2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
4OC0A 1TXRA 1QMUA 3SI1A 2PIZA 3KQXA 3MRUA 4DYOA 5LRKA 5HVFA 4UEEA 4MHPA 3SI0A 3KQZA 5F09A 3SJXA 3IWWA 2JEWA 1KWMA 4F9VA 3TX8A 3BI0A 3WC6A 3S9LA 1Y0YA 3WT4A 1Y0RA 4ZX8A 3FMCA 3WABA 3B7IA 4IHMA 1CG2A 2GREA 1TF9A 1LFWA 3PB7X 4P4DA 1IY7A 1CP6A 2PJCA 2QVPA 3FJUA 5CPAA 4RUHA 4K3NA 2C6CA 5ELYA 3RBUA 3B2YA 2C6PA 3D7GA 4A38A 4MCRA 4UEFA 1F57A 1LOKA 3ISZA 2ZEMA 2AFOA 2PJ4A 4MXUA 3KHXA 2F7VA 4MMOA 3B35A 1CPXA 1YW6A 7CPAA 3MN8A 1R43A 5K8OA 1M4LA 8CPAA 3B3VA 1HDUA 2PCUA 2Q51A 3NH8A 3BXMA 2XEGA 4P45A 1YW4A 3QNVA 4FWUA 2PVWA 4OKOA 5LRJA 3IFEA 1TKHA 3H8EA 4NGRA 4OMEA 3KR5A 2OOTA 3IIBA 2JBJA 3WC5A 1CP7A 2PJAA 2XEIA 2IQ6A 1NSAA 1Z8LA 4UIAA 4WJBA 1XFOA 2GLFA 3GUXA 1ZG7A 2NYQA 3FH4A 5LYIA 3RAMA 1Z5RA 2POKA 3ISXA 2ZEDA 4A94A 4F9UA 3D66A 1BPNA 3I1UA 1ELLP 2BCOA 4H2KA 4OC2A 1VGYA 4P4JA 4O23A 2NSMA 1UWYA 1IGBA 1QQ9A 2CTCA 4PXBA 2PJ0A 3KASA 3KI9A 4Q7AA 2OR4A 5D29A 1YSJA 2HB6A 2V8GA 2CTBA 2ZOFA 2V8VA 1YLOA 2ZEGA 5CBMA 3HUVA 2JBKA 1BLLE 1ZG8A 3VH9A 3FECA 3GLJA 4ZY2A 4EFDA 4DJLA 1LAMA 3NH4A 4NJRA 2ZEEA 1VHEA 2PJ3A 2PJ1A 2ZEOA 4ZX9A 4ONWA 2CF4A 4UF4A 1AYEA 4UIBA 2AFZA 5K8PA 3CPAA 6CPAA 3B3CA 4KSIA 3DLJA 4R8FA 3PB4X 2PJ7A 4NGQA 1TKJA 3KGQA 1HDQA 4W9YA 2ZEPA 4P4IA 4P6YA 2EWBA 1ZLIA 1LAPA 2EK9A 1JQGA 2PJ5A 5HXDA 5HVGA 1ELMP 4NGMA 2C6GA 4P10A 4P4FA 1CPSA 3CDXA 3FEEA 3PB9X 1DTDA 4PQAA 3NFZA 1AMPA 5I4MA 2PRQA 4TNUA 5JGFA 1PYTB 1CBXA 2AFUA 3K9TA 1VIXA 3SJGA 4WWVA 4FAIA 1H8LA 3LMSA 1TKFA 3PRTA 4PXCA 4GM5A 5LYDA 4OIDA 3GB0A 1Z2LA 2AFSA 2G9DA 4G1PA 4PXEA 1CX8A 2PJ8A 2ZOGA 1OBRA 2ABZA 3B3WA 4AXVA 5K8MA 4A37A 5LRGA 1XRYA 1Y7EA 2BOAA 3NH5A 3KL9A 2Q43A 3KR4A 2PIYA 3V38A 5J1QA 4ZY0A 2XEFA 4R6TA 4P4EA 3IEHA 1BPMA 4OC4A 4TWEA 1LANA 3RZAA 3BHXA 2WYRA 3PB8X 5LYFA 4Z65A 1ZG9A 2PJ2A 4P4BA 5JH9A 3H8GA 3PFOA 3PEIA 3IC1A 4R7MA 3V7ZA 4X8IA 4EMEA 2RFHA 5IB9A 5DS0A 1FT7A 2V77A 3NA6A 3BI1A 1LCPA 1PCAA 2F8HA 3KHZA 4OC1A 2AFXA 3FX6A 3KZWA 3TC8A 2IJZA 1ARLA 5THWA 1DE4C 3DGVA 1EE3P 3L2NA 1GYTA 2V8DA 1Q7LA 4X3RA 4MHYA 1F2PA 3D7HA 3IJ3A 2DEAA 4OIWA 4OC5A 2O4HA 4MCSA 3SJEA 4R76A 3B3SA 2ANPA 4YWYA 4MCQA 2VL1A 2C1CA 4NJQA 1XBUA 2ZELA 4ZY1A 2ZEFA 3PBEA 3SJFA 1R3NA 4ZI6A 1ARMA 2J9AA 3SI2A 4CPAA 4JYWA 2QJ8A 2IMOA 3HLPA 4NFRA 2GU2A 4NGPA 4A39A 3FVLA 4JZ0A 3D7DA 1BAVA 4X2TA 4OC3A 4P44A 5D8NA 3PB6X 3VATA 4OP4A 3N5FA 2AFMA 4PXDA 3D4UA 3S9MA 2CIJA 3PBBA 3H8FA 4FUUA 3B3TA 4LQGA 3K2KA 4B6ZA 4MRIA 1F2OA 3T8WA 4YU9A 2O53A 3VARA 3D7FA 3FF3A 2XEJA 3WC7A 4NGSA 2PJ6A 3CPXA 3PFEA 2QYVA 3D68A 4F8ZA 3S9NA 4IAVA 4EWTA 3CT9A 1YMEA 2RB7A 3LWUA 1TF8A 1FNOA 4MCPA 3D67A 1XMBA 4MHNA 1ZLHA 4ZYQA 3IO1A 1HEEA 4NGNA 1XJOA 4PPZA 2V8HA 2WZNA 2FVGA 4FBEA 5JM6A 4DUKA 2ZENA 3JRUA 2Q4ZA 2AFWA 2PVVA 4NGTA 2PJBA 3FEDA 4UEZA 2BO9A 2EK8A 2I3CA 4BD9A 1RTQA 5HVHA 4MHZA 2HC9A 4IK2A 2GLJA 2ZEHA 5LYLA 1VHOA 2PE3A 2PJ9A 5K8NA
chains in the Genus database with same CATH superfamily
3SI1A 5FVJA 3CCR1 4B10A 3MRUA 4DYOA 3GYAA 4C7IA 4OAEA 3KQZA 1KUYA 4H89A 1L1OC 3TX8A 2VPWA 1VQK1 2GFQA 4AG9A 3IWEA 4ZX8A 4DK1A 3CCUZ 1YITZ 2ZAEB 3CCE1 3B7IA 1YVOA 3UY5A 1LFWA 4B14A 4P4DA 3CCQ1 1VQ71 2JIMA 1X10A 2ZW5A 5G21A 4MFLA 2WSAA 4K3NA 3RBUA 1Y9WA 3B2YA 3D7GA 3MGDA 3CC4Z 4MCRA 2YADA 4R3LA 1M902 2V8KA 4E0AA 3HOYI 1LOKA 2RPRA 2AFOA 1K4JA 1X12A 3P5JB 3KHXA 4ONUA 4E30A 4OADA 1I50I 1M4LA 1QVFZ 1VQ5Z 4A95A 3G71Z 3NH8A 4B5PB 3CCJZ 4BBSI 4F6AA 3R95A 1VKCA 4OKOA 5FLXf 3IFEA 4OMEA 4MD7A 2OOTA 3IIBA 4KOSA 3G3SA 3I551 4R3KA 2VF1A 3HOZI 1NSAA 3S16I 4UIAA 1ZG7A 3RAMA 2POKA 4NBGA 2ZEDA 4F9UA 2AJ6A 4H2KA 2LEXA 3P2FA 2CTCA 1QQ9A 2PJ0A 3IU1A 3ZJ0A 4NBEA 3CCM1 1KD12 3FNCA 3GY9A 2ZOFA 2V8VA 1YLOA 2X7BA 2ZEGA 1YHQZ 1ZB8A 4B5OA 1M1K2 1M4DA 1ZG8A 2Z10A 3NDJA 2ZW4A 4LX9A 1YVKA 1W2BY 3IF8A 4A3JI 2P6GA 3MONA 1NJI1 2ZEEA 3D8PA 3VMHA 4E33A 5KTDA 2PJ3A 2VUMI 4UFWA 2ZEOA 1RO0A 2VUGA 1I21A 4UF4A 3T9YA 3CC41 3EY5A 3B3CA 3FQQA 4Y49C 1TKJA 2WUUA 4C2YA 4HNYB 4A3MI 4P6YA 2P28A 1S7LA 1X0TA 4YFJA 1JQGA 4AB7A 4NH1C 1VQNZ 2RBLA 4UA3A 4HGZA 4NGMA 2WAQA 1AMPA 3CCJ1 4PSWA 1CBXA 2AFUA 4I49A 2CNTA 3S2HI 1VIXA 1QF8A 4WWVA 1ZO0A 4FAIA 2JEVA 3PRTA 4OIDA 2BUEA 2PC1A 4EWCA 2GTIA 1S7KA 4NBBA 1IB1E 1M4GA 4A37A 2J8MA 3RNZA 2JDCA 2BOAA 3KL9A 3SXNA 2PIYA 3GTKI 3V38A 1ZH1A 1NUIA 2Q7BA 3JTKA 4P4EA 3IEHA 3CCSZ 3RZAA 3BHXA 5LYFA 1S7MA 1Q821 4P4BA 1Q7Y1 2ZW7A 3BJ8A 1KQSZ 4R7MA 4CAWA 2JIPA 3S1QI 2V77A 3BI1A 3KHZA 4OC1A 1WK4A 2W03A 2REFA 1Z4EA 1SQHA 1VQPZ 4MFZA 4RVDA 3TO6A 2G0BA 4CRZB 2PMZA 2M6NA 2QEXZ 4X3RA 4MHYA 4L8AA 1F2PA 4E32A 4CGMA 2RIQA 4NF1A 2R6MA 1QSOA 2IV2X 2RHBA 2VL1A 3I4MI 1VQN1 4NJQA 3RYOA 2B3VA 4PK2A 1IIDA 3SJFA 1K731 3M3YI 3DNSA 3GIUA 3CCLZ 4NGPA 5DWMA 3FVLA 1VQMZ 1BAVA 1RLYA 3TO7A 5D8NA 4XPDC 4KSFA 3HOUI 2JIRA 1QVGZ 3PBBA 3H8FA 4XX2A 3S6HA 3N7ZA 3GTMS 2DPSA 3GTMI 3FF3A 2CXAA 2FS5A 2JR6A 1QSRA 1V0CA 4F8ZA 1Q861 4FD7A 1YMEA 4A3BI 1FNOA 2PSWA 1JJ2Z 1XOVA 4E31A 2Y0MA 5GCNA 1ZLHA 1BOBA 4CS0B 1XJOA 2V8HA 1AA6A 4H6ZA 5JM6A 4MONA 2Q4ZA 2AFWA 2Q0YA 4A3FI 1NE9A 3LD2A 2QIRA 2QA4Z 2A4NA 1VQP1 2QLVB 2I3CA 5J8CA 2F5IA 2R1IA 3S2DI 4IK2A 4X6AI 1YK3A 2QEX1 2PE3A 5KTAA 2PJ9A 2JA8I 2V3VA 3G4SZ 4MBUA 5A2Qb 3CMAZ 4Q38A 5LRKA 2Z3OA 1WW9A 3TOAA 3P2HA 3GTLI 4MHPA 5D1PA 4MHDA 3CCRZ 4B12A 3SJXA 2K3RA 4F9VA 3BI0A 2PDOA 2NMTA 3G6E1 1Y0YA 1Y0RA 2PRBA 4XPDB 2I00A 1CG2A 3GKRA 4J3GA 1USPB 2PJCA 3FJUA 5C44I 2EUIA 5CPAA 5AG6A 3CCL1 3CCQZ 2C6CA 2HUZA 4ORFA 2HF1A 4CYQA 1VQM1 4KS9A 3OW2Y 5C88A 3ISZA 2ZEMA 4MXUA 3U50C 1Q16A 2EBJA 4MMOA 1CPXA 4A3LI 1ON0A 2JS4A 2I79A 1L0CA 4GS4A 1TWHI 3B3VA 3D3SA 2ODFA 4E2ZA 4NOZA 2XEGA 4P45A 1K83I 3FXTA 3QNVA 