2Q51A

Ensemble refinement of the protein crystal structure of an aspartoacylase from homo sapiens
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 61
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q51A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q51A01
3PFOA 2QVPA 2ZEOA 3CPXA 3D7GA 5THWA 5LRGA 4NJQA 3GB0A 1YLOA 3IC1A 4MHNA 4OMEA 1YW4A 4EMEA 4P4EA 4X2TA 1H8LA 4OP4A 3T8WA 1VHOA 3JRUA 1DTDA 1LAPA 4OC3A 1ARMA 4UIBA 4X8IA 3FX6A 4ZI6A 2HC9A 3B35A 4ZYQA 2OR4A 4FAIA 4P4BA 4ZX9A 3FVLA 1DE4C 4PXCA 2QJ8A 1LANA 2C6GA 2PE3A 4P10A 4YWYA 2JBJA 4A37A 2ZENA 3SI1A 2HB6A 4ZY1A 4NGMA 4R76A 4O23A 2XEJA 3KI9A 5K8OA 2PJCA 4FUUA 4RUHA 2DEAA 2V8DA 2ZEEA 1ELLP 2PIYA 3NA6A 1LCPA 5LYIA 3ISZA 3B3VA 1TKHA 3KQZA 2PJ7A 5DS0A 3KHXA 2IJZA 4R8FA 2CTBA 2O53A 4H2KA 2V77A 4OC5A 2IQ6A 3V38A 3WC6A 6CPAA 4PQAA 2GLFA 2EK9A 5LYFA 4P4JA 3B3WA 3S9LA 3NH4A 2FVGA 3D67A 3WT4A 1CBXA 4FWUA 2Q43A 3SJEA 3PB6X 4P6YA 1VHEA 2O4HA 2C1CA 3H8GA 3VATA 4PXBA 1LOKA 2CTCA 3IFEA 4G1PA 1F2OA 2GU2A 4MXUA 2ZEFA 1TXRA 4A38A 1JQGA 1OBRA 2PJ1A 4P44A 3FECA 5HVGA 4OKOA 5CBMA 4IAVA 4K3NA 1Y0YA 4MCQA 2PJ8A 1AMPA 1LAMA 3KZWA 1XRYA 2PVWA 4P4IA 3D7DA 1Q7LA 2ZOFA 3KR4A 2NYQA 3B3TA 4MHYA 2BCOA 4MCSA 2F8HA 1TKFA 4AXVA 4OC1A 3D7FA 3IO1A 3SI0A 1YMEA 3D4UA 4ZY0A 2JBKA 5JH9A 3SJFA 1M4LA 3CPAA 3H8EA 3KR5A 2PJ2A 3BI1A 2ZEHA 3QNVA 3D68A 2AFSA 2WZNA 1QMUA 4B6ZA 3RBUA 4GM5A 2ANPA 3D7HA 3NH8A 1XBUA 4JZ0A 1CPSA 1XMBA 1ELMP 1CP6A 4MMOA 3SJGA 2PIZA 4P4FA 4PPZA 3TX8A 2PJ0A 3PBEA 1HEEA 8CPAA 5JM6A 1VGYA 3DGVA 2ZEPA 3B7IA 4PXEA 1R43A 1FT7A 2AFWA 3IWWA 3RZAA 1HDUA 1LFWA 5F09A 3SI2A 3BI0A 5K8MA 1TF9A 5IB9A 3HUVA 7CPAA 1QQ9A 5K8NA 4DUKA 1ARLA 3KHZA 2PJ5A 3S9NA 2ZOGA 1ZLIA 1CX8A 1TF8A 1RTQA 4F9UA 4OC2A 2PVVA 5HVHA 4F9VA 4P45A 4OIDA 3B3CA 1CPXA 1ZG9A 4YU9A 5I4MA 3N5FA 4NFRA 2XEGA 4DYOA 2J9AA 5HVFA 5K8PA 3NH5A 4P4DA 1Z8LA 2CF4A 3HLPA 1CG2A 2ZEDA 3K2KA 4DJLA 2JEWA 4A94A 2AFOA 3CDXA 1GYTA 2EK8A 2XEIA 1Z2LA 2V8VA 2ZEMA 5LYDA 2EWBA 5J1QA 4IHMA 5ELYA 4NGTA 3DLJA 4F8ZA 5JGFA 4TWEA 3IEHA 5D8NA 1YW6A 2ZEGA 1CP7A 3PBBA 1UWYA 4PXDA 4MHZA 4NGSA 3I1UA 1VIXA 1Y7EA 3PFEA 3LMSA 4WWVA 3RAMA 2PJBA 4IK2A 2PJ6A 4A39A 2PJ9A 2AFUA 3CT9A 1HDQA 2Q51A 1EE3P 3GLJA 2ABZA 3KL9A 2ZELA 3L2NA 3IJ3A 2IMOA 4EFDA 2PJ3A 4WJBA 2G9DA 3PB8X 4NGQA 4MRIA 1BPMA 3BXMA 2POKA 3B2YA 1KWMA 3IIBA 1Y0RA 4UF4A 2NSMA 2PJ4A 4ZX8A 1BAVA 3FEEA 1YSJA 1ZLHA 2I3CA 1F57A 3FF3A 2AFXA 1IY7A 1BPNA 4ZY2A 4UEEA 4LQGA 2WYRA 2OOTA 1Z5RA 1R3NA 3VH9A 2GREA 3TC8A 5CPAA 3ISXA 4UEFA 3LWUA 3D66A 4Z65A 4NGRA 4X3RA 3WC5A 3GUXA 1AYEA 1PCAA 2RB7A 2RFHA 5LYLA 4KSIA 2V8GA 2C6PA 4CPAA 3FEDA 5D29A 4EWTA 4FBEA 1FNOA 1XJOA 4NGPA 4UEZA 3KGQA 2PCUA 1BLLE 2C6CA 1TKJA 1ZG8A 4R7MA 3WC7A 3K9TA 2F7VA 3KQXA 1ZG7A 2XEFA 4JYWA 2GLJA 4MHPA 4MCPA 2CIJA 5HXDA 4ONWA 1IGBA 4OC4A 3PB9X 4NJRA 3FJUA 5LRKA 2BO9A 2V8HA 3FH4A 2BOAA 4UIAA 1F2PA 2QYVA 2PJAA 1NSAA 3MN8A 4R6TA 5LRJA 2VL1A 3V7ZA 4W9YA 3PB4X 4BD9A 3BHXA 3PRTA 3VARA 3PEIA 2AFMA 2AFZA 4OC0A 3NFZA 4MCRA 3PB7X 1PYTB 3MRUA 4TNUA 4OIWA 3WABA 3S9MA 4NGNA 3H8FA 3KASA 2Q4ZA 1XFOA 3FMCA 3SJXA 3B3SA 2PRQA 4Q7AA
chains in the Genus database with same CATH superfamily
3G4S1 5THWA 1PU9A 1USPA 3D3SA 1N8R2 2DPSA 3IC1A 3CCLZ 1YW4A 4E8OA 3J81b 1W2BY 4X6AI 1K83I 4P4EA 1XEBA 4X2TA 1QVFY 4OP4A 3RNZA 1A2ZA 1VHOA 3JRUA 4OC3A 2ZW7A 2OOXB 1Y8CA 3S1MI 2EO8A 4UIBA 3W91A 3CMA1 4A3EI 3VWEA 2YU9I 4C68A 1QSOA 4ZI6A 2HC9A 2VUMI 4ZYQA 2OR4A 4P4BA 4ZX9A 3CCQZ 3SXNA 2P28A 2VQYA 1Y1WI 2YNCC 1K8A1 4A3CI 3PGPA 5FLXb 1LANA 2PE3A 3D9XA 2PJCA 2B5GB 4RUHA 1MJBA 2PIYA 2P6GA 1TKHA 3FNCA 2IQ6A 2VF1A 3V38A 4HGZA 1Q822 1VQL1 2GLFA 5LYFA 3S17I 3S9LA 2R7ZI 2V8IA 2FVGA 1YJNZ 2OZKA 1RLYA 3EO4A 4HGYA 4FWUA 1M4GA 3PB6X 3SJEA 2PMZA 4R87A 1Z01A 5F46A 1F2OA 3TO7A 1TXRA 2IL4A 1JQGA 2PJ1A 4A3KI 3QAYA 4JLYA 4XPKA 5HVGA 3G6EZ 2NVQI 3LD2A 1AMPA 4FD5A 3D6WA 5J8CA 1Y1VI 1Q812 3KZWA 4YRHA 4BBSI 2PVWA 2HF1A 5BWAB 3FKII 1S7MA 2BCOA 1TWGI 2PQ8A 3CCMZ 4AXVA 4OC1A 5FVJA 3D7FA 3SI0A 1YMEA 4ZY0A 1KC82 1KRLA 1M4IA 3GKQA 3G8WA 3CCQ1 3D68A 2AFSA 3KKWA 3RBUA 2EBJA 3D7HA 1RQFA 3NH8A 1IB1E 1XMBA 1P4NA 2LIYA 4HNXB 1FDIA 3TX8A 8CPAA 1X0TA 1YJWZ 2FXFA 4A33A 4MFPA 1B87A 2Z0ZA 4OLLA 2PC1A 3IWWA 3RZAA 2GTIA 1P0HA 5F09A 3SI2A 3IU1A 3H5ZA 2OZGA 2Z3OA 3IU2A 4A2ZA 5IB9A 3H3VJ 7CPAA 4KLVA 3JVNA 2B4DA 1QQ9A 4DUKA 1ARLA 4A3DI 3TOBA 2ZOGA 2RT9A 2RPRA 1TF8A 5G21A 1ZO0A 5HVHA 1YIT1 4P45A 3GY9A 3TOAA 1CPXA 1ZG9A 1VQO1 2Q7BA 5I4MA 3N5FA 3HOYI 2J9AA 3TO9A 2GTHA 5K8PA 2IZ4A 2Q7SA 2CF4A 4HKFA 1K9M2 1CG2A 2AFOA 4RVFA 4E30A 4B5PA 1YJN1 2V8VA 2E2HI 4XNHC 1XE4A 1N71A 3GCFA 2F5IA 5ELYA 2LFUA 3DLJA 3MZLB 4RVHA 2VPZA 4KVOE 4CYQA 4PXDA 3R9FA 3I1UA 1YJ91 5IP7I 1BOBA 3LMSA 3R96A 3RAMA 1ZB9A 1VQ51 2R7HA 4Q36A 2AFUA 1HDQA 4DNCA 2Q51A 2JA7I 4KOVA 1EE3P 1Z9UA 2FIWA 4MFZA 