2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
3PB9X 3V7ZA 3B3WA 5CPAA 2JEWA 4OC0A 4NJQA 4EFDA 4A39A 4P4BA 2ZOGA 4PXBA 4R6TA 5D8NA 3T8WA 2PE3A 2PJ3A 1F2OA 1DTDA 4DUKA 1EE3P 3PEIA 3LMSA 5J1QA 1QQ9A 4MHYA 4PQAA 4UEEA 1HDUA 2GLJA 2ZEEA 2JBJA 2ZOFA 4H2KA 3K2KA 1XJOA 3FF3A 3JRUA 5K8PA 4MCRA 4NGNA 1YW4A 5JM6A 3IC1A 1TF8A 1IY7A 2CTCA 1XBUA 5F09A 2PJ6A 2WYRA 4ZY2A 2PJ7A 4JZ0A 2C6GA 1JQGA 5CBMA 3D66A 2POKA 4R76A 2EWBA 1BPMA 3CDXA 3FECA 3I1UA 7CPAA 3D67A 3FVLA 2EK9A 1XRYA 4X3RA 2I3CA 3H8FA 3RBUA 2ZEGA 3LWUA 2PIZA 4P44A 5ELYA 5I4MA 3PB6X 2ZENA 4P4IA 3IIBA 4NGQA 2V8GA 4PXDA 2PJAA 4ZYQA 3WT4A 3IFEA 3KZWA 1HEEA 2PIYA 2ZEFA 2XEIA 4R7MA 5LYFA 1AYEA 2ZEMA 2O53A 4NGSA 3V38A 3CPAA 3KL9A 3GLJA 1ARMA 1Z8LA 2BO9A 4K3NA 6CPAA 3D7DA 3NH5A 2PRQA 1HDQA 3B3CA 3SJFA 4Z65A 4P4EA 5LRJA 3B3VA 5LYIA 1R43A 1UWYA 4LQGA 1H8LA 1ZLIA 2BCOA 5D29A 4B6ZA 2Q43A 1Z5RA 1ZG8A 3HLPA 1Y0RA 3PFOA 1Y7EA 2PJ8A 1F57A 4ZY0A 2AFSA 2V8HA 4UF4A 4P45A 3FX6A 4OC4A 2ANPA 5JGFA 1CPSA 3MRUA 4OMEA 3B3SA 4NGMA 4TWEA 4X2TA 3HUVA 3KGQA 4MCPA 4G1PA 4IAVA 1CPXA 2RB7A 4IHMA 1YMEA 2PJBA 2AFXA 1ELMP 4ONWA 4MHPA 3TC8A 3D7FA 2IJZA 1TF9A 4NGTA 3KQXA 3PFEA 4MHNA 3NFZA 4TNUA 3B3TA 1DE4C 4WJBA 3FEDA 4P4FA 1FNOA 1OBRA 2C6CA 3FJUA 3S9MA 2CF4A 2ZELA 2JBKA 3ISZA 4X8IA 3VARA 5K8NA 1F2PA 3KR4A 2QYVA 3WC7A 5K8MA 4P4DA 2GU2A 3NH8A 2RFHA 2WZNA 1BAVA 1LCPA 5JH9A 4PXCA 2AFWA 2DEAA 3H8GA 1PCAA 2PJ0A 4FBEA 4NFRA 4OKOA 2AFMA 4P10A 3L2NA 3KASA 3WC6A 1CBXA 3BI1A 4IK2A 3KR5A 4UIBA 3RZAA 2PJ4A 2C6PA 3FEEA 3D7GA 4ZX9A 4ZY1A 1KWMA 3FMCA 1NSAA 4NJRA 4RUHA 3VH9A 3S9LA 2PJ2A 3B2YA 4MRIA 4O23A 2O4HA 3S9NA 2J9AA 1LFWA 3ISXA 2XEFA 4ZX8A 1ZG7A 2GLFA 5LYDA 1M4LA 3B7IA 3SI2A 3N5FA 4Q7AA 4FAIA 3BI0A 3PB4X 2PVVA 4MCSA 3D68A 2Q51A 2V8VA 4JYWA 3KI9A 4DJLA 4OC1A 3SJXA 2GREA 2PCUA 4OC5A 4EWTA 3SJEA 4F8ZA 3NH4A 4A38A 2IMOA 2PJCA 3B35A 3WABA 1Y0YA 1VGYA 2PVWA 2PJ9A 4FWUA 4UEZA 4P6YA 5HVFA 4OIWA 1PYTB 4W9YA 1QMUA 2QVPA 2XEGA 1LANA 3IEHA 5LRGA 3KHXA 4KSIA 3BHXA 3PBEA 1TKFA 3IO1A 8CPAA 3DLJA 4OP4A 2AFUA 3PB8X 3SJGA 3H8EA 2NYQA 1TKHA 1GYTA 1VHEA 5HVHA 1CG2A 4YWYA 1RTQA 2NSMA 3FH4A 1YSJA 3PB7X 4FUUA 5HXDA 2Q4ZA 3NA6A 1LOKA 4CPAA 1Q7LA 1VIXA 2ZEOA 5LYLA 4MXUA 2PJ1A 3SI0A 4P4JA 4YU9A 2FVGA 4GM5A 1YLOA 1FT7A 3KQZA 2V8DA 4UIAA 3CT9A 2F7VA 2QJ8A 4OIDA 2HB6A 1LAPA 2PJ5A 1XMBA 3WC5A 3VATA 1VHOA 1AMPA 5HVGA 1Z2LA 2HC9A 3PRTA 1ZLHA 1BLLE 1ARLA 2OOTA 1XFOA 2ZEDA 3IWWA 1IGBA 1TXRA 5DS0A 4NGRA 2OR4A 2VL1A 1R3NA 4EMEA 2ABZA 4UEFA 2ZEPA 4NGPA 4DYOA 3BXMA 4OC2A 4A94A 3PBBA 4PXEA 3RAMA 2IQ6A 2CIJA 2V77A 4WWVA 3TX8A 3GUXA 3KHZA 3SI1A 2ZEHA 2F8HA 5THWA 1ZG9A 3MN8A 4MCQA 4AXVA 3QNVA 2XEJA 1LAMA 3GB0A 3D4UA 2AFOA 2C1CA 4MHZA 4BD9A 4MMOA 5IB9A 1TKJA 3IJ3A 3K9TA 2CTBA 5LRKA 4OC3A 2EK8A 3DGVA 2AFZA 2BOAA 3D7HA 3CPXA 4F9UA 4ZI6A 4PPZA 1CX8A 1CP6A 5K8OA 1CP7A 4R8FA 1ELLP 1BPNA 4F9VA 2G9DA 1YW6A 4A37A
chains in the Genus database with same CATH superfamily
1K9M1 2OZHA 4PXBA 4R6TA 3T8WA 1TWAI 5DWMA 5IB0A 1QVFY 4DK1A 1DTDA 4DUKA 3I07A 1QYPA 5AN9F 3LMSA 2FL4A 4E8OA 1HDUA 1W2BZ 2ZAEB 2GLJA 1QXFA 2EO8A 2OTLZ 3I3GA 2VXKA 3FF3A 3JRUA 3PZJA 1YW4A 5JM6A 3IC1A 4L8AA 2B63I 4E30A 2B4DB 1Z02A 4U5YA 1XF8A 5F09A 2WYRA 3CZXA 4B13A 2PC1A 2Q4YA 4OAEA 2QIRA 2RPRA 2EWBA 3CDXA 4CAFA 3I1UA 2EK9A 2OTL1 4X3RA 3OW2Y 5IP9I 1NUIA 2G3TA 3IR7A 1S72Z 2Z3PA 1VQ8Z 3BJ8A 4A3EI 2E2HI 1LQLA 3PB6X 4UCMA 4A3LI 5F48A 3KZWA 1QSTA 3CXSA 1WJ2A 3CCS1 3H5ZA 3F5BA 5JQ4A 2H85A 3EO4A 3KL9A 3GTOI 1Z8LA 1NSLA 2BO9A 6CPAA 3G6EZ 3C26A 1QF8A 1HDQA 3DSBA 4C2YA 1Y9KA 2GFQA 1K83I 4Y7NI 1UWYA 4LQGA 4B6ZA 2Q43A 4KVME 1QSRA 1X10A 4DNCA 2JA8I 1VHSA 4E2WA 4I49A 3HLPA 4MFPA 4QVTA 1Y0RA 4NBFA 1Y7EA 3I4MI 1Y9WA 1MJAA 1KUXA 4NBBA 3QAYA 4E2ZA 4A95A 4PK2A 2AFSA 4A3KI 4P45A 1NJI2 4A3BI 2GTHA 3MRUA 2I79A 3W6XA 1XMTA 4A30A 3HUVA 3K7AI 1IOIA 2JIRA 4ONUA 4IHMA 5LL6f 1Y8CA 5D1PA 4PSXA 1I12A 4ONWA 1TFIA 5F49A 3RO0A 4MHNA 1KZFA 2YU9I 3P2FA 3B3TA 3FKII 4WJBA 1YVOA 2C6CA 3S9MA 3I561 1OZPA 3VARA 1IICA 4B14A 3G711 2JS4A 2LEXA 1BOBA 3R9EA 3WC7A 2OOXB 1P4NA 1BO4A 4P4DA 3NH8A 4PXCA 3VB9A 5C44I 1S7KA 2PR8A 1V0CA 3IGRA 4FBEA 4FD4A 1GHEA 3WC6A 4IK2A 2PR1A 5T6BA 2VEZA 2G3AA 4MD8A 4FD7A 2QR1B 4GS4A 3FEEA 3R9GA 4NEXA 4RUHA 3S9LA 1WCMI 3MZLB 4E2AA 2DE5A 3S9NA 1CJWA 4CYPA 1TWCI 3ISXA 2XEFA 2JUBA 3SI2A 2F4MA 2WUUA 1KQSY 2R7HA 2G0BA 1YJNZ 3BI0A 3PB4X 2PVVA 4KUBA 4MCSA 4JYWA 3QB8A 3GTPI 3KI9A 4DJLA 4OC1A 3CPWZ 4E31A 3SJXA 3D2PA 4OC5A 1VQ61 3GTLI 4PV6A 4A38A 5G1ZA 5IT9f 4E0AA 1VQ9Z 2Z3LA 4AVBA 1YGHA 3S1RI 2R6MA 4FWUA 4P6YA 2DE7A 3U50C 3H3VJ 4ZBGA 5HVFA 2HF1A 3D3SA 1QMUA 2QVPA 2QKDA 5LRGA 1MJ9A 4KSIA 2Q0YA 2DF5A 5FVJA 2AKLA 3DLJA 4KVXA 2OZGA 3PB8X 2V45A 4HNWB 2X7BA 2ZXVA 4NF1A 2P28A 1I1DA 2VZZA 4BY7I 1VHEA 4NBEA 1QVGZ 5HVHA 3FIXA 1CG2A 4YWYA 1Q16A 2WPXA 2NSMA 4C68A 2RBLA 3S1NI 4KUAA 4FUUA 4CGPA 2Q4ZA 1LOKA 4CPAA 1YUKA 5CNPA 3CPWY 2ZEOA 2PJ1A 4YU9A 1YUAA 1WW9A 1M1K2 4MJ8A 3BJ7A 3J80b 2V8DA 2FT0A 3PGPA 1VHOA 1RO2A 1S60A 1Z2LA 5A2Qf 4C2ZA 1ZLHA 2ZEDA 3ZJ0A 2F4OA 1M902 2JEVA 2OU2A 3CXPA 1IIDA 4NGPA 4DYOA 4OC2A 1VQ4Z 3RAMA 3F8KA 2QRCB 2ZW4A 3KHZA 4E32A 5DWNA 2EGTA 3CMAZ 4Y49B 2ZEHA 2J8NA 1RQFA 2Y0MA 1LAMA 3D4UA 4CAEA 4MMOA 4JJXA 1LRZA 4EVYA 3DR8A 4RI1A 3TO6A 2EK8A 2ZW5A 5C4JI 4E33A 1USPA 3EXNA 3IU1A 4ZI6A 4QTUA 1VQ51 1S721 3G4SZ 5K8OA 4KVOE 1QSMA 1BPNA 1YW6A 4HPSA 1JWHC 3S17I 2RC4A 3F3FC 3IWGA 1VQ6Z 1QVFZ 3B3WA 4OC0A 1J4JA 3J7A4 2PJ3A 2IL4A 4JD6A 2IZ3A 1B6BA 4LX9A 1MK4A 3R1KA 1IYKA 1QQ9A 4PQAA 2QA41 4UEEA 1XIXA 2ZEEA 4A2ZA 2JBJA 3JAMb 4CGOA 3CC4Z 3CCM1 1YR0A 4F0YA 2DE6A 2ATRA 5I0CA 2E9HA 2CTCA 1XBUA 2PJ6A 4ZY2A 