4CYNA 2PVWA 5LRJA 1TKHA 2JIOA 4JXQA 3H8EA 4NGRA 2OZHA 3TE4A 5EC4A 3WC5A 1NP6A 4HGYA 2OTJ1 3I55Z 2GLFA 3GUXA 4E2XA 4MFJA 2QA41 2GIVA 3G8WA 4CAFA 2Z3MA 5AN9F 2ATRA 2KCWA 2OH1A 1XF8A 3G4S1 3PO3I 5H86A 1YIJ1 5HH1A 2CTBA 2FCKA 3CCMZ 5CNPA 3I07A 1W2BZ 4KORA 4Y52I 4UCNA 3NE7A 4HPSA 3VH9A 4CAXA 5JQ4A 2QREB 1LQLA 2VPZA 1USPA 4LQ6A 1VHEA 2WPXA 3CC7Z 3JVNA 4QVTA 1YR0A 3RO0A 3GTGI 2YGWA 4A3GI 2VPXA 3LODA 5JPHA 2JUBA 5K8PA 1YREA 6CPAA 3CZXA 4KSIA 2O28A 3JAMf 3DLJA 4R8FA 5H84A 2PJ7A 4NGQA 1JWHC 3EERA 3KGQA 1WJ2A 4W9YA 1VQ6Z 5FLMI 1P9NA 4P4IA 1N71A 2EWBA 3FQMA 3CME1 2FXFA 4KOVA 1TWAI 4E2AA 1IYLA 3DDDA 3PP9A 3CC2Z 1VQ91 2C6GA 3FKII 3F3PC 5I4MA 2PRQA 4A3EI 3D6WA 4CGPA 5IT9f 1H8LA 4PXCA 1TWFI 5LYDA 2Y0SA 4AVAA 3GB0A 1XE4A 4IF5A 2G9DA 2AKLA 4G1PA 1Y9KA 3S1NI 4JXRA 4C2ZA 4PXEA 2ZOGA 4KZTA 1N8R1 1OBRA 2ABZA 4CGLA 4UCMA 3RZDI 5LRGA 4A33A 4QB9A 4BXXI 4NEXA 4KLVA 2Q43A 5J1QA 4ZY0A 2XEFA 1BPMA 1FDIA 4MY3A 2WYRA 1ZG9A 4NB9A 3HOVI 2PJ2A 1XMTA 4QTUA 2Q4VA 1MJAA 3H8GA 3PFOA 5G22A 2P3YA 3PEIA 1M1DA 1Q2DA 3S17I 4FD6A 2RT9A 3NA6A 1MJBA 4FD5A 2B4DA 1LCPA 2F8HA 2AFXA 3FX6A 2JDDA 5C4JI 2IJZA 1S5KA 5THWA 2OZKA 3CC71 1EE3P 3H4QA 3IX0A 3PO2I 4RVHA 1GYTA 2V8DA 3IWGA 1VQO1 3R9EA 2E2II 3SXOA 3TTHA 2BJOA 2NVXI 2DEAA 4OIWA 2PM9A 4QUSA 2O4HA 4MCSA 1I12A 4CYOA 2Q04A 1Y8CA 2PQ8A 5EBVA 1VQ61 4X5KA 2C1CA 3CC21 2Q4YA 1IOIA 1KD11 4NSQA 1XBUA 1YGHA 2EVNA 3PBEA 1IOFA 1R3NA 1Z8TA 1ARMA 2J9AA 5FLXb 2QJ8A 2IMOA 2EO8A 4NXYA 1LRZA 3Q87A 4M6IA 4R57A 4OC3A 4P44A 1I1DA 3EEDA 3PGPA 2E9HA 3N5FA 1NSLA 1Q822 4PXDA 2PR8A 2V8IA 1Q7Y2 3S9MA 2GTHA 4FUUA 3B3TA 3K2KA 4YU9A 3D7FA 3QWUA 4R9MA 3CPXA 5A27A 2QYVA 4EWTA 2VXKA 2REEA 3LWUA 3I3GA 3D67A 1XMBA 3W6SA 4MHNA 2RC4A 4ZYQA 2NVQI 4PPZA 2ARHA 4MH4A 4DUKA 5LL6f 1KC82 4NGTA 3W91A 4UWIA 3FEDA 3K7AI 1K9M2 1VQ8Z 4UEZA 4Y49B 4QBJA 4BD9A 2HC9A 3NDIA 2ZEHA 5LYLA 4OC0A 1UFHA 3NE8A 1VHSA 2PIZA 1KUVA 3KQXA 3H0GI 1K732 5ISVA 5HVFA 3TE5B 3SI0A 5F09A 1KWMA 5IB0A 2Q7SA 3S9LA 3VMGA 5T64A 4A3II 3FMCA 3TFYA 2LFUA 5D1OA 3G6EZ 1TWGI 1SIWA 4C2XA 3R9FA 3CPWY 1S7NA 3T90A 3J81f 3CD6Z 1IY7A 1CP6A 2CNMA 3KIHA 3QAHA 2OTL1 2JA6I 4PV6A 4RUHA 3OW2Z 2AYDA 2C6PA 4A38A 2FIAA 2OZUA 5DWNA 3TCVA 2R93I 4KLWA 5AG5A 1F57A 2R92I 2PJ4A 4II9A 2E2JI 1Q811 4MD9A 2J8NA 3B35A 7CPAA 3LUSA 2YNCC 4DNCA 1QYPA 5K8OA 3D2LA 3J80f 1Y1VS 4UFVA 2PCUA 4KVME 2VEZA 3M4OI 2JNYA 1YW4A 1Z01A 3CXSA 4A3DI 3VWDA 5T67A 4MI4A 5C82A 2XEIA 4RI1A 2IQ6A 3GKQA 2H5MA 2K5RA 4M85A 2ZW6A 3FH4A 2OTJZ 2NAPA 5LYIA 1QXFA 2YU9I 1Z5RA 4UBRA 1VQ81 2B63I 3ISXA 4A94A 2B4BA 1BPNA 1ELLP 2IZ4A 2BCOA 4YGOA 1OZPA 4O23A 1UWYA 4PXBA 2HU9A 5F48A 5J8FA 1XEBA 3KASA 4M6HA 2V8GA 2W04A 3V8IA 2M48A 1IICA 5F46A 1RXTA 2GE3A 1YIJZ 1WWZA 1BLLE 4KVXA 3FECA 1GHEA 2QECA 4ZY2A 4EFDA 1TIQA 4NB8A 3NH4A 4UFXA 4MFKA 1K8A1 4CL1A 3TO9A 4LUAA 3CD61 1YUAA 3S15I 3QAYA 2HV2A 4ONWA 2CF4A 1AYEA 1AUGA 2AFZA 2DE7A 3PB4X 3K9UA 4RV9A 2JA7I 5HXDA 5HMNA 4CAVA 3CMEZ 5HVGA 1ELMP 3CXCY 1B87A 4P10A 2BSWA 3CDXA 3FEEA 3PB9X 5IP9I 1DTDA 3NFZA 4PQAA 1VQ9Z 2R8VA 4A30A 3K9TA 3SJGA 3GTJI 1TKFA 4A32A 2OU2A 2YNDA 2AFSA 1WIIA 1YJN1 4ZGYB 4NBHA 3KKWA 2E2HI 3B3WA 4AXVA 5K8MA 1XRYA 1Y7EA 3NH5A 3KR4A 1SFOI 3GTPI 4R6TA 3H3VJ 1Z03A 1X3WA 3IR7A 4OC4A 1LANA 4KVOE 4KUBA 3WR7A 3BG0B 2G3TA 3PB8X 4JJXA 1QSNA 3FIXA 4MY0A 4BMHA 4F0XA 2OB0A 4CGNA 4C7HA 4MFPA 3V7ZA 4X8IA 4EMEA 2RFHA 5IB9A 5AGEA 2FE7A 3BG1B 4RS2A 1FY7A 4C68A 1ARLA 2P6FA 4QTTA 1DE4C 1VQL1 3MZLB 2YNCA 3L2NA 2B4DB 3I4NI 3DR6A 2GANA 3IJ3A 3D9XA 4OC5A 1VQOZ 3GCFA 5C4XI 3SJEA 3TT2A 3B3SA 2FT0A 4YWYA 1CM0A 1M44A 2Z11A 2Q44A 3MZKB 5G20A 2NVTI 3S1RI 4HH4A 4BINA 5CM2M 2VQYA 2NVYI 2VZYA 4ZY1A 2ZEFA 1N8R2 3HOXI 1JWQA 2BEIA 4ZI6A 5AG4A 4JYWA 4MFQA 2J8RA 2B5GB 1YJWZ 4A3CI 2GU2A 3EFAA 4A39A 4JZ0A 3D7DA 3HOWI 3EO4A 2JMOA 2CNSA 4IUSA 3R1KA 2OOYB 3VATA 3C26A 2AFMA 3PZJA 3D4UA 2CIJA 4PSXA 2KPIA 1YX0A 1F2OA 2R7ZI 2BL1A 2IZ3A 4YRHA 2O53A 3VARA 3J7A4 1J4JA 3BJ7A 4BBHA 2PJ6A 4PK3A 2EGTA 3F8KA 1M901 2K5TA 3S9NA 4IAVA 1VQ41 2RB7A 2V8JA 1TF8A 2Z0ZA 4JLYA 2D4OA 2AE6A 1XIXA 1NJI2 3IO1A 2R98A 2WZNA 3F5BA 4B13A 2ZENA 3JRUA 3GTQI 2PJBA 3R96A 4E8OA 2KI7B 3FB3A 4R87A 3IGRA 2EK8A 5HVHA 1KRLA 4UWJA 2OOXB 3IU2A 4DGLA 3FBUA 4X2TA 4U9YA 2ZPAA 1TXRA 4M6GA 1QMUA 3JAMb 4AVCA 2Z3PA 1KUXA 4UEEA 1YI2Z 4A31A 3IWWA 4AYBA 2JEWA 3CCU1 1YIT1 4JD6A 4U9ZA 4KOTA 3WC6A 3CPWZ 4CGOA 5I0CA 2DE6A 3WT4A 2DE5A 3WABA 4IHMA 2GREA 1TF9A 3PB7X 5IT9b 3F0AA 1WZNA 2B5GA 5IX3A 2QVPA 3CQZI 2D4PA 5D1OB 5ELYA 1YJW1 1M1K1 2C27A 1S72Z 2OTLZ 2JA5I 1I6HI 4UEFA 1YUKA 1Y7RA 1IU8A 2F7VA 2VI7A 3VWEA 1YW6A 2Z3KA 4EVYA 4B5PA 1VQ51 3G711 3MN8A 1R43A 8CPAA 1HDUA 2Q51A 3BXMA 2FSRA 4F0YA 1YQEA 4M3SA 1A2ZA 1QVFY 4FWUA 3GTOI 1QSMA 3DR8A 4RVFA 4AVBA 2VBQA 3BLNA 3KR5A 2JBJA 2FIWA 1CP7A 2PJAA 3D2PA 1Z8LA 4WJBA 1XFOA 3RZOI 1RO5A 2NYQA 4RS4A 1BO4A 4KOYA 1RO2A 2E7ZA 3D66A 3I1UA 4OC2A 1TFIA 1VGYA 4P4JA 2QR1B 3S6GA 2NSMA 1IGBA 1KZFA 2G3AA 4L89A 1ML8A 2VPYA 3KI9A 4Q7AA 2OR4A 5D29A 1YSJA 1YHQ1 3VMIA 2HB6A 2F4MA 5IV0A 4A3KI 2Z3NA 4RN7A 1YI21 5CBMA 1VLAA 1PFTA 4HNWB 5G1ZA 3HUVA 5A28A 2JBKA 5EMIA 4NCZA 2P0WA 3GLJA 1Q2YA 4DJLA 2HQYA 1LAMA 1RO4A 4XPKA 2QKDA 4CAEA 4NJRA 2WB1A 2R7HA 1S7FA 4K30A 3QB8A 1QSTA 4HNXB 1Q812 2WPWA 4BY1I 2PJ1A 4FD4A 2DPTA 4MJ8A 4B11A 4ZX9A 4QC6A 5E96A 1S721 4UIBA 4OLLA 1KC81 3CPAA 3SHPA 1K9M1 2OZGA 2Z3LA 3CXPA 4NBCA 5A2Qf 3W6XA 3E0KA 1DL6A 2PK7A 1HDQA 2ZEPA 1Q862 3CXCZ 1Z9UA 1ZLIA 1Z8XA 1LAPA 2EK9A 2PJ5A 4BBRI 2G2KA 3VTNA 1M4IA 4P4FA 1CPSA 1X3ZA 4RVGA 1PUAA 1YLEA 4TNUA 3VB9A 1PYTB 5JGFA 1Y1WI 2ZXVA 1RQFA 1Y1VI 2DXQA 4S1TA 1U6MA 3LMSA 5KTCA 4GM5A 3CXQA 1RNIA 1Z2LA 