1YVOA 2JA8I 3L2NA 5AG5A 4EFDA 2PJ3A 1IICA 5IT9b 2G9DA 3PB8X 4HNYB 1IOFA 4NGQA 4MRIA 1BPMA 2POKA 5I0CA 3GTJI 2J6AA 5E96A 2HV2A 4A3II 1ML8A 4KORA 3IIBA 1Y0RA 3JAMb 2PJ4A 4RN7A 1Q16A 3QB8A 1I50I 4UFWA 2QMLA 5C4JI 3EEDA 3FF3A 3GTKI 2AFXA 1QVGZ 1PFTA 1Y1VS 4ZY2A 4UEEA 2GIVA 2ZAEB 3D2PA 4MD9A 1Q861 3G4SZ 5D1PA 3LWUA 4CAEA 4KUAA 4HH4A 3WC5A 2WSAA 3HOXI 4MONA 2RFHA 1XMTA 2PDOA 2G3TA 5D29A 4EWTA 4MFLA 3EY5A 4Q38A 4M6HA 4NGPA 2PCUA 1TKJA 1ZG8A 3TE4A 3CXPA 1ZG7A 5AN9F 3UY5A 4CGMA 4JYWA 3HKZA 4MHPA 2ZW4A 3N7ZA 5JPHA 3F5BA 3MONA 3I55Z 3S16I 5J8FA 2BOAA 4UIAA 3CMEZ 2E2II 2ODFA 3MN8A 4R57A 4BMHA 4R6TA 5EC4A 4BD9A 3PRTA 3VARA 3PEIA 4QBJA 3PB7X 3H4QA 3MRUA 4OIWA 2OTLZ 4NGNA 3H8FA 4AG7A 1NE9A 3SJXA 4KZTA 2VBQA 3PFOA 2QVPA 3CPXA 3KIHA 3D7GA 4PV6A 2YNDA 1U6MA 5ISVA 4CGLA 4MHNA 2DPTA 2AYDA 3GTMI 2GE3A 3IF8A 3IFUA 2KPIA 1TIQA 2QEX1 5F47A 1KD12 4AVAA 1I6HI 4MFQA 3DSBA 4AB7A 2REEA 2QKDA 2YGWA 2Z3PA 3CXCY 2PK7A 2EUIA 4II9A 4PXCA 1K732 2JIQA 2QJ8A 2C6GA 4A37A 2JBJA 2I00A 4ZY1A 4O23A 1IYKA 2XEJA 5K8OA 3P5JB 3F8KA 2DEAA 3MGDA 2V8DA 2ZEEA 4E33A 2ARHA 1NSLA 3CME1 3NA6A 5LYIA 3ISZA 3B3VA 5KTCA 1S7NA 5A27A 1QSRA 1S7FA 2IJZA 2O53A 4H2KA 2V77A 2OU2A 4IUSA 2KCWA 5DWNA 1YIJ1 3B3WA 4H6UA 3CCJZ 3FBUA 3IWEA 3WT4A 1YUKA 3I3GA 1XF8A 4P6YA 4YGOA 1VHEA 3TTHA 3FYNA 3H8GA 2PM9A 2AE6A 3VATA 2BSWA 2FE7A 4E2ZA 4B12A 4F0YA 2Y0SA 4PXBA 2WUUA 1VQM1 1VQLZ 1CJWA 1TWAI 3IFEA 4KOXA 2GANA 3I551 3OW2Z 1R9TI 1I12A 4OKOA 3CPWZ 4PK3A 4OAEA 2JR6A 4KOYA 4MCQA 4C2XA 4R3KA 2QLVB 3TCVA 2NMTA 4KOWA 3CCE1 4ZGYB 1Q7LA 3KR4A 1Y9WA 3B3TA 3FRMA 4MHYA 1TWHI 2PSWA 4C7IA 3D4UA 4UFVA 4MBUA 2QA4Z 3EFAA 2VI7A 5JH9A 1KUVA 3SJFA 3GTOI 1YVKA 4F6AA 3J80b 3BJ8A 4GS4A 4RI1A 1GHEA 2H5MA 2PJ2A 4BY7I 3BI1A 2ZEHA 2JDCA 3QNVA 3IGRA 1RO2A 2VZZA 4MD7A 2B63I 3JUWA 4GM5A 4R3LA 4UCNA 4JZ0A 1ELMP 4FD6A 4MMOA 3CXCZ 2PIZA 4P4FA 1X12A 1Z8TA 2CY2A 3G3SA 1VQ5Z 4A3GI 1TWCI 1VGYA 5HH1A 3TFYA 1HDUA 3OWCA 5K8MA 3HUVA 3RO0A 4NCZA 2OTL1 2B58A 4M85A 4MY0A 3S9NA 2PJ5A 3VTNA 3RZDI 1CX8A 4AVCA 1AUGA 4E0AA 5A2Qb 1I3QI 3OW2Y 1M44A 1Z02A 4OIDA 1BO4A 4NOZA 1FY7A 5D1OA 1Q811 2J8NA 5G20A 2JEWA 4R9MA 1NJI1 3J80f 3CCJ1 5LL6f 2P3YA 2EWBA 2RIQA 4CRYB 3T9YA 4NGTA 2PR1A 5H84A 4A32A 3LUSA 4TWEA 4Y52I 3NDIA 5D8NA 1YW6A 2V8KA 1UWYA 2Q4VA 1VKCA 4NGSA 1VIXA 4BBRI 3PFEA 4WWVA 1Q7Y2 4U9YA 1LQLA 3CC2Z 3CCM1 3GLJA 3NE7A 3I4NI 2F4MA 2IMOA 4QVTA 2NVYI 1JWQA 3S1RI 3BXMA 3D2LA 3K7AI 2Q0YA 2Z10A 2K3RA 1M1K1 3RZOI 1KWMA 3CC41 1Q2YA 1M4DA 4KOSA 2FL4A 3F0AA 3BG1B 5D1OB 1M1K2 4KSAA 3FB3A 4LUAA 2OTJ1 1QVFZ 1F57A 2R1IA 1BPNA 3CXSA 3B8GA 4LQGA 2DF5A 2OOTA 1Z5RA 1R3NA 2EVNA 3S14I 3HOUI 1K9M1 5CPAA 1ZH1A 4UEFA 4Z65A 4KS9A 3I56Z 4FBEA 1P9NA 3DDDA 3I9SA 2QEXZ 3SHPA 1NP6A 4U5YA 1L1OC 3WC7A 1K8A2 3K9TA 1S7LA 2Q4YA 2XEFA 1RNIA 1LRZA 3E0KA 4MCPA 1M902 1VQMZ 4CRZB 1YJW1 3BJ7A 1XOVA 3FJUA 5LRKA 4H6ZA 1FDOA 2BO9A 1SIWA 1F2PA 1YX0A 2CXAA 2QYVA 4Y49C 3S2DI 2VL1A 4B5OA 4Y7NI 3V7ZA 3EC4A 4M6IA 2J8MA 3PP9A 3J81f 3NFZA 2DE6A 2IV2X 2OH1A 3WABA 3S9MA 1XIXA 5A2Qf 3FMCA 3GTMS 1Q862 3HOWI 4BINA 3B3SA 2NAPA 2RC4A 2ZEOA 4MHDA 5T67A 2FS5A 4NJQA 3GB0A 4KOUA 3J7A4 4RS2A 4OMEA 3P2HA 5FLMI 2NVTI 1JWHC 5H86A 1LAPA 2ZPAA 2WB1A 1TFIA 4E2WA 4X8IA 4QUSA 3I561 3FX6A 3CC4Z 2JA6I 4AG9A 4UCMA 1VQKZ 2A4NA 4UCPA 3FVLA 3D2MA 1VQ91 2IZ3A 4BXXI 2QR1B 4C2YA 1KQSY 3NE8A 4LQ6A 4NGMA 2WPWA 4DK1A 1S3ZA 1QSNA 2VZYA 4CAVA 3KQZA 2OB0A 4EVYA 4R8FA 3ZZIA 1YGHA 1VQ61 2PRBA 2FSRA 4CGPA 3DNSA 3GYAA 1M1DA 3CC7Z 4YFJA 5C4XI 1S60A 2C1CA 1Q2CA 3G71Z 1ZB8A 2JIPA 2HUZA 1K4JA 4KSFA 4MJ8A 3FXTA 2M48A 4G1PA 1KUXA 4MXUA 2ZEFA 3BLNA 4NB9A 4A38A 3FQQA 2Z3LA 2DE5A 2VPXA 5G22A 4CYPA 5CBMA 4K3NA 4E31A 1Y0YA 2B4DB 4NB8A 3R95A 1LAMA 3TT2A 1YI21 4LX9A 1VQOZ 2BUEA 2OOYB 2NYQA 4A30A 2Z3NA 1V0CA 2G0BA 4NXYA 3IO1A 4E2AA 2K5RA 1Q2DA 2JBKA 3CZXA 4PK2A 1M4LA 3PZJA 4ONUA 1YLEA 3PO3S 2GFQA 3I07A 2WZNA 2ANPA 1XBUA 1CP6A 3IWGA 4JWPA 2PJ0A 3PBEA 2R6MA 3C26A 4C7HA 3DGVA 3S1NI 3CC21 4ZBGA 3B7IA 4A3JI 1R43A 4NF1A 1YITZ 3BI0A 4A31A 1TF9A 4B11A 3IR7A 2JEVA 5K8NA 1VQK1 3S6FA 1X3ZA 3D8PA 4XPDC 4NSQA 3CPWY 1RTQA 1W2BZ 3CCL1 1SFOI 4FD7A 5C44I 5IP9I 2B5GA 1Z03A 3CMAZ 4F9VA 4CS0B 1PUAA 3W6XA 3H0GI 4NFRA 5HVFA 2OTJZ 4P4DA 3DR6A 1Z8LA 5A28A 3S6HA 4A3FI 4DJLA 3RYOA 1MK4A 4A94A 3BG0B 3T4NB 2XEIA 3K9UA 2E2JI 4OADA 1Y7RA 1Z4RA 2I79A 1WW9A 4PSXA 2X7BA 4CGNA 2VUGA 2Q44A 5JGFA 4NBCA 3S1QI 4DQYB 3CCV1 4RVGA 3S15I 1RXTA 2OZUA 3CXQA 2QREB 2ZEGA 3PBBA 5EMIA 4MHZA 1VQ9Z 3DR8A 2VPYA 2DXQA 1Y7EA 2R93I 1KZFA 3GIUA 4IK2A 1VQ41 4ORFA 1WJ2A 2H85A 2PJ9A 2DE7A 2G2KA 1M901 5JQ4A 3KL9A 3VMGA 4MY3A 3QWUA 2G3AA 4NBHA 1QSMA 3IJ3A 5AG4A 4WJBA 4E32A 2VPWA 3CQZI 4EWCA 4KLWA 2OZHA 1YI2Z 1KC81 4B5PB 3FIXA 2FCKA 4PSWA 4KVXA 1R57A 3A9LA 1TWFI 3U50C 1QSTA 4UWJA 1YSJA 1ZLHA 2I3CA 4QB9A 2YADA 4RVDA 2QRCB 2QECA 4A3LI 2J8RA 