1Z8WA 3CCRZ 5CBMA 3NDIA 3D66A 2POKA 4R76A 3EC4A 4DQYB 4RS2A 3FECA 4MFJA 7CPAA 5AG5A 1XRYA 3GTGI 2I3CA 4K30A 1S7FA 3RBUA 3G4S1 2ZEGA 2I00A 4P44A 4A31A 5I4MA 5C88A 2ZENA 3IIBA 3H0GI 4RVGA 4PXDA 1I3QI 2PIYA 2ZEFA 2XEIA 4R7MA 5LYFA 2ZEMA 3V38A 3CPAA 2HU9A 2DPTA 5KTCA 2DPSA 4K3NA 2YNEA 2PRQA 4M6IA 1IOFA 4P4EA 3IF8A 1VQ71 3G3SA 2OH1A 1H8LA 3CCSZ 2LIYA 2BCOA 5D29A 1Z5RA 3TO9A 4NOZA 4B5PB 2CNMA 2QMLA 3GTJI 1KUYA 2Q7BA 4BBRI 4NBHA 2BJOA 3KIHA 2V8HA 3I55Z 1JJ2Y 3FX6A 1YJN1 2P0WA 4OC4A 2ANPA 4OMEA 3B3SA 3CC2Z 2BUEA 2VPYA 5EC4A 3DNSA 4RS4A 3VMGA 4MCPA 5H84A 3CXQA 1ZH1A 1YREA 1KC82 3Q87A 5FLXb 4HGYA 1VQL1 4S1TA 1Q7Y1 3KQXA 1Y1WI 2J8RA 4B12A 4NCZA 3NFZA 4DGLA 1DE4C 3CC21 2ZELA 4RN7A 2JBKA 1N2FA 4NB9A 3JUWA 3KR4A 3GTMS 3DDDA 5K8MA 2W03A 3I56Z 2GU2A 3PO3S 2ARHA 2WZNA 1BAVA 5JH9A 1K8A1 1R57A 3H8GA 1PCAA 2JIQA 5A28A 3VWEA 4QB9A 4P10A 3L2NA 3KASA 1CBXA 3KR5A 2FIAA 3I551 3D7GA 3CCVZ 1KD11 3VH9A 4MI4A 3CCLZ 1YHQ1 4MRIA 4O23A 2O4HA 1Q2DA 4ZX8A 4R57A 4M85A 5LYDA 3B7IA 4R9MA 3N5FA 4Q7AA 2R93I 2REFA 4CAVA 1IU8A 4XNHB 2CNTA 4KOUA 3CME1 2GREA 1MJBA 4A3DI 2PCUA 3ESWA 4MBUA 4IUSA 3NH4A 4MH4A 2IMOA 3S6GA 3GY9A 4M3SA 3B35A 3WABA 1Y0YA 1Q822 2WSAA 1M4GA 4MD7A 2FS5A 3CMA1 3CCV1 1S3ZA 3MGDA 3MONA 4A32A 3D9XA 2OTJZ 1VQ41 3CQZI 1PYTB 4CRYB 3IEHA 4KSAA 4BBHA 2JR6A 4CAWA 5J8FA 3CXCZ 3NE8A 4XPDB 4R87A 8CPAA 2V3VA 1ZO0A 4MY0A 1YITZ 4M6GA 4PK3A 1GYTA 2AJ6A 2B5GB 5FLXf 1USPB 2OB0A 1AA6A 4C7HA 4UCPA 2PSWA 3EERA 2BL1A 3FH4A 3PB7X 1Z8XA 1JWQA 4A3CI 1RLYA 1VIXA 3S6KA 1X12A 1VQMZ 2FVGA 1VQPZ 2WAQA 1W2BY 2PDOA 1Q7Y2 4XPDC 3N7ZA 2QJ8A 5AG6A 1LAPA 4MD9A 1M1DA 2D4OA 1XMBA 2JA7I 1RO5A 3WC5A 5A27A 2B4DA 5HVGA 3CC41 1WWZA 3H4QA 4XNHC 1S7MA 1ARLA 4A3II 1BLLE 3IWWA 2IV2X 4A93I 1K8A2 5E96A 3S16I 1SQHA 4AG9A 3PO2I 2B58A 2Q7SA 3HOXI 4PXEA 2ZPAA 4WWVA 3TX8A 5IV0A 3V8IA 5BWAB 3SI1A 3G8WA 2F8HA 5THWA 3S6HA 4MCQA 2QRDB 5T64A 1N8R1 4MY3A 3GB0A 2R1IA 4CAXA 1VQKZ 4E2XA 4BD9A 5IB9A 1KRLA 1TKJA 2QEXZ 3K9TA 2CTBA 5LRKA 3W6SA 2NVXI 5JPHA 3FYNA 2AFZA 2BOAA 5KTDA 2JMOA 1FY7A 1CX8A 1CP7A 3E0KA 4KOSA 4F9VA 2G9DA 4A37A 2VBQA 4NSQA 1VQP1 4R3KA 4NJQA 4EFDA 4P4BA 4MFZA 2RT9A 3M3YI 2PE3A 4Y52I 1F2OA 4II9A 1EE3P 3PEIA 4CS0B 3HOYI 4MHYA 5AGEA 4CGNA 4MONA 3CCMZ 1RNIA 2ZOFA 4H2KA 3B8GA 4F6AA 3K2KA 2IZ4A 1WZNA 1K9M2 4MCRA 4RVHA 2B3VA 2Z3KA 2CY2A 1K4JA 4KLVA 4JZ0A 2C6GA 2V8JA 4C2XA 3VTNA 2VPWA 2GTIA 1BPMA 1YQEA 3IFUA 3D67A 3H8FA 4HH4A 3CC7Z 5EBVA 2JDCA 4KOTA 2QA4Z 4JXQA 3LWUA 2PIZA 4JXRA 2Q44A 1DL6A 4NBAA 2Q4VA 2EVNA 5GCNA 2JIOA 4ZYQA 3IFEA 4KOYA 1HEEA 5A2Qb 2JA6I 1AYEA 2O53A 3LUSA 3S1QI 3S2DI 1S7LA 1ARMA 2JDDA 3NH5A 2PRBA 4NH1C 3G6E1 1VQ91 1Q811 1YJW1 1PUAA 2ODFA 3CXCY 4Z65A 2GANA 5LYIA 3SHPA 5KTAA 1S7NA 4EWCA 1ZLIA 3NDJA 5IP7I 2E7ZA 2ZW6A 3HOWI 4KSFA 1KQSZ 4FD5A 4QC6A 3R95A 3JVNA 1WIIA 1ZG8A 3F3PC 3PFOA 3HOVI 1JJ2Z 3T4NB 4HNXB 2E2JI 1F57A 2QECA 3CCU1 2WB1A 2R7ZI 1L1OC 4UF4A 5JGFA 4TWEA 1TIQA 4G1PA 1ZB9A 1CPXA 3UY5A 2RB7A 2M6NA 1YMEA 1YHQZ 2PJBA 2JIMA 4AB7A 2PQ8A 4KOXA 1ELMP 3NE7A 3TC8A 2Z10A 3D7FA 4NGTA 3PFEA 2R98A 4A3FI 3FEDA 1Y1VS 1FNOA 4P4FA 4CGMA 1QVGY 5K8NA 2V8IA 4U9YA 5EMIA 3W91A 2VF1A 5FLMI 3FRMA 2AFWA 2K3RA 2DEAA 2NVTI 3HOZI 2AFMA 5ISVA 1ON0A 4ZGYB 4YRHA 1AUGA 3BI1A 2PJ4A 4ZX9A 1NE9A 2P6EA 1NSAA 4NJRA 3CCUZ 2PJ2A 3B2YA 4KORA 2Q04A 2G2KA 1LFWA 2REEA 1M4LA 3CCE1 1X3WA 4FAIA 4Y49C 1WK4A 4B5OA 2ZW7A 3JAMf 2Q51A 2V8VA 1VQ7Z 4F8ZA 4GXHA 2Z0ZA 4QBJA 3GTQI 1I21A 4MFKA 4AVCA 3TDHB 4AG7A 4JLYA 4JWPA 4QUSA 3CC71 3K9UA 1Q812 2VZYA 2EBJA 2QLVB 2JLMA 2PJ9A 4UFXA 4CYOA 3GTKI 4H89A 2QREB 4OIWA 4W9YA 2V8KA 1Q862 1CM0A 3BHXA 3PBEA 1TKFA 3IO1A 3CD61 4HGZA 1A2ZA 2AFUA 3CCL1 4BBSI 3H8EA 1M1K1 5AG4A 1TKHA 3VMHA 4QTTA 3J81f 1YSJA 4CYQA 2P6GA 1Q7LA 2JIPA 1VQO1 5LYLA 3LACA 2F5IA 2A4NA 4P4JA 4CYNA 1M901 2NMTA 1FT7A 1ZB8A 3KQZA 4PSWA 2F7VA 4L89A 3RNZA 2HB6A 4J3GA 4KOWA 5F47A 3FXTA 3M4OI 5G21A 3VATA 3PO3I 3IU2A 3J81b 2HC9A 2GE3A 2B3UA 2OOTA 3R9FA 3LODA 1YI21 5AG7A 5DS0A 4NGRA 3P5JB 2OR4A 2YADA 1R3NA 4EMEA 4UEFA 3BXMA 3FNCA 1S5KA 1Q2YA 4UBRA 2IQ6A 2CIJA 3GUXA 3CMEZ 4RVFA 4X6AI 2YGWA 1U6MA 2E2II 3S15I 3CCJ1 1ZG9A 3MN8A 2GIVA 3TFYA 4AXVA 2HV2A 3QNVA 2XEJA 3F0AA 2Z11A 3GTMI 1TWHI 2KPIA 4MHZA 2OZUA 3TCVA 1R9TI 1VKCA 1PFTA 1I6HI 4NBDA 4OC3A 3CCQZ 3FQMA 2PM9A 1QSOA 3D8PA 3D7HA 4CL1A 3CPXA 4F9UA 4Q38A 2FXFA 1CP6A 2R8VA 4E2YA 4H6ZA 3LD2A 3PB9X 3J80f 4A3GI 3V7ZA 5CPAA 2JEWA 1N71A 4AYBA 1VQNZ 4A39A 2K5TA 2RHBA 2ZOGA 2PK7A 5D8NA 5CM2M 4RV9A 1TWFI 2NVQI 1Q861 1FDOA 1IB1E 4OADA 5C4XI 5J1QA 4A3JI 2VUMI 4KOVA 1Y7RA 1M44A 1P0HA 2VI7A 4BMHA 1XJOA 5K8PA 2J8MA 4NGNA 3FBUA 5G20A 1TF8A 1IY7A 3TE5B 2W04A 4UFWA 1SFOI 2PJ7A 1M4DA 1VQN1 1JQGA 3JTKA 4XPLA 2CXAA 4KLWA 2K5RA 3FVLA 3CD6Z 4B5PA 4R3LA 2WPWA 5H86A 2OZKA 5ELYA 2OOYB 2P6FA 2VQYA 3OW2Z 4P4IA 4BINA 4NGQA 3S6FA 2V8GA 3IX0A 1NMTA 2PJAA 1X0TA 3WT4A 4F0XA 4KS9A 4UFVA 1Y1VI 1I50I 1YIJZ 1SIWA 4NGSA 4Q36A 3GLJA 2Z3OA 5IT9b 4ORFA 4B10A 3D7DA 1Z8TA 3BG0B 3B3CA 2FCKA 3SJFA 5LRJA 2LFUA 3P2HA 3B3VA 1R43A 4H6UA 1YJ9Z 2B5GA 2YNDA 3D6WA 2FIWA 3GYAA 3I9SA 3VMIA 1YK3A 2JA5I 4U9ZA 1FDIA 2B4BA 4CGLA 4M6HA 3GIUA 3WR7A 4LQ6A 2PJ8A 2Y0SA 4NXYA 4ZY0A 1YIJ1 3T90A 3G71Z 1RO4A 5F46A 5C82A 1CPSA 4NGMA 4CRZB 1YJWZ 4X2TA 2FE7A 3KGQA 4IAVA 1Z4EA 1X3ZA 2DXQA 3A9LA 3RYOA 4B11A 2AFXA 2Z3NA 1Z03A 1UFHA 1K731 5J8CA 4MHPA 4MFLA 3CCR1 2KI7B 2NAPA 2IJZA 1TF9A 3BLNA 4BY1I 4TNUA 2BSWA 3FQQA 1IYLA 1OBRA 3FJUA 1Z9UA 2CF4A 3ISZA 4X8IA 3QAHA 1KC81 1F2PA 1QSNA 1VQM1 1YIT1 2QYVA 1KUVA 2CNSA 1VQOZ 1TWGI 2RFHA 4XX2A 1LCPA 2EUIA 2PJ0A 5D1OB 4MHDA 4NFRA 4OKOA 2AE6A 4MFQA 3SXNA 2KCWA 4UIBA 3RZAA 1YJ91 