1WCMI 2FL4A 3A9LA 3CCVZ 3R9GA 1MJ9A 1CJWA 1YJNZ 1CX8A 2PJ8A 5AG7A 2VZZA 3JUWA 5T6BA 1YJ9Z 1Z8WA 2LIYA 2V45A 3CCS1 3B8GA 5C3EI 2H85A 1K8A2 2IL4A 4TWEA 2B3UA 4MD8A 4Z65A 3S14I 2PR1A 4E2YA 5JH9A 1PU9A 4XNHC 3IC1A 3S6KA 5DS0A 4AG7A 1FT7A 1KQSY 1P4NA 1PCAA 2JIQA 3ZZIA 2B58A 4KOXA 3J81b 3KZWA 3HKZA 3TC8A 4U5YA 5IP7I 2QRDB 3DGVA 3F3FC 4HKFA 1S60A 4A93I 3T4NB 4E2WA 1VQLZ 1Q7LA 1P0HA 2P6EA 3I56Z 3D7HA 4KUAA 4KSAA 2CY2A 5F47A 4R76A 2J6AA 3FRMA 2ANPA 2YNEA 1I3QI 4MCQA 4XPLA 3IFUA 1VQKZ 3J80b 3TDHB 1B6BA 3CCEZ 2ZELA 2JLMA 4H6UA 1VQ7Z 5F49A 3SI2A 4CPAA 1TWCI 3HLPA 4BY7I 4NFRA 2QMLA 3I9SA 4CYPA 3CCV1 4Q36A 1N2FA 1IYKA 4JWPA 3PB6X 3ESWA 3S1MI 3EC4A 4OP4A 1R57A 3S6FA 1YJ91 3OWCA 4KOUA 4XNHB 4NBDA 4DQYB 1Z02A 3KIFA 4LQGA 5BWAB 4B6ZA 4MRIA 3T8WA 2XEJA 4A2ZA 3WC7A 4NBFA 1QVGY 1MK4A 4NGSA 3PFEA 1NMTA 3D68A 4KOWA 2QRCB 3CT9A 1Q2CA 4GXHA 4MCPA 3EXNA 4ZBGA 1VQ4Z 4UCPA 3LACA 3H5ZA 1HEEA 3FYNA 4NGNA 1JJ2Y 2FVGA 4CRYB 4FBEA 4NBAA 1FDOA 2PVVA 1R9TI 2DF5A 1ZB9A 1S3ZA 3D2MA 2BO9A 2F4OA 1RTQA 1Z4RA 3DSBA 4MHZA 4Y7NI 3PO3S 2GLJA 3CMA1 1VHOA 3TOBA 5K8NA 3I561
chains in the Genus database with same CATH topology
4OC0A 2JA8I 1TXRA 1QMUA 3G4SZ 3SI1A 5A2Qb 3CMAZ 2PIZA 3JAMb 3CCR1 3KQXA 3MRUA 4DYOA 5LRKA 1WW9A 3H0GI 1K732 5HVFA 4UEEA 3TE5B 3GTLI 4MHPA 3SI0A 5D1PA 1YI2Z 3CCRZ 3KQZA 5F09A 3SJXA 2K3RA 3IWWA 4AYBA 1L1OC 2JEWA 3CCU1 1KWMA 1YIT1 3TX8A 4F9VA 3BI0A 1VQK1 3WC6A 3S9LA 3CPWZ 3G6E1 3VMGA 1Y0YA 5T64A 2DE6A 3WT4A 1Y0RA 4ZX8A 4A3II 4DK1A 3CCUZ 1YITZ 3FMCA 2DE5A 3WABA 2LFUA 2ZAEB 3CCE1 3B7IA 5D1OA 3G6EZ 1TWGI 4IHMA 1CG2A 3CPWY 2GREA 1TF9A 3J81f 1LFWA 3PB7X 4P4DA 3CCQ1 1USPB 3CD6Z 1VQ71 5IT9b 1IY7A 3KIHA 1CP6A 2PJCA 2QVPA 3FJUA 5C44I 2OTL1 2JA6I 5CPAA 4RUHA 3CQZI 3OW2Z 4K3NA 5D1OB 3CCL1 3CCQZ 1YJW1 1M1K1 2C6CA 3B2YA 5ELYA 3RBUA 1S72Z 2C6PA 3D7GA 2HF1A 2OTLZ 4A38A 3CC4Z 2JA5I 4MCRA 1VQM1 2YADA 2R93I 1M902 2V8KA 1I6HI 3OW2Y 3HOYI 4UEFA 1F57A 1LOKA 2R92I 3ISZA 2RPRA 2ZEMA 2AFOA 2PJ4A 4MXUA 3U50C 1YUKA 3P5JB 3KHXA 2E2JI 2F7VA 4MMOA 1Q811 4MD9A 3B35A 1CPXA 4A3LI 1YW6A 2JS4A 1VQ51 4E30A 7CPAA 3G711 3LUSA 1I50I 3MN8A 1QYPA 1R43A 5K8OA 1M4LA 1TWHI 8CPAA 3B3VA 1QVFZ 1VQ5Z 3J80f 1Y1VS 1HDUA 3G71Z 2PCUA 2Q51A 3NH8A 3BXMA 4E2ZA 4NOZA 3M4OI 2XEGA 4P45A 3CCJZ 2JNYA 1YW4A 1K83I 4BBSI 1Z01A 3QNVA 1QVFY 3GTOI 4FWUA 4RVFA 2PVWA 5FLXf 4A3DI 3IFEA 5T67A 1TKHA 4OKOA 5LRJA 3H8EA 4NGRA 4OMEA 4MD7A 3KR5A 2OOTA 3IIBA 2JBJA 3I551 3WC5A 1CP7A 2VF1A 2PJAA 1NP6A 4HGYA 2XEIA 3HOZI 2OTJ1 2IQ6A 3GKQA 1NSAA 3S16I 1Z8LA 4UIAA 3I55Z 4WJBA 1XFOA 2GLFA 2K5RA 3GUXA 1ZG7A 3RZOI 2NYQA 4E2XA 4RS4A 3FH4A 2OTJZ 5LYIA 3RAMA 2YU9I 1Z5RA 1VQ81 1RO2A 2B63I 2POKA 2QA41 3ISXA 4NBGA 2ZEDA 4A94A 4F9UA 3D66A 1BPNA 3I1UA 1ELLP 2IZ4A 2BCOA 4H2KA 5AN9F 1TFIA 1VGYA 4OC2A 4P4JA 2QR1B 4O23A 2NSMA 1IGBA 1UWYA 1QQ9A 2CTCA 2HU9A 4PXBA 1ML8A 2PJ0A 3KASA 3G4S1 3KI9A 4NBEA 3PO3I 3CCM1 4Q7AA 2OR4A 5D29A 1YSJA 1YHQ1 1YIJ1 3VMIA 1KD12 2HB6A 2V8GA 2CTBA 2W04A 2F4MA 2V8VA 1YLOA 4A3KI 2ZOFA 2M48A 3CCMZ 1YI21 2ZEGA 3I07A 5CBMA 1VLAA 1W2BZ 1YHQZ 1YIJZ 4Y52I 1PFTA 3HUVA 2JBKA 1ZB8A 1BLLE 1M1K2 1ZG8A 3VH9A 3FECA 3GLJA 3NDJA 4ZY2A 4EFDA 4DJLA 1LAMA 1RO4A 4NB8A 1W2BY 2QKDA 3IF8A 3NH4A 1K8A1 4NJRA 2QREB 1LQLA 2WB1A 4A3JI 1USPA 4CL1A 3MONA 1NJI1 2ZEEA 1VHEA 3VMHA 4E33A 3CC7Z 1Q812 3CD61 2PJ3A 4BY1I 2VUMI 1YUAA 2PJ1A 3S15I 3GTGI 4A3GI 2ZEOA 1RO0A 2VUGA 4ZX9A 4ONWA 1S721 2CF4A 4UF4A 1AYEA 4UIBA 1KC81 2AFZA 2JUBA 3CC41 5K8PA 3CPAA 2DE7A 1K9M1 6CPAA 3B3CA 3FQQA 4NBCA 5A2Qf 4KSIA 3JAMf 3DLJA 4R8FA 3PB4X 2PJ7A 4NGQA 1JWHC 3EERA 1DL6A 1TKJA 3KGQA 2PK7A 1HDQA 4W9YA 1VQ6Z 4RV9A 1P9NA 5FLMI 2ZEPA 4P4IA 1Q862 4A3MI 4P6YA 3CXCZ 2EWBA 2P28A 3FQMA 3CME1 1TWAI 1ZLIA 1X0TA 2JA7I 1LAPA 2EK9A 1JQGA 4NH1C 1VQNZ 2PJ5A 2RBLA 3CC2Z 4BBRI 5HXDA 1VQ91 2G2KA 3VTNA 3CMEZ 4HGZA 1ELMP 3CXCY 5HVGA 4NGMA 2C6GA 4P10A 4P4FA 1CPSA 2WAQA 3FKII 3CDXA 1X3ZA 4RVGA 3FEEA 3F3PC 3PB9X 5IP9I 1DTDA 3NFZA 4PQAA 1AMPA 5I4MA 2PRQA 4TNUA 3CCJ1 3VB9A 1PYTB 1VQ9Z 5JGFA 1CBXA 2AFUA 1Y1WI 3K9TA 3S2HI 1VIXA 4A3EI 3D6WA 1RQFA 1QF8A 1Y1VI 4WWVA 3SJGA 4S1TA 3GTJI 5IT9f 4FAIA 1H8LA 3LMSA 1TKFA 3PRTA 4PXCA 1TWFI 4GM5A 5LYDA 4OIDA 2Y0SA 1RNIA 3GB0A 1Z2LA 1WCMI 4EWCA 2AFSA 2GTIA 1WIIA 1YJN1 2G9DA 2AKLA 4NBHA 3CCVZ 4G1PA 3S1NI 4NBBA 4PXEA 2E2HI 1YJNZ 1CX8A 2PJ8A 2ZOGA 1N8R1 1OBRA 5T6BA 2ABZA 1YJ9Z 3B3WA 4AXVA 5K8MA 3RZDI 4A37A 5LRGA 4BXXI 1XRYA 2LIYA 1Y7EA 2BOAA 3NH5A 3KL9A 2Q43A 3KR4A 3CCS1 2PIYA 3GTKI 1SFOI 3V38A 1ZH1A 5C3EI 2H85A 3GTPI 1NUIA 5J1QA 4ZY0A 2XEFA 4R6TA 1K8A2 4P4EA 3IEHA 3CCSZ 3H3VJ 1Z03A 1X3WA 1BPMA 4OC4A 4TWEA 1LANA 3RZAA 3BHXA 2WYRA 3BG0B 4MD8A 3PB8X 5LYFA 1S7MA 4Z65A 3S14I 1ZG9A 4NB9A 1Q821 3HOVI 2PJ2A 4P4BA 1Q7Y1 4QTUA 4E2YA 5JH9A 3H8GA 3PFOA 1KQSZ 2P3YA 3PEIA 3IC1A 4R7MA 3V7ZA 4X8IA 4EMEA 2RFHA 3S17I 5IB9A 5DS0A 2RT9A 3S1QI 1FT7A 2V77A 3NA6A 3BI1A 1KQSY 3BG1B 1LCPA 1PCAA 2F8HA 3KHZA 4OC1A 2AFXA 3FX6A 5C4JI 3J81b 2W03A 3HKZA 3KZWA 3TC8A 2IJZA 1ARLA 5IP7I 4QTTA 1DE4C 5THWA 2QRDB 2OZKA 1VQL1 3CC71 1VQPZ 3DGVA 3MZLB 3F3FC 1EE3P 4RVDA 3L2NA 4A93I 2PMZA 3T4NB 3IX0A 2M6NA 3PO2I 4E2WA 4RVHA 1GYTA 1VQLZ 1Q7LA 2V8DA 2QEXZ 1VQO1 3I4NI 3I56Z 4X3RA 4MHYA 2E2II 2BJOA 1F2PA 2NVXI 3D7HA 3IJ3A 2DEAA 3D9XA 4OIWA 4OC5A 2PM9A 4E32A 1VQOZ 2O4HA 4MCSA 3GCFA 5C4XI 3SJEA 2RIQA 4R76A 3B3SA 2J6AA 2R6MA 2ANPA 1VQ61 4YWYA 2RHBA 1I3QI 4MCQA 3IFUA 1VQKZ 2VL1A 3MZKB 2NVTI 3I4MI 3S1RI 4HH4A 1VQN1 2C1CA 3CC21 3J80b 3TDHB 5CM2M 1KD11 2NVYI 4NJQA 1XBUA 3CCEZ 2ZELA 4ZY1A 2ZEFA 1N8R2 3PBEA 3SJFA 1R3NA 3HOXI 4ZI6A 1ARMA 1K731 2J9AA 5FLXb 1VQ7Z 3M3YI 3SI2A 4CPAA 4JYWA 2QJ8A 