  3B2Y A;  3WC6 A;  2R6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...