1NP6A 2C6PA 4ZY1A 3EEDA 1KWMA 3D2MA 1RO0A 3FMCA 1Q821 2YNCC 2J9AA 4UWJA 1ZG7A 2GLFA 1VQ5Z 3FB3A 4FD6A 4KZTA 2J6AA 4BXXI 2YNCA 3D68A 2OTJ1 4LUAA 4EWTA 3SJEA 3EY5A 1VQK1 3IWEA 3PP9A 3D2LA 1KD12 2VPZA 3GKQA 3CCEZ 3TOBA 2PJCA 4A33A 1VGYA 2PVWA 3CCJZ 1Q2CA 2VUGA 4HKFA 1YI2Z 3GCFA 4UEZA 2HQYA 2XEGA 1LANA 4UA3A 2H5MA 3KHXA 3VWDA 4UWIA 1VLAA 1XEBA 4OP4A 4OLLA 3I4NI 3S1MI 3SJGA 2NYQA 1Z01A 3RZDI 4AVAA 2JNYA 4YGOA 4C7IA 4YFJA 3TT2A 1VQ81 1RTQA 1PU9A 5HH1A 4NBGA 3T9YA 5IX3A 5HXDA 2R92I 3NA6A 4UCNA 3MZKB 1VQLZ 4MXUA 3RZOI 3TOAA 4X5KA 3SI0A 4GM5A 1K732 1YLOA 2BEIA 2PMZA 3S2HI 3KIFA 4XPKA 1ML8A 4UIAA 3CT9A 1XE4A 3HKZA 5C3EI 4OIDA 3GKRA 2FSRA 4A3MI 1L0CA 1YX0A 4HNYB 2PJ5A 3DR6A 1AMPA 3PRTA 1XFOA 1YLEA 1IGBA 3TTHA 3ZZIA 1N8R2 1TXRA 2VL1A 2ABZA 2AYDA 5G22A 4RVDA 1RXTA 2HUZA 2ZEPA 3EFAA 3KKWA 4A94A 4NB8A 2Z3MA 3PBBA 2V77A 2P3YA 2M48A 3HOUI 5D1OA 4NBCA 2QEX1 5HMNA 1P9NA 5T67A 2RIQA 3QWUA 2VPXA 2AFOA 2C1CA 3BG1B 3OWCA 3CCQ1 3IJ3A 4IF5A 2D4PA 1NJI1 3SXOA 3DGVA 1Z4RA 3R96A 4PPZA 2O28A 2C27A 3TE4A 1YVKA 3S14I 1B87A 4R8FA 1ELLP 1XOVA 1M4IA 2NVYI 3TO7A
chains in the Genus database with same CATH topology
3PB9X 3J80f 1VQ6Z 4A3GI 1K9M1 1QVFZ 3V7ZA 3B3WA 5CPAA 2JEWA 4OC0A 4NJQA 4EFDA 4AYBA 1VQNZ 4A39A 2RHBA 4P4BA 2ZOGA 2PK7A 4PXBA 4R6TA 5D8NA 3T8WA 1TWAI 2RT9A 3M3YI 5CM2M 4RV9A 1TWFI 4Y52I 3J7A4 2NVQI 2PE3A 1F2OA 1Q861 4DK1A 1QVFY 1DTDA 2PJ3A 4DUKA 3I07A 1QYPA 1EE3P 3PEIA 5AN9F 3LMSA 2IZ3A 5C4XI 3HOYI 5J1QA 1QQ9A 4MHYA 4PQAA 2QA41 4UEEA 4A3JI 1HDUA 1W2BZ 2ZAEB 2GLJA 2VUMI 4MONA 2ZEEA 2OTLZ 2JBJA 3JAMb 3CCMZ 1RNIA 2ZOFA 4H2KA 3CC4Z 3CCM1 3K2KA 1XJOA 2IZ4A 3FF3A 1K9M2 3JRUA 5K8PA 4MCRA 4NGNA 1YW4A 5JM6A 3IC1A 2DE6A 4RVHA 2B63I 4E30A 2E9HA 1TF8A 1IY7A 1Z02A 3TE5B 2W04A 2CTCA 1SFOI 1XBUA 5F09A 2PJ6A 2WYRA 4ZY2A 2PJ7A 4JZ0A 3CCRZ 2C6GA 2V8JA 1VQN1 1JQGA 5CBMA 3VTNA 2GTIA 3NDIA 3D66A 2POKA 4R76A 2RPRA 1BPMA 2EWBA 4DQYB 3CDXA 3FECA 3IFUA 3I1UA 7CPAA 2K5RA 3D67A 3FVLA 2EK9A 2OTL1 1XRYA 3OW2Y 3GTGI 2I3CA 4X3RA 3H8FA 5IP9I 4HH4A 3CC7Z 3RBUA 1NUIA 3CD6Z 3G4S1 1S72Z 2QA4Z 1VQ8Z 2ZEGA 3LWUA 2PIZA 2OZKA 4P44A 4A3EI 2E2HI 5ELYA 5I4MA 2OOYB 1LQLA 3PB6X 1DL6A 3OW2Z 2ZENA 4P4IA 4NBAA 3IIBA 3H0GI 4NGQA 4RVGA 2V8GA 3IX0A 4PXDA 1I3QI 2PJAA 1X0TA 4A3LI 4ZYQA 3WT4A 3IFEA 3KZWA 1HEEA 2PIYA 2ZEFA 2XEIA 5A2Qb 3CCS1 2JA6I 4R7MA 5LYFA 1Y1VI 1AYEA 1I50I 2ZEMA 1YIJZ 2O53A 2H85A 3LUSA 4NGSA 3V38A 3CPAA 2HU9A 3S1QI 3S2DI 3KL9A 3GTOI 3GLJA 1ARMA 1Z8LA 2BO9A 5IT9b 4K3NA 6CPAA 3D7DA 3NH5A 2PRQA 4NH1C 3G6EZ 3G6E1 1VQ91 1Q811 1YJW1 3BG0B 1QF8A 1HDQA 3CXCY 3B3CA 1K83I 3SJFA 4Z65A 4P4EA 5LRJA 3IF8A 2LFUA 3B3VA 1VQ71 5LYIA 4Y7NI 4EWCA 1R43A 1UWYA 4LQGA 1H8LA 3CCSZ 2LIYA 1ZLIA 1YJ9Z 2BCOA 3NDJA 5D29A 4B6ZA 5IP7I 2Q43A 1Z5RA 3D6WA 3HOWI 4NOZA 1KQSZ 3VMIA 2JA8I 2JA5I 1WIIA 3GTJI 4E2WA 1ZG8A 3HLPA 1Y0RA 3F3PC 4NBFA 3PFOA 4BBRI 1Y7EA 3HOVI 1JJ2Z 4NBHA 3I4MI 4NBBA 3T4NB 2E2JI 2PJ8A 1F57A 2Y0SA 4E2ZA 3CCU1 1YIJ1 4ZY0A 2BJOA 2WB1A 2R7ZI 2AFSA 3KIHA 3G71Z 1L1OC 1RO4A 2V8HA 4UF4A 3I55Z 1JJ2Y 4A3KI 4P45A 1NJI2 3FX6A 1YJN1 4A3BI 4OC4A 2ANPA 5JGFA 1CPSA 2GTHA 3MRUA 4OMEA 3B3SA 3CC2Z 4NGMA 1YJWZ 4RS4A 4TWEA 4X2TA 3VMGA 3HUVA 3KGQA 4MCPA 3K7AI 4G1PA 1ZB9A 4IAVA 1CPXA 1ZH1A 1X3ZA 2RB7A 5LL6f 4IHMA 2M6NA 1YMEA 1YHQZ 1KC82 3Q87A 2PJBA 5FLXb 2AFXA 1ELMP 1Z03A 5D1PA 4HGYA 1VQL1 4ONWA 1TFIA 1K731 4S1TA 4MHPA 3CCR1 3TC8A 2KI7B 3D7FA 2IJZA 1Q7Y1 1TF9A 4NGTA 3KQXA 3PFEA 4MHNA 4BY1I 1Y1WI 2YU9I 3NFZA 3FKII 4TNUA 3B3TA 4DGLA 4A3FI 1DE4C 4WJBA 3FEDA 1Y1VS 3FQQA 1FNOA 1OBRA 2C6CA 3FJUA 4P4FA 3S9MA 3CC21 2CF4A 2ZELA 2JBKA 1N2FA 1QVGY 3I561 3ISZA 4X8IA 3VARA 5K8NA 4NB9A 2V8IA 1KC81 3G711 3GTMS 1F2PA 2JS4A 1VQM1 3KR4A 1YIT1 2QYVA 3WC7A 5K8MA 2OOXB 2VF1A 1VQOZ 2W03A 3I56Z 2GU2A 3NH8A 3PO3S 1TWGI 5FLMI 4P4DA 2RFHA 2WZNA 1BAVA 4XX2A 1LCPA 5JH9A 4PXCA 2AFWA 3VB9A 2K3RA 1K8A1 5C44I 2DEAA 3H8GA 2NVTI 1PCAA 3HOZI 2PJ0A 5D1OB 4FBEA 4NFRA 4OKOA 2AFMA 4P10A 3L2NA 3KASA 3WC6A 1CBXA 3BI1A 4IK2A 3KR5A 5T6BA 4UIBA 3RZAA 1YJ91 2PJ4A 4MD8A 2QR1B 1NP6A 3I551 2C6PA 3FEEA 3D7GA 3EEDA 4ZX9A 4ZY1A 1KWMA 3CCVZ 1RO0A 3FMCA 1NSAA 1KD11 4NJRA 3VH9A 4RUHA 1WCMI 3S9LA 3CCUZ 3CCLZ 3MZLB 2DE5A 1YHQ1 2PJ2A 4MRIA 3B2YA 4O23A 2O4HA 3S9NA 1Q821 2J9AA 1TWCI 2G2KA 1LFWA 3ISXA 2XEFA 4ZX8A 1ZG7A 2GLFA 1VQ5Z 5LYDA 1M4LA 2JUBA 3B7IA 3SI2A 3CCE1 3N5FA 4Q7AA 2F4MA 2R93I 1X3WA 4FAIA 1KQSY 1YJNZ 2J6AA 4BXXI 3BI0A 3PB4X 3JAMf 2PVVA 4MCSA 3D68A 2OTJ1 2Q51A 2V8VA 4JYWA 3GTPI 3KI9A 3CME1 4DJLA 4OC1A 3CPWZ 4E31A 3SJXA 2GREA 2PCUA 1VQ61 4A3DI 3GTLI 4OC5A 4EWTA 3ESWA 3SJEA 1VQ7Z 1VQK1 4F8ZA 3NH4A 4MH4A 4A38A 2IMOA 1KD12 3GKQA 3CCEZ 5IT9f 3GTQI 2PJCA 3B35A 3WABA 1Y0YA 1VQ9Z 1Q822 1VGYA 3TDHB 4MD7A 2PVWA 3CCJZ 3CC71 2VUGA 1Q812 1YI2Z 3CMA1 3S1RI 2QLVB 2PJ9A 2R6MA 3CCV1 3GCFA 4FWUA 4UEZA 4P6YA 2DE7A 3MONA 3U50C 3GTKI 3H3VJ 3D9XA 2OTJZ 2QREB 1VQ41 5HVFA 2HF1A 3CQZI 4OIWA 1PYTB 4W9YA 2V8KA 1Q862 1QMUA 2QVPA 2QKDA 1LANA 2XEGA 3IEHA 5LRGA 3KHXA 2JR6A 4KSIA 3BHXA 3CXCZ 3PBEA 1TKFA 3IO1A 2AKLA 1VLAA 3CD61 8CPAA 4HGZA 3DLJA 4OP4A 2AFUA 3PB8X 3CCL1 3I4NI 1YITZ 3S1MI 4BBSI 3SJGA 3H8EA 2NYQA 1Z01A 2P28A 1M1K1 3RZDI 1TKHA 1GYTA 2JNYA 4BY7I 3VMHA 1VHEA 4NBEA 1QVGZ 5HVHA 5FLXf 1CG2A 1USPB 4YWYA 1VQ81 1RTQA 3EERA 4NBGA 4QTTA 2NSMA 2RBLA 3S1NI 3J81f 3FH4A 1YSJA 3PB7X 4FUUA 5HXDA 2Q4ZA 2R92I 3NA6A 4A3CI 1LOKA 4CPAA 1RLYA 1YUKA 1Q7LA 1VIXA 3MZKB 1VQLZ 3CPWY 1VQO1 2ZEOA 5LYLA 4MXUA 2PJ1A 3RZOI 3SI0A 4P4JA 4YU9A 1VQMZ 2FVGA 4GM5A 1VQPZ 1M901 1K732 1YLOA 1YUAA 1WW9A 1FT7A 1M1K2 1ZB8A 2PMZA 2WAQA 1W2BY 3KIFA 1Q7Y2 3S2HI 3KQZA 3J80b 1ML8A 2V8DA 4UIAA 