1TWCI 2IMOA 3HLPA 3CCLZ 4BY7I 1YJWZ 4NFRA 2GU2A 4A3CI 4NGPA 4A39A 3Q87A 3FVLA 4JZ0A 3D7DA 3HOWI 2JMOA 3CCV1 1VQMZ 1BAVA 4X2TA 4OC3A 4P44A 1N2FA 1RLYA 5D8NA 3EEDA 3PB6X 3ESWA 2OOYB 2E9HA 3S1MI 3VATA 4OP4A 3N5FA 1Q822 2AFMA 3HOUI 4PXDA 1YJ91 3D4UA 2V8IA 1Q7Y2 3S9MA 1QVGZ 2CIJA 3PBBA 4NBDA 4XX2A 4DQYB 2GTHA 3H8FA 4FUUA 1Z02A 2KPIA 3KIFA 3B3TA 4LQGA 3K2KA 4B6ZA 4MRIA 1F2OA 2R7ZI 3GTMS 3T8WA 2IZ3A 3GTMI 4YU9A 2O53A 3VARA 3D7FA 3FF3A 3J7A4 2XEJA 3WC7A 4NBFA 3QWUA 1QVGY 4NGSA 2PJ6A 2JR6A 3CPXA 3PFEA 2EGTA 2QYVA 1M901 3D68A 4F8ZA 1Q861 3S9NA 4IAVA 2QRCB 4EWTA 3CT9A 1VQ41 1YMEA 2RB7A 2V8JA 1TF8A 3LWUA 4A3BI 1FNOA 4MCPA 3D67A 1XMBA 1JJ2Z 4E31A 4MHNA 1NJI2 1VQ4Z 1ZLHA 4ZYQA 3IO1A 1HEEA 2NVQI 4NGNA 1XJOA 4PPZA 2V8HA 2WZNA 1JJ2Y 2FVGA 4FBEA 5JM6A 4MH4A 4MONA 4NBAA 4DUKA 5LL6f 2ZENA 3JRUA 2Q4ZA 2AFWA 3GTQI 2PVVA 4A3FI 1KC82 4NGTA 1R9TI 2PJBA 1ZB9A 3FEDA 3K7AI 1K9M2 1VQ8Z 2KI7B 4UEZA 2QA4Z 1VQP1 2BO9A 2EK8A 2QLVB 2I3CA 4BD9A 2F4OA 1RTQA 5HVHA 1KRLA 2OOXB 4MHZA 4Y7NI 2HC9A 3PO3S 3S2DI 3NDIA 4DGLA 2GLJA 4X6AI 2ZEHA 3CMA1 4IK2A 5LYLA 1VHOA 2QEX1 2PE3A 2PJ9A 5K8NA 3I561
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC0 A;  1TXR A;  1QMU A;  3SI1 A;  2PIZ A;  3KQX A;  3MRU A;  4DYO A;  5LRK A;  5HVF A;  4UEE A;  4MHP A;  3SI0 A;  3KQZ A;  5F09 A;  3SJX A;  3IWW A;  2JEW A;  1KWM A;  4F9V A;  3TX8 A;  3BI0 A;  3WC6 A;  3S9L A;  1Y0Y A;  3WT4 A;  1Y0R A;  4ZX8 A;  3FMC A;  3WAB A;  3B7I A;  4IHM A;  1CG2 A;  2GRE A;  1TF9 A;  1LFW A;  3PB7 X;  4P4D A;  1IY7 A;  1CP6 A;  2PJC A;  2QVP A;  3FJU A;  5CPA A;  4RUH A;  4K3N A;  2C6C A;  5ELY A;  3RBU A;  3B2Y A;  2C6P A;  3D7G A;  4A38 A;  4MCR A;  4UEF A;  1F57 A;  1LOK A;  3ISZ A;  2ZEM A;  2AFO A;  2PJ4 A;  4MXU A;  3KHX A;  2F7V A;  4MMO A;  3B35 A;  1CPX A;  1YW6 A;  7CPA A;  3MN8 A;  1R43 A;  5K8O A;  1M4L A;  8CPA A;  3B3V A;  1HDU A;  2PCU A;  2Q51 A;  3NH8 A;  3BXM A;  2XEG A;  4P45 A;  1YW4 A;  3QNV A;  4FWU A;  2PVW A;  4OKO A;  5LRJ A;  3IFE A;  1TKH A;  3H8E A;  4NGR A;  4OME A;  3KR5 A;  2OOT A;  3IIB A;  2JBJ A;  3WC5 A;  1CP7 A;  2PJA A;  2XEI A;  2IQ6 A;  1NSA A;  1Z8L A;  4UIA A;  4WJB A;  1XFO A;  2GLF A;  3GUX A;  1ZG7 A;  2NYQ A;  3FH4 A;  5LYI A;  3RAM A;  1Z5R A;  2POK A;  3ISX A;  2ZED A;  4A94 A;  4F9U A;  3D66 A;  1BPN A;  3I1U A;  1ELL P;  2BCO A;  4H2K A;  4OC2 A;  1VGY A;  4P4J A;  4O23 A;  2NSM A;  1UWY A;  1IGB A;  1QQ9 A;  2CTC A;  4PXB A;  2PJ0 A;  3KAS A;  3KI9 A;  4Q7A A;  2OR4 A;  5D29 A;  1YSJ A;  2HB6 A;  2V8G A;  2CTB A;  2ZOF A;  2V8V A;  1YLO A;  2ZEG A;  5CBM A;  3HUV A;  2JBK A;  1BLL E;  1ZG8 A;  3VH9 A;  3FEC A;  3GLJ A;  4ZY2 A;  4EFD A;  4DJL A;  1LAM A;  3NH4 A;  4NJR A;  2ZEE A;  1VHE A;  2PJ3 A;  2PJ1 A;  2ZEO A;  4ZX9 A;  4ONW A;  2CF4 A;  4UF4 A;  1AYE A;  4UIB A;  2AFZ A;  5K8P A;  3CPA A;  6CPA A;  3B3C A;  4KSI A;  3DLJ A;  4R8F A;  3PB4 X;  2PJ7 A;  4NGQ A;  1TKJ A;  3KGQ A;  1HDQ A;  4W9Y A;  2ZEP A;  4P4I A;  4P6Y A;  2EWB A;  1ZLI A;  1LAP A;  2EK9 A;  1JQG A;  2PJ5 A;  5HXD A;  5HVG A;  1ELM P;  4NGM A;  2C6G A;  4P10 A;  4P4F A;  1CPS A;  3CDX A;  3FEE A;  3PB9 X;  1DTD A;  4PQA A;  3NFZ A;  1AMP A;  5I4M A;  2PRQ A;  4TNU A;  5JGF A;  1PYT B;  1CBX A;  2AFU A;  3K9T A;  1VIX A;  3SJG A;  4WWV A;  4FAI A;  1H8L A;  3LMS A;  1TKF A;  3PRT A;  4PXC A;  4GM5 A;  5LYD A;  4OID A;  3GB0 A;  1Z2L A;  2AFS A;  2G9D A;  4G1P A;  4PXE A;  1CX8 A;  2PJ8 A;  2ZOG A;  1OBR A;  2ABZ A;  3B3W A;  4AXV A;  5K8M A;  4A37 A;  5LRG A;  1XRY A;  1Y7E A;  2BOA A;  3NH5 A;  3KL9 A;  2Q43 A;  3KR4 A;  2PIY A;  3V38 A;  5J1Q A;  4ZY0 A;  2XEF A;  4R6T A;  4P4E A;  3IEH A;  1BPM A;  4OC4 A;  4TWE A;  1LAN A;  3RZA A;  3BHX A;  2WYR A;  3PB8 X;  5LYF A;  4Z65 A;  1ZG9 A;  2PJ2 A;  4P4B A;  5JH9 A;  3H8G A;  3PFO A;  3PEI A;  3IC1 A;  4R7M A;  3V7Z A;  4X8I A;  4EME A;  2RFH A;  5IB9 A;  5DS0 A;  1FT7 A;  2V77 A;  3NA6 A;  3BI1 A;  1LCP A;  1PCA A;  2F8H A;  3KHZ A;  4OC1 A;  2AFX A;  3FX6 A;  3KZW A;  3TC8 A;  2IJZ A;  1ARL A;  5THW A;  1DE4 C;  3DGV A;  1EE3 P;  3L2N A;  1GYT A;  2V8D A;  1Q7L A;  4X3R A;  4MHY A;  1F2P A;  3D7H A;  3IJ3 A;  2DEA A;  4OIW A;  4OC5 A;  2O4H A;  4MCS A;  3SJE A;  4R76 A;  3B3S A;  2ANP A;  4YWY A;  4MCQ A;  2VL1 A;  2C1C A;  4NJQ A;  1XBU A;  2ZEL A;  4ZY1 A;  2ZEF A;  3PBE A;  3SJF A;  1R3N A;  4ZI6 A;  1ARM A;  2J9A A;  3SI2 A;  4CPA A;  4JYW A;  2QJ8 A;  2IMO A;  3HLP A;  4NFR A;  2GU2 A;  4NGP A;  4A39 A;  3FVL A;  4JZ0 A;  3D7D A;  1BAV A;  4X2T A;  4OC3 A;  4P44 A;  5D8N A;  3PB6 X;  3VAT A;  4OP4 A;  3N5F A;  2AFM A;  4PXD A;  3D4U A;  3S9M A;  2CIJ A;  3PBB A;  3H8F A;  4FUU A;  3B3T A;  4LQG A;  3K2K A;  4B6Z A;  4MRI A;  1F2O A;  3T8W A;  4YU9 A;  2O53 A;  3VAR A;  3D7F A;  3FF3 A;  2XEJ A;  3WC7 A;  4NGS A;  2PJ6 A;  3CPX A;  3PFE A;  2QYV A;  3D68 A;  4F8Z A;  3S9N A;  4IAV A;  4EWT A;  3CT9 A;  1YME A;  2RB7 A;  3LWU A;  1TF8 A;  1FNO A;  4MCP A;  3D67 A;  1XMB A;  4MHN A;  1ZLH A;  4ZYQ A;  3IO1 A;  1HEE A;  4NGN A;  1XJO A;  4PPZ A;  2V8H A;  2WZN A;  2FVG A;  4FBE A;  5JM6 A;  4DUK A;  2ZEN A;  3JRU A;  2Q4Z A;  2AFW A;  2PVV A;  4NGT A;  2PJB A;  3FED A;  4UEZ A;  2BO9 A;  2EK8 A;  2I3C A;  4BD9 A;  1RTQ A;  5HVH A;  4MHZ A;  2HC9 A;  4IK2 A;  2GLJ A;  2ZEH A;  5LYL A;  1VHO A;  2PE3 A;  2PJ9 A;  5K8N A; 
#chains in the Genus database with same CATH topology
