2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
3KHZA 2OR4A 1ARLA 3RZAA 3WABA 2F7VA 3DGVA 4F8ZA 2PJ6A 3RBUA 3B3TA 2BO9A 3KQXA 1LCPA 1CPSA 1Y7EA 4NGTA 1ELMP 3HUVA 4B6ZA 2PVVA 1XMBA 3H8GA 1YLOA 3L2NA 3MRUA 4YU9A 2AFOA 1IGBA 3KR5A 3WC6A 5LRJA 4FWUA 4NJQA 1R3NA 2JEWA 2PJ8A 4MHNA 2AFUA 1M4LA 3B3VA 3BI0A 4OP4A 1NSAA 2BOAA 1LAMA 3IC1A 2V8GA 3WT4A 2EWBA 3KR4A 2BCOA 3PRTA 1QMUA 2VL1A 2C6PA 2ZEGA 4OC1A 1YW6A 2V8HA 3BXMA 1LOKA 3WC7A 1XBUA 2ZEHA 3D67A 2AFWA 3PB9X 4MRIA 2PJ1A 3FECA 4ZYQA 3S9MA 2FVGA 4FAIA 4OC4A 3ISZA 3SI1A 1BAVA 3BHXA 3D66A 1F2OA 3TX8A 3KHXA 3RAMA 5LYDA 4Z65A 4ZY0A 4ZY2A 4UEFA 2WZNA 1YW4A 1TF9A 1LFWA 4MHYA 1ZG8A 2F8HA 2PCUA 1VHEA 1Y0RA 5JH9A 2V8DA 3B3WA 1CP6A 5F09A 3KGQA 1ZLIA 1ZG7A 3CT9A 3PFOA 2G9DA 4OC0A 1BPNA 4P4IA 4X3RA 2GLJA 1CPXA 5K8MA 3SJEA 3GLJA 1KWMA 1BLLE 1Z5RA 2QVPA 1JQGA 5K8NA 4A38A 4A39A 2AFZA 1PCAA 4FUUA 1DE4C 8CPAA 4UIBA 5HVFA 1Z8LA 1ZLHA 3H8FA 2RFHA 5LRGA 1AMPA 3KL9A 4MHZA 2AFSA 4CPAA 4NJRA 4IAVA 2Q4ZA 2PJAA 2RB7A 5I4MA 3GB0A 4NGPA 3GUXA 4MHPA 5HVHA 3KZWA 3FMCA 2OOTA 3NA6A 4P10A 4PXBA 4F9UA 1FNOA 1RTQA 5J1QA 3VH9A 1DTDA 4P4EA 2PJ9A 4FBEA 3H8EA 1XJOA 1CG2A 3CPXA 4K3NA 3I1UA 4P4FA 4YWYA 3PB4X 4Q7AA 3PB8X 2I3CA 1QQ9A 1HEEA 2ANPA 1GYTA 3IWWA 3D7GA 1YMEA 2PVWA 4P44A 3IFEA 2CTBA 4EMEA 2ZEEA 4PQAA 1Q7LA 4OIDA 1H8LA 5LYIA 4A94A 2PE3A 4P45A 4OMEA 4TNUA 3QNVA 1VHOA 3S9LA 2Q43A 4KSIA 2ZEMA 5D8NA 3B2YA 1TKJA 1VGYA 3FJUA 1TXRA 2ZEPA 3LMSA 4R8FA 4MCQA 4NGRA 1F57A 2C6GA 2ZOFA 4ZX9A 3K2KA 3FEDA 5DS0A 2PJCA 1HDUA 1AYEA 2ZEDA 3S9NA 4MCSA 4MMOA 4R6TA 3JRUA 3PBBA 2JBKA 3D7DA 4F9VA 2POKA 4OC3A 4PPZA 5D29A 2GU2A 3B3SA 4ZY1A 4DJLA 4WJBA 4IHMA 7CPAA 1R43A 4DUKA 1ZG9A 2JBJA 4R7MA 3NH5A 3DLJA 2C1CA 3LWUA 1TKFA 3HLPA 2PJ4A 1XFOA 1FT7A 2CF4A 1Y0YA 2XEJA 3IIBA 1CBXA 2PJ7A 4H2KA 4IK2A 3PEIA 4OC2A 3D7HA 2XEGA 2HC9A 1YSJA 4A37A 3NH8A 4PXCA 4PXEA 2XEIA 2C6CA 4P4DA 3WC5A 2ABZA 1LAPA 3IJ3A 1CX8A 4LQGA 2ZOGA 4ONWA 3FF3A 2PJ3A 3D7FA 5K8PA 2PJBA 4OIWA 3SJFA 3BI1A 4EFDA 5THWA 2HB6A 3V7ZA 5HVGA 1CP7A 1XRYA 1Z2LA 2PRQA 3PFEA 4R76A 3VATA 1EE3P 3V38A 5IB9A 2PIYA 4P4JA 2AFMA 4NGNA 3IEHA 4MXUA 2J9AA 3IO1A 3FEEA 2CIJA 2ZENA 4JYWA 2EK8A 3FX6A 5CPAA 4NGMA 1TF8A 2ZELA 2EK9A 4P6YA 4UEZA 4UF4A 3CPAA 1OBRA 3B7IA 5JGFA 3T8WA 5K8OA 1PYTB 2IJZA 1HDQA 1LANA 2PIZA 3SI2A 2IQ6A 1UWYA 2Q51A 4X8IA 3D4UA 3KASA 4ZX8A 5ELYA 5JM6A 4ZI6A 2ZEFA 4EWTA 3FH4A 4G1PA 2PJ2A 4MCPA 4NGSA 3MN8A 3KQZA 5CBMA 4WWVA 1F2PA 2AFXA 4P4BA 3VARA 3ISXA 2WYRA 5LYLA 3B35A 2PJ0A 3CDXA 2QYVA 4RUHA 3KI9A 4AXVA 4O23A 2ZEOA 6CPAA 2O53A 3PB6X 1ARMA 3SJGA 3PB7X 4X2TA 3SI0A 1TKHA 3N5FA 2CTCA 3SJXA 2V77A 3K9TA 4UEEA 5LYFA 4GM5A 4MCRA 5HXDA 4OC5A 4NFRA 1VIXA 3TC8A 3NFZA 2IMOA 2GREA 5LRKA 2NSMA 3FVLA 2O4HA 1ELLP 3NH4A 3PBEA 2GLFA 2PJ5A 4W9YA 2QJ8A 1BPMA 2V8VA 3B3CA 4TWEA 2NYQA 4PXDA 4BD9A 4DYOA 1IY7A 4OKOA 2DEAA 2XEFA 3D68A 4UIAA 4JZ0A 4NGQA
chains in the Genus database with same CATH superfamily
2OR4A 2PR8A 5A2Qb 3WABA 1VKCA 1LCPA 3I4NI 1YITZ 4B6ZA 1XMBA 2R1IA 3VMIA 3L2NA 3IFUA 2JIQA 2I00A 1VQ81 2JEWA 4KSFA 3CMEZ 1KC81 1NSAA 3WT4A 4KOSA 4NBEA 2BCOA 3PRTA 1QMUA 5C82A 3I9SA 2E2JI 2C6PA 4A3FI 2ZEGA 2RBLA 1Q7Y1 2CY2A 3PO3S 4JWPA 3CCRZ 1VQ71 2KCWA 2ZW5A 3P2FA 4NF1A 4C7HA 1Y7RA 1FDIA 3SI1A 1KUVA 1S72Z 1ZB9A 3CCV1 1YW4A 3SXNA 4B5OA 1TF9A 1LFWA 2F8HA 4FD7A 2BUEA 2P6FA 1S7MA 5F09A 3KGQA 4ORFA 4UA3A 2Z10A 1QVGY 4NBAA 1K8A2 3FKII 1CPXA 3S1RI 1KWMA 3HOVI 1JQGA 1TWAI 4R87A 1WK4A 1YLEA 1Z8XA 4A38A 1YX0A 5IP9I 5HH1A 8CPAA 1QSRA 2WPWA 2GFQA 1ZLHA 3HOUI 4MFKA 4R57A 4UCNA 2JDCA 4UWIA 4RV9A 5I4MA 2RB7A 4UBRA 3RZOI 2OTLZ 3GUXA 5HVHA 4NBDA 4KOXA 3RNZA 3CC7Z 3G6E1 3NA6A 4PXBA 1M1K1 1YJWZ 2J6AA 4NEXA 3JAMb 5J1QA 2R92I 3HOZI 3GTQI 3BG1B 3IGRA 1QVFY 4RVFA 1XJOA 1M4DA 4I49A 3CPXA 3FIXA 4NOZA 4Q7AA 1YK3A 3F5BA 2VF1A 1HEEA 1VQKZ 3FXTA 4KUBA 3CD6Z 5T67A 1MJ9A 1GYTA 2R6MA 3SHPA 3IWWA 3R95A 2PVWA 3IFEA 3GTOI 4OIDA 1H8LA 1I3QI 4XPDB 1QSMA 4A94A 3CMA1 5KTCA 4OMEA 3QNVA 5EC4A 4QTUA 3TE5B 4A3EI 5CNPA 4NCZA 4CGNA 5DS0A 3DSBA 1HDUA 1AYEA 1QSTA 2M6NA 3S9NA 4MCSA 3CC2Z 2JEVA 4MMOA 2ZW7A 3D7DA 3VMHA 4F9VA 4E2XA 3CCSZ 3I3GA 1VQ6Z 2ZW6A 7CPAA 4B11A 3CCE1 4LX9A 3A9LA 2QRCB 2JBJA 4MD7A 4R7MA 2IZ3A 3DLJA 1MJBA 3RYOA 2DF5A 4MFPA 4Q36A 3HLPA 2PJ4A 1P9NA 3CCQZ 4CGOA 3IIBA 1B6BA 1CBXA 4AVCA 4IK2A 5EBVA 2JLMA 3FBUA 4X5KA 2E9HA 4RVHA 1IYLA 3GCFA 2HC9A 5FLMI 1YSJA 2KI7B 1YI21 3EXNA 4PK3A 4PXCA 4Y52I 2Q7SA 4P4DA 4NB9A 4U9ZA 1TWGI 2ABZA 2JA8I 3CC71 4RN7A 3S1MI 4MH4A 3CCM1 3H5ZA 1AUGA 5K8PA 1KQSZ 2PJBA 2V8KA 1I21A 5HMNA 3PZJA 3JTKA 4MFLA 1XRYA 3PFEA 1R9TI 2JA5I 2LFUA 2ZXVA 4NGNA 4E2AA 3G8WA 2QKDA 2P3YA 1VQMZ 3FEEA 4NB8A 4NBHA 2BEIA 2ZENA 4JYWA 1YVKA 1Q821 2JIOA 5F47A 1YJNZ 3CPAA 4DK1A 1QSNA 1OBRA 5JGFA 5JQ4A 3T8WA 1IB1E 3S6FA 4F6AA 4OADA 1Q861 2F4OA 3CMAZ 2JA7I 2DXQA 2IQ6A 3CXQA 2A4NA 3S17I 2RT9A 4ZX8A 2AYDA 1JWHC 4B10A 2PM9A 4EWTA 2W03A 3CQZI 2D4OA 4YRHA 4NGSA 5C4XI 3MN8A 5CBMA 3CXCY 1F2PA 4HNXB 1CJWA 2AFXA 3FQMA 3G4SZ 2DE5A 3VARA 3ISXA 2WYRA 3B35A 3CDXA 3MGDA 2QYVA 3CCU1 4AXVA 4O23A 4C7IA 6CPAA 2O53A 2EGTA 2R98A 3FRMA 4RS4A 3LACA 2K5RA 3SJGA 3IX0A 4UFVA 1Y1WI 3PB7X 3SI0A 4X2TA 1Z4EA 2ATRA 2PRBA 4OC5A 4NFRA 5G20A 2R7ZI 3NFZA 4HNYB 2WAQA 4Y49C 3IU1A 1MK4A 4A32A 5LRKA 1ZO0A 3FVLA 2IL4A 4BY7I 3MONA 1SFOI 1WZNA 4W9YA 2QJ8A 1VQOZ 2V8VA 3QAHA 4TWEA 2NYQA 2J8RA 1IY7A 1Y1VI 2NMTA 3D68A 2GIVA 4DGLA 1XE4A 4NGQA 1FY7A 5FLXb 4XNHB 2J8NA 3T90A 3B3TA 2BO9A 3T9YA 1PUAA 5G22A 1Y7EA 2QMLA 2Z3LA 1M44A 3CXSA 1IGBA 2FE7A 3KR5A 4A31A 4FWUA 1TWFI 3FNCA 2VXKA 2AFUA 2FCKA 5LL6f 2JDDA 5KTAA 2YU9I 1SIWA 4R9MA 3HOYI 4OP4A 3CCMZ 5T64A 