3CT9A 2F7VA 3HKZA 5C3EI 2QJ8A 4OIDA 2HB6A 4A3MI 1LAPA 4MD9A 2PJ5A 1XMBA 2JA7I 3M4OI 3WC5A 3VATA 1VHOA 1AMPA 5HVGA 1RO2A 3CC41 1Z2LA 3PO3I 5A2Qf 3J81b 2HC9A 3PRTA 1ZLHA 1S7MA 1ARLA 4A3II 1BLLE 2OOTA 1XFOA 2ZEDA 3IWWA 2F4OA 1M902 1YI21 1IGBA 1N8R2 4A93I 1TXRA 1K8A2 4NGRA 5DS0A 3P5JB 2OR4A 3S16I 2YADA 2VL1A 1R3NA 4EMEA 2ABZA 4UEFA 4RVDA 3PO2I 2ZEPA 4NGPA 4DYOA 3BXMA 4OC2A 4A94A 1VQ4Z 4NB8A 3HOXI 3PBBA 4PXEA 3RAMA 2IQ6A 2CIJA 2V77A 2P3YA 4WWVA 2M48A 3HOUI 2QRCB 3GUXA 3TX8A 3CMEZ 4E32A 3KHZA 4RVFA 5D1OA 2EGTA 4NBCA 2QEX1 3SI1A 4X6AI 3CMAZ 1P9NA 5T67A 2RIQA 2E2II 3S15I 2ZEHA 3CCJ1 2F8HA 1ZG9A 5THWA 3MN8A 4MCQA 3QWUA 4AXVA 2QRDB 5T64A 1RQFA 1N8R1 3QNVA 2XEJA 1LAMA 3GB0A 3GTMI 3D4UA 2AFOA 1TWHI 2KPIA 2C1CA 4MHZA 1VQKZ 4E2XA 4BD9A 4MMOA 1KRLA 1TKJA 5IB9A 3BG1B 1R9TI 2QEXZ 3CCQ1 1PFTA 3IJ3A 3K9TA 1I6HI 4NBDA 2CTBA 5LRKA 4OC3A 3CCQZ 1NJI1 3FQMA 2EK8A 3DGVA 2NVXI 2AFZA 5C4JI 2PM9A 2BOAA 3D7HA 4E33A 1USPA 2JMOA 4CL1A 3CPXA 4F9UA 4ZI6A 4PPZA 4QTUA 1VQ51 1CX8A 3S14I 1S721 3G4SZ 1CP6A 5K8OA 1CP7A 4R8FA 1ELLP 4E2YA 1BPNA 4F9VA 2G9DA 1YW6A 1JWHC 3S17I 4A37A 1VQP1 2NVYI 3F3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB9 X;  3V7Z A;  3B3W A;  5CPA A;  2JEW A;  4OC0 A;  4NJQ A;  4EFD A;  4A39 A;  4P4B A;  2ZOG A;  4PXB A;  4R6T A;  5D8N A;  3T8W A;  2PE3 A;  2PJ3 A;  1F2O A;  1DTD A;  4DUK A;  1EE3 P;  3PEI A;  3LMS A;  5J1Q A;  1QQ9 A;  4MHY A;  4PQA A;  4UEE A;  1HDU A;  2GLJ A;  2ZEE A;  2JBJ A;  2ZOF A;  4H2K A;  3K2K A;  1XJO A;  3FF3 A;  3JRU A;  5K8P A;  4MCR A;  4NGN A;  1YW4 A;  5JM6 A;  3IC1 A;  1TF8 A;  1IY7 A;  2CTC A;  1XBU A;  5F09 A;  2PJ6 A;  2WYR A;  4ZY2 A;  2PJ7 A;  4JZ0 A;  2C6G A;  1JQG A;  5CBM A;  3D66 A;  2POK A;  4R76 A;  2EWB A;  1BPM A;  3CDX A;  3FEC A;  3I1U A;  7CPA A;  3D67 A;  3FVL A;  2EK9 A;  1XRY A;  4X3R A;  2I3C A;  3H8F A;  3RBU A;  2ZEG A;  3LWU A;  2PIZ A;  4P44 A;  5ELY A;  5I4M A;  3PB6 X;  2ZEN A;  4P4I A;  3IIB A;  4NGQ A;  2V8G A;  4PXD A;  2PJA A;  4ZYQ A;  3WT4 A;  3IFE A;  3KZW A;  1HEE A;  2PIY A;  2ZEF A;  2XEI A;  4R7M A;  5LYF A;  1AYE A;  2ZEM A;  2O53 A;  4NGS A;  3V38 A;  3CPA A;  3KL9 A;  3GLJ A;  1ARM A;  1Z8L A;  2BO9 A;  4K3N A;  6CPA A;  3D7D A;  3NH5 A;  2PRQ A;  1HDQ A;  3B3C A;  3SJF A;  4Z65 A;  4P4E A;  5LRJ A;  3B3V A;  5LYI A;  1R43 A;  1UWY A;  4LQG A;  1H8L A;  1ZLI A;  2BCO A;  5D29 A;  4B6Z A;  2Q43 A;  1Z5R A;  1ZG8 A;  3HLP A;  1Y0R A;  3PFO A;  1Y7E A;  2PJ8 A;  1F57 A;  4ZY0 A;  2AFS A;  2V8H A;  4UF4 A;  4P45 A;  3FX6 A;  4OC4 A;  2ANP A;  5JGF A;  1CPS A;  3MRU A;  4OME A;  3B3S A;  4NGM A;  4TWE A;  4X2T A;  3HUV A;  3KGQ A;  4MCP A;  4G1P A;  4IAV A;  1CPX A;  2RB7 A;  4IHM A;  1YME A;  2PJB A;  2AFX A;  1ELM P;  4ONW A;  4MHP A;  3TC8 A;  3D7F A;  2IJZ A;  1TF9 A;  4NGT A;  3KQX A;  3PFE A;  4MHN A;  3NFZ A;  4TNU A;  3B3T A;  1DE4 C;  4WJB A;  3FED A;  4P4F A;  1FNO A;  1OBR A;  2C6C A;  3FJU A;  3S9M A;  2CF4 A;  2ZEL A;  2JBK A;  3ISZ A;  4X8I A;  3VAR A;  5K8N A;  1F2P A;  3KR4 A;  2QYV A;  3WC7 A;  5K8M A;  4P4D A;  2GU2 A;  3NH8 A;  2RFH A;  2WZN A;  1BAV A;  1LCP A;  5JH9 A;  4PXC A;  2AFW A;  2DEA A;  3H8G A;  1PCA A;  2PJ0 A;  4FBE A;  4NFR A;  4OKO A;  2AFM A;  4P10 A;  3L2N A;  3KAS A;  3WC6 A;  1CBX A;  3BI1 A;  4IK2 A;  3KR5 A;  4UIB A;  3RZA A;  2PJ4 A;  2C6P A;  3FEE A;  3D7G A;  4ZX9 A;  4ZY1 A;  1KWM A;  3FMC A;  1NSA A;  4NJR A;  4RUH A;  3VH9 A;  3S9L A;  2PJ2 A;  3B2Y A;  4MRI A;  4O23 A;  2O4H A;  3S9N A;  2J9A A;  1LFW A;  3ISX A;  2XEF A;  4ZX8 A;  1ZG7 A;  2GLF A;  5LYD A;  1M4L A;  3B7I A;  3SI2 A;  3N5F A;  4Q7A A;  4FAI A;  3BI0 A;  3PB4 X;  2PVV A;  4MCS A;  3D68 A;  2Q51 A;  2V8V A;  4JYW A;  3KI9 A;  4DJL A;  4OC1 A;  3SJX A;  2GRE A;  2PCU A;  4OC5 A;  4EWT A;  3SJE A;  4F8Z A;  3NH4 A;  4A38 A;  2IMO A;  2PJC A;  3B35 A;  3WAB A;  1Y0Y A;  1VGY A;  2PVW A;  2PJ9 A;  4FWU A;  4UEZ A;  4P6Y A;  5HVF A;  4OIW A;  1PYT B;  4W9Y A;  1QMU A;  2QVP A;  2XEG A;  1LAN A;  3IEH A;  5LRG A;  3KHX A;  4KSI A;  3BHX A;  3PBE A;  1TKF A;  3IO1 A;  8CPA A;  3DLJ A;  4OP4 A;  2AFU A;  3PB8 X;  3SJG A;  3H8E A;  2NYQ A;  1TKH A;  1GYT A;  1VHE A;  5HVH A;  1CG2 A;  4YWY A;  1RTQ A;  2NSM A;  3FH4 A;  1YSJ A;  3PB7 X;  4FUU A;  5HXD A;  2Q4Z A;  3NA6 A;  1LOK A;  4CPA A;  1Q7L A;  1VIX A;  2ZEO A;  5LYL A;  4MXU A;  2PJ1 A;  3SI0 A;  4P4J A;  4YU9 A;  2FVG A;  4GM5 A;  1YLO A;  1FT7 A;  3KQZ A;  2V8D A;  4UIA A;  3CT9 A;  2F7V A;  2QJ8 A;  4OID A;  2HB6 A;  1LAP A;  2PJ5 A;  1XMB A;  3WC5 A;  3VAT A;  1VHO A;  1AMP A;  5HVG A;  1Z2L A;  2HC9 A;  3PRT A;  1ZLH A;  1BLL E;  1ARL A;  2OOT A;  1XFO A;  2ZED A;  3IWW A;  1IGB A;  1TXR A;  5DS0 A;  4NGR A;  2OR4 A;  2VL1 A;  1R3N A;  4EME A;  2ABZ A;  4UEF A;  2ZEP A;  4NGP A;  4DYO A;  3BXM A;  4OC2 A;  4A94 A;  3PBB A;  4PXE A;  3RAM A;  2IQ6 A;  2CIJ A;  2V77 A;  4WWV A;  3TX8 A;  3GUX A;  3KHZ A;  3SI1 A;  2ZEH A;  2F8H A;  5THW A;  1ZG9 A;  3MN8 A;  4MCQ A;  4AXV A;  3QNV A;  2XEJ A;  1LAM A;  3GB0 A;  3D4U A;  2AFO A;  2C1C A;  4MHZ A;  4BD9 A;  4MMO A;  5IB9 A;  1TKJ A;  3IJ3 A;  3K9T A;  2CTB A;  5LRK A;  4OC3 A;  2EK8 A;  3DGV A;  2AFZ A;  2BOA A;  3D7H A;  3CPX A;  4F9U A;  4ZI6 A;  4PPZ A;  1CX8 A;  1CP6 A;  5K8O A;  1CP7 A;  4R8F A;  1ELL P;  1BPN A;  4F9V A;  2G9D A;  1YW6 A;  4A37 A; 
#chains in the Genus database with same CATH topology