 3SI1 A;  5FVJ A;  3CCR 1;  4B10 A;  3MRU A;  4DYO A;  3GYA A;  4C7I A;  4OAE A;  3KQZ A;  1KUY A;  4H89 A;  1L1O C;  3TX8 A;  2VPW A;  1VQK 1;  2GFQ A;  4AG9 A;  3IWE A;  4ZX8 A;  4DK1 A;  3CCU Z;  1YIT Z;  2ZAE B;  3CCE 1;  3B7I A;  1YVO A;  3UY5 A;  1LFW A;  4B14 A;  4P4D A;  3CCQ 1;  1VQ7 1;  2JIM A;  1X10 A;  2ZW5 A;  5G21 A;  4MFL A;  2WSA A;  4K3N A;  3RBU A;  1Y9W A;  3B2Y A;  3D7G A;  3MGD A;  3CC4 Z;  4MCR A;  2YAD A;  4R3L A;  1M90 2;  2V8K A;  4E0A A;  3HOY I;  1LOK A;  2RPR A;  2AFO A;  1K4J A;  1X12 A;  3P5J B;  3KHX A;  4ONU A;  4E30 A;  4OAD A;  1I50 I;  1M4L A;  1QVF Z;  1VQ5 Z;  4A95 A;  3G71 Z;  3NH8 A;  4B5P B;  3CCJ Z;  4BBS I;  4F6A A;  3R95 A;  1VKC A;  4OKO A;  5FLX f;  3IFE A;  4OME A;  4MD7 A;  2OOT A;  3IIB A;  4KOS A;  3G3S A;  3I55 1;  4R3K A;  2VF1 A;  3HOZ I;  1NSA A;  3S16 I;  4UIA A;  1ZG7 A;  3RAM A;  2POK A;  4NBG A;  2ZED A;  4F9U A;  2AJ6 A;  4H2K A;  2LEX A;  3P2F A;  2CTC A;  1QQ9 A;  2PJ0 A;  3IU1 A;  3ZJ0 A;  4NBE A;  3CCM 1;  1KD1 2;  3FNC A;  3GY9 A;  2ZOF A;  2V8V A;  1YLO A;  2X7B A;  2ZEG A;  1YHQ Z;  1ZB8 A;  4B5O A;  1M1K 2;  1M4D A;  1ZG8 A;  2Z10 A;  3NDJ A;  2ZW4 A;  4LX9 A;  1YVK A;  1W2B Y;  3IF8 A;  4A3J I;  2P6G A;  3MON A;  1NJI 1;  2ZEE A;  3D8P A;  3VMH A;  4E33 A;  5KTD A;  2PJ3 A;  2VUM I;  4UFW A;  2ZEO A;  1RO0 A;  2VUG A;  1I21 A;  4UF4 A;  3T9Y A;  3CC4 1;  3EY5 A;  3B3C A;  3FQQ A;  4Y49 C;  1TKJ A;  2WUU A;  4C2Y A;  4HNY B;  4A3M I;  4P6Y A;  2P28 A;  1S7L A;  1X0T A;  4YFJ A;  1JQG A;  4AB7 A;  4NH1 C;  1VQN Z;  2RBL A;  4UA3 A;  4HGZ A;  4NGM A;  2WAQ A;  1AMP A;  3CCJ 1;  4PSW A;  1CBX A;  2AFU A;  4I49 A;  2CNT A;  3S2H I;  1VIX A;  1QF8 A;  4WWV A;  1ZO0 A;  4FAI A;  2JEV A;  3PRT A;  4OID A;  2BUE A;  2PC1 A;  4EWC A;  2GTI A;  1S7K A;  4NBB A;  1IB1 E;  1M4G A;  4A37 A;  2J8M A;  3RNZ A;  2JDC A;  2BOA A;  3KL9 A;  3SXN A;  2PIY A;  3GTK I;  3V38 A;  1ZH1 A;  1NUI A;  2Q7B A;  3JTK A;  4P4E A;  3IEH A;  3CCS Z;  3RZA A;  3BHX A;  5LYF A;  1S7M A;  1Q82 1;  4P4B A;  1Q7Y 1;  2ZW7 A;  3BJ8 A;  1KQS Z;  4R7M A;  4CAW A;  2JIP A;  3S1Q I;  2V77 A;  3BI1 A;  3KHZ A;  4OC1 A;  1WK4 A;  2W03 A;  2REF A;  1Z4E A;  1SQH A;  1VQP Z;  4MFZ A;  4RVD A;  3TO6 A;  2G0B A;  4CRZ B;  2PMZ A;  2M6N A;  2QEX Z;  4X3R A;  4MHY A;  4L8A A;  1F2P A;  4E32 A;  4CGM A;  2RIQ A;  4NF1 A;  2R6M A;  1QSO A;  2IV2 X;  2RHB A;  2VL1 A;  3I4M I;  1VQN 1;  4NJQ A;  3RYO A;  2B3V A;  4PK2 A;  1IID A;  3SJF A;  1K73 1;  3M3Y I;  3DNS A;  3GIU A;  3CCL Z;  4NGP A;  5DWM A;  3FVL A;  1VQM Z;  1BAV A;  1RLY A;  3TO7 A;  5D8N A;  4XPD C;  4KSF A;  3HOU I;  2JIR A;  1QVG Z;  3PBB A;  3H8F A;  4XX2 A;  3S6H A;  3N7Z A;  3GTM S;  2DPS A;  3GTM I;  3FF3 A;  2CXA A;  2FS5 A;  2JR6 A;  1QSR A;  1V0C A;  4F8Z A;  1Q86 1;  4FD7 A;  1YME A;  4A3B I;  1FNO A;  2PSW A;  1JJ2 Z;  1XOV A;  4E31 A;  2Y0M A;  5GCN A;  1ZLH A;  1BOB A;  4CS0 B;  1XJO A;  2V8H A;  1AA6 A;  4H6Z A;  5JM6 A;  4MON A;  2Q4Z A;  2AFW A;  2Q0Y A;  4A3F I;  1NE9 A;  3LD2 A;  2QIR A;  2QA4 Z;  2A4N A;  1VQP 1;  2QLV B;  2I3C A;  5J8C A;  2F5I A;  2R1I A;  3S2D I;  4IK2 A;  4X6A I;  1YK3 A;  2QEX 1;  2PE3 A;  5KTA A;  2PJ9 A;  2JA8 I;  2V3V A;  3G4S Z;  4MBU A;  5A2Q b;  3CMA Z;  4Q38 A;  5LRK A;  2Z3O A;  1WW9 A;  3TOA A;  3P2H A;  3GTL I;  4MHP A;  5D1P A;  4MHD A;  3CCR Z;  4B12 A;  3SJX A;  2K3R A;  4F9V A;  3BI0 A;  2PDO A;  2NMT A;  3G6E 1;  1Y0Y A;  1Y0R A;  2PRB A;  4XPD B;  2I00 A;  1CG2 A;  3GKR A;  4J3G A;  1USP B;  2PJC A;  3FJU A;  5C44 I;  2EUI A;  5CPA A;  5AG6 A;  3CCL 1;  3CCQ Z;  2C6C A;  2HUZ A;  4ORF A;  2HF1 A;  4CYQ A;  1VQM 1;  4KS9 A;  3OW2 Y;  5C88 A;  3ISZ A;  2ZEM A;  4MXU A;  3U50 C;  1Q16 A;  2EBJ A;  4MMO A;  1CPX A;  4A3L I;  1ON0 A;  2JS4 A;  2I79 A;  1L0C A;  4GS4 A;  1TWH I;  3B3V A;  3D3S A;  2ODF A;  4E2Z A;  4NOZ A;  2XEG A;  4P45 A;  1K83 I;  3FXT A;  3QNV A;  4CYN A;  2PVW A;  5LRJ A;  1TKH A;  2JIO A;  4JXQ A;  3H8E A;  4NGR A;  2OZH A;  3TE4 A;  5EC4 A;  3WC5 A;  1NP6 A;  4HGY A;  2OTJ 1;  3I55 Z;  2GLF A;  3GUX A;  4E2X A;  4MFJ A;  2QA4 1;  2GIV A;  3G8W A;  4CAF A;  2Z3M A;  5AN9 F;  2ATR A;  2KCW A;  2OH1 A;  1XF8 A;  3G4S 1;  3PO3 I;  5H86 A;  1YIJ 1;  5HH1 A;  2CTB A;  2FCK A;  3CCM Z;  5CNP A;  3I07 A;  1W2B Z;  4KOR A;  4Y52 I;  4UCN A;  3NE7 A;  4HPS A;  3VH9 A;  4CAX A;  5JQ4 A;  2QRE B;  1LQL A;  2VPZ A;  1USP A;  4LQ6 A;  1VHE A;  2WPX A;  3CC7 Z;  3JVN A;  4QVT A;  1YR0 A;  3RO0 A;  3GTG I;  2YGW A;  4A3G I;  2VPX A;  3LOD A;  5JPH A;  2JUB A;  5K8P A;  1YRE A;  6CPA A;  3CZX A;  4KSI A;  2O28 A;  3JAM f;  3DLJ A;  4R8F A;  5H84 A;  2PJ7 A;  4NGQ A;  1JWH C;  3EER A;  3KGQ A;  1WJ2 A;  4W9Y A;  1VQ6 Z;  5FLM I;  1P9N A;  4P4I A;  1N71 A;  2EWB A;  3FQM A;  3CME 1;  2FXF A;  4KOV A;  1TWA I;  4E2A A;  1IYL A;  3DDD A;  3PP9 A;  3CC2 Z;  1VQ9 1;  2C6G A;  3FKI I;  3F3P C;  5I4M A;  2PRQ A;  4A3E I;  3D6W A;  4CGP A;  5IT9 f;  1H8L A;  4PXC A;  1TWF I;  5LYD A;  2Y0S A;  4AVA A;  3GB0 A;  1XE4 A;  4IF5 A;  2G9D A;  2AKL A;  4G1P A;  1Y9K A;  3S1N I;  4JXR A;  4C2Z A;  4PXE A;  2ZOG A;  4KZT A;  1N8R 1;  1OBR A;  2ABZ A;  4CGL A;  4UCM A;  3RZD I;  5LRG A;  4A33 A;  4QB9 A;  4BXX I;  4NEX A;  4KLV A;  2Q43 A;  5J1Q A;  4ZY0 A;  2XEF A;  1BPM A;  1FDI A;  4MY3 A;  2WYR A;  1ZG9 A;  4NB9 A;  3HOV I;  2PJ2 A;  1XMT A;  4QTU A;  2Q4V A;  1MJA A;  3H8G A;  3PFO A;  5G22 A;  2P3Y A;  3PEI A;  1M1D A;  1Q2D A;  3S17 I;  4FD6 A;  2RT9 A;  3NA6 A;  1MJB A;  4FD5 A;  2B4D A;  1LCP A;  2F8H A;  2AFX A;  3FX6 A;  2JDD A;  5C4J I;  2IJZ A;  1S5K A;  5THW A;  