2BOAA 3IC1A 3KR4A 2DE7A 2VL1A 1KD12 4HH4A 4OC1A 2Z3OA 4CAWA 1BOBA 3WC7A 1YVOA 1XBUA 4QC6A 4F0YA 1ZB8A 3PB9X 2PJ1A 4ZBGA 4Y49B 1Q7Y2 3PO2I 1VQ4Z 1X12A 2EVNA 2ARHA 1Y9KA 4OC4A 3ISZA 3MZKB 3D66A 1DL6A 1VQ91 4C2ZA 3RAMA 1Q2DA 4Z65A 4ZY0A 4XPKA 1Y9WA 4UEFA 2YGWA 2QIRA 4KLVA 2PCUA 1Y0RA 4CGLA 3PO3I 4DQYB 1XMTA 2NVQI 1YIT1 2HF1A 2R7HA 3BJ7A 1ZLIA 1ZG7A 3CT9A 5IV0A 5JPHA 3TO9A 1I50I 1BPNA 4FD6A 1YHQZ 4A2ZA 2GLJA 1VQ9Z 3GTKI 1Z5RA 2QVPA 5D1PA 1YJW1 2Y0SA 4AB7A 5K8NA 1QF8A 4CYQA 1PU9A 1PCAA 4UFWA 3T4NB 3P2HA 3FYNA 2J8MA 2RFHA 3KL9A 4MHZA 2AFSA 3KKWA 4IAVA 2Q4ZA 3W6SA 3CD61 4MHPA 2QREB 1WW9A 1TIQA 4H6UA 5H86A 3FMCA 4MFQA 3J81f 4P10A 4MY0A 1Y8CA 4L89A 3ESWA 2OOYB 2VPXA 2ODFA 4BBHA 4XPLA 2PJ9A 1K732 1CG2A 4P4FA 1VQL1 3PB4X 3LD2A 4JLYA 1X3WA 3PB8X 2I3CA 4QVTA 4AG9A 4X6AI 1RO5A 2JA6I 3QWUA 3D7GA 3JUWA 2CTBA 4II9A 3S14I 3CPWY 3D6WA 2ZEEA 5FVJA 3V8IA 2GTIA 2PE3A 5BWAB 1S5KA 1K731 2VUGA 2DPTA 1VHOA 4J3GA 3S9LA 2ZEMA 4E31A 3TO7A 3B2YA 1TKJA 3K9UA 3FJUA 3R9FA 3J80f 3LMSA 4NGRA 3K2KA 1VQPZ 2PJCA 2Z0ZA 3UY5A 2WPXA 3CXCZ 3QB8A 4R6TA 3PBBA 4A95A 4K30A 2JBKA 3M3YI 3WR7A 4OC3A 1JJ2Z 2GU2A 4DJLA 4WJBA 4JXRA 2OTJZ 5J8FA 2C1CA 3LWUA 1USPA 4EWCA 1TKFA 2JIPA 2FXFA 1FT7A 4KZTA 4A30A 3OWCA 1ML8A 4HGZA 2PJ7A 1YQEA 3B8GA 4H2KA 1RO2A 4C68A 2E2II 4OC2A 3D7HA 4U5YA 1W2BZ 4PXEA 3RZDI 3SXOA 3S2DI 1VQN1 2BL1A 5GCNA 4LQGA 1S7LA 4XX2A 2F5IA 3NDJA 4M6IA 4AG7A 3SJFA 1A2ZA 4PSXA 3VTNA 1YHQ1 5THWA 2HB6A 4CYPA 3VATA 1S60A 1EE3P 1I1DA 2I79A 2K5TA 4P4JA 2AFMA 4NH1C 3IEHA 3GTMS 3OW2Z 1U6MA 3IO1A 1IYKA 1Z03A 2EK8A 3FX6A 2OTL1 3TOAA 4P6YA 4PV6A 1OZPA 1Q2CA 1PYTB 2IJZA 2ZW4A 1VHSA 4A3LI 3D2PA 3I4MI 2JS4A 2JIRA 3KIFA 3TDHB 2H5MA 2Z3MA 4JD6A 2Q51A 2V45A 4X8IA 3D4UA 3TOBA 2BSWA 2DPSA 3F8KA 5JM6A 4A3MI 3VMGA 1AA6A 1YI2Z 1I12A 2QECA 3N7ZA 3DNSA 2VPZA 1K4JA 3IR7A 2PJ0A 4CAXA 2ZEOA 3PB6X 4M6HA 2QA4Z 3N5FA 2CTCA 2V77A 4UEEA 4MCRA 2VPWA 1YUKA 3R9EA 1VIXA 2FS5A 4KVME 4CGPA 3M4OI 2VUMI 2GREA 3BLNA 4M3SA 5A27A 2GE3A 4UFXA 3NE8A 4CRYB 5C88A 2HU9A 3NH4A 5T6BA 5IX3A 4PK2A 1BPMA 2QEX1 4BD9A 4BINA 2AE6A 3IWGA 2DEAA 4NBBA 1ON0A 2JIMA 3F0AA 1RO0A 4UIAA 1KD11 3KHZA 1GHEA 3TT2A 3E0KA 1ZH1A 2B4BA 5E96A 1ARLA 4KORA 2PJ6A 3RBUA 3GTGI 3J80b 3KQXA 1CPSA 2RIQA 1XEBA 1WJ2A 1K83I 3F3PC 5C44I 2G0BA 4R3KA 1KUXA 1YLOA 4KVOE 3MRUA 1CM0A 4YU9A 1Z4RA 2AFOA 3GKRA 2B4DB 2QLVB 2EUIA 3WC6A 4NJQA 1X0TA 1UFHA 1M4LA 2HV2A 3B3VA 1Z01A 3TTHA 1YIJZ 4CAFA 1LAMA 3I56Z 5IT9f 1Q16A 5AG4A 1NJI2 2V8HA 3BXMA 1YUAA 3HOXI 2RC4A 2ZEHA 1NP6A 2HQYA 1VQO1 3D67A 1N8R2 3FECA 2WB1A 3D9XA 3S9MA 1M4IA 2B63I 1LQLA 2JMOA 1Q822 2OZKA 3CC4Z 2PMZA 4E32A 2PSWA 3BHXA 2RHBA 1FDOA 5G1ZA 3S6GA 2LEXA 1IOFA 3TX8A 2OZGA 1KRLA 4A93I 3R9GA 2WZNA 3G6EZ 4MHYA 1VHEA 5JH9A 1K9M1 1M1DA 3IWEA 2EO8A 3PFOA 2G9DA 3QAYA 2WSAA 2NVXI 4OC0A 5F48A 4L8AA 4P4IA 1Z8TA 5K8MA 2PDOA 3CCS1 1BLLE 1IICA 2Q0YA 1KC82 2EBJA 1M902 1VQK1 3CC21 4A39A 2AFZA 1NE9A 4KOTA 1Z8LA 2B5GB 3H8FA 1AMPA 4F0XA 4RVGA 2X7BA 4NJRA 3GB0A 5CM2M 3EY5A 3CCQ1 3NE7A 3CC41 1WWZA 5J8CA 2CNTA 3CME1 1FNOA 1RTQA 4MD9A 4E33A 1USPB 3S15I 1S7FA 1NJI1 4XNHC 4UWJA 1S721 4P4EA 1WIIA 4FBEA 1M901 1NMTA 4FD5A 4K3NA 3I1UA 5AG7A 4CYNA 4MHDA 4KSAA 4HNWB 4YWYA 4KS9A 1YJ9Z 1N8R1 3IF8A 3ZJ0A 4IUSA 1QQ9A 4OLLA 3CCL1 2R93I 2ZPAA 5I0CA 2B58A 4EMEA 2M48A 2W04A 4B13A 3S6HA 4P45A 2LIYA 4TNUA 1K9M2 1VGYA 4KOUA 1TXRA 2ZEPA 4R8FA 4MCQA 4ZX9A 2GTHA 3FEDA 4A33A 5DWMA 2H85A 3EERA 2ZEDA 1MJAA 4DNCA 3JRUA 2PC1A 1BO4A 3RO0A 2POKA 5D1OB 3CCR1 1Q2YA 2OZHA 4PPZA 1I6HI 3B3SA 1IOIA 4DUKA 1ZG9A 4RS2A 5AG6A 1VQ51 3CCJZ 1LRZA 3OW2Y 1XFOA 2CF4A 2XEJA 1M4GA 4IF5A 3I07A 2FIWA 5IT9b 3G71Z 4CS0B 1K8A1 1X3ZA 3PEIA 2HUZA 3BG0B 3NH8A 1VQ8Z 2XEIA 2CNSA 3D2LA 1NSLA 1QXFA 4B14A 3IJ3A 1CX8A 1TWHI 2ZOGA 4ONWA 3MZLB 4B12A 3FF3A 3D7FA 4MBUA 4OIWA 3BI1A 1JJ2Y 3FQQA 4YGOA 2R8VA 5HVGA 1CP7A 1QVFZ 1N2FA 1RNIA 3V38A 5IB9A 2G2KA 2Q44A 1X10A 2PQ8A 2V8IA 2VZYA 3S2HI 2CNMA 2OOXB 4CRZB 2FSRA 2NAPA 3D2MA 4NGMA 2JR6A 2ZELA 4UEZA 4UF4A 1PFTA 4M85A 2ZAEB 1KZFA 2Q7BA 1Q811 4UCPA 1YJN1 5K8OA 2Q04A 1HDQA 1VLAA 2Q4VA 1IIDA 3CCJ1 2PIZA 2O28A 3SI2A 1UWYA 3KASA 4E0AA 5ELYA 2IV2X 5A2Qf 4C2YA 4G1PA 4E8OA 3D3SA 3KQZA 3CCLZ 2KPIA 4NSQA 4RUHA 3KI9A 3EC4A 3GIUA 4M6GA 2IZ4A 1ARMA 4PSWA 2B5GA 3CCVZ 3EFAA 4BBSI 1TKHA 3R1KA 2JNYA 5LYFA 1RO4A 4GM5A 3VWEA 1RQFA 5HXDA 2Z3KA 3TC8A 4RI1A 4GS4A 3W6XA 2YNCA 4R3LA 4BMHA 2G3AA 3J81b 4KLWA 2F4MA 3B3CA 4NXYA 2P0WA 4DYOA 4B5PB 2VBQA 2XEFA 1NUIA 4MFJA 4JZ0A 1J4JA 3LODA 5C4JI 3ZZIA 3S6KA 3GTMI 3RZAA 2F7VA 3DGVA 4F8ZA 3TFYA 4E2ZA 3DDDA 4QB9A 4MJ8A 4NGTA 1ELMP 3HUVA 2PVVA 3H8GA 2VQYA 4Q38A 2V3VA 4LQ6A 4EVYA 1JWQA 5LRJA 4AYBA 5F46A 1R3NA 2PJ8A 4H6ZA 4MHNA 2REEA 4BBRI 1L0CA 4NBCA 3BI0A 2YNCC 1SQHA 4QTTA 2V8GA 2EWBA 4HKFA 3S1QI 1VQNZ 1P0HA 2QR1B 3JAMf 4YFJA 1YW6A 1Y1VS 4MFZA 5H84A 1RLYA 1LOKA 1QSOA 3I551 2OH1A 2P6GA 3FB3A 5D1OA 2Z3NA 1R57A 4A3JI 2AFWA 3PP9A 4MRIA 3R96A 1IU8A 4CL1A 3EEDA 4ZYQA 2FVGA 4FAIA 3CXPA 1BAVA 1F2OA 1QYPA 4QUSA 3KHXA 5LYDA 4A3CI 3K7AI 4ZY2A 1ZG8A 3DR6A 2P6EA 2V8DA 1VQLZ 3B3WA 1CP6A 4OAEA 5IB0A 4KUAA 4X3RA 1TFIA 3SJEA 3Q87A 3GLJA 2B4DA 1N71A 2E7ZA 4A3GI 3H0GI 3I561 2FL4A 2YNDA 3S16I 3G3SA 4FUUA 2B3VA 1DE4C 4MI4A 2JUBA 1VQ7Z 2P28A 4UIBA 5HVFA 4ZGYB 4CYOA 1YR0A 5DWNA 5LRGA 1YGHA 1KUYA 3GYAA 4CPAA 1WCMI 5FLXf 2PJAA 3VWDA 4NGPA 1XOVA 3KZWA 2OOTA 4B5PA 2G3TA 1Z9UA 3IU2A 4F9UA 2NVYI 3C26A 3VH9A 1VQ61 2FT0A 1DTDA 4H89A 3H8EA 4FD4A 1W2BY 5C3EI 4HGYA 2VZZA 4E30A 2NVTI 5AN9F 3G4S1 4U9YA 4CAVA 5IP7I 2ANPA 2B3UA 2Q4YA 3PGPA 4A3KI 3NDIA 2CXAA 3VB9A 3CCEZ 1YMEA 2V8JA 4P44A 4A3II 4AVBA 4BXXI 4PQAA 4CGMA 1Q7LA 