 1K9M 1;  2OZH A;  4PXB A;  4R6T A;  3T8W A;  1TWA I;  5DWM A;  5IB0 A;  1QVF Y;  4DK1 A;  1DTD A;  4DUK A;  3I07 A;  1QYP A;  5AN9 F;  3LMS A;  2FL4 A;  4E8O A;  1HDU A;  1W2B Z;  2ZAE B;  2GLJ A;  1QXF A;  2EO8 A;  2OTL Z;  3I3G A;  2VXK A;  3FF3 A;  3JRU A;  3PZJ A;  1YW4 A;  5JM6 A;  3IC1 A;  4L8A A;  2B63 I;  4E30 A;  2B4D B;  1Z02 A;  4U5Y A;  1XF8 A;  5F09 A;  2WYR A;  3CZX A;  4B13 A;  2PC1 A;  2Q4Y A;  4OAE A;  2QIR A;  2RPR A;  2EWB A;  3CDX A;  4CAF A;  3I1U A;  2EK9 A;  2OTL 1;  4X3R A;  3OW2 Y;  5IP9 I;  1NUI A;  2G3T A;  3IR7 A;  1S72 Z;  2Z3P A;  1VQ8 Z;  3BJ8 A;  4A3E I;  2E2H I;  1LQL A;  3PB6 X;  4UCM A;  4A3L I;  5F48 A;  3KZW A;  1QST A;  3CXS A;  1WJ2 A;  3CCS 1;  3H5Z A;  3F5B A;  5JQ4 A;  2H85 A;  3EO4 A;  3KL9 A;  3GTO I;  1Z8L A;  1NSL A;  2BO9 A;  6CPA A;  3G6E Z;  3C26 A;  1QF8 A;  1HDQ A;  3DSB A;  4C2Y A;  1Y9K A;  2GFQ A;  1K83 I;  4Y7N I;  1UWY A;  4LQG A;  4B6Z A;  2Q43 A;  4KVM E;  1QSR A;  1X10 A;  4DNC A;  2JA8 I;  1VHS A;  4E2W A;  4I49 A;  3HLP A;  4MFP A;  4QVT A;  1Y0R A;  4NBF A;  1Y7E A;  3I4M I;  1Y9W A;  1MJA A;  1KUX A;  4NBB A;  3QAY A;  4E2Z A;  4A95 A;  4PK2 A;  2AFS A;  4A3K I;  4P45 A;  1NJI 2;  4A3B I;  2GTH A;  3MRU A;  2I79 A;  3W6X A;  1XMT A;  4A30 A;  3HUV A;  3K7A I;  1IOI A;  2JIR A;  4ONU A;  4IHM A;  5LL6 f;  1Y8C A;  5D1P A;  4PSX A;  1I12 A;  4ONW A;  1TFI A;  5F49 A;  3RO0 A;  4MHN A;  1KZF A;  2YU9 I;  3P2F A;  3B3T A;  3FKI I;  4WJB A;  1YVO A;  2C6C A;  3S9M A;  3I56 1;  1OZP A;  3VAR A;  1IIC A;  4B14 A;  3G71 1;  2JS4 A;  2LEX A;  1BOB A;  3R9E A;  3WC7 A;  2OOX B;  1P4N A;  1BO4 A;  4P4D A;  3NH8 A;  4PXC A;  3VB9 A;  5C44 I;  1S7K A;  2PR8 A;  1V0C A;  3IGR A;  4FBE A;  4FD4 A;  1GHE A;  3WC6 A;  4IK2 A;  2PR1 A;  5T6B A;  2VEZ A;  2G3A A;  4MD8 A;  4FD7 A;  2QR1 B;  4GS4 A;  3FEE A;  3R9G A;  4NEX A;  4RUH A;  3S9L A;  1WCM I;  3MZL B;  4E2A A;  2DE5 A;  3S9N A;  1CJW A;  4CYP A;  1TWC I;  3ISX A;  2XEF A;  2JUB A;  3SI2 A;  2F4M A;  2WUU A;  1KQS Y;  2R7H A;  2G0B A;  1YJN Z;  3BI0 A;  3PB4 X;  2PVV A;  4KUB A;  4MCS A;  4JYW A;  3QB8 A;  3GTP I;  3KI9 A;  4DJL A;  4OC1 A;  3CPW Z;  4E31 A;  3SJX A;  3D2P A;  4OC5 A;  1VQ6 1;  3GTL I;  4PV6 A;  4A38 A;  5G1Z A;  5IT9 f;  4E0A A;  1VQ9 Z;  2Z3L A;  4AVB A;  1YGH A;  3S1R I;  2R6M A;  4FWU A;  4P6Y A;  2DE7 A;  3U50 C;  3H3V J;  4ZBG A;  5HVF A;  2HF1 A;  3D3S A;  1QMU A;  2QVP A;  2QKD A;  5LRG A;  1MJ9 A;  4KSI A;  2Q0Y A;  2DF5 A;  5FVJ A;  2AKL A;  3DLJ A;  4KVX A;  2OZG A;  3PB8 X;  2V45 A;  4HNW B;  2X7B A;  2ZXV A;  4NF1 A;  2P28 A;  1I1D A;  2VZZ A;  4BY7 I;  1VHE A;  4NBE A;  1QVG Z;  5HVH A;  3FIX A;  1CG2 A;  4YWY A;  1Q16 A;  2WPX A;  2NSM A;  4C68 A;  2RBL A;  3S1N I;  4KUA A;  4FUU A;  4CGP A;  2Q4Z A;  1LOK A;  4CPA A;  1YUK A;  5CNP A;  3CPW Y;  2ZEO A;  2PJ1 A;  4YU9 A;  1YUA A;  1WW9 A;  1M1K 2;  4MJ8 A;  3BJ7 A;  3J80 b;  2V8D A;  2FT0 A;  3PGP A;  1VHO A;  1RO2 A;  1S60 A;  1Z2L A;  5A2Q f;  4C2Z A;  1ZLH A;  2ZED A;  3ZJ0 A;  2F4O A;  1M90 2;  2JEV A;  2OU2 A;  3CXP A;  1IID A;  4NGP A;  4DYO A;  4OC2 A;  1VQ4 Z;  3RAM A;  3F8K A;  2QRC B;  2ZW4 A;  3KHZ A;  4E32 A;  5DWN A;  2EGT A;  3CMA Z;  4Y49 B;  2ZEH A;  2J8N A;  1RQF A;  2Y0M A;  1LAM A;  3D4U A;  4CAE A;  4MMO A;  4JJX A;  1LRZ A;  4EVY A;  3DR8 A;  4RI1 A;  3TO6 A;  2EK8 A;  2ZW5 A;  5C4J I;  4E33 A;  1USP A;  3EXN A;  3IU1 A;  4ZI6 A;  4QTU A;  1VQ5 1;  1S72 1;  3G4S Z;  5K8O A;  4KVO E;  1QSM A;  1BPN A;  1YW6 A;  4HPS A;  1JWH C;  3S17 I;  2RC4 A;  3F3F C;  3IWG A;  1VQ6 Z;  1QVF Z;  3B3W A;  4OC0 A;  1J4J A;  3J7A 4;  2PJ3 A;  2IL4 A;  4JD6 A;  2IZ3 A;  1B6B A;  4LX9 A;  1MK4 A;  3R1K A;  1IYK A;  1QQ9 A;  4PQA A;  2QA4 1;  4UEE A;  1XIX A;  2ZEE A;  4A2Z A;  2JBJ A;  3JAM b;  4CGO A;  3CC4 Z;  3CCM 1;  1YR0 A;  4F0Y A;  2DE6 A;  2ATR A;  5I0C A;  2E9H A;  2CTC A;  1XBU A;  2PJ6 A;  4ZY2 A;  1Z8W A;  3CCR Z;  5CBM A;  3NDI A;  3D66 A;  2POK A;  4R76 A;  3EC4 A;  4DQY B;  4RS2 A;  3FEC A;  4MFJ A;  7CPA A;  5AG5 A;  1XRY A;  3GTG I;  2I3C A;  4K30 A;  1S7F A;  3RBU A;  3G4S 1;  2ZEG A;  2I00 A;  4P44 A;  4A31 A;  5I4M A;  5C88 A;  2ZEN A;  3IIB A;  3H0G I;  4RVG A;  4PXD A;  1I3Q I;  2PIY A;  2ZEF A;  2XEI A;  4R7M A;  5LYF A;  2ZEM A;  3V38 A;  3CPA A;  2HU9 A;  2DPT A;  5KTC A;  2DPS A;  4K3N A;  2YNE A;  2PRQ A;  4M6I A;  1IOF A;  4P4E A;  3IF8 A;  1VQ7 1;  3G3S A;  2OH1 A;  1H8L A;  3CCS Z;  2LIY A;  2BCO A;  5D29 A;  1Z5R A;  3TO9 A;  4NOZ A;  4B5P B;  2CNM A;  2QML A;  3GTJ I;  1KUY A;  2Q7B A;  4BBR I;  4NBH A;  2BJO A;  3KIH A;  2V8H A;  3I55 Z;  1JJ2 Y;  3FX6 A;  1YJN 1;  2P0W A;  4OC4 A;  2ANP A;  4OME A;  3B3S A;  3CC2 Z;  2BUE A;  2VPY A;  5EC4 A;  3DNS A;  4RS4 A;  3VMG A;  4MCP A;  5H84 A;  3CXQ A;  1ZH1 A;  1YRE A;  1KC8 2;  3Q87 A;  5FLX b;  4HGY A;  1VQL 1;  4S1T A;  1Q7Y 1;  3KQX A;  1Y1W I;  2J8R A;  4B12 A;  4NCZ A;  3NFZ A;  4DGL A;  1DE4 C;  3CC2 1;  2ZEL A;  4RN7 A;  2JBK A;  1N2F A;  4NB9 A;  3JUW A;  3KR4 A;  3GTM S;  3DDD A;  5K8M A;  2W03 A;  3I56 Z;  2GU2 A;  3PO3 S;  2ARH A;  2WZN A;  1BAV A;  5JH9 A;  1K8A 1;  1R57 A;  3H8G A;  1PCA A;  2JIQ A;  5A28 A;  3VWE A;  4QB9 A;  4P10 A;  3L2N A;  3KAS A;  1CBX A;  3KR5 A;  2FIA A;  3I55 1;  3D7G A;  3CCV Z;  1KD1 1;  3VH9 A;  4MI4 A;  3CCL Z;  1YHQ 1;  4MRI A;  4O23 A;  2O4H A;  1Q2D A;  4ZX8 A;  4R57 A;  4M85 A;  5LYD A;  3B7I A;  4R9M A;  3N5F A;  4Q7A A;  2R93 I;  2REF A;  4CAV A;  1IU8 A;  4XNH B;  2CNT A;  4KOU A;  3CME 1;  2GRE A;  1MJB A;  4A3D I;  2PCU A;  3ESW A;  4MBU A;  4IUS A;  3NH4 A;  4MH4 A;  2IMO A;  