2OZK A;  3CC7 1;  1EE3 P;  3H4Q A;  3IX0 A;  3PO2 I;  4RVH A;  1GYT A;  2V8D A;  3IWG A;  1VQO 1;  3R9E A;  2E2I I;  3SXO A;  3TTH A;  2BJO A;  2NVX I;  2DEA A;  4OIW A;  2PM9 A;  4QUS A;  2O4H A;  4MCS A;  1I12 A;  4CYO A;  2Q04 A;  1Y8C A;  2PQ8 A;  5EBV A;  1VQ6 1;  4X5K A;  2C1C A;  3CC2 1;  2Q4Y A;  1IOI A;  1KD1 1;  4NSQ A;  1XBU A;  1YGH A;  2EVN A;  3PBE A;  1IOF A;  1R3N A;  1Z8T A;  1ARM A;  2J9A A;  5FLX b;  2QJ8 A;  2IMO A;  2EO8 A;  4NXY A;  1LRZ A;  3Q87 A;  4M6I A;  4R57 A;  4OC3 A;  4P44 A;  1I1D A;  3EED A;  3PGP A;  2E9H A;  3N5F A;  1NSL A;  1Q82 2;  4PXD A;  2PR8 A;  2V8I A;  1Q7Y 2;  3S9M A;  2GTH A;  4FUU A;  3B3T A;  3K2K A;  4YU9 A;  3D7F A;  3QWU A;  4R9M A;  3CPX A;  5A27 A;  2QYV A;  4EWT A;  2VXK A;  2REE A;  3LWU A;  3I3G A;  3D67 A;  1XMB A;  3W6S A;  4MHN A;  2RC4 A;  4ZYQ A;  2NVQ I;  4PPZ A;  2ARH A;  4MH4 A;  4DUK A;  5LL6 f;  1KC8 2;  4NGT A;  3W91 A;  4UWI A;  3FED A;  3K7A I;  1K9M 2;  1VQ8 Z;  4UEZ A;  4Y49 B;  4QBJ A;  4BD9 A;  2HC9 A;  3NDI A;  2ZEH A;  5LYL A;  4OC0 A;  1UFH A;  3NE8 A;  1VHS A;  2PIZ A;  1KUV A;  3KQX A;  3H0G I;  1K73 2;  5ISV A;  5HVF A;  3TE5 B;  3SI0 A;  5F09 A;  1KWM A;  5IB0 A;  2Q7S A;  3S9L A;  3VMG A;  5T64 A;  4A3I I;  3FMC A;  3TFY A;  2LFU A;  5D1O A;  3G6E Z;  1TWG I;  1SIW A;  4C2X A;  3R9F A;  3CPW Y;  1S7N A;  3T90 A;  3J81 f;  3CD6 Z;  1IY7 A;  1CP6 A;  2CNM A;  3KIH A;  3QAH A;  2OTL 1;  2JA6 I;  4PV6 A;  4RUH A;  3OW2 Z;  2AYD A;  2C6P A;  4A38 A;  2FIA A;  2OZU A;  5DWN A;  3TCV A;  2R93 I;  4KLW A;  5AG5 A;  1F57 A;  2R92 I;  2PJ4 A;  4II9 A;  2E2J I;  1Q81 1;  4MD9 A;  2J8N A;  3B35 A;  7CPA A;  3LUS A;  2YNC C;  4DNC A;  1QYP A;  5K8O A;  3D2L A;  3J80 f;  1Y1V S;  4UFV A;  2PCU A;  4KVM E;  2VEZ A;  3M4O I;  2JNY A;  1YW4 A;  1Z01 A;  3CXS A;  4A3D I;  3VWD A;  5T67 A;  4MI4 A;  5C82 A;  2XEI A;  4RI1 A;  2IQ6 A;  3GKQ A;  2H5M A;  2K5R A;  4M85 A;  2ZW6 A;  3FH4 A;  2OTJ Z;  2NAP A;  5LYI A;  1QXF A;  2YU9 I;  1Z5R A;  4UBR A;  1VQ8 1;  2B63 I;  3ISX A;  4A94 A;  2B4B A;  1BPN A;  1ELL P;  2IZ4 A;  2BCO A;  4YGO A;  1OZP A;  4O23 A;  1UWY A;  4PXB A;  2HU9 A;  5F48 A;  5J8F A;  1XEB A;  3KAS A;  4M6H A;  2V8G A;  2W04 A;  3V8I A;  2M48 A;  1IIC A;  5F46 A;  1RXT A;  2GE3 A;  1YIJ Z;  1WWZ A;  1BLL E;  4KVX A;  3FEC A;  1GHE A;  2QEC A;  4ZY2 A;  4EFD A;  1TIQ A;  4NB8 A;  3NH4 A;  4UFX A;  4MFK A;  1K8A 1;  4CL1 A;  3TO9 A;  4LUA A;  3CD6 1;  1YUA A;  3S15 I;  3QAY A;  2HV2 A;  4ONW A;  2CF4 A;  1AYE A;  1AUG A;  2AFZ A;  2DE7 A;  3PB4 X;  3K9U A;  4RV9 A;  2JA7 I;  5HXD A;  5HMN A;  4CAV A;  3CME Z;  5HVG A;  1ELM P;  3CXC Y;  1B87 A;  4P10 A;  2BSW A;  3CDX A;  3FEE A;  3PB9 X;  5IP9 I;  1DTD A;  3NFZ A;  4PQA A;  1VQ9 Z;  2R8V A;  4A30 A;  3K9T A;  3SJG A;  3GTJ I;  1TKF A;  4A32 A;  2OU2 A;  2YND A;  2AFS A;  1WII A;  1YJN 1;  4ZGY B;  4NBH A;  3KKW A;  2E2H I;  3B3W A;  4AXV A;  5K8M A;  1XRY A;  1Y7E A;  3NH5 A;  3KR4 A;  1SFO I;  3GTP I;  4R6T A;  3H3V J;  1Z03 A;  1X3W A;  3IR7 A;  4OC4 A;  1LAN A;  4KVO E;  4KUB A;  3WR7 A;  3BG0 B;  2G3T A;  3PB8 X;  4JJX A;  1QSN A;  3FIX A;  4MY0 A;  4BMH A;  4F0X A;  2OB0 A;  4CGN A;  4C7H A;  4MFP A;  3V7Z A;  4X8I A;  4EME A;  2RFH A;  5IB9 A;  5AGE A;  2FE7 A;  3BG1 B;  4RS2 A;  1FY7 A;  4C68 A;  1ARL A;  2P6F A;  4QTT A;  1DE4 C;  1VQL 1;  3MZL B;  2YNC A;  3L2N A;  2B4D B;  3I4N I;  3DR6 A;  2GAN A;  3IJ3 A;  3D9X A;  4OC5 A;  1VQO Z;  3GCF A;  5C4X I;  3SJE A;  3TT2 A;  3B3S A;  2FT0 A;  4YWY A;  1CM0 A;  1M44 A;  2Z11 A;  2Q44 A;  3MZK B;  5G20 A;  2NVT I;  3S1R I;  4HH4 A;  4BIN A;  5CM2 M;  2VQY A;  2NVY I;  2VZY A;  4ZY1 A;  2ZEF A;  1N8R 2;  3HOX I;  1JWQ A;  2BEI A;  4ZI6 A;  5AG4 A;  4JYW A;  4MFQ A;  2J8R A;  2B5G B;  1YJW Z;  4A3C I;  2GU2 A;  3EFA A;  4A39 A;  4JZ0 A;  3D7D A;  3HOW I;  3EO4 A;  2JMO A;  2CNS A;  4IUS A;  3R1K A;  2OOY B;  3VAT A;  3C26 A;  2AFM A;  3PZJ A;  3D4U A;  2CIJ A;  4PSX A;  2KPI A;  1YX0 A;  1F2O A;  2R7Z I;  2BL1 A;  2IZ3 A;  4YRH A;  2O53 A;  3VAR A;  3J7A 4;  1J4J A;  3BJ7 A;  4BBH A;  2PJ6 A;  4PK3 A;  2EGT A;  3F8K A;  1M90 1;  2K5T A;  3S9N A;  4IAV A;  1VQ4 1;  2RB7 A;  2V8J A;  1TF8 A;  2Z0Z A;  4JLY A;  2D4O A;  2AE6 A;  1XIX A;  1NJI 2;  3IO1 A;  2R98 A;  2WZN A;  3F5B A;  4B13 A;  2ZEN A;  3JRU A;  3GTQ I;  2PJB A;  3R96 A;  4E8O A;  2KI7 B;  3FB3 A;  4R87 A;  3IGR A;  2EK8 A;  5HVH A;  1KRL A;  4UWJ A;  2OOX B;  3IU2 A;  4DGL A;  3FBU A;  4X2T A;  4U9Y A;  2ZPA A;  1TXR A;  4M6G A;  1QMU A;  3JAM b;  4AVC A;  2Z3P A;  1KUX A;  4UEE A;  1YI2 Z;  4A31 A;  3IWW A;  4AYB A;  2JEW A;  3CCU 1;  1YIT 1;  4JD6 A;  4U9Z A;  4KOT A;  3WC6 A;  3CPW Z;  4CGO A;  5I0C A;  2DE6 A;  3WT4 A;  2DE5 A;  3WAB A;  4IHM A;  2GRE A;  1TF9 A;  3PB7 X;  5IT9 b;  3F0A A;  1WZN A;  2B5G A;  5IX3 A;  2QVP A;  3CQZ I;  2D4P A;  5D1O B;  5ELY A;  1YJW 1;  1M1K 1;  2C27 A;  1S72 Z;  2OTL Z;  2JA5 I;  1I6H I;  4UEF A;  1YUK A;  1Y7R A;  1IU8 A;  2F7V A;  2VI7 A;  3VWE A;  1YW6 A;  2Z3K A;  4EVY A;  4B5P A;  1VQ5 1;  3G71 1;  3MN8 A;  1R43 A;  8CPA A;  1HDU A;  2Q51 A;  3BXM A;  2FSR A;  4F0Y A;  1YQE A;  4M3S A;  1A2Z A;  1QVF Y;  4FWU A;  3GTO I;  1QSM A;  3DR8 A;  4RVF A;  4AVB A;  2VBQ A;  3BLN A;  3KR5 A;  2JBJ A;  2FIW A;  1CP7 A;  2PJA A;  3D2P A;  1Z8L A;  4WJB A;  1XFO A;  3RZO I;  1RO5 A;  2NYQ A;  4RS4 A;  1BO4 A;  4KOY A;  1RO2 A;  2E7Z A;  3D66 A;  3I1U A;  4OC2 A;  1TFI A;  1VGY A;  4P4J A;  2QR1 B;  3S6G A;  2NSM A;  