1JJ2Z 5F49A 3CCEZ 2E9HA 3LACA 2V45A 1Z8XA 3JAMf 4B10A 3JTKA 2GREA 3ISXA 2KI7B 1J4JA 1WK4A 3D66A 4NGRA 5F48A 4X5KA 1MJAA 2FIAA 5DWMA 5LYLA 4CAFA 2JIOA 1RO5A 3S6GA 5C88A 3CC71 3KGQA 1BLLE 2C6CA 2JMOA 2BEIA 1KUYA 2F7VA 4MFKA 3ESWA 3KQXA 2QA41 1Q821 2JA5I 2C27A 2Z3KA 4ONWA 3S6KA 1Y9KA 2PR8A 4NJRA 1YHQZ 2Z3MA 3CD61 1VQ7Z 2V8HA 5AG7A 3FH4A 2JIMA 1Z4EA 4UWIA 2PJAA 4MI4A 5AGEA 4NBAA 2F4OA 4M6GA 4E2YA 3BHXA 2AFMA 2AFZA 2VXKA 4OC0A 2JDDA 4Y49B 4MCRA 2D4OA 3W6SA 4TNUA 3KASA 2Q4ZA 1XFOA 2Q04A 3PO2I 4MFJA 5EBVA 4Q7AA 4CAWA 5LRGA 2RHBA 4HPSA 1YLOA 4BBHA 3FQMA 4QTTA 5IX3A 4UFXA 4EMEA 1IU8A 1VQ4Z 4B13A 1H8LA 3T8WA 4A95A 4HNWB 1USPB 1VQ81 3P2FA 1DTDA 4M3SA 1ARMA 3F3FC 2R98A 3Q87A 2M6NA 2JLMA 2YNCA 1X3WA 3VWDA 3B35A 4GXHA 1WWZA 4FAIA 1ON0A 1QYPA 1DE4C 1WCMI 1K731 2QRDB 4QC6A 1QXFA 4NBEA 4P10A 4YWYA 4CGOA 2ZENA 3SI1A 2HB6A 4R76A 1QF8A 2R92I 3KI9A 4MH4A 1VHSA 4JD6A 4S1TA 4FUUA 3T90A 1IOIA 4CAXA 1ELLP 1LCPA 2PJ7A 5DS0A 3KHXA 4A93I 2CTBA 1IIDA 1S5KA 1VQPZ 4OC5A 3WC6A 1AA6A 4A3BI 4NBFA 6CPAA 4KOTA 4PQAA 2EK9A 2WAQA 4P4JA 4XX2A 3CCU1 3NH4A 1VQ71 3D67A 2QIRA 1CBXA 5CNPA 2Q43A 2O4HA 4L8AA 2HQYA 4XNHB 1LOKA 3GTPI 2CTCA 1YIJZ 4K30A 2GU2A 1MJ9A 1OBRA 4P44A 3EXNA 2Y0MA 3FECA 2ZXVA 4NBDA 4I49A 3LODA 4IAVA 1NUIA 2K5TA 2PJ8A 1XRYA 4P4IA 3D7DA 2ZOFA 3IX0A 4MCSA 2F8HA 1TKFA 2W03A 3CCRZ 2ZW5A 3GKRA 4AVBA 3CCVZ 4B14A 3EERA 3CPAA 3H8EA 3KR5A 2AJ6A 2B3VA 5HMNA 5IB0A 4KVME 2BL1A 2V3VA 3VMIA 1QMUA 4B6ZA 1B6BA 2VEZA 1KQSZ 3TE5B 4DGLA 4C2ZA 1CPSA 3M4OI 1DL6A 1UFHA 5C3EI 3GTLI 3SJGA 4PPZA 3CD6Z 1VQP1 1HEEA 5JM6A 4CYOA 2ZEPA 5IT9f 4PXEA 4F0XA 2AFWA 1FT7A 2O28A 1LFWA 2P0WA 1YREA 3PO3I 1S72Z 2CNSA 3S2HI 4UA3A 2P6FA 2HU9A 2D4PA 3KHZA 1ZLIA 4JXQA 4F9UA 1Q7Y1 1I1DA 4OC2A 2PVVA 2YNEA 3B3CA 4YU9A 4NBBA 2R8VA 3VMHA 4J3GA 2XEGA 4DYOA 2BJOA 3NH5A 4XPDB 1OZPA 3HLPA 2ZEDA 1VQ8Z 3K2KA 3CDXA 1Z8WA 3SXOA 1GYTA 2EK8A 2WPXA 1WZNA 1Z2LA 2CNMA 1NJI2 2ZEMA 5LYDA 2RBLA 5J1QA 4IHMA 1YR0A 1SQHA 3CCR1 1X10A 4F8ZA 4NBGA 1YUAA 3IEHA 3I4MI 4U9ZA 4MD8A 3HOZI 2P6EA 1NMTA 1CP7A 2REFA 3NDJA 3KIFA 2ATRA 4RV9A 1CM0A 1N8R1 1VQNZ 3CCS1 2PJBA 2PJ6A 4A39A 4RS4A 3CT9A 2AKLA 3WR7A 2ABZA 4CL1A 4CYNA 1YK3A 2ZELA 2B4BA 2JUBA 4QTUA 4XPLA 1RO0A 1KD11 3B2YA 5KTDA 4UF4A 2NSMA 4ZX8A 1BAVA 3FEEA 5FLXf 3GTQI 3QAHA 2JNYA 2B3UA 3G711 1IY7A 1JJ2Y 2WYRA 4JXRA 1QVGY 3R9EA 5GCNA 5C82A 1WIIA 4UBRA 4KUBA 2EGTA 3M3YI 3VH9A 4H89A 5KTAA 5T64A 3TC8A 2E7ZA 3ZJ0A 4X3RA 3GUXA 1IYLA 4A3MI 2ZW6A 5IV0A 1AYEA 1PCAA 2RB7A 3VB9A 4KSIA 5G1ZA 2V8GA 2LEXA 2C6PA 4CPAA 3FEDA 1S721 3V8IA 3GTGI 1FNOA 4JJXA 1XJOA 4UEZA 3CCUZ 3R9GA 4R7MA 3F3PC 1YJ9Z 2FT0A 3CCSZ 3HOVI 2GLJA 2Z11A 2CIJA 5HXDA 1RO4A 1S7KA 1IGBA 4OC4A 1N2FA 2W04A 3PB9X 4BY1I 1YQEA 4NH1C 3TO6A 1NSAA 1VQN1 4NEXA 5LRJA 5AG6A 4AYBA 4W9YA 3PB4X 3R1KA 2CNTA 1YHQ1 3TDHB 4FD4A 2JS4A 1VLAA 4E2XA 1PYTB 1L0CA 4IF5A 5T6BA 2NVXI 3G6E1 3MZKB 1I21A 4L89A 2JIRA 1VQ6Z 2PRQA 2V8JA 5CM2M
chains in the Genus database with same CATH topology
3PFOA 2QVPA 3G4S1 3KIHA 2ZEOA 3CPXA 3D7GA 5LRGA 5THWA 1USPA 2RHBA 5T67A 4NJQA 1N8R2 3GB0A 1YLOA 3IC1A 3FQMA 3J7A4 4MHNA 4QTTA 3CCLZ 3GTMI 4OMEA 1YW4A 3J81b 1W2BY 4X6AI 4EMEA 1K83I 4P4EA 4X2TA 1QVFY 1VQ4Z 5FLMI 1H8LA 4OP4A 3IF8A 3T8WA 1VHOA 3IFUA 2NVTI 1JWHC 1USPB 2KPIA 3JRUA 1VQ81 1DTDA 1LAPA 4OC3A 1ARMA 2OOXB 2QEX1 2WB1A 1TFIA 4E2WA 1KD12 3S1MI 4UIBA 4X8IA 3F3FC 3CMA1 3Q87A 2M6NA 4A3EI 2YU9I 1X3WA 3I561 1I6HI 3FX6A 3CC4Z 2JA6I 4ZI6A 2HC9A 3B35A 2QKDA 2VUMI 4ZYQA 2OR4A 4FAIA 1VQKZ 4P4BA 4ZX9A 3CCQZ 2P28A 3FVLA 1QYPA 1DE4C 3CXCY 1VQ91 2IZ3A 1Y1WI 2PK7A 4BXXI 1WCMI 1K731 2QR1B 4PXCA 2QRDB 1K8A1 1K732 4NBEA 1KQSY 4A3CI 2QJ8A 5FLXb 1LANA 2C6GA 2PE3A 4P10A 4YWYA 3D9XA 2JBJA 4A37A 2ZENA 3SI1A 2HB6A 4ZY1A 4NGMA 4R76A 1QF8A 4O23A 2XEJA 2R92I 3KI9A 5K8OA 4MH4A 3P5JB 4DK1A 4S1TA 2PJCA 4FUUA 4RUHA 2DEAA 2V8DA 2ZEEA 4E33A 1ELLP 3CME1 2PIYA 1LCPA 3NA6A 5LYIA 3ISZA 3B3VA 1TKHA 3KQZA 2PJ7A 5DS0A 3KHXA 4A93I 2IJZA 4R8FA 2CTBA 2O53A 4H2KA 2V77A 1VQPZ 4OC5A 2IQ6A 2VF1A 1VQ61 3V38A 3WC6A 4A3BI 4HGZA 4NBFA 6CPAA 1Q822 1VQL1 4PQAA 2GLFA 2EK9A 5LYFA 2WAQA 4P4JA 1YIJ1 4XX2A 3S17I 3CCU1 3CC7Z 3NH4A 3B3WA 3S9LA 2R7ZI 2V8IA 2FVGA 1VQ71 1YJNZ 3CCJZ 2OZKA 1RLYA 3D67A 3WT4A 1YUKA 1CBXA 4HGYA 4FWUA 2Q43A 3SJEA 3PB6X 5C4XI 4P6YA 1VHEA 2O4HA 2C1CA 3H8GA 2PM9A 3VATA 2PMZA 3G71Z 1ZB8A 4E2ZA 2Y0SA 4PXBA 1LOKA 1VQM1 1Z01A 3GTPI 1VQLZ 2CTCA 2M48A 3IFEA 1TWAI 1YIJZ 4G1PA 1F2OA 2GU2A 4MXUA 2ZEFA 4NB9A 1TXRA 4A38A 3I551 1JQGA 3OW2Z 1OBRA 2PJ1A 4A3KI 4P44A 3FECA 3FQQA 1R9TI 5HVGA 4OKOA 4NBDA 3G6EZ 3CPWZ 2DE5A 5CBMA 4IAVA 2NVQI 4K3NA 1NUIA 4E31A 2JR6A 1Y0YA 4MCQA 2PJ8A 4NB8A 1AMPA 3D6WA 2QLVB 1Y1VI 1LAMA 1Q812 1XRYA 3KZWA 4BBSI 1YI21 3CCE1 2PVWA 2HF1A 1VQOZ 4P4IA 3D7DA 1Q7LA 2ZOFA 3FKII 3KR4A 2OOYB 1S7MA 2NYQA 3B3TA 3IX0A 4MHYA 