5LYIA 3W91A 3GKQA 3JVNA 4E2YA 3D8PA 5G21A 2Q43A 4KSIA 4JXQA 5D8NA 2WUUA 3P5JB 1Q862 2OZUA 4BY1I 4KOWA 1F57A 2C6GA 3F3FC 2ZOFA 3S1NI 5KTDA 1S3ZA 4NBGA 3DR8A 2Y0MA 5AGEA 1VQM1 4AVAA 1M1K2 4UCMA 4S1TA 5D29A 4ZY1A 1KQSY 1XF8A 3BJ8A 1B87A 4IHMA 3TO6A 1R43A 3NH5A 3J7A4 3CPWZ 3TE4A 3G711 2AKLA 3EO4A 1Y0YA 1S7KA 3HKZA 1Z8WA 2Z3PA 1YIJ1 4A3BI 2XEGA 3CZXA 4A37A 5A28A 4KOYA 3TCVA 2DE6A 2OB0A 2C6CA 4KOVA 3WC5A 2C27A 1YREA 1LAPA 4MY3A 2PJ3A 4C2XA 2E2HI 2REFA 4EFDA 3I55Z 3V7ZA 1Z2LA 2PRQA 4R76A 4ONUA 2YADA 2QRDB 2PIYA 4MXUA 2J9AA 2CIJA 5F49A 4LUAA 5CPAA 1VQ5Z 1TF8A 1VQP1 3HOWI 2EK9A 4Y7NI 4NBFA 2OTJ1 4E2WA 3LUSA 2PR1A 4RVDA 3B7IA 4GXHA 4KVXA 3CCUZ 2K3RA 1YJ91 1LANA 1XIXA 3H4QA 1QVGZ 2QEXZ 1RXTA 4ZI6A 2ZEFA 3FH4A 2QA41 2PJ2A 4MCPA 4MD8A 1Q812 4WWVA 1TWCI 5ISVA 2RPRA 1VQ41 4MONA 4P4BA 5LYLA 1Z02A 2BJOA 2PK7A 1V0CA 2VI7A 1L1OC 3SJXA 3GTJI 3K9TA 1S7NA 3GTPI 3H3VJ 4HPSA 2GANA 2IMOA 4XPDC 2VPYA 1P4NA 2OU2A 2D4PA 2NSMA 4A3DI 2O4HA 1ELLP 3U50C 3PBEA 2GLFA 2PJ5A 2AJ6A 4CAEA 5EMIA 4JJXA 2VEZA 5AG5A 4PXDA 2FIAA 4OKOA 2YNEA 3KIHA 3GTLI 3GY9A 2Z11A 4QBJA
chains in the Genus database with same CATH topology
1KD11 5C4JI 3KHZA 2OR4A 1ZH1A 5FLXb 1ARLA 5A2Qb 3GTMI 3RZAA 3WABA 2F7VA 3DGVA 4F8ZA 2PJ6A 3RBUA 3GTGI 3B3TA 3J80b 2BO9A 3KQXA 4E2ZA 1LCPA 1CPSA 2RIQA 1Y7EA 4NGTA 1K83I 3F3PC 1ELMP 3HUVA 3I4NI 5C44I 1YITZ 4B6ZA 2PVVA 1XMBA 3VMIA 3H8GA 1YLOA 3L2NA 3IFUA 3MRUA 4YU9A 2AFOA 1IGBA 3KR5A 2QLVB 3WC6A 5LRJA 4FWUA 4NJQA 4AYBA 1TWFI 1R3NA 1VQ81 1X0TA 2JEWA 2PJ8A 4MHNA 2AFUA 5LL6f 4BBRI 2YU9I 1M4LA 4NBCA 3B3VA 3BI0A 1Z01A 3HOYI 4OP4A 3CCMZ 1YIJZ 1KC81 3CMEZ 5T64A 1NSAA 2BOAA 4QTTA 1LAMA 2V8GA 3IC1A 3WT4A 2EWBA 3I56Z 3KR4A 4NBEA 5IT9f 2DE7A 2BCOA 3PRTA 1QMUA 3S1QI 1VQNZ 2VL1A 1KD12 2E2JI 2QR1B 2C6PA 4HH4A 3JAMf 4A3FI 2ZEGA 4OC1A 1NJI2 1YW6A 2V8HA 1Y1VS 1RLYA 3BXMA 1YUAA 1LOKA 3HOXI 2RBLA 1Q7Y1 3I551 3WC7A 1XBUA 2ZEHA 1NP6A 5D1OA 3PO3S 1VQO1 1ZB8A 3D67A 1N8R2 4A3JI 2AFWA 3PB9X 4MRIA 3CCRZ 2PJ1A 3FECA 1VQ71 2WB1A 3D9XA 4CL1A 3EEDA 4ZYQA 3S9MA 2FVGA 4FAIA 1Q7Y2 2B63I 1LQLA 2JMOA 1Q822 3PO2I 1VQ4Z 2OZKA 3CC4Z 2PMZA 4E32A 4OC4A 3ISZA 3SI1A 1BAVA 3BHXA 1S72Z 1ZB9A 2RHBA 3MZKB 3D66A 1DL6A 1VQ91 1F2OA 3TX8A 1QYPA 3KHXA 3CCV1 3RAMA 5LYDA 1KRLA 4Z65A 4A93I 4A3CI 4ZY0A 3K7AI 4ZY2A 4UEFA 2WZNA 1YW4A 1TF9A 3G6EZ 1LFWA 4MHYA 1ZG8A 2F8HA 2PCUA 1VHEA 1Y0RA 5JH9A 3PO3I 2V8DA 1VQLZ 1K9M1 3B3WA 1CP6A 4DQYB 1S7MA 5F09A 2NVQI 3KGQA 1YIT1 2HF1A 1ZLIA 1ZG7A 3CT9A 3PFOA 1QVGY 2G9DA 1I50I 4NBAA 2NVXI 4OC0A 1BPNA 1K8A2 4P4IA 4X3RA 1TFIA 3FKII 1YHQZ 2GLJA 1CPXA 5K8MA 1VQ9Z 3S1RI 3CCS1 3SJEA 3Q87A 3GLJA 1KWMA 3GTKI 1BLLE 1Z5RA 3HOVI 2QVPA 1JQGA 1TWAI 5D1PA 1YJW1 1KC82 2Y0SA 1M902 1VQK1 5K8NA 1QF8A 4A3GI 3H0GI 3CC21 3I561 4A38A 3S16I 4A39A 2AFZA 1PCAA 5IP9I 4FUUA 1DE4C 8CPAA 3T4NB 2JUBA 1VQ7Z 2P28A 4UIBA 5HVFA 1Z8LA 1ZLHA 3H8FA 2RFHA 3HOUI 5LRGA 1AMPA 3KL9A 4RVGA 4MHZA 2AFSA 4CPAA 1WCMI 4IAVA 4NJRA 4RV9A 2Q4ZA 5FLXf 2PJAA 2RB7A 3RZOI 3GB0A 2OTLZ 5I4MA 3CD61 4NGPA 3GUXA 4MHPA 2QREB 1WW9A 5CM2M 5HVHA 4NBDA 3CCQ1 3KZWA 3CC41 3FMCA 2OOTA 3J81f 3CC7Z 3G6E1 3NA6A 4P10A 4PXBA 4F9UA 1M1K1 2NVYI 3CME1 1YJWZ 2J6AA 1FNOA 3JAMb 1RTQA 5J1QA 4MD9A 4E33A 2R92I 3ESWA 1USPB 3S15I 3HOZI 2OOYB 3VH9A 1NJI1 1VQ61 3GTQI 1S721 1DTDA 3BG1B 1WIIA 1K732 2PJ9A 4P4EA 3H8EA 1QVFY 4RVFA 4FBEA 1XJOA 1W2BY 1M901 1CG2A 3CPXA 4K3NA 3I1UA 5C3EI 4P4FA 4NOZA 4HGYA 1VQL1 4YWYA 3PB4X 4Q7AA 1X3WA 4E30A 2NVTI 1YJ9Z 1N8R1 3IF8A 3PB8X 5AN9F 2VF1A 2I3CA 3G4S1 1HEEA 1QQ9A 1VQKZ 3CD6Z 4X6AI 5IP7I 5T67A 3CCL1 2ANPA 2JA6I 3QWUA 4A3KI 2R93I 1GYTA 2R6MA 3NDIA 3IWWA 3VB9A 3CCEZ 1YMEA 3D7GA 2PVWA 2V8JA 4P44A 3IFEA 2CTBA 3S14I 4A3II 3GTOI 3CPWY 4BXXI 4EMEA 3D6WA 2ZEEA 4PQAA 1Q7LA 4OIDA 1H8LA 1I3QI 5LYIA 2M48A 2W04A 3GKQA 4A94A 2GTIA 2PE3A 4E2YA 3CMA1 4P45A 1K731 2VUGA 2LIYA 4OMEA 4TNUA 3QNVA 1VHOA 3S9LA 2Q43A 4KSIA 2ZEMA 4E31A 1K9M2 4QTUA 3B2YA 5D8NA 1TKJA 1VGYA 3FJUA 3P5JB 1Q862 3TE5B 1TXRA 3J80f 2ZEPA 4A3EI 3LMSA 4BY1I 4MCQA 4R8FA 4NGRA 1F57A 2C6GA 3F3FC 2ZOFA 4ZX9A 2GTHA 3S1NI 3K2KA 3FEDA 1VQPZ 5DS0A 2PJCA 4NBGA 1HDUA 2H85A 1AYEA 3EERA 2M6NA 2ZEDA 3S9NA 4MCSA 3CC2Z 3CXCZ 1VQM1 4MMOA 4R6TA 3JRUA 3PBBA 1M1K2 2JBKA 3D7DA 3VMHA 3M3YI 4F9VA 4S1TA 2POKA 4OC3A 5D1OB 4E2XA 3CCR1 1JJ2Z 3CCSZ 4PPZA 1I6HI 2GU2A 5D29A 3B3SA 4ZY1A 1KQSY 1VQ6Z 4DJLA 4WJBA 4IHMA 7CPAA 3CCE1 1R43A 4DUKA 2OTJZ 2QRCB 1ZG9A 4MD7A 2JBJA 2IZ3A 4R7MA 3NH5A 3J7A4 3CPWZ 3DLJA 2C1CA 1VQ51 3LWUA 3G711 2AKLA 1USPA 4EWCA 3CCJZ 1TKFA 3OW2Y 3HLPA 2PJ4A 1P9NA 1FT7A 1XFOA 2CF4A 1Y0YA 3CCQZ 2XEJA 3HKZA 3IIBA 3I07A 1CBXA 1ML8A 4HGZA 3G71Z 5IT9b 2PJ7A 1YIJ1 1X3ZA 1RO2A 1K8A1 4A3BI 3PEIA 2E2II 4H2KA 4IK2A 2E9HA 4OC2A 4RVHA 3D7HA 3GCFA 2XEGA 2HC9A 5FLMI 1YSJA 2KI7B 3BG0B 1YI21 1W2BZ 4A37A 3NH8A 4PXCA 4PXEA 2DE6A 3RZDI 1VQ8Z 4Y52I 2C6CA 2XEIA 4P4DA 4NB9A 3WC5A 1TWGI 3S2DI 2ABZA 1VQN1 2JA8I 1LAPA 3CC71 3IJ3A 3S1MI 1CX8A 1TWHI 4LQGA 4MH4A 2ZOGA 4ONWA 3MZLB 4XX2A 3FF3A 2PJ3A 3CCM1 3D7FA 5K8PA 1KQSZ 3NDJA 2PJBA 4OIWA 2E2HI 3SJFA 3BI1A 2V8KA 1JJ2Y 4EFDA 3VTNA 1YHQ1 3FQQA 5THWA 3I55Z 2HB6A 3V7ZA 5HVGA 1CP7A 1XRYA 1QVFZ 1Z2LA 2PRQA 3PFEA 4R76A 2YADA 3VATA 1N2FA 1R9TI 2JA5I 1EE3P 2QRDB 1RNIA 2LFUA 3V38A 5IB9A 2G2KA 2PIYA 4P4JA 2AFMA 4NGNA 4NH1C 3IEHA 3GTMS 3OW2Z 4MXUA 2J9AA 2QKDA 2P3YA 3IO1A 1VQMZ 3FEEA 2V8IA 4NB8A 2CIJA 4NBHA 3S2HI 2ZENA 4JYWA 2OOXB 1Z03A 2EK8A 3FX6A 2OTL1 5CPAA 1VQ5Z 1Q821 4NGMA 1TF8A 1VQP1 2JR6A 3HOWI 1YJNZ 2EK9A 2ZELA 4P6YA 4Y7NI 4UEZA 4UF4A 1PFTA 4NBFA 2OTJ1 3CPAA 4E2WA 2ZAEB 4DK1A 3LUSA 4RVDA 1OBRA 3B7IA 5JGFA 1Q811 3T8WA 1YJN1 5K8OA 