3S6G A;  3GY9 A;  4M3S A;  3B35 A;  3WAB A;  1Y0Y A;  1Q82 2;  2WSA A;  1M4G A;  4MD7 A;  2FS5 A;  3CMA 1;  3CCV 1;  1S3Z A;  3MGD A;  3MON A;  4A32 A;  3D9X A;  2OTJ Z;  1VQ4 1;  3CQZ I;  1PYT B;  4CRY B;  3IEH A;  4KSA A;  4BBH A;  2JR6 A;  4CAW A;  5J8F A;  3CXC Z;  3NE8 A;  4XPD B;  4R87 A;  8CPA A;  2V3V A;  1ZO0 A;  4MY0 A;  1YIT Z;  4M6G A;  4PK3 A;  1GYT A;  2AJ6 A;  2B5G B;  5FLX f;  1USP B;  2OB0 A;  1AA6 A;  4C7H A;  4UCP A;  2PSW A;  3EER A;  2BL1 A;  3FH4 A;  3PB7 X;  1Z8X A;  1JWQ A;  4A3C I;  1RLY A;  1VIX A;  3S6K A;  1X12 A;  1VQM Z;  2FVG A;  1VQP Z;  2WAQ A;  1W2B Y;  2PDO A;  1Q7Y 2;  4XPD C;  3N7Z A;  2QJ8 A;  5AG6 A;  1LAP A;  4MD9 A;  1M1D A;  2D4O A;  1XMB A;  2JA7 I;  1RO5 A;  3WC5 A;  5A27 A;  2B4D A;  5HVG A;  3CC4 1;  1WWZ A;  3H4Q A;  4XNH C;  1S7M A;  1ARL A;  4A3I I;  1BLL E;  3IWW A;  2IV2 X;  4A93 I;  1K8A 2;  5E96 A;  3S16 I;  1SQH A;  4AG9 A;  3PO2 I;  2B58 A;  2Q7S A;  3HOX I;  4PXE A;  2ZPA A;  4WWV A;  3TX8 A;  5IV0 A;  3V8I A;  5BWA B;  3SI1 A;  3G8W A;  2F8H A;  5THW A;  3S6H A;  4MCQ A;  2QRD B;  5T64 A;  1N8R 1;  4MY3 A;  3GB0 A;  2R1I A;  4CAX A;  1VQK Z;  4E2X A;  4BD9 A;  5IB9 A;  1KRL A;  1TKJ A;  2QEX Z;  3K9T A;  2CTB A;  5LRK A;  3W6S A;  2NVX I;  5JPH A;  3FYN A;  2AFZ A;  2BOA A;  5KTD A;  2JMO A;  1FY7 A;  1CX8 A;  1CP7 A;  3E0K A;  4KOS A;  4F9V A;  2G9D A;  4A37 A;  2VBQ A;  4NSQ A;  1VQP 1;  4R3K A;  4NJQ A;  4EFD A;  4P4B A;  4MFZ A;  2RT9 A;  3M3Y I;  2PE3 A;  4Y52 I;  1F2O A;  4II9 A;  1EE3 P;  3PEI A;  4CS0 B;  3HOY I;  4MHY A;  5AGE A;  4CGN A;  4MON A;  3CCM Z;  1RNI A;  2ZOF A;  4H2K A;  3B8G A;  4F6A A;  3K2K A;  2IZ4 A;  1WZN A;  1K9M 2;  4MCR A;  4RVH A;  2B3V A;  2Z3K A;  2CY2 A;  1K4J A;  4KLV A;  4JZ0 A;  2C6G A;  2V8J A;  4C2X A;  3VTN A;  2VPW A;  2GTI A;  1BPM A;  1YQE A;  3IFU A;  3D67 A;  3H8F A;  4HH4 A;  3CC7 Z;  5EBV A;  2JDC A;  4KOT A;  2QA4 Z;  4JXQ A;  3LWU A;  2PIZ A;  4JXR A;  2Q44 A;  1DL6 A;  4NBA A;  2Q4V A;  2EVN A;  5GCN A;  2JIO A;  4ZYQ A;  3IFE A;  4KOY A;  1HEE A;  5A2Q b;  2JA6 I;  1AYE A;  2O53 A;  3LUS A;  3S1Q I;  3S2D I;  1S7L A;  1ARM A;  2JDD A;  3NH5 A;  2PRB A;  4NH1 C;  3G6E 1;  1VQ9 1;  1Q81 1;  1YJW 1;  1PUA A;  2ODF A;  3CXC Y;  4Z65 A;  2GAN A;  5LYI A;  3SHP A;  5KTA A;  1S7N A;  4EWC A;  1ZLI A;  3NDJ A;  5IP7 I;  2E7Z A;  2ZW6 A;  3HOW I;  4KSF A;  1KQS Z;  4FD5 A;  4QC6 A;  3R95 A;  3JVN A;  1WII A;  1ZG8 A;  3F3P C;  3PFO A;  3HOV I;  1JJ2 Z;  3T4N B;  4HNX B;  2E2J I;  1F57 A;  2QEC A;  3CCU 1;  2WB1 A;  2R7Z I;  1L1O C;  4UF4 A;  5JGF A;  4TWE A;  1TIQ A;  4G1P A;  1ZB9 A;  1CPX A;  3UY5 A;  2RB7 A;  2M6N A;  1YME A;  1YHQ Z;  2PJB A;  2JIM A;  4AB7 A;  2PQ8 A;  4KOX A;  1ELM P;  3NE7 A;  3TC8 A;  2Z10 A;  3D7F A;  4NGT A;  3PFE A;  2R98 A;  4A3F I;  3FED A;  1Y1V S;  1FNO A;  4P4F A;  4CGM A;  1QVG Y;  5K8N A;  2V8I A;  4U9Y A;  5EMI A;  3W91 A;  2VF1 A;  5FLM I;  3FRM A;  2AFW A;  2K3R A;  2DEA A;  2NVT I;  3HOZ I;  2AFM A;  5ISV A;  1ON0 A;  4ZGY B;  4YRH A;  1AUG A;  3BI1 A;  2PJ4 A;  4ZX9 A;  1NE9 A;  2P6E A;  1NSA A;  4NJR A;  3CCU Z;  2PJ2 A;  3B2Y A;  4KOR A;  2Q04 A;  2G2K A;  1LFW A;  2REE A;  1M4L A;  3CCE 1;  1X3W A;  4FAI A;  4Y49 C;  1WK4 A;  4B5O A;  2ZW7 A;  3JAM f;  2Q51 A;  2V8V A;  1VQ7 Z;  4F8Z A;  4GXH A;  2Z0Z A;  4QBJ A;  3GTQ I;  1I21 A;  4MFK A;  4AVC A;  3TDH B;  4AG7 A;  4JLY A;  4JWP A;  4QUS A;  3CC7 1;  3K9U A;  1Q81 2;  2VZY A;  2EBJ A;  2QLV B;  2JLM A;  2PJ9 A;  4UFX A;  4CYO A;  3GTK I;  4H89 A;  2QRE B;  4OIW A;  4W9Y A;  2V8K A;  1Q86 2;  1CM0 A;  3BHX A;  3PBE A;  1TKF A;  3IO1 A;  3CD6 1;  4HGZ A;  1A2Z A;  2AFU A;  3CCL 1;  4BBS I;  3H8E A;  1M1K 1;  5AG4 A;  1TKH A;  3VMH A;  4QTT A;  3J81 f;  1YSJ A;  4CYQ A;  2P6G A;  1Q7L A;  2JIP A;  1VQO 1;  5LYL A;  3LAC A;  2F5I A;  2A4N A;  4P4J A;  4CYN A;  1M90 1;  2NMT A;  1FT7 A;  1ZB8 A;  3KQZ A;  4PSW A;  2F7V A;  4L89 A;  3RNZ A;  2HB6 A;  4J3G A;  4KOW A;  5F47 A;  3FXT A;  3M4O I;  5G21 A;  3VAT A;  3PO3 I;  3IU2 A;  3J81 b;  2HC9 A;  2GE3 A;  2B3U A;  2OOT A;  3R9F A;  3LOD A;  1YI2 1;  5AG7 A;  5DS0 A;  4NGR A;  3P5J B;  2OR4 A;  2YAD A;  1R3N A;  4EME A;  4UEF A;  3BXM A;  3FNC A;  1S5K A;  1Q2Y A;  4UBR A;  2IQ6 A;  2CIJ A;  3GUX A;  3CME Z;  4RVF A;  4X6A I;  2YGW A;  1U6M A;  2E2I I;  3S15 I;  3CCJ 1;  1ZG9 A;  3MN8 A;  2GIV A;  3TFY A;  4AXV A;  2HV2 A;  3QNV A;  2XEJ A;  3F0A A;  2Z11 A;  3GTM I;  1TWH I;  2KPI A;  4MHZ A;  2OZU A;  3TCV A;  1R9T I;  1VKC A;  1PFT A;  1I6H I;  4NBD A;  4OC3 A;  3CCQ Z;  3FQM A;  2PM9 A;  1QSO A;  3D8P A;  3D7H A;  4CL1 A;  3CPX A;  4F9U A;  4Q38 A;  2FXF A;  1CP6 A;  2R8V A;  4E2Y A;  4H6Z A;  3LD2 A;  3PB9 X;  3J80 f;  4A3G I;  3V7Z A;  5CPA A;  2JEW A;  1N71 A;  4AYB A;  1VQN Z;  4A39 A;  2K5T A;  2RHB A;  2ZOG A;  2PK7 A;  5D8N A;  5CM2 M;  4RV9 A;  1TWF I;  2NVQ I;  1Q86 1;  1FDO A;  1IB1 E;  4OAD A;  5C4X I;  5J1Q A;  4A3J I;  2VUM I;  4KOV A;  1Y7R A;  1M44 A;  1P0H A;  2VI7 A;  4BMH A;  1XJO A;  5K8P A;  2J8M A;  4NGN A;  3FBU A;  5G20 A;  1TF8 A;  1IY7 A;  3TE5 B;  2W04 A;  4UFW A;  1SFO I;  2PJ7 A;  1M4D A;  1VQN 1;  1JQG A;  3JTK A;  4XPL A;  2CXA A;  4KLW A;  2K5R A;  3FVL A;  3CD6 Z;  4B5P A;  4R3L A;  2WPW A;  5H86 A;  2OZK A;  5ELY A;  2OOY B;  2P6F A;  2VQY A;  3OW2 Z;  4P4I A;  4BIN A;  4NGQ A;  3S6F A;  2V8G A;  3IX0 A;  1NMT A;  2PJA A;  1X0T A;  3WT4 A;  4F0X A;  4KS9 A;  4UFV A;  1Y1V I;  1I50 I;  1YIJ Z;  1SIW A;  4NGS A;  