2BCOA 1TWGI 4MCSA 2F8HA 1TKFA 3CCMZ 4AXVA 1TWHI 4OC1A 3D7FA 2W03A 3IO1A 3SI0A 1YMEA 3CCRZ 3D4UA 2K5RA 4ZY0A 2JBKA 2QA4Z 5JH9A 1KC82 3CCVZ 3SJFA 3GTOI 3EERA 1M4LA 3CPAA 1KRLA 3J80b 3H8EA 3KR5A 2PJ2A 3GKQA 4BY7I 3BI1A 3PO3S 2ZEHA 3QNVA 3I07A 1RO2A 3CCQ1 3D68A 2AFSA 4MD7A 3VMIA 1QMUA 2B63I 2WZNA 3RBUA 4GM5A 4B6ZA 2ANPA 1KQSZ 3TE5B 4DGLA 3D7HA 1RQFA 3NH8A 1XBUA 4JZ0A 1CPSA 3M4OI 1DL6A 1XMBA 1ELMP 1CP6A 4MMOA 2LIYA 5C3EI 3GTLI 3SJGA 3CXCZ 2PIZA 3CD6Z 1VQP1 4P4FA 4PPZA 2PJ0A 3TX8A 3PBEA 1HEEA 2R6MA 8CPAA 1VQ5Z 4A3GI 1TWCI 1X0TA 5JM6A 1VGYA 1YJWZ 3DGVA 3S1NI 3CC21 2ZEPA 5IT9f 3B7IA 4PXEA 4A3JI 1R43A 1FT7A 2AFWA 3IWWA 3RZAA 1HDUA 2GTIA 1LFWA 5F09A 1YITZ 3SI2A 3BI0A 5K8MA 1TF9A 3PO3I 5IB9A 3HUVA 3H3VJ 7CPAA 2OTL1 1S72Z 1QQ9A 5K8NA 3S2HI 4DUKA 1ARLA 1VQK1 2HU9A 4A3DI 3KHZA 1X3ZA 2PJ5A 3S9NA 3VTNA 2ZOGA 3RZDI 2RT9A 1ZLIA 2RPRA 1CX8A 1TF8A 3CPWY 1RTQA 1W2BZ 4F9UA 3CCL1 1Q7Y1 1SFOI 5C44I 5A2Qb 1I3QI 5IP9I 4OC2A 2PVVA 5HVHA 3OW2Y 1YIT1 1Z03A 3CMAZ 4F9VA 1Z02A 4OIDA 4P45A 3B3CA 1CPXA 1ZG9A 1VQO1 4YU9A 4NBBA 4NOZA 5I4MA 3N5FA 3VMHA 3H0GI 4NFRA 2XEGA 4DYOA 3HOYI 2J9AA 5HVFA 2GTHA 2OTJZ 5K8PA 2BJOA 3NH5A 2IZ4A 4P4DA 1Z8LA 4A3FI 5D1OA 1Q811 2CF4A 3HLPA 1K9M2 1CG2A 2ZEDA 1VQ8Z 3K2KA 4DJLA 2JEWA 4A94A 2AFOA 4RVFA 3BG0B 3CDXA 3T4NB 4E30A 1NJI1 1GYTA 2EK8A 3J80f 3CCJ1 1YJN1 2XEIA 5LL6f 1Z2LA 2V8VA 2E2HI 1NJI2 2ZEMA 2P3YA 5LYDA 2EWBA 2RIQA 2E2JI 2RBLA 5J1QA 4IHMA 1WW9A 3GCFA 5ELYA 4NGTA 3CCR1 2LFUA 3DLJA 3MZLB 2VUGA 4F8ZA 5JGFA 4NBGA 3LUSA 1YUAA 4NBCA 4DQYB 3CCV1 4RVGA 3I4MI 3S15I 3S1QI 3IEHA 4RVHA 4Y52I 4MD8A 3HOZI 2QREB 3NDIA 5D8NA 1YW6A 2ZEGA 2V8KA 1CP7A 3PBBA 1UWYA 4PXDA 4MHZA 1VQ9Z 4NGSA 3I1UA 3NDJA 3KIFA 1VIXA 4RV9A 1YJ91 1Y7EA 2R93I 1N8R1 4BBRI 5IP7I 1VQNZ 3PFEA 3LMSA 4WWVA 1Q7Y2 3RAMA 3CCS1 1ZB9A 1VQ51 2PJBA 4IK2A 2PJ6A 1VQ41 4A39A 4RS4A 2H85A 2PJ9A 2AFUA 3CT9A 1LQLA 3CC2Z 3CCM1 1HDQA 2DE7A 2AKLA 2Q51A 2G2KA 1M901 2JA7I 1EE3P 3GLJA 2ABZA 4CL1A 3KL9A 3VMGA 2ZELA 2JA8I 3QWUA 4NBHA 3I4NI 3L2NA 2F4MA 3IJ3A 2IMOA 4EFDA 2PJ3A 4WJBA 5IT9b 2G9DA 3PB8X 2NVYI 3S1RI 4NGQA 4MRIA 2JUBA 4QTUA 4E32A 1BPMA 3K7AI 2POKA 3BXMA 3CQZI 4EWCA 1RO0A 1YI2Z 1KD11 1KC81 2K3RA 3GTJI 2J6AA 1M1K1 3B2YA 4A3II 1ML8A 3RZOI 1KWMA 3CC41 1TWFI 3U50C 1Y0RA 3JAMb 3IIBA 2NSMA 2PJ4A 4UF4A 3BG1B 5D1OB 1M1K2 1I50I 4ZX8A 1BAVA 5C4JI 3FEEA 3EEDA 5FLXf 1YSJA 1ZLHA 2I3CA 3GTQI 2OTJ1 2JNYA 1QVFZ 1F57A 3FF3A 3G711 3GTKI 2AFXA 1IY7A 1QVGZ 1PFTA 1Y1VS 2YADA 1BPNA 1JJ2Y 4ZY2A 4RVDA 4UEEA 2QRCB 4LQGA 2WYRA 4A3LI 1JJ2Z 2ZAEB 3CCEZ 2E9HA 1QVGY 2OOTA 4MD9A 1Q861 1WIIA 2EGTA 3G4SZ 1R3NA 1Z5RA 3M3YI 3JAMf 3S14I 3VH9A 5T64A 3HOUI 5D1PA 2GREA 3TC8A 1K9M1 5CPAA 3ISXA 2KI7B 1ZH1A 4UEFA 3LWUA 3D66A 4Z65A 4NGRA 4X3RA 4HH4A 3WC5A 3GUXA 3HOXI 4A3MI 1AYEA 1PCAA 2RB7A 4MONA 3VB9A 2RFHA 5LYLA 4KSIA 2V8GA 2C6PA 3I56Z 3FEDA 5D29A 1S721 4CPAA 4EWTA 4FBEA 3GTGI 1P9NA 1FNOA 2QEXZ 1XJOA 4NGPA 3CCUZ 3CC71 4UEZA 3KGQA 1NP6A 2PCUA 1BLLE 2C6CA 1TKJA 2JMOA 1ZG8A 4R7MA 3F3PC 1L1OC 3WC7A 1K8A2 3K9TA 2F7VA 1YJ9Z 3ESWA 3KQXA 1ZG7A 2QA41 1Q821 2XEFA 2JA5I 5AN9F 1RNIA 3CCSZ 3HOVI 4JYWA 2GLJA 3HKZA 4MHPA 4MCPA 2CIJA 5HXDA 1M902 1RO4A 1VQMZ 4ONWA 1IGBA 1YJW1 4OC4A 1N2FA 2W04A 3PB9X 4NJRA 3FJUA 3MONA 5LRKA 1YHQZ 3I55Z 2BO9A 3S16I 3CD61 4BY1I 1VQ7Z 2V8HA 3FH4A 4NH1C 2BOAA 4UIAA 1F2PA 2QYVA 3CMEZ 2PJAA 2E2II 1NSAA 3MN8A 1VQN1 3S2DI 4R6TA 5LRJA 2VL1A 4NBAA 4Y7NI 2F4OA 3V7ZA 4AYBA 4W9YA 4E2YA 3PB4X 4BD9A 3BHXA 3PRTA 3VARA 3PEIA 2AFMA 4TWEA 2AFZA 1YHQ1 3J81f 3TDHB 4OC0A 3NFZA 2DE6A 2JS4A 4MCRA 3PB7X 1VLAA 4E2XA 4TNUA 1PYTB 3MRUA 4OIWA 2OTLZ 3WABA 5T6BA 2NVXI 3S9MA 4NGNA 5A2Qf 3H8FA 3G6E1 3MZKB 3KASA 2Q4ZA 1XFOA 3FMCA 3GTMS 3SJXA 1Q862 3HOWI 1VQ6Z 3B3SA 3PO2I 2PRQA 2V8JA 5CM2M 4Q7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFO A;  2QVP A;  2ZEO A;  3CPX A;  3D7G A;  5THW A;  5LRG A;  4NJQ A;  3GB0 A;  1YLO A;  3IC1 A;  4MHN A;  4OME A;  1YW4 A;  4EME A;  4P4E A;  4X2T A;  1H8L A;  4OP4 A;  3T8W A;  1VHO A;  3JRU A;  1DTD A;  1LAP A;  4OC3 A;  1ARM A;  4UIB A;  4X8I A;  3FX6 A;  4ZI6 A;  2HC9 A;  3B35 A;  4ZYQ A;  2OR4 A;  4FAI A;  4P4B A;  4ZX9 A;  3FVL A;  1DE4 C;  4PXC A;  2QJ8 A;  1LAN A;  2C6G A;  2PE3 A;  4P10 A;  4YWY A;  2JBJ A;  4A37 A;  2ZEN A;  3SI1 A;  2HB6 A;  4ZY1 A;  4NGM A;  4R76 A;  4O23 A;  2XEJ A;  3KI9 A;  5K8O A;  2PJC A;  4FUU A;  4RUH A;  2DEA A;  2V8D A;  2ZEE A;  1ELL P;  2PIY A;  3NA6 A;  1LCP A;  5LYI A;  3ISZ A;  3B3V A;  1TKH A;  3KQZ A;  2PJ7 A;  5DS0 A;  3KHX A;  2IJZ A;  4R8F A;  2CTB A;  2O53 A;  4H2K A;  2V77 A;  4OC5 A;  2IQ6 A;  3V38 A;  3WC6 A;  6CPA A;  4PQA A;  2GLF A;  2EK9 A;  5LYF A;  4P4J A;  3B3W A;  3S9L A;  3NH4 A;  2FVG A;  3D67 A;  3WT4 A;  1CBX A;  4FWU A;  2Q43 A;  3SJE A;  3PB6 X;  4P6Y A;  1VHE A;  