1PYTB 2IJZA 1HDQA 1VLAA 3CCUZ 4A3LI 2K3RA 1Q861 1YJ91 2JS4A 3I4MI 1LANA 3KIFA 3TDHB 2F4OA 3CMAZ 3CCJ1 2PIZA 2JA7I 3SI2A 2IQ6A 1UWYA 2Q51A 3S17I 4X8IA 3D4UA 3KASA 2RT9A 4ZX8A 1QVGZ 5ELYA 2QEXZ 5JM6A 5A2Qf 1JWHC 4ZI6A 2ZEFA 2PM9A 4EWTA 2W03A 3FH4A 4G1PA 4A3MI 3VMGA 3CQZI 2QA41 2PJ2A 1YI2Z 4MCPA 4MD8A 4NGSA 1Q812 5C4XI 3MN8A 3KQZA 5CBMA 4WWVA 3CXCY 1F2PA 3CCLZ 2AFXA 1TWCI 2KPIA 2RPRA 1VQ41 3FQMA 3G4SZ 2DE5A 4MONA 4P4BA 3ISXA 2WYRA 3VARA 3B35A 2PJ0A 3CDXA 5LYLA 2QYVA 1Z02A 4RUHA 3CCU1 3KI9A 4O23A 2ZEOA 4AXVA 6CPAA 2O53A 2IZ4A 3PB6X 2EGTA 4RS4A 2K5RA 1ARMA 3SJGA 3IX0A 1Y1WI 3PB7X 2BJOA 2PK7A 3CCVZ 4X2TA 3SI0A 4BBSI 1TKHA 2QA4Z 3N5FA 2CTCA 1L1OC 2JNYA 3GTJI 2V77A 3K9TA 4UEEA 3SJXA 5LYFA 3GTPI 1RO4A 4GM5A 4MCRA 1RQFA 3H3VJ 5HXDA 1YUKA 4OC5A 4NFRA 2R7ZI 1VIXA 3TC8A 3NFZA 2WAQA 3M4OI 2IMOA 2VUMI 2GREA 5LRKA 2NSMA 4A3DI 3FVLA 2O4HA 1ELLP 3U50C 4BY7I 2HU9A 3MONA 3NH4A 5T6BA 3PBEA 2GLFA 1SFOI 2PJ5A 3J81b 4W9YA 2QJ8A 1VQOZ 1BPMA 2V8VA 2F4MA 3B3CA 4TWEA 2QEX1 2NYQA 4PXDA 4BD9A 4DYOA 1IY7A 1Y1VI 4OKOA 2DEAA 2XEFA 4NBBA 3D68A 3KIHA 1NUIA 4DGLA 3GTLI 4UIAA 1RO0A 4JZ0A 4NGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHZ A;  2OR4 A;  1ARL A;  3RZA A;  3WAB A;  2F7V A;  3DGV A;  4F8Z A;  2PJ6 A;  3RBU A;  3B3T A;  2BO9 A;  3KQX A;  1LCP A;  1CPS A;  1Y7E A;  4NGT A;  1ELM P;  3HUV A;  4B6Z A;  2PVV A;  1XMB A;  3H8G A;  1YLO A;  3L2N A;  3MRU A;  4YU9 A;  2AFO A;  1IGB A;  3KR5 A;  3WC6 A;  5LRJ A;  4FWU A;  4NJQ A;  1R3N A;  2JEW A;  2PJ8 A;  4MHN A;  2AFU A;  1M4L A;  3B3V A;  3BI0 A;  4OP4 A;  1NSA A;  2BOA A;  1LAM A;  3IC1 A;  2V8G A;  3WT4 A;  2EWB A;  3KR4 A;  2BCO A;  3PRT A;  1QMU A;  2VL1 A;  2C6P A;  2ZEG A;  4OC1 A;  1YW6 A;  2V8H A;  3BXM A;  1LOK A;  3WC7 A;  1XBU A;  2ZEH A;  3D67 A;  2AFW A;  3PB9 X;  4MRI A;  2PJ1 A;  3FEC A;  4ZYQ A;  3S9M A;  2FVG A;  4FAI A;  4OC4 A;  3ISZ A;  3SI1 A;  1BAV A;  3BHX A;  3D66 A;  1F2O A;  3TX8 A;  3KHX A;  3RAM A;  5LYD A;  4Z65 A;  4ZY0 A;  4ZY2 A;  4UEF A;  2WZN A;  1YW4 A;  1TF9 A;  1LFW A;  4MHY A;  1ZG8 A;  2F8H A;  2PCU A;  1VHE A;  1Y0R A;  5JH9 A;  2V8D A;  3B3W A;  1CP6 A;  5F09 A;  3KGQ A;  1ZLI A;  1ZG7 A;  3CT9 A;  3PFO A;  2G9D A;  4OC0 A;  1BPN A;  4P4I A;  4X3R A;  2GLJ A;  1CPX A;  5K8M A;  3SJE A;  3GLJ A;  1KWM A;  1BLL E;  1Z5R A;  2QVP A;  1JQG A;  5K8N A;  4A38 A;  4A39 A;  2AFZ A;  1PCA A;  4FUU A;  1DE4 C;  8CPA A;  4UIB A;  5HVF A;  1Z8L A;  1ZLH A;  3H8F A;  2RFH A;  5LRG A;  1AMP A;  3KL9 A;  4MHZ A;  2AFS A;  4CPA A;  4NJR A;  4IAV A;  2Q4Z A;  2PJA A;  2RB7 A;  5I4M A;  3GB0 A;  4NGP A;  3GUX A;  4MHP A;  5HVH A;  3KZW A;  3FMC A;  2OOT A;  3NA6 A;  4P10 A;  4PXB A;  4F9U A;  1FNO A;  1RTQ A;  5J1Q A;  3VH9 A;  1DTD A;  4P4E A;  2PJ9 A;  4FBE A;  3H8E A;  1XJO A;  1CG2 A;  3CPX A;  4K3N A;  3I1U A;  4P4F A;  4YWY A;  3PB4 X;  4Q7A A;  3PB8 X;  2I3C A;  1QQ9 A;  1HEE A;  2ANP A;  1GYT A;  3IWW A;  3D7G A;  1YME A;  2PVW A;  4P44 A;  3IFE A;  2CTB A;  4EME A;  2ZEE A;  4PQA A;  1Q7L A;  4OID A;  1H8L A;  5LYI A;  4A94 A;  2PE3 A;  4P45 A;  4OME A;  4TNU A;  3QNV A;  1VHO A;  3S9L A;  2Q43 A;  4KSI A;  2ZEM A;  5D8N A;  3B2Y A;  1TKJ A;  1VGY A;  3FJU A;  1TXR A;  2ZEP A;  3LMS A;  4R8F A;  4MCQ A;  4NGR A;  1F57 A;  2C6G A;  2ZOF A;  4ZX9 A;  3K2K A;  3FED A;  5DS0 A;  2PJC A;  1HDU A;  1AYE A;  2ZED A;  3S9N A;  4MCS A;  4MMO A;  4R6T A;  3JRU A;  3PBB A;  2JBK A;  3D7D A;  4F9V A;  2POK A;  4OC3 A;  4PPZ A;  5D29 A;  2GU2 A;  3B3S A;  4ZY1 A;  4DJL A;  4WJB A;  4IHM A;  7CPA A;  1R43 A;  4DUK A;  1ZG9 A;  2JBJ A;  4R7M A;  3NH5 A;  3DLJ A;  2C1C A;  3LWU A;  1TKF A;  3HLP A;  2PJ4 A;  1XFO A;  1FT7 A;  2CF4 A;  1Y0Y A;  2XEJ A;  3IIB A;  1CBX A;  2PJ7 A;  4H2K A;  4IK2 A;  3PEI A;  4OC2 A;  3D7H A;  2XEG A;  2HC9 A;  1YSJ A;  4A37 A;  3NH8 A;  4PXC A;  4PXE A;  2XEI A;  2C6C A;  4P4D A;  3WC5 A;  2ABZ A;  1LAP A;  3IJ3 A;  1CX8 A;  4LQG A;  2ZOG A;  4ONW A;  3FF3 A;  2PJ3 A;  3D7F A;  5K8P A;  2PJB A;  4OIW A;  3SJF A;  3BI1 A;  4EFD A;  5THW A;  2HB6 A;  3V7Z A;  5HVG A;  1CP7 A;  1XRY A;  1Z2L A;  2PRQ A;  3PFE A;  4R76 A;  3VAT A;  1EE3 P;  3V38 A;  5IB9 A;  2PIY A;  4P4J A;  2AFM A;  4NGN A;  3IEH A;  4MXU A;  2J9A A;  3IO1 A;  3FEE A;  2CIJ A;  2ZEN A;  4JYW A;  2EK8 A;  3FX6 A;  5CPA A;  4NGM A;  1TF8 A;  2ZEL A;  2EK9 A;  4P6Y A;  4UEZ A;  4UF4 A;  3CPA A;  1OBR A;  3B7I A;  5JGF A;  3T8W A;  5K8O A;  1PYT B;  2IJZ A;  1HDQ A;  1LAN A;  2PIZ A;  3SI2 A;  2IQ6 A;  1UWY A;  2Q51 A;  4X8I A;  3D4U A;  3KAS A;  4ZX8 A;  5ELY A;  5JM6 A;  4ZI6 A;  2ZEF A;  4EWT A;  3FH4 A;  4G1P A;  2PJ2 A;  4MCP A;  4NGS A;  3MN8 A;  3KQZ A;  5CBM A;  4WWV A;  1F2P A;  2AFX A;  4P4B A;  3VAR A;  3ISX A;  2WYR A;  5LYL A;  3B35 A;  2PJ0 A;  3CDX A;  2QYV A;  4RUH A;  3KI9 A;  4AXV A;  4O23 A;  2ZEO A;  6CPA A;  2O53 A;  3PB6 X;  1ARM A;  3SJG A;  3PB7 X;  4X2T A;  3SI0 A;  1TKH A;  3N5F A;  2CTC A;  3SJX A;  2V77 A;  3K9T A;  4UEE A;  5LYF A;  4GM5 A;  4MCR A;  5HXD A;  4OC5 A;  4NFR A;  1VIX A;  3TC8 A;  3NFZ A;  2IMO A;  2GRE A;  5LRK A;  2NSM A;  3FVL A;  2O4H A;  1ELL P;  3NH4 A;  3PBE A;  2GLF A;  2PJ5 A;  4W9Y A;  2QJ8 A;  1BPM A;  2V8V A;  3B3C A;  4TWE A;  2NYQ A;  4PXD A;  4BD9 A;  4DYO A;  1IY7 A;  4OKO A;  2DEA A;  2XEF A;  3D68 A;  4UIA A;  4JZ0 A;  4NGQ A; 
#chains in the Genus database with same CATH topology