1IGB A;  1KZF A;  2G3A A;  4L89 A;  1ML8 A;  2VPY A;  3KI9 A;  4Q7A A;  2OR4 A;  5D29 A;  1YSJ A;  1YHQ 1;  3VMI A;  2HB6 A;  2F4M A;  5IV0 A;  4A3K I;  2Z3N A;  4RN7 A;  1YI2 1;  5CBM A;  1VLA A;  1PFT A;  4HNW B;  5G1Z A;  3HUV A;  5A28 A;  2JBK A;  5EMI A;  4NCZ A;  2P0W A;  3GLJ A;  1Q2Y A;  4DJL A;  2HQY A;  1LAM A;  1RO4 A;  4XPK A;  2QKD A;  4CAE A;  4NJR A;  2WB1 A;  2R7H A;  1S7F A;  4K30 A;  3QB8 A;  1QST A;  4HNX B;  1Q81 2;  2WPW A;  4BY1 I;  2PJ1 A;  4FD4 A;  2DPT A;  4MJ8 A;  4B11 A;  4ZX9 A;  4QC6 A;  5E96 A;  1S72 1;  4UIB A;  4OLL A;  1KC8 1;  3CPA A;  3SHP A;  1K9M 1;  2OZG A;  2Z3L A;  3CXP A;  4NBC A;  5A2Q f;  3W6X A;  3E0K A;  1DL6 A;  2PK7 A;  1HDQ A;  2ZEP A;  1Q86 2;  3CXC Z;  1Z9U A;  1ZLI A;  1Z8X A;  1LAP A;  2EK9 A;  2PJ5 A;  4BBR I;  2G2K A;  3VTN A;  1M4I A;  4P4F A;  1CPS A;  1X3Z A;  4RVG A;  1PUA A;  1YLE A;  4TNU A;  3VB9 A;  1PYT B;  5JGF A;  1Y1W I;  2ZXV A;  1RQF A;  1Y1V I;  2DXQ A;  4S1T A;  1U6M A;  3LMS A;  5KTC A;  4GM5 A;  3CXQ A;  1RNI A;  1Z2L A;  1WCM I;  2FL4 A;  3A9L A;  3CCV Z;  3R9G A;  1MJ9 A;  1CJW A;  1YJN Z;  1CX8 A;  2PJ8 A;  5AG7 A;  2VZZ A;  3JUW A;  5T6B A;  1YJ9 Z;  1Z8W A;  2LIY A;  2V45 A;  3CCS 1;  3B8G A;  5C3E I;  2H85 A;  1K8A 2;  2IL4 A;  4TWE A;  2B3U A;  4MD8 A;  4Z65 A;  3S14 I;  2PR1 A;  4E2Y A;  5JH9 A;  1PU9 A;  4XNH C;  3IC1 A;  3S6K A;  5DS0 A;  4AG7 A;  1FT7 A;  1KQS Y;  1P4N A;  1PCA A;  2JIQ A;  3ZZI A;  2B58 A;  4KOX A;  3J81 b;  3KZW A;  3HKZ A;  3TC8 A;  4U5Y A;  5IP7 I;  2QRD B;  3DGV A;  3F3F C;  4HKF A;  1S60 A;  4A93 I;  3T4N B;  4E2W A;  1VQL Z;  1Q7L A;  1P0H A;  2P6E A;  3I56 Z;  3D7H A;  4KUA A;  4KSA A;  2CY2 A;  5F47 A;  4R76 A;  2J6A A;  3FRM A;  2ANP A;  2YNE A;  1I3Q I;  4MCQ A;  4XPL A;  3IFU A;  1VQK Z;  3J80 b;  3TDH B;  1B6B A;  3CCE Z;  2ZEL A;  2JLM A;  4H6U A;  1VQ7 Z;  5F49 A;  3SI2 A;  4CPA A;  1TWC I;  3HLP A;  4BY7 I;  4NFR A;  2QML A;  3I9S A;  4CYP A;  3CCV 1;  4Q36 A;  1N2F A;  1IYK A;  4JWP A;  3PB6 X;  3ESW A;  3S1M I;  3EC4 A;  4OP4 A;  1R57 A;  3S6F A;  1YJ9 1;  3OWC A;  4KOU A;  4XNH B;  4NBD A;  4DQY B;  1Z02 A;  3KIF A;  4LQG A;  5BWA B;  4B6Z A;  4MRI A;  3T8W A;  2XEJ A;  4A2Z A;  3WC7 A;  4NBF A;  1QVG Y;  1MK4 A;  4NGS A;  3PFE A;  1NMT A;  3D68 A;  4KOW A;  2QRC B;  3CT9 A;  1Q2C A;  4GXH A;  4MCP A;  3EXN A;  4ZBG A;  1VQ4 Z;  4UCP A;  3LAC A;  3H5Z A;  1HEE A;  3FYN A;  4NGN A;  1JJ2 Y;  2FVG A;  4CRY B;  4FBE A;  4NBA A;  1FDO A;  2PVV A;  1R9T I;  2DF5 A;  1ZB9 A;  1S3Z A;  3D2M A;  2BO9 A;  2F4O A;  1RTQ A;  1Z4R A;  3DSB A;  4MHZ A;  4Y7N I;  3PO3 S;  2GLJ A;  3CMA 1;  1VHO A;  3TOB A;  5K8N A;  3I56 1; 
#chains in the Genus database with same CATH homology
 4OC0 A;  2JA8 I;  1TXR A;  1QMU A;  3G4S Z;  3SI1 A;  5A2Q b;  3CMA Z;  2PIZ A;  3JAM b;  3CCR 1;  3KQX A;  3MRU A;  4DYO A;  5LRK A;  1WW9 A;  3H0G I;  1K73 2;  5HVF A;  4UEE A;  3TE5 B;  3GTL I;  4MHP A;  3SI0 A;  5D1P A;  1YI2 Z;  3CCR Z;  3KQZ A;  5F09 A;  3SJX A;  2K3R A;  3IWW A;  4AYB A;  1L1O C;  2JEW A;  3CCU 1;  1KWM A;  1YIT 1;  3TX8 A;  4F9V A;  3BI0 A;  1VQK 1;  3WC6 A;  3S9L A;  3CPW Z;  3G6E 1;  3VMG A;  1Y0Y A;  5T64 A;  2DE6 A;  3WT4 A;  1Y0R A;  4ZX8 A;  4A3I I;  4DK1 A;  3CCU Z;  1YIT Z;  3FMC A;  2DE5 A;  3WAB A;  2LFU A;  2ZAE B;  3CCE 1;  3B7I A;  5D1O A;  3G6E Z;  1TWG I;  4IHM A;  1CG2 A;  3CPW Y;  2GRE A;  1TF9 A;  3J81 f;  1LFW A;  3PB7 X;  4P4D A;  3CCQ 1;  1USP B;  3CD6 Z;  1VQ7 1;  5IT9 b;  1IY7 A;  3KIH A;  1CP6 A;  2PJC A;  2QVP A;  3FJU A;  5C44 I;  2OTL 1;  2JA6 I;  5CPA A;  4RUH A;  3CQZ I;  3OW2 Z;  4K3N A;  5D1O B;  3CCL 1;  3CCQ Z;  1YJW 1;  1M1K 1;  2C6C A;  3B2Y A;  5ELY A;  3RBU A;  1S72 Z;  2C6P A;  3D7G A;  2HF1 A;  2OTL Z;  4A38 A;  3CC4 Z;  2JA5 I;  4MCR A;  1VQM 1;  2YAD A;  2R93 I;  1M90 2;  2V8K A;  1I6H I;  3OW2 Y;  3HOY I;  4UEF A;  1F57 A;  1LOK A;  2R92 I;  3ISZ A;  2RPR A;  2ZEM A;  2AFO A;  2PJ4 A;  4MXU A;  3U50 C;  1YUK A;  3P5J B;  3KHX A;  2E2J I;  2F7V A;  4MMO A;  1Q81 1;  4MD9 A;  3B35 A;  1CPX A;  4A3L I;  1YW6 A;  2JS4 A;  1VQ5 1;  4E30 A;  7CPA A;  3G71 1;  3LUS A;  1I50 I;  3MN8 A;  1QYP A;  1R43 A;  5K8O A;  1M4L A;  1TWH I;  8CPA A;  3B3V A;  1QVF Z;  1VQ5 Z;  3J80 f;  1Y1V S;  1HDU A;  3G71 Z;  2PCU A;  2Q51 A;  3NH8 A;  3BXM A;  4E2Z A;  4NOZ A;  3M4O I;  2XEG A;  4P45 A;  3CCJ Z;  2JNY A;  1YW4 A;  1K83 I;  4BBS I;  1Z01 A;  3QNV A;  1QVF Y;  3GTO I;  4FWU A;  4RVF A;  2PVW A;  5FLX f;  4A3D I;  3IFE A;  5T67 A;  1TKH A;  4OKO A;  5LRJ A;  3H8E A;  4NGR A;  4OME A;  4MD7 A;  3KR5 A;  2OOT A;  3IIB A;  2JBJ A;  3I55 1;  3WC5 A;  1CP7 A;  2VF1 A;  2PJA A;  1NP6 A;  4HGY A;  2XEI A;  3HOZ I;  2OTJ 1;  2IQ6 A;  3GKQ A;  1NSA A;  3S16 I;  1Z8L A;  4UIA A;  3I55 Z;  4WJB A;  1XFO A;  2GLF A;  2K5R A;  3GUX A;  1ZG7 A;  3RZO I;  2NYQ A;  4E2X A;  4RS4 A;  3FH4 A;  2OTJ Z;  5LYI A;  3RAM A;  2YU9 I;  1Z5R A;  1VQ8 1;  1RO2 A;  2B63 I;  2POK A;  2QA4 1;  3ISX A;  4NBG A;  2ZED A;  4A94 A;  4F9U A;  3D66 A;  1BPN A;  3I1U A;  1ELL P;  2IZ4 A;  2BCO A;  4H2K A;  5AN9 F;  1TFI A;  1VGY A;  4OC2 A;  4P4J A;  2QR1 B;  4O23 A;  2NSM A;  1IGB A;  1UWY A;  1QQ9 A;  2CTC A;  2HU9 A;  4PXB A;  1ML8 A;  2PJ0 A;  3KAS A;  3G4S 1;  3KI9 A;  4NBE A;  3PO3 I;  3CCM 1;  4Q7A A;  2OR4 A;  5D29 A;  1YSJ A;  1YHQ 1;  1YIJ 1;  3VMI A;  1KD1 2;  2HB6 A;  2V8G A;  2CTB A;  2W04 A;  2F4M A;  2V8V A;  1YLO A;  4A3K I;  2ZOF A;  2M48 A;  3CCM Z;  1YI2 1;  2ZEG A;  3I07 A;  