2O4H A;  2C1C A;  3H8G A;  3VAT A;  4PXB A;  1LOK A;  2CTC A;  3IFE A;  4G1P A;  1F2O A;  2GU2 A;  4MXU A;  2ZEF A;  1TXR A;  4A38 A;  1JQG A;  1OBR A;  2PJ1 A;  4P44 A;  3FEC A;  5HVG A;  4OKO A;  5CBM A;  4IAV A;  4K3N A;  1Y0Y A;  4MCQ A;  2PJ8 A;  1AMP A;  1LAM A;  3KZW A;  1XRY A;  2PVW A;  4P4I A;  3D7D A;  1Q7L A;  2ZOF A;  3KR4 A;  2NYQ A;  3B3T A;  4MHY A;  2BCO A;  4MCS A;  2F8H A;  1TKF A;  4AXV A;  4OC1 A;  3D7F A;  3IO1 A;  3SI0 A;  1YME A;  3D4U A;  4ZY0 A;  2JBK A;  5JH9 A;  3SJF A;  1M4L A;  3CPA A;  3H8E A;  3KR5 A;  2PJ2 A;  3BI1 A;  2ZEH A;  3QNV A;  3D68 A;  2AFS A;  2WZN A;  1QMU A;  4B6Z A;  3RBU A;  4GM5 A;  2ANP A;  3D7H A;  3NH8 A;  1XBU A;  4JZ0 A;  1CPS A;  1XMB A;  1ELM P;  1CP6 A;  4MMO A;  3SJG A;  2PIZ A;  4P4F A;  4PPZ A;  3TX8 A;  2PJ0 A;  3PBE A;  1HEE A;  8CPA A;  5JM6 A;  1VGY A;  3DGV A;  2ZEP A;  3B7I A;  4PXE A;  1R43 A;  1FT7 A;  2AFW A;  3IWW A;  3RZA A;  1HDU A;  1LFW A;  5F09 A;  3SI2 A;  3BI0 A;  5K8M A;  1TF9 A;  5IB9 A;  3HUV A;  7CPA A;  1QQ9 A;  5K8N A;  4DUK A;  1ARL A;  3KHZ A;  2PJ5 A;  3S9N A;  2ZOG A;  1ZLI A;  1CX8 A;  1TF8 A;  1RTQ A;  4F9U A;  4OC2 A;  2PVV A;  5HVH A;  4F9V A;  4P45 A;  4OID A;  3B3C A;  1CPX A;  1ZG9 A;  4YU9 A;  5I4M A;  3N5F A;  4NFR A;  2XEG A;  4DYO A;  2J9A A;  5HVF A;  5K8P A;  3NH5 A;  4P4D A;  1Z8L A;  2CF4 A;  3HLP A;  1CG2 A;  2ZED A;  3K2K A;  4DJL A;  2JEW A;  4A94 A;  2AFO A;  3CDX A;  1GYT A;  2EK8 A;  2XEI A;  1Z2L A;  2V8V A;  2ZEM A;  5LYD A;  2EWB A;  5J1Q A;  4IHM A;  5ELY A;  4NGT A;  3DLJ A;  4F8Z A;  5JGF A;  4TWE A;  3IEH A;  5D8N A;  1YW6 A;  2ZEG A;  1CP7 A;  3PBB A;  1UWY A;  4PXD A;  4MHZ A;  4NGS A;  3I1U A;  1VIX A;  1Y7E A;  3PFE A;  3LMS A;  4WWV A;  3RAM A;  2PJB A;  4IK2 A;  2PJ6 A;  4A39 A;  2PJ9 A;  2AFU A;  3CT9 A;  1HDQ A;  2Q51 A;  1EE3 P;  3GLJ A;  2ABZ A;  3KL9 A;  2ZEL A;  3L2N A;  3IJ3 A;  2IMO A;  4EFD A;  2PJ3 A;  4WJB A;  2G9D A;  3PB8 X;  4NGQ A;  4MRI A;  1BPM A;  3BXM A;  2POK A;  3B2Y A;  1KWM A;  3IIB A;  1Y0R A;  4UF4 A;  2NSM A;  2PJ4 A;  4ZX8 A;  1BAV A;  3FEE A;  1YSJ A;  1ZLH A;  2I3C A;  1F57 A;  3FF3 A;  2AFX A;  1IY7 A;  1BPN A;  4ZY2 A;  4UEE A;  4LQG A;  2WYR A;  2OOT A;  1Z5R A;  1R3N A;  3VH9 A;  2GRE A;  3TC8 A;  5CPA A;  3ISX A;  4UEF A;  3LWU A;  3D66 A;  4Z65 A;  4NGR A;  4X3R A;  3WC5 A;  3GUX A;  1AYE A;  1PCA A;  2RB7 A;  2RFH A;  5LYL A;  4KSI A;  2V8G A;  2C6P A;  4CPA A;  3FED A;  5D29 A;  4EWT A;  4FBE A;  1FNO A;  1XJO A;  4NGP A;  4UEZ A;  3KGQ A;  2PCU A;  1BLL E;  2C6C A;  1TKJ A;  1ZG8 A;  4R7M A;  3WC7 A;  3K9T A;  2F7V A;  3KQX A;  1ZG7 A;  2XEF A;  4JYW A;  2GLJ A;  4MHP A;  4MCP A;  2CIJ A;  5HXD A;  4ONW A;  1IGB A;  4OC4 A;  3PB9 X;  4NJR A;  3FJU A;  5LRK A;  2BO9 A;  2V8H A;  3FH4 A;  2BOA A;  4UIA A;  1F2P A;  2QYV A;  2PJA A;  1NSA A;  3MN8 A;  4R6T A;  5LRJ A;  2VL1 A;  3V7Z A;  4W9Y A;  3PB4 X;  4BD9 A;  3BHX A;  3PRT A;  3VAR A;  3PEI A;  2AFM A;  2AFZ A;  4OC0 A;  3NFZ A;  4MCR A;  3PB7 X;  1PYT B;  3MRU A;  4TNU A;  4OIW A;  3WAB A;  3S9M A;  4NGN A;  3H8F A;  3KAS A;  2Q4Z A;  1XFO A;  3FMC A;  3SJX A;  3B3S A;  2PRQ A;  4Q7A A; 
#chains in the Genus database with same CATH topology
 3G4S 1;  5THW A;  1PU9 A;  1USP A;  3D3S A;  1N8R 2;  2DPS A;  3IC1 A;  3CCL Z;  1YW4 A;  4E8O A;  3J81 b;  1W2B Y;  4X6A I;  1K83 I;  4P4E A;  1XEB A;  4X2T A;  1QVF Y;  4OP4 A;  3RNZ A;  1A2Z A;  1VHO A;  3JRU A;  4OC3 A;  2ZW7 A;  2OOX B;  1Y8C A;  3S1M I;  2EO8 A;  4UIB A;  3W91 A;  3CMA 1;  4A3E I;  3VWE A;  2YU9 I;  4C68 A;  1QSO A;  4ZI6 A;  2HC9 A;  2VUM I;  4ZYQ A;  2OR4 A;  4P4B A;  4ZX9 A;  3CCQ Z;  3SXN A;  2P28 A;  2VQY A;  1Y1W I;  2YNC C;  1K8A 1;  4A3C I;  3PGP A;  5FLX b;  1LAN A;  2PE3 A;  3D9X A;  2PJC A;  2B5G B;  4RUH A;  1MJB A;  2PIY A;  2P6G A;  1TKH A;  3FNC A;  2IQ6 A;  2VF1 A;  3V38 A;  4HGZ A;  1Q82 2;  1VQL 1;  2GLF A;  5LYF A;  3S17 I;  3S9L A;  2R7Z I;  2V8I A;  2FVG A;  1YJN Z;  2OZK A;  1RLY A;  3EO4 A;  4HGY A;  4FWU A;  1M4G A;  3PB6 X;  3SJE A;  2PMZ A;  4R87 A;  1Z01 A;  5F46 A;  1F2O A;  3TO7 A;  1TXR A;  2IL4 A;  1JQG A;  2PJ1 A;  4A3K I;  3QAY A;  4JLY A;  4XPK A;  5HVG A;  3G6E Z;  2NVQ I;  3LD2 A;  1AMP A;  4FD5 A;  3D6W A;  5J8C A;  1Y1V I;  1Q81 2;  3KZW A;  4YRH A;  4BBS I;  2PVW A;  2HF1 A;  5BWA B;  3FKI I;  1S7M A;  2BCO A;  1TWG I;  2PQ8 A;  3CCM Z;  4AXV A;  4OC1 A;  5FVJ A;  3D7F A;  3SI0 A;  1YME A;  4ZY0 A;  1KC8 2;  1KRL A;  1M4I A;  3GKQ A;  3G8W A;  3CCQ 1;  3D68 A;  2AFS A;  3KKW A;  3RBU A;  2EBJ A;  3D7H A;  1RQF A;  3NH8 A;  1IB1 E;  1XMB A;  1P4N A;  2LIY A;  4HNX B;  1FDI A;  3TX8 A;  8CPA A;  1X0T A;  1YJW Z;  2FXF A;  4A33 A;  4MFP A;  1B87 