 2OR4 A;  2PR8 A;  5A2Q b;  3WAB A;  1VKC A;  1LCP A;  3I4N I;  1YIT Z;  4B6Z A;  1XMB A;  2R1I A;  3VMI A;  3L2N A;  3IFU A;  2JIQ A;  2I00 A;  1VQ8 1;  2JEW A;  4KSF A;  3CME Z;  1KC8 1;  1NSA A;  3WT4 A;  4KOS A;  4NBE A;  2BCO A;  3PRT A;  1QMU A;  5C82 A;  3I9S A;  2E2J I;  2C6P A;  4A3F I;  2ZEG A;  2RBL A;  1Q7Y 1;  2CY2 A;  3PO3 S;  4JWP A;  3CCR Z;  1VQ7 1;  2KCW A;  2ZW5 A;  3P2F A;  4NF1 A;  4C7H A;  1Y7R A;  1FDI A;  3SI1 A;  1KUV A;  1S72 Z;  1ZB9 A;  3CCV 1;  1YW4 A;  3SXN A;  4B5O A;  1TF9 A;  1LFW A;  2F8H A;  4FD7 A;  2BUE A;  2P6F A;  1S7M A;  5F09 A;  3KGQ A;  4ORF A;  4UA3 A;  2Z10 A;  1QVG Y;  4NBA A;  1K8A 2;  3FKI I;  1CPX A;  3S1R I;  1KWM A;  3HOV I;  1JQG A;  1TWA I;  4R87 A;  1WK4 A;  1YLE A;  1Z8X A;  4A38 A;  1YX0 A;  5IP9 I;  5HH1 A;  8CPA A;  1QSR A;  2WPW A;  2GFQ A;  1ZLH A;  3HOU I;  4MFK A;  4R57 A;  4UCN A;  2JDC A;  4UWI A;  4RV9 A;  5I4M A;  2RB7 A;  4UBR A;  3RZO I;  2OTL Z;  3GUX A;  5HVH A;  4NBD A;  4KOX A;  3RNZ A;  3CC7 Z;  3G6E 1;  3NA6 A;  4PXB A;  1M1K 1;  1YJW Z;  2J6A A;  4NEX A;  3JAM b;  5J1Q A;  2R92 I;  3HOZ I;  3GTQ I;  3BG1 B;  3IGR A;  1QVF Y;  4RVF A;  1XJO A;  1M4D A;  4I49 A;  3CPX A;  3FIX A;  4NOZ A;  4Q7A A;  1YK3 A;  3F5B A;  2VF1 A;  1HEE A;  1VQK Z;  3FXT A;  4KUB A;  3CD6 Z;  5T67 A;  1MJ9 A;  1GYT A;  2R6M A;  3SHP A;  3IWW A;  3R95 A;  2PVW A;  3IFE A;  3GTO I;  4OID A;  1H8L A;  1I3Q I;  4XPD B;  1QSM A;  4A94 A;  3CMA 1;  5KTC A;  4OME A;  3QNV A;  5EC4 A;  4QTU A;  3TE5 B;  4A3E I;  5CNP A;  4NCZ A;  4CGN A;  5DS0 A;  3DSB A;  1HDU A;  1AYE A;  1QST A;  2M6N A;  3S9N A;  4MCS A;  3CC2 Z;  2JEV A;  4MMO A;  2ZW7 A;  3D7D A;  3VMH A;  4F9V A;  4E2X A;  3CCS Z;  3I3G A;  1VQ6 Z;  2ZW6 A;  7CPA A;  4B11 A;  3CCE 1;  4LX9 A;  3A9L A;  2QRC B;  2JBJ A;  4MD7 A;  4R7M A;  2IZ3 A;  3DLJ A;  1MJB A;  3RYO A;  2DF5 A;  4MFP A;  4Q36 A;  3HLP A;  2PJ4 A;  1P9N A;  3CCQ Z;  4CGO A;  3IIB A;  1B6B A;  1CBX A;  4AVC A;  4IK2 A;  5EBV A;  2JLM A;  3FBU A;  4X5K A;  2E9H A;  4RVH A;  1IYL A;  3GCF A;  2HC9 A;  5FLM I;  1YSJ A;  2KI7 B;  1YI2 1;  3EXN A;  4PK3 A;  4PXC A;  4Y52 I;  2Q7S A;  4P4D A;  4NB9 A;  4U9Z A;  1TWG I;  2ABZ A;  2JA8 I;  3CC7 1;  4RN7 A;  3S1M I;  4MH4 A;  3CCM 1;  3H5Z A;  1AUG A;  5K8P A;  1KQS Z;  2PJB A;  2V8K A;  1I21 A;  5HMN A;  3PZJ A;  3JTK A;  4MFL A;  1XRY A;  3PFE A;  1R9T I;  2JA5 I;  2LFU A;  2ZXV A;  4NGN A;  4E2A A;  3G8W A;  2QKD A;  2P3Y A;  1VQM Z;  3FEE A;  4NB8 A;  4NBH A;  2BEI A;  2ZEN A;  4JYW A;  1YVK A;  1Q82 1;  2JIO A;  5F47 A;  1YJN Z;  3CPA A;  4DK1 A;  1QSN A;  1OBR A;  5JGF A;  5JQ4 A;  3T8W A;  1IB1 E;  3S6F A;  4F6A A;  4OAD A;  1Q86 1;  2F4O A;  3CMA Z;  2JA7 I;  2DXQ A;  2IQ6 A;  3CXQ A;  2A4N A;  3S17 I;  2RT9 A;  4ZX8 A;  2AYD A;  1JWH C;  4B10 A;  2PM9 A;  4EWT A;  2W03 A;  3CQZ I;  2D4O A;  4YRH A;  4NGS A;  5C4X I;  3MN8 A;  5CBM A;  3CXC Y;  1F2P A;  4HNX B;  1CJW A;  2AFX A;  3FQM A;  3G4S Z;  2DE5 A;  3VAR A;  3ISX A;  2WYR A;  3B35 A;  3CDX A;  3MGD A;  2QYV A;  3CCU 1;  4AXV A;  4O23 A;  4C7I A;  6CPA A;  2O53 A;  2EGT A;  2R98 A;  3FRM A;  4RS4 A;  3LAC A;  2K5R A;  3SJG A;  3IX0 A;  4UFV A;  1Y1W I;  3PB7 X;  3SI0 A;  4X2T A;  1Z4E A;  2ATR A;  2PRB A;  4OC5 A;  4NFR A;  5G20 A;  2R7Z I;  3NFZ A;  4HNY B;  2WAQ A;  4Y49 C;  3IU1 A;  1MK4 A;  4A32 A;  5LRK A;  1ZO0 A;  3FVL A;  2IL4 A;  4BY7 I;  3MON A;  1SFO I;  1WZN A;  4W9Y A;  2QJ8 A;  1VQO Z;  2V8V A;  3QAH A;  4TWE A;  2NYQ A;  2J8R A;  1IY7 A;  1Y1V I;  2NMT A;  3D68 A;  2GIV A;  4DGL A;  1XE4 A;  4NGQ A;  1FY7 A;  5FLX b;  4XNH B;  2J8N A;  3T90 A;  3B3T A;  2BO9 A;  3T9Y A;  1PUA A;  5G22 A;  1Y7E A;  2QML A;  2Z3L A;  1M44 A;  3CXS A;  1IGB A;  2FE7 A;  3KR5 A;  4A31 A;  4FWU A;  1TWF I;  3FNC A;  2VXK A;  2AFU A;  2FCK A;  5LL6 f;  2JDD A;  5KTA A;  2YU9 I;  1SIW A;  4R9M A;  3HOY I;  4OP4 A;  3CCM Z;  5T64 A;  2BOA A;  3IC1 A;  3KR4 A;  2DE7 A;  2VL1 A;  1KD1 2;  4HH4 A;  4OC1 A;  2Z3O A;  4CAW A;  1BOB A;  3WC7 A;  1YVO A;  1XBU A;  4QC6 A;  4F0Y A;  1ZB8 A;  3PB9 X;  2PJ1 A;  4ZBG A;  4Y49 B;  1Q7Y 2;  3PO2 I;  1VQ4 Z;  1X12 A;  2EVN A;  2ARH A;  1Y9K A;  4OC4 A;  3ISZ A;  3MZK B;  3D66 A;  1DL6 A;  1VQ9 1;  4C2Z A;  3RAM A;  1Q2D A;  4Z65 A;  4ZY0 A;  4XPK A;  1Y9W A;  4UEF A;  2YGW A;  2QIR A;  4KLV A;  2PCU A;  1Y0R A;  4CGL A;  3PO3 I;  4DQY B;  1XMT A;  2NVQ I;  1YIT 1;  2HF1 A;  2R7H A;  3BJ7 A;  1ZLI A;  1ZG7 A;  3CT9 A;  5IV0 A;  5JPH A;  3TO9 A;  1I50 I;  1BPN A;  4FD6 A;  1YHQ Z;  4A2Z A;  2GLJ A;  1VQ9 Z;  3GTK I;  1Z5R A;  2QVP A;  5D1P A;  1YJW 1;  2Y0S A;  4AB7 A;  5K8N A;  1QF8 A;  4CYQ A;  1PU9 A;  1PCA A;  4UFW A;  3T4N B;  3P2H A;  3FYN A;  2J8M A;  2RFH A;  3KL9 A;  4MHZ A;  2AFS A;  3KKW A;  4IAV A;  2Q4Z A;  3W6S A;  3CD6 1;  4MHP A;  2QRE B;  1WW9 A;  1TIQ A;  4H6U A;  5H86 A;  3FMC A;  4MFQ A;  3J81 f;  4P10 A;  4MY0 A;  1Y8C A;  4L89 A;  3ESW A;  2OOY B;  2VPX A;  2ODF A;  4BBH A;  4XPL A;  2PJ9 A;  1K73 2;  1CG2 A;  4P4F A;  1VQL 1;  3PB4 X;  3LD2 A;  4JLY A;  1X3W A;  3PB8 X;  2I3C A;  4QVT A;  4AG9 A;  4X6A I;  1RO5 A;  2JA6 I;  3QWU A;  3D7G A;  3JUW A;  2CTB A;  4II9 A;  3S14 I;  3CPW Y;  3D6W A;  2ZEE A;  5FVJ A;  3V8I A;  2GTI A;  2PE3 A;  5BWA B;  1S5K A;  1K73 1;  2VUG A;  2DPT A;  1VHO A;  4J3G A;  3S9L A;  2ZEM A;  4E31 A;  3TO7 A;  3B2Y A;  1TKJ A;  3K9U A;  3FJU A;  3R9F A;  3J80 f;  3LMS A;  4NGR A;  3K2K A;  1VQP Z;  2PJC A;  2Z0Z A;  3UY5 A;  2WPX A;  3CXC Z;  3QB8 A;  4R6T A;  3PBB A;  4A95 A;  4K30 A;  2JBK A;  3M3Y I;  3WR7 A;  4OC3 A;  1JJ2 Z;  2GU2 A;  4DJL A;  