4Q36 A;  3GLJ A;  2Z3O A;  5IT9 b;  4ORF A;  4B10 A;  3D7D A;  1Z8T A;  3BG0 B;  3B3C A;  2FCK A;  3SJF A;  5LRJ A;  2LFU A;  3P2H A;  3B3V A;  1R43 A;  4H6U A;  1YJ9 Z;  2B5G A;  2YND A;  3D6W A;  2FIW A;  3GYA A;  3I9S A;  3VMI A;  1YK3 A;  2JA5 I;  4U9Z A;  1FDI A;  2B4B A;  4CGL A;  4M6H A;  3GIU A;  3WR7 A;  4LQ6 A;  2PJ8 A;  2Y0S A;  4NXY A;  4ZY0 A;  1YIJ 1;  3T90 A;  3G71 Z;  1RO4 A;  5F46 A;  5C82 A;  1CPS A;  4NGM A;  4CRZ B;  1YJW Z;  4X2T A;  2FE7 A;  3KGQ A;  4IAV A;  1Z4E A;  1X3Z A;  2DXQ A;  3A9L A;  3RYO A;  4B11 A;  2AFX A;  2Z3N A;  1Z03 A;  1UFH A;  1K73 1;  5J8C A;  4MHP A;  4MFL A;  3CCR 1;  2KI7 B;  2NAP A;  2IJZ A;  1TF9 A;  3BLN A;  4BY1 I;  4TNU A;  2BSW A;  3FQQ A;  1IYL A;  1OBR A;  3FJU A;  1Z9U A;  2CF4 A;  3ISZ A;  4X8I A;  3QAH A;  1KC8 1;  1F2P A;  1QSN A;  1VQM 1;  1YIT 1;  2QYV A;  1KUV A;  2CNS A;  1VQO Z;  1TWG I;  2RFH A;  4XX2 A;  1LCP A;  2EUI A;  2PJ0 A;  5D1O B;  4MHD A;  4NFR A;  4OKO A;  2AE6 A;  4MFQ A;  3SXN A;  2KCW A;  4UIB A;  3RZA A;  1YJ9 1;  1NP6 A;  2C6P A;  4ZY1 A;  3EED A;  1KWM A;  3D2M A;  1RO0 A;  3FMC A;  1Q82 1;  2YNC C;  2J9A A;  4UWJ A;  1ZG7 A;  2GLF A;  1VQ5 Z;  3FB3 A;  4FD6 A;  4KZT A;  2J6A A;  4BXX I;  2YNC A;  3D68 A;  2OTJ 1;  4LUA A;  4EWT A;  3SJE A;  3EY5 A;  1VQK 1;  3IWE A;  3PP9 A;  3D2L A;  1KD1 2;  2VPZ A;  3GKQ A;  3CCE Z;  3TOB A;  2PJC A;  4A33 A;  1VGY A;  2PVW A;  3CCJ Z;  1Q2C A;  2VUG A;  4HKF A;  1YI2 Z;  3GCF A;  4UEZ A;  2HQY A;  2XEG A;  1LAN A;  4UA3 A;  2H5M A;  3KHX A;  3VWD A;  4UWI A;  1VLA A;  1XEB A;  4OP4 A;  4OLL A;  3I4N I;  3S1M I;  3SJG A;  2NYQ A;  1Z01 A;  3RZD I;  4AVA A;  2JNY A;  4YGO A;  4C7I A;  4YFJ A;  3TT2 A;  1VQ8 1;  1RTQ A;  1PU9 A;  5HH1 A;  4NBG A;  3T9Y A;  5IX3 A;  5HXD A;  2R92 I;  3NA6 A;  4UCN A;  3MZK B;  1VQL Z;  4MXU A;  3RZO I;  3TOA A;  4X5K A;  3SI0 A;  4GM5 A;  1K73 2;  1YLO A;  2BEI A;  2PMZ A;  3S2H I;  3KIF A;  4XPK A;  1ML8 A;  4UIA A;  3CT9 A;  1XE4 A;  3HKZ A;  5C3E I;  4OID A;  3GKR A;  2FSR A;  4A3M I;  1L0C A;  1YX0 A;  4HNY B;  2PJ5 A;  3DR6 A;  1AMP A;  3PRT A;  1XFO A;  1YLE A;  1IGB A;  3TTH A;  3ZZI A;  1N8R 2;  1TXR A;  2VL1 A;  2ABZ A;  2AYD A;  5G22 A;  4RVD A;  1RXT A;  2HUZ A;  2ZEP A;  3EFA A;  3KKW A;  4A94 A;  4NB8 A;  2Z3M A;  3PBB A;  2V77 A;  2P3Y A;  2M48 A;  3HOU I;  5D1O A;  4NBC A;  2QEX 1;  5HMN A;  1P9N A;  5T67 A;  2RIQ A;  3QWU A;  2VPX A;  2AFO A;  2C1C A;  3BG1 B;  3OWC A;  3CCQ 1;  3IJ3 A;  4IF5 A;  2D4P A;  1NJI 1;  3SXO A;  3DGV A;  1Z4R A;  3R96 A;  4PPZ A;  2O28 A;  2C27 A;  3TE4 A;  1YVK A;  3S14 I;  1B87 A;  4R8F A;  1ELL P;  1XOV A;  1M4I A;  2NVY I;  3TO7 A; 
#chains in the Genus database with same CATH homology
 3PB9 X;  3J80 f;  1VQ6 Z;  4A3G I;  1K9M 1;  1QVF Z;  3V7Z A;  3B3W A;  5CPA A;  2JEW A;  4OC0 A;  4NJQ A;  4EFD A;  4AYB A;  1VQN Z;  4A39 A;  2RHB A;  4P4B A;  2ZOG A;  2PK7 A;  4PXB A;  4R6T A;  5D8N A;  3T8W A;  1TWA I;  2RT9 A;  3M3Y I;  5CM2 M;  4RV9 A;  1TWF I;  4Y52 I;  3J7A 4;  2NVQ I;  2PE3 A;  1F2O A;  1Q86 1;  4DK1 A;  1QVF Y;  1DTD A;  2PJ3 A;  4DUK A;  3I07 A;  1QYP A;  1EE3 P;  3PEI A;  5AN9 F;  3LMS A;  2IZ3 A;  5C4X I;  3HOY I;  5J1Q A;  1QQ9 A;  4MHY A;  4PQA A;  2QA4 1;  4UEE A;  4A3J I;  1HDU A;  1W2B Z;  2ZAE B;  2GLJ A;  2VUM I;  4MON A;  2ZEE A;  2OTL Z;  2JBJ A;  3JAM b;  3CCM Z;  1RNI A;  2ZOF A;  4H2K A;  3CC4 Z;  3CCM 1;  3K2K A;  1XJO A;  2IZ4 A;  3FF3 A;  1K9M 2;  3JRU A;  5K8P A;  4MCR A;  4NGN A;  1YW4 A;  5JM6 A;  3IC1 A;  2DE6 A;  4RVH A;  2B63 I;  4E30 A;  2E9H A;  1TF8 A;  1IY7 A;  1Z02 A;  3TE5 B;  2W04 A;  2CTC A;  1SFO I;  1XBU A;  5F09 A;  2PJ6 A;  2WYR A;  4ZY2 A;  2PJ7 A;  4JZ0 A;  3CCR Z;  2C6G A;  2V8J A;  1VQN 1;  1JQG A;  5CBM A;  3VTN A;  2GTI A;  3NDI A;  3D66 A;  2POK A;  4R76 A;  2RPR A;  1BPM A;  2EWB A;  4DQY B;  3CDX A;  3FEC A;  3IFU A;  3I1U A;  7CPA A;  2K5R A;  3D67 A;  3FVL A;  2EK9 A;  2OTL 1;  1XRY A;  3OW2 Y;  3GTG I;  2I3C A;  4X3R A;  3H8F A;  5IP9 I;  4HH4 A;  3CC7 Z;  3RBU A;  1NUI A;  3CD6 Z;  3G4S 1;  1S72 Z;  2QA4 Z;  1VQ8 Z;  2ZEG A;  3LWU A;  2PIZ A;  2OZK A;  4P44 A;  4A3E I;  2E2H I;  5ELY A;  5I4M A;  2OOY B;  1LQL A;  3PB6 X;  1DL6 A;  3OW2 Z;  2ZEN A;  4P4I A;  4NBA A;  3IIB A;  3H0G I;  4NGQ A;  4RVG A;  2V8G A;  3IX0 A;  4PXD A;  1I3Q I;  2PJA A;  1X0T A;  4A3L I;  4ZYQ A;  3WT4 A;  3IFE A;  3KZW A;  1HEE A;  2PIY A;  2ZEF A;  2XEI A;  5A2Q b;  3CCS 1;  2JA6 I;  4R7M A;  5LYF A;  1Y1V I;  1AYE A;  1I50 I;  2ZEM A;  1YIJ Z;  2O53 A;  2H85 A;  3LUS A;  4NGS A;  3V38 A;  3CPA A;  2HU9 A;  3S1Q I;  3S2D I;  3KL9 A;  3GTO I;  3GLJ A;  1ARM A;  1Z8L A;  2BO9 A;  5IT9 b;  4K3N A;  6CPA A;  3D7D A;  3NH5 A;  2PRQ A;  4NH1 C;  3G6E Z;  3G6E 1;  1VQ9 1;  1Q81 1;  1YJW 1;  3BG0 B;  1QF8 A;  1HDQ A;  3CXC Y;  3B3C A;  1K83 I;  3SJF A;  4Z65 A;  4P4E A;  5LRJ A;  3IF8 A;  2LFU A;  3B3V A;  1VQ7 1;  5LYI A;  4Y7N I;  4EWC A;  1R43 A;  1UWY A;  4LQG A;  1H8L A;  3CCS Z;  2LIY A;  1ZLI A;  1YJ9 Z;  2BCO A;  3NDJ A;  5D29 A;  4B6Z A;  5IP7 I;  2Q43 A;  1Z5R A;  3D6W A;  3HOW I;  4NOZ A;  1KQS Z;  3VMI A;  2JA8 I;  2JA5 I;  1WII A;  3GTJ I;  4E2W A;  1ZG8 A;  3HLP A;  1Y0R A;  3F3P C;  4NBF A;  3PFO A;  4BBR I;  1Y7E A;  3HOV I;  1JJ2 Z;  4NBH A;  3I4M I;  4NBB A;  3T4N B;  2E2J I;  2PJ8 A;  1F57 A;  2Y0S A;  4E2Z A;  3CCU 1;  1YIJ 1;  4ZY0 A;  2BJO A;  2WB1 A;  2R7Z I;  2AFS A;  3KIH A;  3G71 Z;  1L1O C;  1RO4 A;  2V8H A;  4UF4 A;  3I55 Z;  1JJ2 