A;  2Z0Z A;  4OLL A;  2PC1 A;  3IWW A;  3RZA A;  2GTI A;  1P0H A;  5F09 A;  3SI2 A;  3IU1 A;  3H5Z A;  2OZG A;  2Z3O A;  3IU2 A;  4A2Z A;  5IB9 A;  3H3V J;  7CPA A;  4KLV A;  3JVN A;  2B4D A;  1QQ9 A;  4DUK A;  1ARL A;  4A3D I;  3TOB A;  2ZOG A;  2RT9 A;  2RPR A;  1TF8 A;  5G21 A;  1ZO0 A;  5HVH A;  1YIT 1;  4P45 A;  3GY9 A;  3TOA A;  1CPX A;  1ZG9 A;  1VQO 1;  2Q7B A;  5I4M A;  3N5F A;  3HOY I;  2J9A A;  3TO9 A;  2GTH A;  5K8P A;  2IZ4 A;  2Q7S A;  2CF4 A;  4HKF A;  1K9M 2;  1CG2 A;  2AFO A;  4RVF A;  4E30 A;  4B5P A;  1YJN 1;  2V8V A;  2E2H I;  4XNH C;  1XE4 A;  1N71 A;  3GCF A;  2F5I A;  5ELY A;  2LFU A;  3DLJ A;  3MZL B;  4RVH A;  2VPZ A;  4KVO E;  4CYQ A;  4PXD A;  3R9F A;  3I1U A;  1YJ9 1;  5IP7 I;  1BOB A;  3LMS A;  3R96 A;  3RAM A;  1ZB9 A;  1VQ5 1;  2R7H A;  4Q36 A;  2AFU A;  1HDQ A;  4DNC A;  2Q51 A;  2JA7 I;  4KOV A;  1EE3 P;  1Z9U A;  2FIW A;  4MFZ A;  1YVO A;  2JA8 I;  3L2N A;  5AG5 A;  4EFD A;  2PJ3 A;  1IIC A;  5IT9 b;  2G9D A;  3PB8 X;  4HNY B;  1IOF A;  4NGQ A;  4MRI A;  1BPM A;  2POK A;  5I0C A;  3GTJ I;  2J6A A;  5E96 A;  2HV2 A;  4A3I I;  1ML8 A;  4KOR A;  3IIB A;  1Y0R A;  3JAM b;  2PJ4 A;  4RN7 A;  1Q16 A;  3QB8 A;  1I50 I;  4UFW A;  2QML A;  5C4J I;  3EED A;  3FF3 A;  3GTK I;  2AFX A;  1QVG Z;  1PFT A;  1Y1V S;  4ZY2 A;  4UEE A;  2GIV A;  2ZAE B;  3D2P A;  4MD9 A;  1Q86 1;  3G4S Z;  5D1P A;  3LWU A;  4CAE A;  4KUA A;  4HH4 A;  3WC5 A;  2WSA A;  3HOX I;  4MON A;  2RFH A;  1XMT A;  2PDO A;  2G3T A;  5D29 A;  4EWT A;  4MFL A;  3EY5 A;  4Q38 A;  4M6H A;  4NGP A;  2PCU A;  1TKJ A;  1ZG8 A;  3TE4 A;  3CXP A;  1ZG7 A;  5AN9 F;  3UY5 A;  4CGM A;  4JYW A;  3HKZ A;  4MHP A;  2ZW4 A;  3N7Z A;  5JPH A;  3F5B A;  3MON A;  3I55 Z;  3S16 I;  5J8F A;  2BOA A;  4UIA A;  3CME Z;  2E2I I;  2ODF A;  3MN8 A;  4R57 A;  4BMH A;  4R6T A;  5EC4 A;  4BD9 A;  3PRT A;  3VAR A;  3PEI A;  4QBJ A;  3PB7 X;  3H4Q A;  3MRU A;  4OIW A;  2OTL Z;  4NGN A;  3H8F A;  4AG7 A;  1NE9 A;  3SJX A;  4KZT A;  2VBQ A;  3PFO A;  2QVP A;  3CPX A;  3KIH A;  3D7G A;  4PV6 A;  2YND A;  1U6M A;  5ISV A;  4CGL A;  4MHN A;  2DPT A;  2AYD A;  3GTM I;  2GE3 A;  3IF8 A;  3IFU A;  2KPI A;  1TIQ A;  2QEX 1;  5F47 A;  1KD1 2;  4AVA A;  1I6H I;  4MFQ A;  3DSB A;  4AB7 A;  2REE A;  2QKD A;  2YGW A;  2Z3P A;  3CXC Y;  2PK7 A;  2EUI A;  4II9 A;  4PXC A;  1K73 2;  2JIQ A;  2QJ8 A;  2C6G A;  4A37 A;  2JBJ A;  2I00 A;  4ZY1 A;  4O23 A;  1IYK A;  2XEJ A;  5K8O A;  3P5J B;  3F8K A;  2DEA A;  3MGD A;  2V8D A;  2ZEE A;  4E33 A;  2ARH A;  1NSL A;  3CME 1;  3NA6 A;  5LYI A;  3ISZ A;  3B3V A;  5KTC A;  1S7N A;  5A27 A;  1QSR A;  1S7F A;  2IJZ A;  2O53 A;  4H2K A;  2V77 A;  2OU2 A;  4IUS A;  2KCW A;  5DWN A;  1YIJ 1;  3B3W A;  4H6U A;  3CCJ Z;  3FBU A;  3IWE A;  3WT4 A;  1YUK A;  3I3G A;  1XF8 A;  4P6Y A;  4YGO A;  1VHE A;  3TTH A;  3FYN A;  3H8G A;  2PM9 A;  2AE6 A;  3VAT A;  2BSW A;  2FE7 A;  4E2Z A;  4B12 A;  4F0Y A;  2Y0S A;  4PXB A;  2WUU A;  1VQM 1;  1VQL Z;  1CJW A;  1TWA I;  3IFE A;  4KOX A;  2GAN A;  3I55 1;  3OW2 Z;  1R9T I;  1I12 A;  4OKO A;  3CPW Z;  4PK3 A;  4OAE A;  2JR6 A;  4KOY A;  4MCQ A;  4C2X A;  4R3K A;  2QLV B;  3TCV A;  2NMT A;  4KOW A;  3CCE 1;  4ZGY B;  1Q7L A;  3KR4 A;  1Y9W A;  3B3T A;  3FRM A;  4MHY A;  1TWH I;  2PSW A;  4C7I A;  3D4U A;  4UFV A;  4MBU A;  2QA4 Z;  3EFA A;  2VI7 A;  5JH9 A;  1KUV A;  3SJF A;  3GTO I;  1YVK A;  4F6A A;  3J80 b;  3BJ8 A;  4GS4 A;  4RI1 A;  1GHE A;  2H5M A;  2PJ2 A;  4BY7 I;  3BI1 A;  2ZEH A;  2JDC A;  3QNV A;  3IGR A;  1RO2 A;  2VZZ A;  4MD7 A;  2B63 I;  3JUW A;  4GM5 A;  4R3L A;  4UCN A;  4JZ0 A;  1ELM P;  4FD6 A;  4MMO A;  3CXC Z;  2PIZ A;  4P4F A;  1X12 A;  1Z8T A;  2CY2 A;  3G3S A;  1VQ5 Z;  4A3G I;  1TWC I;  1VGY A;  5HH1 A;  3TFY A;  1HDU A;  3OWC A;  5K8M A;  3HUV A;  3RO0 A;  4NCZ A;  2OTL 1;  2B58 A;  4M85 A;  4MY0 A;  3S9N A;  2PJ5 A;  3VTN A;  3RZD I;  1CX8 A;  4AVC A;  1AUG A;  4E0A A;  5A2Q b;  1I3Q I;  3OW2 Y;  1M44 A;  1Z02 A;  4OID A;  1BO4 A;  4NOZ A;  1FY7 A;  5D1O A;  1Q81 1;  2J8N A;  5G20 A;  2JEW A;  4R9M A;  1NJI 1;  3J80 f;  3CCJ 1;  5LL6 f;  2P3Y A;  2EWB A;  2RIQ A;  4CRY B;  3T9Y A;  4NGT A;  2PR1 A;  5H84 A;  4A32 A;  3LUS A;  4TWE A;  4Y52 I;  3NDI A;  5D8N A;  1YW6 A;  2V8K A;  1UWY A;  2Q4V A;  1VKC A;  4NGS A;  1VIX A;  4BBR I;  3PFE A;  4WWV A;  1Q7Y 2;  4U9Y A;  1LQL A;  3CC2 Z;  3CCM 1;  3GLJ A;  3NE7 A;  3I4N I;  2F4M A;  2IMO A;  4QVT A;  2NVY I;  1JWQ A;  3S1R I;  3BXM A;  3D2L A;  3K7A I;  2Q0Y A;  2Z10 A;  2K3R A;  1M1K 1;  3RZO I;  1KWM A;  3CC4 1;  1Q2Y A;  1M4D A;  4KOS A;  2FL4 A;  3F0A A;  3BG1 B;  5D1O B;  1M1K 2;  4KSA A;  3FB3 A;  4LUA A;  2OTJ 1;  1QVF Z;  1F57 A;  2R1I A;  1BPN A;  3CXS A;  