4WJB A;  4JXR A;  2OTJ Z;  5J8F A;  2C1C A;  3LWU A;  1USP A;  4EWC A;  1TKF A;  2JIP A;  2FXF A;  1FT7 A;  4KZT A;  4A30 A;  3OWC A;  1ML8 A;  4HGZ A;  2PJ7 A;  1YQE A;  3B8G A;  4H2K A;  1RO2 A;  4C68 A;  2E2I I;  4OC2 A;  3D7H A;  4U5Y A;  1W2B Z;  4PXE A;  3RZD I;  3SXO A;  3S2D I;  1VQN 1;  2BL1 A;  5GCN A;  4LQG A;  1S7L A;  4XX2 A;  2F5I A;  3NDJ A;  4M6I A;  4AG7 A;  3SJF A;  1A2Z A;  4PSX A;  3VTN A;  1YHQ 1;  5THW A;  2HB6 A;  4CYP A;  3VAT A;  1S60 A;  1EE3 P;  1I1D A;  2I79 A;  2K5T A;  4P4J A;  2AFM A;  4NH1 C;  3IEH A;  3GTM S;  3OW2 Z;  1U6M A;  3IO1 A;  1IYK A;  1Z03 A;  2EK8 A;  3FX6 A;  2OTL 1;  3TOA A;  4P6Y A;  4PV6 A;  1OZP A;  1Q2C A;  1PYT B;  2IJZ A;  2ZW4 A;  1VHS A;  4A3L I;  3D2P A;  3I4M I;  2JS4 A;  2JIR A;  3KIF A;  3TDH B;  2H5M A;  2Z3M A;  4JD6 A;  2Q51 A;  2V45 A;  4X8I A;  3D4U A;  3TOB A;  2BSW A;  2DPS A;  3F8K A;  5JM6 A;  4A3M I;  3VMG A;  1AA6 A;  1YI2 Z;  1I12 A;  2QEC A;  3N7Z A;  3DNS A;  2VPZ A;  1K4J A;  3IR7 A;  2PJ0 A;  4CAX A;  2ZEO A;  3PB6 X;  4M6H A;  2QA4 Z;  3N5F A;  2CTC A;  2V77 A;  4UEE A;  4MCR A;  2VPW A;  1YUK A;  3R9E A;  1VIX A;  2FS5 A;  4KVM E;  4CGP A;  3M4O I;  2VUM I;  2GRE A;  3BLN A;  4M3S A;  5A27 A;  2GE3 A;  4UFX A;  3NE8 A;  4CRY B;  5C88 A;  2HU9 A;  3NH4 A;  5T6B A;  5IX3 A;  4PK2 A;  1BPM A;  2QEX 1;  4BD9 A;  4BIN A;  2AE6 A;  3IWG A;  2DEA A;  4NBB A;  1ON0 A;  2JIM A;  3F0A A;  1RO0 A;  4UIA A;  1KD1 1;  3KHZ A;  1GHE A;  3TT2 A;  3E0K A;  1ZH1 A;  2B4B A;  5E96 A;  1ARL A;  4KOR A;  2PJ6 A;  3RBU A;  3GTG I;  3J80 b;  3KQX A;  1CPS A;  2RIQ A;  1XEB A;  1WJ2 A;  1K83 I;  3F3P C;  5C44 I;  2G0B A;  4R3K A;  1KUX A;  1YLO A;  4KVO E;  3MRU A;  1CM0 A;  4YU9 A;  1Z4R A;  2AFO A;  3GKR A;  2B4D B;  2QLV B;  2EUI A;  3WC6 A;  4NJQ A;  1X0T A;  1UFH A;  1M4L A;  2HV2 A;  3B3V A;  1Z01 A;  3TTH A;  1YIJ Z;  4CAF A;  1LAM A;  3I56 Z;  5IT9 f;  1Q16 A;  5AG4 A;  1NJI 2;  2V8H A;  3BXM A;  1YUA A;  3HOX I;  2RC4 A;  2ZEH A;  1NP6 A;  2HQY A;  1VQO 1;  3D67 A;  1N8R 2;  3FEC A;  2WB1 A;  3D9X A;  3S9M A;  1M4I A;  2B63 I;  1LQL A;  2JMO A;  1Q82 2;  2OZK A;  3CC4 Z;  2PMZ A;  4E32 A;  2PSW A;  3BHX A;  2RHB A;  1FDO A;  5G1Z A;  3S6G A;  2LEX A;  1IOF A;  3TX8 A;  2OZG A;  1KRL A;  4A93 I;  3R9G A;  2WZN A;  3G6E Z;  4MHY A;  1VHE A;  5JH9 A;  1K9M 1;  1M1D A;  3IWE A;  2EO8 A;  3PFO A;  2G9D A;  3QAY A;  2WSA A;  2NVX I;  4OC0 A;  5F48 A;  4L8A A;  4P4I A;  1Z8T A;  5K8M A;  2PDO A;  3CCS 1;  1BLL E;  1IIC A;  2Q0Y A;  1KC8 2;  2EBJ A;  1M90 2;  1VQK 1;  3CC2 1;  4A39 A;  2AFZ A;  1NE9 A;  4KOT A;  1Z8L A;  2B5G B;  3H8F A;  1AMP A;  4F0X A;  4RVG A;  2X7B A;  4NJR A;  3GB0 A;  5CM2 M;  3EY5 A;  3CCQ 1;  3NE7 A;  3CC4 1;  1WWZ A;  5J8C A;  2CNT A;  3CME 1;  1FNO A;  1RTQ A;  4MD9 A;  4E33 A;  1USP B;  3S15 I;  1S7F A;  1NJI 1;  4XNH C;  4UWJ A;  1S72 1;  4P4E A;  1WII A;  4FBE A;  1M90 1;  1NMT A;  4FD5 A;  4K3N A;  3I1U A;  5AG7 A;  4CYN A;  4MHD A;  4KSA A;  4HNW B;  4YWY A;  4KS9 A;  1YJ9 Z;  1N8R 1;  3IF8 A;  3ZJ0 A;  4IUS A;  1QQ9 A;  4OLL A;  3CCL 1;  2R93 I;  2ZPA A;  5I0C A;  2B58 A;  4EME A;  2M48 A;  2W04 A;  4B13 A;  3S6H A;  4P45 A;  2LIY A;  4TNU A;  1K9M 2;  1VGY A;  4KOU A;  1TXR A;  2ZEP A;  4R8F A;  4MCQ A;  4ZX9 A;  2GTH A;  3FED A;  4A33 A;  5DWM A;  2H85 A;  3EER A;  2ZED A;  1MJA A;  4DNC A;  3JRU A;  2PC1 A;  1BO4 A;  3RO0 A;  2POK A;  5D1O B;  3CCR 1;  1Q2Y A;  2OZH A;  4PPZ A;  1I6H I;  3B3S A;  1IOI A;  4DUK A;  1ZG9 A;  4RS2 A;  5AG6 A;  1VQ5 1;  3CCJ Z;  1LRZ A;  3OW2 Y;  1XFO A;  2CF4 A;  2XEJ A;  1M4G A;  4IF5 A;  3I07 A;  2FIW A;  5IT9 b;  3G71 Z;  4CS0 B;  1K8A 1;  1X3Z A;  3PEI A;  2HUZ A;  3BG0 B;  3NH8 A;  1VQ8 Z;  2XEI A;  2CNS A;  3D2L A;  1NSL A;  1QXF A;  4B14 A;  3IJ3 A;  1CX8 A;  1TWH I;  2ZOG A;  4ONW A;  3MZL B;  4B12 A;  3FF3 A;  3D7F A;  4MBU A;  4OIW A;  3BI1 A;  1JJ2 Y;  3FQQ A;  4YGO A;  2R8V A;  5HVG A;  1CP7 A;  1QVF Z;  1N2F A;  1RNI A;  3V38 A;  5IB9 A;  2G2K A;  2Q44 A;  1X10 A;  2PQ8 A;  2V8I A;  2VZY A;  3S2H I;  2CNM A;  2OOX B;  4CRZ B;  2FSR A;  2NAP A;  3D2M A;  4NGM A;  2JR6 A;  2ZEL A;  4UEZ A;  4UF4 A;  1PFT A;  4M85 A;  2ZAE B;  1KZF A;  2Q7B A;  1Q81 1;  4UCP A;  1YJN 1;  5K8O A;  2Q04 A;  1HDQ A;  1VLA A;  2Q4V A;  1IID A;  3CCJ 1;  2PIZ A;  2O28 A;  3SI2 A;  1UWY A;  3KAS A;  4E0A A;  5ELY A;  2IV2 X;  5A2Q f;  4C2Y A;  4G1P A;  4E8O A;  3D3S A;  3KQZ A;  3CCL Z;  2KPI A;  4NSQ A;  4RUH A;  3KI9 A;  3EC4 A;  3GIU A;  4M6G A;  2IZ4 A;  1ARM A;  4PSW A;  2B5G A;  3CCV Z;  3EFA A;  4BBS I;  1TKH A;  3R1K A;  2JNY A;  5LYF A;  1RO4 A;  4GM5 A;  3VWE A;  1RQF A;  5HXD A;  2Z3K A;  3TC8 A;  4RI1 A;  4GS4 A;  3W6X A;  2YNC A;  4R3L A;  4BMH A;  2G3A A;  3J81 b;  4KLW A;  2F4M A;  3B3C A;  4NXY A;  2P0W A;  4DYO A;  4B5P B;  2VBQ A;  2XEF A;  1NUI A;  4MFJ A;  4JZ0 A;  1J4J A;  3LOD A;  5C4J I;  3ZZI A;  3S6K A;  3GTM I;  3RZA A;  2F7V A;  3DGV A;  4F8Z A;  3TFY A;  4E2Z A;  3DDD A;  4QB9 A;  4MJ8 A;  4NGT A;  1ELM P;  3HUV A;  2PVV A;  3H8G A;  2VQY A;  4Q38 A;  2V3V A;  4LQ6 A;  4EVY A;  1JWQ A;  5LRJ A;  4AYB A;  5F46 A;  1R3N A;  2PJ8 A;  4H6Z A;  4MHN A;  2REE A;  4BBR I;  1L0C A;  4NBC A;  3BI0 A;  2YNC C;  1SQH A;  4QTT A;  2V8G A;  2EWB A;  4HKF A;  3S1Q I;  1VQN Z;  1P0H A;  2QR1 B;  3JAM f;  4YFJ A;  1YW6 A;  1Y1V S;  4MFZ A;  5H84 A;  1RLY A;  1LOK A;  1QSO A;  3I55 1;  2OH1 A;  2P6G A;  3FB3 A;  5D1O A;  2Z3N A;  1R57 A;  4A3J I;  2AFW A;  3PP9 A;  