5CBM A;  1VLA A;  1W2B Z;  1YHQ Z;  1YIJ Z;  4Y52 I;  1PFT A;  3HUV A;  2JBK A;  1ZB8 A;  1BLL E;  1M1K 2;  1ZG8 A;  3VH9 A;  3FEC A;  3GLJ A;  3NDJ A;  4ZY2 A;  4EFD A;  4DJL A;  1LAM A;  1RO4 A;  4NB8 A;  1W2B Y;  2QKD A;  3IF8 A;  3NH4 A;  1K8A 1;  4NJR A;  2QRE B;  1LQL A;  2WB1 A;  4A3J I;  1USP A;  4CL1 A;  3MON A;  1NJI 1;  2ZEE A;  1VHE A;  3VMH A;  4E33 A;  3CC7 Z;  1Q81 2;  3CD6 1;  2PJ3 A;  4BY1 I;  2VUM I;  1YUA A;  2PJ1 A;  3S15 I;  3GTG I;  4A3G I;  2ZEO A;  1RO0 A;  2VUG A;  4ZX9 A;  4ONW A;  1S72 1;  2CF4 A;  4UF4 A;  1AYE A;  4UIB A;  1KC8 1;  2AFZ A;  2JUB A;  3CC4 1;  5K8P A;  3CPA A;  2DE7 A;  1K9M 1;  6CPA A;  3B3C A;  3FQQ A;  4NBC A;  5A2Q f;  4KSI A;  3JAM f;  3DLJ A;  4R8F A;  3PB4 X;  2PJ7 A;  4NGQ A;  1JWH C;  3EER A;  1DL6 A;  1TKJ A;  3KGQ A;  2PK7 A;  1HDQ A;  4W9Y A;  1VQ6 Z;  4RV9 A;  1P9N A;  5FLM I;  2ZEP A;  4P4I A;  1Q86 2;  4A3M I;  4P6Y A;  3CXC Z;  2EWB A;  2P28 A;  3FQM A;  3CME 1;  1TWA I;  1ZLI A;  1X0T A;  2JA7 I;  1LAP A;  2EK9 A;  1JQG A;  4NH1 C;  1VQN Z;  2PJ5 A;  2RBL A;  3CC2 Z;  4BBR I;  5HXD A;  1VQ9 1;  2G2K A;  3VTN A;  3CME Z;  4HGZ A;  1ELM P;  3CXC Y;  5HVG A;  4NGM A;  2C6G A;  4P10 A;  4P4F A;  1CPS A;  2WAQ A;  3FKI I;  3CDX A;  1X3Z A;  4RVG A;  3FEE A;  3F3P C;  3PB9 X;  5IP9 I;  1DTD A;  3NFZ A;  4PQA A;  1AMP A;  5I4M A;  2PRQ A;  4TNU A;  3CCJ 1;  3VB9 A;  1PYT B;  1VQ9 Z;  5JGF A;  1CBX A;  2AFU A;  1Y1W I;  3K9T A;  3S2H I;  1VIX A;  4A3E I;  3D6W A;  1RQF A;  1QF8 A;  1Y1V I;  4WWV A;  3SJG A;  4S1T A;  3GTJ I;  5IT9 f;  4FAI A;  1H8L A;  3LMS A;  1TKF A;  3PRT A;  4PXC A;  1TWF I;  4GM5 A;  5LYD A;  4OID A;  2Y0S A;  1RNI A;  3GB0 A;  1Z2L A;  1WCM I;  4EWC A;  2AFS A;  2GTI A;  1WII A;  1YJN 1;  2G9D A;  2AKL A;  4NBH A;  3CCV Z;  4G1P A;  3S1N I;  4NBB A;  4PXE A;  2E2H I;  1YJN Z;  1CX8 A;  2PJ8 A;  2ZOG A;  1N8R 1;  1OBR A;  5T6B A;  2ABZ A;  1YJ9 Z;  3B3W A;  4AXV A;  5K8M A;  3RZD I;  4A37 A;  5LRG A;  4BXX I;  1XRY A;  2LIY A;  1Y7E A;  2BOA A;  3NH5 A;  3KL9 A;  2Q43 A;  3KR4 A;  3CCS 1;  2PIY A;  3GTK I;  1SFO I;  3V38 A;  1ZH1 A;  5C3E I;  2H85 A;  3GTP I;  1NUI A;  5J1Q A;  4ZY0 A;  2XEF A;  4R6T A;  1K8A 2;  4P4E A;  3IEH A;  3CCS Z;  3H3V J;  1Z03 A;  1X3W A;  1BPM A;  4OC4 A;  4TWE A;  1LAN A;  3RZA A;  3BHX A;  2WYR A;  3BG0 B;  4MD8 A;  3PB8 X;  5LYF A;  1S7M A;  4Z65 A;  3S14 I;  1ZG9 A;  4NB9 A;  1Q82 1;  3HOV I;  2PJ2 A;  4P4B A;  1Q7Y 1;  4QTU A;  4E2Y A;  5JH9 A;  3H8G A;  3PFO A;  1KQS Z;  2P3Y A;  3PEI A;  3IC1 A;  4R7M A;  3V7Z A;  4X8I A;  4EME A;  2RFH A;  3S17 I;  5IB9 A;  5DS0 A;  2RT9 A;  3S1Q I;  1FT7 A;  2V77 A;  3NA6 A;  3BI1 A;  1KQS Y;  3BG1 B;  1LCP A;  1PCA A;  2F8H A;  3KHZ A;  4OC1 A;  2AFX A;  3FX6 A;  5C4J I;  3J81 b;  2W03 A;  3HKZ A;  3KZW A;  3TC8 A;  2IJZ A;  1ARL A;  5IP7 I;  4QTT A;  1DE4 C;  5THW A;  2QRD B;  2OZK A;  1VQL 1;  3CC7 1;  1VQP Z;  3DGV A;  3MZL B;  3F3F C;  1EE3 P;  4RVD A;  3L2N A;  4A93 I;  2PMZ A;  3T4N B;  3IX0 A;  2M6N A;  3PO2 I;  4E2W A;  4RVH A;  1GYT A;  1VQL Z;  1Q7L A;  2V8D A;  2QEX Z;  1VQO 1;  3I4N I;  3I56 Z;  4X3R A;  4MHY A;  2E2I I;  2BJO A;  1F2P A;  2NVX I;  3D7H A;  3IJ3 A;  2DEA A;  3D9X A;  4OIW A;  4OC5 A;  2PM9 A;  4E32 A;  1VQO Z;  2O4H A;  4MCS A;  3GCF A;  5C4X I;  3SJE A;  2RIQ A;  4R76 A;  3B3S A;  2J6A A;  2R6M A;  2ANP A;  1VQ6 1;  4YWY A;  2RHB A;  1I3Q I;  4MCQ A;  3IFU A;  1VQK Z;  2VL1 A;  3MZK B;  2NVT I;  3I4M I;  3S1R I;  4HH4 A;  1VQN 1;  2C1C A;  3CC2 1;  3J80 b;  3TDH B;  5CM2 M;  1KD1 1;  2NVY I;  4NJQ A;  1XBU A;  3CCE Z;  2ZEL A;  4ZY1 A;  2ZEF A;  1N8R 2;  3PBE A;  3SJF A;  1R3N A;  3HOX I;  4ZI6 A;  1ARM A;  1K73 1;  2J9A A;  5FLX b;  1VQ7 Z;  3M3Y I;  3SI2 A;  4CPA A;  4JYW A;  2QJ8 A;  1TWC I;  2IMO A;  3HLP A;  3CCL Z;  4BY7 I;  1YJW Z;  4NFR A;  2GU2 A;  4A3C I;  4NGP A;  4A39 A;  3Q87 A;  3FVL A;  4JZ0 A;  3D7D A;  3HOW I;  2JMO A;  3CCV 1;  1VQM Z;  1BAV A;  4X2T A;  4OC3 A;  4P44 A;  1N2F A;  1RLY A;  5D8N A;  3EED A;  3PB6 X;  3ESW A;  2OOY B;  2E9H A;  3S1M I;  3VAT A;  4OP4 A;  3N5F A;  1Q82 2;  2AFM A;  3HOU I;  4PXD A;  1YJ9 1;  3D4U A;  2V8I A;  1Q7Y 2;  3S9M A;  1QVG Z;  2CIJ A;  3PBB A;  4NBD A;  4XX2 A;  4DQY B;  2GTH A;  3H8F A;  4FUU A;  1Z02 A;  2KPI A;  3KIF A;  3B3T A;  4LQG A;  3K2K A;  4B6Z A;  4MRI A;  1F2O A;  2R7Z I;  3GTM S;  3T8W A;  2IZ3 A;  3GTM I;  4YU9 A;  2O53 A;  3VAR A;  3D7F A;  3FF3 A;  3J7A 4;  2XEJ A;  3WC7 A;  4NBF A;  3QWU A;  1QVG Y;  4NGS A;  2PJ6 A;  2JR6 A;  3CPX A;  3PFE A;  2EGT A;  2QYV A;  1M90 1;  3D68 A;  4F8Z A;  1Q86 1;  3S9N A;  4IAV A;  2QRC B;  4EWT A;  3CT9 A;  1VQ4 1;  1YME A;  2RB7 A;  2V8J A;  1TF8 A;  3LWU A;  4A3B I;  1FNO A;  4MCP A;  3D67 A;  1XMB A;  1JJ2 Z;  4E31 A;  4MHN A;  1NJI 2;  1VQ4 Z;  1ZLH A;  4ZYQ A;  3IO1 A;  1HEE A;  2NVQ I;  4NGN A;  1XJO A;  4PPZ A;  2V8H A;  2WZN A;  1JJ2 Y;  2FVG A;  4FBE A;  5JM6 A;  4MH4 A;  4MON A;  4NBA A;  4DUK A;  5LL6 f;  2ZEN A;  3JRU A;  2Q4Z A;  2AFW A;  3GTQ I;  2PVV A;  4A3F I;  1KC8 2;  4NGT A;  1R9T I;  2PJB A;  1ZB9 A;  3FED A;  3K7A I;  1K9M 2;  1VQ8 Z;  2KI7 B;  4UEZ A;  2QA4 Z;  1VQP 1;  2BO9 A;  2EK8 A;  2QLV B;  2I3C A;  4BD9 A;  2F4O A;  1RTQ A;  5HVH A;  1KRL A;  2OOX B;  4MHZ A;  4Y7N I;  2HC9 A;  3PO3 S;  3S2D I;  3NDI A;  4DGL A;  2GLJ A;  4X6A I;  2ZEH A;  3CMA 1;  4IK2 A;  5LYL A;  1VHO A;  2QEX 1;  2PE3 A;  2PJ9 A;  5K8N A;  3I56 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...