3B8G A;  4LQG A;  2DF5 A;  2OOT A;  1Z5R A;  1R3N A;  2EVN A;  3S14 I;  3HOU I;  1K9M 1;  5CPA A;  1ZH1 A;  4UEF A;  4Z65 A;  4KS9 A;  3I56 Z;  4FBE A;  1P9N A;  3DDD A;  3I9S A;  2QEX Z;  3SHP A;  1NP6 A;  4U5Y A;  1L1O C;  3WC7 A;  1K8A 2;  3K9T A;  1S7L A;  2Q4Y A;  2XEF A;  1RNI A;  1LRZ A;  3E0K A;  4MCP A;  1M90 2;  1VQM Z;  4CRZ B;  1YJW 1;  3BJ7 A;  1XOV A;  3FJU A;  5LRK A;  4H6Z A;  1FDO A;  2BO9 A;  1SIW A;  1F2P A;  1YX0 A;  2CXA A;  2QYV A;  4Y49 C;  3S2D I;  2VL1 A;  4B5O A;  4Y7N I;  3V7Z A;  3EC4 A;  4M6I A;  2J8M A;  3PP9 A;  3J81 f;  3NFZ A;  2DE6 A;  2IV2 X;  2OH1 A;  3WAB A;  3S9M A;  1XIX A;  5A2Q f;  3FMC A;  3GTM S;  1Q86 2;  3HOW I;  4BIN A;  3B3S A;  2NAP A;  2RC4 A;  2ZEO A;  4MHD A;  5T67 A;  2FS5 A;  4NJQ A;  3GB0 A;  4KOU A;  3J7A 4;  4RS2 A;  4OME A;  3P2H A;  5FLM I;  2NVT I;  1JWH C;  5H86 A;  1LAP A;  2ZPA A;  2WB1 A;  1TFI A;  4E2W A;  4X8I A;  4QUS A;  3I56 1;  3FX6 A;  3CC4 Z;  2JA6 I;  4AG9 A;  4UCM A;  1VQK Z;  2A4N A;  4UCP A;  3FVL A;  3D2M A;  1VQ9 1;  2IZ3 A;  4BXX I;  2QR1 B;  4C2Y A;  1KQS Y;  3NE8 A;  4LQ6 A;  4NGM A;  2WPW A;  4DK1 A;  1S3Z A;  1QSN A;  2VZY A;  4CAV A;  3KQZ A;  2OB0 A;  4EVY A;  4R8F A;  3ZZI A;  1YGH A;  1VQ6 1;  2PRB A;  2FSR A;  4CGP A;  3DNS A;  3GYA A;  1M1D A;  3CC7 Z;  4YFJ A;  5C4X I;  1S60 A;  2C1C A;  1Q2C A;  3G71 Z;  1ZB8 A;  2JIP A;  2HUZ A;  1K4J A;  4KSF A;  4MJ8 A;  3FXT A;  2M48 A;  4G1P A;  1KUX A;  4MXU A;  2ZEF A;  3BLN A;  4NB9 A;  4A38 A;  3FQQ A;  2Z3L A;  2DE5 A;  2VPX A;  5G22 A;  4CYP A;  5CBM A;  4K3N A;  4E31 A;  1Y0Y A;  2B4D B;  4NB8 A;  3R95 A;  1LAM A;  3TT2 A;  1YI2 1;  4LX9 A;  1VQO Z;  2BUE A;  2OOY B;  2NYQ A;  4A30 A;  2Z3N A;  1V0C A;  2G0B A;  4NXY A;  3IO1 A;  4E2A A;  2K5R A;  1Q2D A;  2JBK A;  3CZX A;  4PK2 A;  1M4L A;  3PZJ A;  4ONU A;  1YLE A;  3PO3 S;  2GFQ A;  3I07 A;  2WZN A;  2ANP A;  1XBU A;  1CP6 A;  3IWG A;  4JWP A;  2PJ0 A;  3PBE A;  2R6M A;  3C26 A;  4C7H A;  3DGV A;  3S1N I;  3CC2 1;  4ZBG A;  3B7I A;  4A3J I;  1R43 A;  4NF1 A;  1YIT Z;  3BI0 A;  4A31 A;  1TF9 A;  4B11 A;  3IR7 A;  2JEV A;  5K8N A;  1VQK 1;  3S6F A;  1X3Z A;  3D8P A;  4XPD C;  4NSQ A;  3CPW Y;  1RTQ A;  1W2B Z;  3CCL 1;  1SFO I;  4FD7 A;  5C44 I;  5IP9 I;  2B5G A;  1Z03 A;  3CMA Z;  4F9V A;  4CS0 B;  1PUA A;  3W6X A;  3H0G I;  4NFR A;  5HVF A;  2OTJ Z;  4P4D A;  3DR6 A;  1Z8L A;  5A28 A;  3S6H A;  4A3F I;  4DJL A;  3RYO A;  1MK4 A;  4A94 A;  3BG0 B;  3T4N B;  2XEI A;  3K9U A;  2E2J I;  4OAD A;  1Y7R A;  1Z4R A;  2I79 A;  1WW9 A;  4PSX A;  2X7B A;  4CGN A;  2VUG A;  2Q44 A;  5JGF A;  4NBC A;  3S1Q I;  4DQY B;  3CCV 1;  4RVG A;  3S15 I;  1RXT A;  2OZU A;  3CXQ A;  2QRE B;  2ZEG A;  3PBB A;  5EMI A;  4MHZ A;  1VQ9 Z;  3DR8 A;  2VPY A;  2DXQ A;  1Y7E A;  2R93 I;  1KZF A;  3GIU A;  4IK2 A;  1VQ4 1;  4ORF A;  1WJ2 A;  2H85 A;  2PJ9 A;  2DE7 A;  2G2K A;  1M90 1;  5JQ4 A;  3KL9 A;  3VMG A;  4MY3 A;  3QWU A;  2G3A A;  4NBH A;  1QSM A;  3IJ3 A;  5AG4 A;  4WJB A;  4E32 A;  2VPW A;  3CQZ I;  4EWC A;  4KLW A;  2OZH A;  1YI2 Z;  1KC8 1;  4B5P B;  3FIX A;  2FCK A;  4PSW A;  4KVX A;  1R57 A;  3A9L A;  1TWF I;  3U50 C;  1QST A;  4UWJ A;  1YSJ A;  1ZLH A;  2I3C A;  4QB9 A;  2YAD A;  4RVD A;  2QRC B;  2QEC A;  4A3L I;  2J8R A;  1JJ2 Z;  5F49 A;  3CCE Z;  2E9H A;  3LAC A;  2V45 A;  1Z8X A;  3JAM f;  4B10 A;  3JTK A;  2GRE A;  3ISX A;  2KI7 B;  1J4J A;  1WK4 A;  3D66 A;  4NGR A;  5F48 A;  4X5K A;  1MJA A;  2FIA A;  5DWM A;  5LYL A;  4CAF A;  2JIO A;  1RO5 A;  3S6G A;  5C88 A;  3CC7 1;  3KGQ A;  1BLL E;  2C6C A;  2JMO A;  2BEI A;  1KUY A;  2F7V A;  4MFK A;  3ESW A;  3KQX A;  2QA4 1;  1Q82 1;  2JA5 I;  2C27 A;  2Z3K A;  4ONW A;  3S6K A;  1Y9K A;  2PR8 A;  4NJR A;  1YHQ Z;  2Z3M A;  3CD6 1;  1VQ7 Z;  2V8H A;  5AG7 A;  3FH4 A;  2JIM A;  1Z4E A;  4UWI A;  2PJA A;  4MI4 A;  5AGE A;  4NBA A;  2F4O A;  4M6G A;  4E2Y A;  3BHX A;  2AFM A;  2AFZ A;  2VXK A;  4OC0 A;  2JDD A;  4Y49 B;  4MCR A;  2D4O A;  3W6S A;  4TNU A;  3KAS A;  2Q4Z A;  1XFO A;  2Q04 A;  3PO2 I;  4MFJ A;  5EBV A;  4Q7A A;  4CAW A;  5LRG A;  2RHB A;  4HPS A;  1YLO A;  4BBH A;  3FQM A;  4QTT A;  5IX3 A;  4UFX A;  4EME A;  1IU8 A;  1VQ4 Z;  4B13 A;  1H8L A;  3T8W A;  4A95 A;  4HNW B;  1USP B;  1VQ8 1;  3P2F A;  1DTD A;  4M3S A;  1ARM A;  3F3F C;  2R98 A;  3Q87 A;  2M6N A;  2JLM A;  2YNC A;  1X3W A;  3VWD A;  3B35 A;  4GXH A;  1WWZ A;  4FAI A;  1ON0 A;  1QYP A;  1DE4 C;  1WCM I;  1K73 1;  2QRD B;  4QC6 A;  1QXF A;  4NBE A;  4P10 A;  4YWY A;  4CGO A;  2ZEN A;  3SI1 A;  2HB6 A;  4R76 A;  1QF8 A;  2R92 I;  3KI9 A;  4MH4 A;  1VHS A;  4JD6 A;  4S1T A;  4FUU A;  3T90 A;  1IOI A;  4CAX A;  1ELL P;  1LCP A;  2PJ7 A;  5DS0 A;  3KHX A;  4A93 