4MRI A;  3R96 A;  1IU8 A;  4CL1 A;  3EED A;  4ZYQ A;  2FVG A;  4FAI A;  3CXP A;  1BAV A;  1F2O A;  1QYP A;  4QUS A;  3KHX A;  5LYD A;  4A3C I;  3K7A I;  4ZY2 A;  1ZG8 A;  3DR6 A;  2P6E A;  2V8D A;  1VQL Z;  3B3W A;  1CP6 A;  4OAE A;  5IB0 A;  4KUA A;  4X3R A;  1TFI A;  3SJE A;  3Q87 A;  3GLJ A;  2B4D A;  1N71 A;  2E7Z A;  4A3G I;  3H0G I;  3I56 1;  2FL4 A;  2YND A;  3S16 I;  3G3S A;  4FUU A;  2B3V A;  1DE4 C;  4MI4 A;  2JUB A;  1VQ7 Z;  2P28 A;  4UIB A;  5HVF A;  4ZGY B;  4CYO A;  1YR0 A;  5DWN A;  5LRG A;  1YGH A;  1KUY A;  3GYA A;  4CPA A;  1WCM I;  5FLX f;  2PJA A;  3VWD A;  4NGP A;  1XOV A;  3KZW A;  2OOT A;  4B5P A;  2G3T A;  1Z9U A;  3IU2 A;  4F9U A;  2NVY I;  3C26 A;  3VH9 A;  1VQ6 1;  2FT0 A;  1DTD A;  4H89 A;  3H8E A;  4FD4 A;  1W2B Y;  5C3E I;  4HGY A;  2VZZ A;  4E30 A;  2NVT I;  5AN9 F;  3G4S 1;  4U9Y A;  4CAV A;  5IP7 I;  2ANP A;  2B3U A;  2Q4Y A;  3PGP A;  4A3K I;  3NDI A;  2CXA A;  3VB9 A;  3CCE Z;  1YME A;  2V8J A;  4P44 A;  4A3I I;  4AVB A;  4BXX I;  4PQA A;  4CGM A;  1Q7L A;  5LYI A;  3W91 A;  3GKQ A;  3JVN A;  4E2Y A;  3D8P A;  5G21 A;  2Q43 A;  4KSI A;  4JXQ A;  5D8N A;  2WUU A;  3P5J B;  1Q86 2;  2OZU A;  4BY1 I;  4KOW A;  1F57 A;  2C6G A;  3F3F C;  2ZOF A;  3S1N I;  5KTD A;  1S3Z A;  4NBG A;  3DR8 A;  2Y0M A;  5AGE A;  1VQM 1;  4AVA A;  1M1K 2;  4UCM A;  4S1T A;  5D29 A;  4ZY1 A;  1KQS Y;  1XF8 A;  3BJ8 A;  1B87 A;  4IHM A;  3TO6 A;  1R43 A;  3NH5 A;  3J7A 4;  3CPW Z;  3TE4 A;  3G71 1;  2AKL A;  3EO4 A;  1Y0Y A;  1S7K A;  3HKZ A;  1Z8W A;  2Z3P A;  1YIJ 1;  4A3B I;  2XEG A;  3CZX A;  4A37 A;  5A28 A;  4KOY A;  3TCV A;  2DE6 A;  2OB0 A;  2C6C A;  4KOV A;  3WC5 A;  2C27 A;  1YRE A;  1LAP A;  4MY3 A;  2PJ3 A;  4C2X A;  2E2H I;  2REF A;  4EFD A;  3I55 Z;  3V7Z A;  1Z2L A;  2PRQ A;  4R76 A;  4ONU A;  2YAD A;  2QRD B;  2PIY A;  4MXU A;  2J9A A;  2CIJ A;  5F49 A;  4LUA A;  5CPA A;  1VQ5 Z;  1TF8 A;  1VQP 1;  3HOW I;  2EK9 A;  4Y7N I;  4NBF A;  2OTJ 1;  4E2W A;  3LUS A;  2PR1 A;  4RVD A;  3B7I A;  4GXH A;  4KVX A;  3CCU Z;  2K3R A;  1YJ9 1;  1LAN A;  1XIX A;  3H4Q A;  1QVG Z;  2QEX Z;  1RXT A;  4ZI6 A;  2ZEF A;  3FH4 A;  2QA4 1;  2PJ2 A;  4MCP A;  4MD8 A;  1Q81 2;  4WWV A;  1TWC I;  5ISV A;  2RPR A;  1VQ4 1;  4MON A;  4P4B A;  5LYL A;  1Z02 A;  2BJO A;  2PK7 A;  1V0C A;  2VI7 A;  1L1O C;  3SJX A;  3GTJ I;  3K9T A;  1S7N A;  3GTP I;  3H3V J;  4HPS A;  2GAN A;  2IMO A;  4XPD C;  2VPY A;  1P4N A;  2OU2 A;  2D4P A;  2NSM A;  4A3D I;  2O4H A;  1ELL P;  3U50 C;  3PBE A;  2GLF A;  2PJ5 A;  2AJ6 A;  4CAE A;  5EMI A;  4JJX A;  2VEZ A;  5AG5 A;  4PXD A;  2FIA A;  4OKO A;  2YNE A;  3KIH A;  3GTL I;  3GY9 A;  2Z11 A;  4QBJ A; 
#chains in the Genus database with same CATH homology
 1KD1 1;  5C4J I;  3KHZ A;  2OR4 A;  1ZH1 A;  5FLX b;  1ARL A;  5A2Q b;  3GTM I;  3RZA A;  3WAB A;  2F7V A;  3DGV A;  4F8Z A;  2PJ6 A;  3RBU A;  3GTG I;  3B3T A;  3J80 b;  2BO9 A;  3KQX A;  4E2Z A;  1LCP A;  1CPS A;  2RIQ A;  1Y7E A;  4NGT A;  1K83 I;  3F3P C;  1ELM P;  3HUV A;  3I4N I;  5C44 I;  1YIT Z;  4B6Z A;  2PVV A;  1XMB A;  3VMI A;  3H8G A;  1YLO A;  3L2N A;  3IFU A;  3MRU A;  4YU9 A;  2AFO A;  1IGB A;  3KR5 A;  2QLV B;  3WC6 A;  5LRJ A;  4FWU A;  4NJQ A;  4AYB A;  1TWF I;  1R3N A;  1VQ8 1;  1X0T A;  2JEW A;  2PJ8 A;  4MHN A;  2AFU A;  5LL6 f;  4BBR I;  2YU9 I;  1M4L A;  4NBC A;  3B3V A;  3BI0 A;  1Z01 A;  3HOY I;  4OP4 A;  3CCM Z;  1YIJ Z;  1KC8 1;  3CME Z;  5T64 A;  1NSA A;  2BOA A;  4QTT A;  1LAM A;  2V8G A;  3IC1 A;  3WT4 A;  2EWB A;  3I56 Z;  3KR4 A;  4NBE A;  5IT9 f;  2DE7 A;  2BCO A;  3PRT A;  1QMU A;  3S1Q I;  1VQN Z;  2VL1 A;  1KD1 2;  2E2J I;  2QR1 B;  2C6P A;  4HH4 A;  3JAM f;  4A3F I;  2ZEG A;  4OC1 A;  1NJI 2;  1YW6 A;  2V8H A;  1Y1V S;  1RLY A;  3BXM A;  1YUA A;  1LOK A;  3HOX I;  2RBL A;  1Q7Y 1;  3I55 1;  3WC7 A;  1XBU A;  2ZEH A;  1NP6 A;  5D1O A;  3PO3 S;  1VQO 1;  1ZB8 A;  3D67 A;  1N8R 2;  4A3J I;  2AFW A;  3PB9 X;  4MRI A;  3CCR Z;  2PJ1 A;  3FEC A;  1VQ7 1;  2WB1 A;  3D9X A;  4CL1 A;  3EED A;  4ZYQ A;  3S9M A;  2FVG A;  4FAI A;  1Q7Y 2;  2B63 I;  1LQL A;  2JMO A;  1Q82 2;  3PO2 I;  1VQ4 Z;  2OZK A;  3CC4 Z;  2PMZ A;  4E32 A;  4OC4 A;  3ISZ A;  3SI1 A;  1BAV A;  3BHX A;  1S72 Z;  1ZB9 A;  2RHB A;  3MZK B;  3D66 A;  1DL6 A;  1VQ9 1;  1F2O A;  3TX8 A;  1QYP A;  3KHX A;  3CCV 1;  3RAM A;  5LYD A;  1KRL A;  4Z65 A;  4A93 I;  4A3C I;  4ZY0 A;  3K7A I;  4ZY2 A;  4UEF A;  2WZN A;  1YW4 A;  1TF9 A;  3G6E Z;  1LFW A;  4MHY A;  1ZG8 A;  2F8H A;  2PCU A;  1VHE A;  1Y0R A;  5JH9 A;  3PO3 I;  2V8D A;  1VQL Z;  1K9M 1;  3B3W A;  1CP6 A;  4DQY B;  1S7M A;  5F09 A;  2NVQ I;  3KGQ A;  1YIT 1;  2HF1 A;  1ZLI A;  1ZG7 A;  3CT9 A;  3PFO A;  1QVG Y;  2G9D A;  1I50 I;  4NBA A;  2NVX I;  4OC0 A;  1BPN A;  1K8A 2;  4P4I A;  4X3R A;  1TFI A;  3FKI I;  1YHQ Z;  2GLJ A;  1CPX A;  5K8M A;  1VQ9 Z;  3S1R I;  3CCS 1;  3SJE A;  3Q87 A;  3GLJ A;  1KWM A;  3GTK I;  1BLL E;  1Z5R A;  3HOV I;  2QVP A;  1JQG A;  1TWA I;  5D1P A;  1YJW 1;  1KC8 2;  2Y0S A;  1M90 2;  1VQK 1;  5K8N A;  1QF8 A;  4A3G I;  3H0G I;  3CC2 1;  3I56 1;  4A38 A;  3S16 I;  4A39 A;  2AFZ A;  1PCA A;  5IP9 I;  4FUU A;  1DE4 C;  8CPA A;  3T4N B;  2JUB A;  1VQ7 Z;  2P28 A;  4UIB A;  5HVF A;  1Z8L A;  1ZLH A;  3H8F A;  2RFH A;  3HOU I;  5LRG A;  1AMP A;  3KL9 A;  4RVG A;  4MHZ A;  2AFS A;  4CPA A;  1WCM I;  4IAV A;  4NJR A;  4RV9 A;  2Q4Z A;  5FLX f;  2PJA A;  2RB7 A;  3RZO I;  3GB0 A;  2OTL Z;  5I4M A;  3CD6 1;  4NGP A;  3GUX A;  4MHP A;  2QRE