Y;  4A3K I;  4P45 A;  1NJI 2;  3FX6 A;  1YJN 1;  4A3B I;  4OC4 A;  2ANP A;  5JGF A;  1CPS A;  2GTH A;  3MRU A;  4OME A;  3B3S A;  3CC2 Z;  4NGM A;  1YJW Z;  4RS4 A;  4TWE A;  4X2T A;  3VMG A;  3HUV A;  3KGQ A;  4MCP A;  3K7A I;  4G1P A;  1ZB9 A;  4IAV A;  1CPX A;  1ZH1 A;  1X3Z A;  2RB7 A;  5LL6 f;  4IHM A;  2M6N A;  1YME A;  1YHQ Z;  1KC8 2;  3Q87 A;  2PJB A;  5FLX b;  2AFX A;  1ELM P;  1Z03 A;  5D1P A;  4HGY A;  1VQL 1;  4ONW A;  1TFI A;  1K73 1;  4S1T A;  4MHP A;  3CCR 1;  3TC8 A;  2KI7 B;  3D7F A;  2IJZ A;  1Q7Y 1;  1TF9 A;  4NGT A;  3KQX A;  3PFE A;  4MHN A;  4BY1 I;  1Y1W I;  2YU9 I;  3NFZ A;  3FKI I;  4TNU A;  3B3T A;  4DGL A;  4A3F I;  1DE4 C;  4WJB A;  3FED A;  1Y1V S;  3FQQ A;  1FNO A;  1OBR A;  2C6C A;  3FJU A;  4P4F A;  3S9M A;  3CC2 1;  2CF4 A;  2ZEL A;  2JBK A;  1N2F A;  1QVG Y;  3I56 1;  3ISZ A;  4X8I A;  3VAR A;  5K8N A;  4NB9 A;  2V8I A;  1KC8 1;  3G71 1;  3GTM S;  1F2P A;  2JS4 A;  1VQM 1;  3KR4 A;  1YIT 1;  2QYV A;  3WC7 A;  5K8M A;  2OOX B;  2VF1 A;  1VQO Z;  2W03 A;  3I56 Z;  2GU2 A;  3NH8 A;  3PO3 S;  1TWG I;  5FLM I;  4P4D A;  2RFH A;  2WZN A;  1BAV A;  4XX2 A;  1LCP A;  5JH9 A;  4PXC A;  2AFW A;  3VB9 A;  2K3R A;  1K8A 1;  5C44 I;  2DEA A;  3H8G A;  2NVT I;  1PCA A;  3HOZ I;  2PJ0 A;  5D1O B;  4FBE A;  4NFR A;  4OKO A;  2AFM A;  4P10 A;  3L2N A;  3KAS A;  3WC6 A;  1CBX A;  3BI1 A;  4IK2 A;  3KR5 A;  5T6B A;  4UIB A;  3RZA A;  1YJ9 1;  2PJ4 A;  4MD8 A;  2QR1 B;  1NP6 A;  3I55 1;  2C6P A;  3FEE A;  3D7G A;  3EED A;  4ZX9 A;  4ZY1 A;  1KWM A;  3CCV Z;  1RO0 A;  3FMC A;  1NSA A;  1KD1 1;  4NJR A;  3VH9 A;  4RUH A;  1WCM I;  3S9L A;  3CCU Z;  3CCL Z;  3MZL B;  2DE5 A;  1YHQ 1;  2PJ2 A;  4MRI A;  3B2Y A;  4O23 A;  2O4H A;  3S9N A;  1Q82 1;  2J9A A;  1TWC I;  2G2K A;  1LFW A;  3ISX A;  2XEF A;  4ZX8 A;  1ZG7 A;  2GLF A;  1VQ5 Z;  5LYD A;  1M4L A;  2JUB A;  3B7I A;  3SI2 A;  3CCE 1;  3N5F A;  4Q7A A;  2F4M A;  2R93 I;  1X3W A;  4FAI A;  1KQS Y;  1YJN Z;  2J6A A;  4BXX I;  3BI0 A;  3PB4 X;  3JAM f;  2PVV A;  4MCS A;  3D68 A;  2OTJ 1;  2Q51 A;  2V8V A;  4JYW A;  3GTP I;  3KI9 A;  3CME 1;  4DJL A;  4OC1 A;  3CPW Z;  4E31 A;  3SJX A;  2GRE A;  2PCU A;  1VQ6 1;  4A3D I;  3GTL I;  4OC5 A;  4EWT A;  3ESW A;  3SJE A;  1VQ7 Z;  1VQK 1;  4F8Z A;  3NH4 A;  4MH4 A;  4A38 A;  2IMO A;  1KD1 2;  3GKQ A;  3CCE Z;  5IT9 f;  3GTQ I;  2PJC A;  3B35 A;  3WAB A;  1Y0Y A;  1VQ9 Z;  1Q82 2;  1VGY A;  3TDH B;  4MD7 A;  2PVW A;  3CCJ Z;  3CC7 1;  2VUG A;  1Q81 2;  1YI2 Z;  3CMA 1;  3S1R I;  2QLV B;  2PJ9 A;  2R6M A;  3CCV 1;  3GCF A;  4FWU A;  4UEZ A;  4P6Y A;  2DE7 A;  3MON A;  3U50 C;  3GTK I;  3H3V J;  3D9X A;  2OTJ Z;  2QRE B;  1VQ4 1;  5HVF A;  2HF1 A;  3CQZ I;  4OIW A;  1PYT B;  4W9Y A;  2V8K A;  1Q86 2;  1QMU A;  2QVP A;  2QKD A;  1LAN A;  2XEG A;  3IEH A;  5LRG A;  3KHX A;  2JR6 A;  4KSI A;  3BHX A;  3CXC Z;  3PBE A;  1TKF A;  3IO1 A;  2AKL A;  1VLA A;  3CD6 1;  8CPA A;  4HGZ A;  3DLJ A;  4OP4 A;  2AFU A;  3PB8 X;  3CCL 1;  3I4N I;  1YIT Z;  3S1M I;  4BBS I;  3SJG A;  3H8E A;  2NYQ A;  1Z01 A;  2P28 A;  1M1K 1;  3RZD I;  1TKH A;  1GYT A;  2JNY A;  4BY7 I;  3VMH A;  1VHE A;  4NBE A;  1QVG Z;  5HVH A;  5FLX f;  1CG2 A;  1USP B;  4YWY A;  1VQ8 1;  1RTQ A;  3EER A;  4NBG A;  4QTT A;  2NSM A;  2RBL A;  3S1N I;  3J81 f;  3FH4 A;  1YSJ A;  3PB7 X;  4FUU A;  5HXD A;  2Q4Z A;  2R92 I;  3NA6 A;  4A3C I;  1LOK A;  4CPA A;  1RLY A;  1YUK A;  1Q7L A;  1VIX A;  3MZK B;  1VQL Z;  3CPW Y;  1VQO 1;  2ZEO A;  5LYL A;  4MXU A;  2PJ1 A;  3RZO I;  3SI0 A;  4P4J A;  4YU9 A;  1VQM Z;  2FVG A;  4GM5 A;  1VQP Z;  1M90 1;  1K73 2;  1YLO A;  1YUA A;  1WW9 A;  1FT7 A;  1M1K 2;  1ZB8 A;  2PMZ A;  2WAQ A;  1W2B Y;  3KIF A;  1Q7Y 2;  3S2H I;  3KQZ A;  3J80 b;  1ML8 A;  2V8D A;  4UIA A;  3CT9 A;  2F7V A;  3HKZ A;  5C3E I;  2QJ8 A;  4OID A;  2HB6 A;  4A3M I;  1LAP A;  4MD9 A;  2PJ5 A;  1XMB A;  2JA7 I;  3M4O I;  3WC5 A;  3VAT A;  1VHO A;  1AMP A;  5HVG A;  1RO2 A;  3CC4 1;  1Z2L A;  3PO3 I;  5A2Q f;  3J81 b;  2HC9 A;  3PRT A;  1ZLH A;  1S7M A;  1ARL A;  4A3I I;  1BLL E;  2OOT A;  1XFO A;  2ZED A;  3IWW A;  2F4O A;  1M90 2;  1YI2 1;  1IGB A;  1N8R 2;  4A93 I;  1TXR A;  1K8A 2;  4NGR A;  5DS0 A;  3P5J B;  2OR4 A;  3S16 I;  2YAD A;  2VL1 A;  1R3N A;  4EME A;  2ABZ A;  4UEF A;  4RVD A;  3PO2 I;  2ZEP A;  4NGP A;  4DYO A;  3BXM A;  4OC2 A;  4A94 A;  1VQ4 Z;  4NB8 A;  3HOX I;  3PBB A;  4PXE A;  3RAM A;  2IQ6 A;  2CIJ A;  2V77 A;  2P3Y A;  4WWV A;  2M48 A;  3HOU I;  2QRC B;  3GUX A;  3TX8 A;  3CME Z;  4E32 A;  3KHZ A;  4RVF A;  5D1O A;  2EGT A;  4NBC A;  2QEX 1;  3SI1 A;  4X6A I;  3CMA Z;  1P9N A;  5T67 A;  2RIQ A;  2E2I I;  3S15 I;  2ZEH A;  3CCJ 1;  2F8H A;  1ZG9 A;  5THW A;  3MN8 A;  4MCQ A;  3QWU A;  4AXV A;  2QRD B;  5T64 A;  1RQF A;  1N8R 1;  3QNV A;  2XEJ A;  1LAM A;  3GB0 A;  3GTM I;  3D4U A;  2AFO A;  1TWH I;  2KPI A;  2C1C A;  4MHZ A;  1VQK Z;  4E2X A;  4BD9 A;  4MMO A;  1KRL A;  1TKJ A;  5IB9 A;  3BG1 B;  1R9T I;  2QEX Z;  3CCQ 1;  1PFT A;  3IJ3 A;  3K9T A;  1I6H I;  4NBD A;  2CTB A;  5LRK A;  4OC3 A;  3CCQ Z;  1NJI 1;  3FQM A;  2EK8 A;  3DGV A;  2NVX I;  2AFZ A;  5C4J I;  2PM9 A;  2BOA A;  3D7H A;  4E33 A;  1USP A;  2JMO A;  4CL1 A;  3CPX A;  4F9U A;  4ZI6 A;  4PPZ A;  4QTU A;  1VQ5 1;  1CX8 A;  3S14 I;  1S72 1;  3G4S Z;  1CP6 A;  5K8O A;  1CP7 A;  4R8F A;  1ELL P;  4E2Y A;  1BPN A;  4F9V A;  2G9D A;  1YW6 A;  1JWH C;  3S17 I;  4A37 A;  1VQP 1;  2NVY I;  3F3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...