B;  1WW9 A;  5CM2 M;  5HVH A;  4NBD A;  3CCQ 1;  3KZW A;  3CC4 1;  3FMC A;  2OOT A;  3J81 f;  3CC7 Z;  3G6E 1;  3NA6 A;  4P10 A;  4PXB A;  4F9U A;  1M1K 1;  2NVY I;  3CME 1;  1YJW Z;  2J6A A;  1FNO A;  3JAM b;  1RTQ A;  5J1Q A;  4MD9 A;  4E33 A;  2R92 I;  3ESW A;  1USP B;  3S15 I;  3HOZ I;  2OOY B;  3VH9 A;  1NJI 1;  1VQ6 1;  3GTQ I;  1S72 1;  1DTD A;  3BG1 B;  1WII A;  1K73 2;  2PJ9 A;  4P4E A;  3H8E A;  1QVF Y;  4RVF A;  4FBE A;  1XJO A;  1W2B Y;  1M90 1;  1CG2 A;  3CPX A;  4K3N A;  3I1U A;  5C3E I;  4P4F A;  4NOZ A;  4HGY A;  1VQL 1;  4YWY A;  3PB4 X;  4Q7A A;  1X3W A;  4E30 A;  2NVT I;  1YJ9 Z;  1N8R 1;  3IF8 A;  3PB8 X;  5AN9 F;  2VF1 A;  2I3C A;  3G4S 1;  1HEE A;  1QQ9 A;  1VQK Z;  3CD6 Z;  4X6A I;  5IP7 I;  5T67 A;  3CCL 1;  2ANP A;  2JA6 I;  3QWU A;  4A3K I;  2R93 I;  1GYT A;  2R6M A;  3NDI A;  3IWW A;  3VB9 A;  3CCE Z;  1YME A;  3D7G A;  2PVW A;  2V8J A;  4P44 A;  3IFE A;  2CTB A;  3S14 I;  4A3I I;  3GTO I;  3CPW Y;  4BXX I;  4EME A;  3D6W A;  2ZEE A;  4PQA A;  1Q7L A;  4OID A;  1H8L A;  1I3Q I;  5LYI A;  2M48 A;  2W04 A;  3GKQ A;  4A94 A;  2GTI A;  2PE3 A;  4E2Y A;  3CMA 1;  4P45 A;  1K73 1;  2VUG A;  2LIY A;  4OME A;  4TNU A;  3QNV A;  1VHO A;  3S9L A;  2Q43 A;  4KSI A;  2ZEM A;  4E31 A;  1K9M 2;  4QTU A;  3B2Y A;  5D8N A;  1TKJ A;  1VGY A;  3FJU A;  3P5J B;  1Q86 2;  3TE5 B;  1TXR A;  3J80 f;  2ZEP A;  4A3E I;  3LMS A;  4BY1 I;  4MCQ A;  4R8F A;  4NGR A;  1F57 A;  2C6G A;  3F3F C;  2ZOF A;  4ZX9 A;  2GTH A;  3S1N I;  3K2K A;  3FED A;  1VQP Z;  5DS0 A;  2PJC A;  4NBG A;  1HDU A;  2H85 A;  1AYE A;  3EER A;  2M6N A;  2ZED A;  3S9N A;  4MCS A;  3CC2 Z;  3CXC Z;  1VQM 1;  4MMO A;  4R6T A;  3JRU A;  3PBB A;  1M1K 2;  2JBK A;  3D7D A;  3VMH A;  3M3Y I;  4F9V A;  4S1T A;  2POK A;  4OC3 A;  5D1O B;  4E2X A;  3CCR 1;  1JJ2 Z;  3CCS Z;  4PPZ A;  1I6H I;  2GU2 A;  5D29 A;  3B3S A;  4ZY1 A;  1KQS Y;  1VQ6 Z;  4DJL A;  4WJB A;  4IHM A;  7CPA A;  3CCE 1;  1R43 A;  4DUK A;  2OTJ Z;  2QRC B;  1ZG9 A;  4MD7 A;  2JBJ A;  2IZ3 A;  4R7M A;  3NH5 A;  3J7A 4;  3CPW Z;  3DLJ A;  2C1C A;  1VQ5 1;  3LWU A;  3G71 1;  2AKL A;  1USP A;  4EWC A;  3CCJ Z;  1TKF A;  3OW2 Y;  3HLP A;  2PJ4 A;  1P9N A;  1FT7 A;  1XFO A;  2CF4 A;  1Y0Y A;  3CCQ Z;  2XEJ A;  3HKZ A;  3IIB A;  3I07 A;  1CBX A;  1ML8 A;  4HGZ A;  3G71 Z;  5IT9 b;  2PJ7 A;  1YIJ 1;  1X3Z A;  1RO2 A;  1K8A 1;  4A3B I;  3PEI A;  2E2I I;  4H2K A;  4IK2 A;  2E9H A;  4OC2 A;  4RVH A;  3D7H A;  3GCF A;  2XEG A;  2HC9 A;  5FLM I;  1YSJ A;  2KI7 B;  3BG0 B;  1YI2 1;  1W2B Z;  4A37 A;  3NH8 A;  4PXC A;  4PXE A;  2DE6 A;  3RZD I;  1VQ8 Z;  4Y52 I;  2C6C A;  2XEI A;  4P4D A;  4NB9 A;  3WC5 A;  1TWG I;  3S2D I;  2ABZ A;  1VQN 1;  2JA8 I;  1LAP A;  3CC7 1;  3IJ3 A;  3S1M I;  1CX8 A;  1TWH I;  4LQG A;  4MH4 A;  2ZOG A;  4ONW A;  3MZL B;  4XX2 A;  3FF3 A;  2PJ3 A;  3CCM 1;  3D7F A;  5K8P A;  1KQS Z;  3NDJ A;  2PJB A;  4OIW A;  2E2H I;  3SJF A;  3BI1 A;  2V8K A;  1JJ2 Y;  4EFD A;  3VTN A;  1YHQ 1;  3FQQ A;  5THW A;  3I55 Z;  2HB6 A;  3V7Z A;  5HVG A;  1CP7 A;  1XRY A;  1QVF Z;  1Z2L A;  2PRQ A;  3PFE A;  4R76 A;  2YAD A;  3VAT A;  1N2F A;  1R9T I;  2JA5 I;  1EE3 P;  2QRD B;  1RNI A;  2LFU A;  3V38 A;  5IB9 A;  2G2K A;  2PIY A;  4P4J A;  2AFM A;  4NGN A;  4NH1 C;  3IEH A;  3GTM S;  3OW2 Z;  4MXU A;  2J9A A;  2QKD A;  2P3Y A;  3IO1 A;  1VQM Z;  3FEE A;  2V8I A;  4NB8 A;  2CIJ A;  4NBH A;  3S2H I;  2ZEN A;  4JYW A;  2OOX B;  1Z03 A;  2EK8 A;  3FX6 A;  2OTL 1;  5CPA A;  1VQ5 Z;  1Q82 1;  4NGM A;  1TF8 A;  1VQP 1;  2JR6 A;  3HOW I;  1YJN Z;  2EK9 A;  2ZEL A;  4P6Y A;  4Y7N I;  4UEZ A;  4UF4 A;  1PFT A;  4NBF A;  2OTJ 1;  3CPA A;  4E2W A;  2ZAE B;  4DK1 A;  3LUS A;  4RVD A;  1OBR A;  3B7I A;  5JGF A;  1Q81 1;  3T8W A;  1YJN 1;  5K8O A;  1PYT B;  2IJZ A;  1HDQ A;  1VLA A;  3CCU Z;  4A3L I;  2K3R A;  1Q86 1;  1YJ9 1;  2JS4 A;  3I4M I;  1LAN A;  3KIF A;  3TDH B;  2F4O A;  3CMA Z;  3CCJ 1;  2PIZ A;  2JA7 I;  3SI2 A;  2IQ6 A;  1UWY A;  2Q51 A;  3S17 I;  4X8I A;  3D4U A;  3KAS A;  2RT9 A;  4ZX8 A;  1QVG Z;  5ELY A;  2QEX Z;  5JM6 A;  5A2Q f;  1JWH C;  4ZI6 A;  2ZEF A;  2PM9 A;  4EWT A;  2W03 A;  3FH4 A;  4G1P A;  4A3M I;  3VMG A;  3CQZ I;  2QA4 1;  2PJ2 A;  1YI2 Z;  4MCP A;  4MD8 A;  4NGS A;  1Q81 2;  5C4X I;  3MN8 A;  3KQZ A;  5CBM A;  4WWV A;  3CXC Y;  1F2P A;  3CCL Z;  2AFX A;  1TWC I;  2KPI A;  2RPR A;  1VQ4 1;  3FQM A;  3G4S Z;  2DE5 A;  4MON A;  4P4B A;  3ISX A;  2WYR A;  3VAR A;  3B35 A;  2PJ0 A;  3CDX A;  5LYL A;  2QYV A;  1Z02 A;  4RUH A;  3CCU 1;  3KI9 A;  4O23 A;  2ZEO A;  4AXV A;  6CPA A;  2O53 A;  2IZ4 A;  3PB6 X;  2EGT A;  4RS4 A;  2K5R A;  1ARM A;  3SJG A;  3IX0 A;  1Y1W I;  3PB7 X;  2BJO A;  2PK7 A;  3CCV Z;  4X2T A;  3SI0 A;  4BBS I;  1TKH A;  2QA4 Z;  3N5F A;  2CTC A;  1L1O C;  2JNY A;  3GTJ I;  2V77 A;  3K9T A;  4UEE A;  3SJX A;  5LYF A;  3GTP I;  1RO4 A;  4GM5 A;  4MCR A;  1RQF A;  3H3V J;  5HXD A;  1YUK A;  4OC5 A;  4NFR A;  2R7Z I;  1VIX A;  3TC8 A;  3NFZ A;  2WAQ A;  3M4O I;  2IMO A;  2VUM I;  2GRE A;  5LRK A;  2NSM A;  4A3D I;  3FVL A;  2O4H A;  1ELL P;  3U50 C;  4BY7 I;  2HU9 A;  3MON A;  3NH4 A;  5T6B A;  3PBE A;  2GLF A;  1SFO I;  2PJ5 A;  3J81 b;  4W9Y A;  2QJ8 A;  1VQO Z;  1BPM A;  2V8V A;  2F4M A;  3B3C A;  4TWE A;  2QEX 1;  2NYQ A;  4PXD A;  4BD9 A;  4DYO A;  1IY7 A;  1Y1V I;  4OKO A;  2DEA A;  2XEF A;  4NBB A;  3D68 A;  3KIH A;  1NUI A;  4DGL A;  3GTL I;  4UIA A;  1RO0 A;  4JZ0 A;  4NGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...