I;  2CTB A;  1IID A;  1S5K A;  1VQP Z;  4OC5 A;  3WC6 A;  1AA6 A;  4A3B I;  4NBF A;  6CPA A;  4KOT A;  4PQA A;  2EK9 A;  2WAQ A;  4P4J A;  4XX2 A;  3CCU 1;  3NH4 A;  1VQ7 1;  3D67 A;  2QIR A;  1CBX A;  5CNP A;  2Q43 A;  2O4H A;  4L8A A;  2HQY A;  4XNH B;  1LOK A;  3GTP I;  2CTC A;  1YIJ Z;  4K30 A;  2GU2 A;  1MJ9 A;  1OBR A;  4P44 A;  3EXN A;  2Y0M A;  3FEC A;  2ZXV A;  4NBD A;  4I49 A;  3LOD A;  4IAV A;  1NUI A;  2K5T A;  2PJ8 A;  1XRY A;  4P4I A;  3D7D A;  2ZOF A;  3IX0 A;  4MCS A;  2F8H A;  1TKF A;  2W03 A;  3CCR Z;  2ZW5 A;  3GKR A;  4AVB A;  3CCV Z;  4B14 A;  3EER A;  3CPA A;  3H8E A;  3KR5 A;  2AJ6 A;  2B3V A;  5HMN A;  5IB0 A;  4KVM E;  2BL1 A;  2V3V A;  3VMI A;  1QMU A;  4B6Z A;  1B6B A;  2VEZ A;  1KQS Z;  3TE5 B;  4DGL A;  4C2Z A;  1CPS A;  3M4O I;  1DL6 A;  1UFH A;  5C3E I;  3GTL I;  3SJG A;  4PPZ A;  3CD6 Z;  1VQP 1;  1HEE A;  5JM6 A;  4CYO A;  2ZEP A;  5IT9 f;  4PXE A;  4F0X A;  2AFW A;  1FT7 A;  2O28 A;  1LFW A;  2P0W A;  1YRE A;  3PO3 I;  1S72 Z;  2CNS A;  3S2H I;  4UA3 A;  2P6F A;  2HU9 A;  2D4P A;  3KHZ A;  1ZLI A;  4JXQ A;  4F9U A;  1Q7Y 1;  1I1D A;  4OC2 A;  2PVV A;  2YNE A;  3B3C A;  4YU9 A;  4NBB A;  2R8V A;  3VMH A;  4J3G A;  2XEG A;  4DYO A;  2BJO A;  3NH5 A;  4XPD B;  1OZP A;  3HLP A;  2ZED A;  1VQ8 Z;  3K2K A;  3CDX A;  1Z8W A;  3SXO A;  1GYT A;  2EK8 A;  2WPX A;  1WZN A;  1Z2L A;  2CNM A;  1NJI 2;  2ZEM A;  5LYD A;  2RBL A;  5J1Q A;  4IHM A;  1YR0 A;  1SQH A;  3CCR 1;  1X10 A;  4F8Z A;  4NBG A;  1YUA A;  3IEH A;  3I4M I;  4U9Z A;  4MD8 A;  3HOZ I;  2P6E A;  1NMT A;  1CP7 A;  2REF A;  3NDJ A;  3KIF A;  2ATR A;  4RV9 A;  1CM0 A;  1N8R 1;  1VQN Z;  3CCS 1;  2PJB A;  2PJ6 A;  4A39 A;  4RS4 A;  3CT9 A;  2AKL A;  3WR7 A;  2ABZ A;  4CL1 A;  4CYN A;  1YK3 A;  2ZEL A;  2B4B A;  2JUB A;  4QTU A;  4XPL A;  1RO0 A;  1KD1 1;  3B2Y A;  5KTD A;  4UF4 A;  2NSM A;  4ZX8 A;  1BAV A;  3FEE A;  5FLX f;  3GTQ I;  3QAH A;  2JNY A;  2B3U A;  3G71 1;  1IY7 A;  1JJ2 Y;  2WYR A;  4JXR A;  1QVG Y;  3R9E A;  5GCN A;  5C82 A;  1WII A;  4UBR A;  4KUB A;  2EGT A;  3M3Y I;  3VH9 A;  4H89 A;  5KTA A;  5T64 A;  3TC8 A;  2E7Z A;  3ZJ0 A;  4X3R A;  3GUX A;  1IYL A;  4A3M I;  2ZW6 A;  5IV0 A;  1AYE A;  1PCA A;  2RB7 A;  3VB9 A;  4KSI A;  5G1Z A;  2V8G A;  2LEX A;  2C6P A;  4CPA A;  3FED A;  1S72 1;  3V8I A;  3GTG I;  1FNO A;  4JJX A;  1XJO A;  4UEZ A;  3CCU Z;  3R9G A;  4R7M A;  3F3P C;  1YJ9 Z;  2FT0 A;  3CCS Z;  3HOV I;  2GLJ A;  2Z11 A;  2CIJ A;  5HXD A;  1RO4 A;  1S7K A;  1IGB A;  4OC4 A;  1N2F A;  2W04 A;  3PB9 X;  4BY1 I;  1YQE A;  4NH1 C;  3TO6 A;  1NSA A;  1VQN 1;  4NEX A;  5LRJ A;  5AG6 A;  4AYB A;  4W9Y A;  3PB4 X;  3R1K A;  2CNT A;  1YHQ 1;  3TDH B;  4FD4 A;  2JS4 A;  1VLA A;  4E2X A;  1PYT B;  1L0C A;  4IF5 A;  5T6B A;  2NVX I;  3G6E 1;  3MZK B;  1I21 A;  4L89 A;  2JIR A;  1VQ6 Z;  2PRQ A;  2V8J A;  5CM2 M; 
#chains in the Genus database with same CATH homology
 3PFO A;  2QVP A;  3G4S 1;  3KIH A;  2ZEO A;  3CPX A;  3D7G A;  5LRG A;  5THW A;  1USP A;  2RHB A;  5T67 A;  4NJQ A;  1N8R 2;  3GB0 A;  1YLO A;  3IC1 A;  3FQM A;  3J7A 4;  4MHN A;  4QTT A;  3CCL Z;  3GTM I;  4OME A;  1YW4 A;  3J81 b;  1W2B Y;  4X6A I;  4EME A;  1K83 I;  4P4E A;  4X2T A;  1QVF Y;  1VQ4 Z;  5FLM I;  1H8L A;  4OP4 A;  3IF8 A;  3T8W A;  1VHO A;  3IFU A;  2NVT I;  1JWH C;  1USP B;  2KPI A;  3JRU A;  1VQ8 1;  1DTD A;  1LAP A;  4OC3 A;  1ARM A;  2OOX B;  2QEX 1;  2WB1 A;  1TFI A;  4E2W A;  1KD1 2;  3S1M I;  4UIB A;  4X8I A;  3F3F C;  3CMA 1;  3Q87 A;  2M6N A;  4A3E I;  2YU9 I;  1X3W A;  3I56 1;  1I6H I;  3FX6 A;  3CC4 Z;  2JA6 I;  4ZI6 A;  2HC9 A;  3B35 A;  2QKD A;  2VUM I;  4ZYQ A;  2OR4 A;  4FAI A;  1VQK Z;  4P4B A;  4ZX9 A;  3CCQ Z;  2P28 A;  3FVL A;  1QYP A;  1DE4 C;  3CXC Y;  1VQ9 1;  2IZ3 A;  1Y1W I;  2PK7 A;  4BXX I;  1WCM I;  1K73 1;  2QR1 B;  4PXC A;  2QRD B;  1K8A 1;  1K73 2;  4NBE A;  1KQS Y;  4A3C I;  2QJ8 A;  5FLX b;  1LAN A;  2C6G A;  2PE3 A;  4P10 A;  4YWY A;  3D9X A;  2JBJ A;  4A37 A;  2ZEN A;  3SI1 A;  2HB6 A;  4ZY1 A;  4NGM A;  4R76 A;  1QF8 A;  4O23 A;  2XEJ A;  2R92 I;  3KI9 A;  5K8O A;  4MH4 A;  3P5J B;  4DK1 A;  4S1T A;  2PJC A;  4FUU A;  4RUH A;  2DEA A;  2V8D A;  2ZEE A;  4E33 A;  1ELL P;  3CME 1;  2PIY A;  1LCP A;  3NA6 A;  5LYI A;  3ISZ A;  3B3V A;  1TKH A;  3KQZ A;  2PJ7 A;  5DS0 A;  3KHX A;  4A93 I;  2IJZ A;  4R8F A;  2CTB A;  2O53 A;  4H2K A;  2V77 A;  1VQP Z;  4OC5 A;  2IQ6 A;  2VF1 A;  1VQ6 1;  3V38 A;  3WC6 A;  4A3B I;  4HGZ A;  4NBF A;  6CPA A;  1Q82 2;  1VQL 1;  4PQA A;  2GLF A;  2EK9 A;  5LYF A;  2WAQ A;  4P4J A;  1YIJ 1;  4XX2 A;  3S17 I;  3CCU 1;  3CC7 Z;  3NH4 A;  3B3W A;  3S9L A;  2R7Z I;  2V8I A;  2FVG A;  1VQ7 1;  1YJN Z;  3CCJ Z;  2OZK A;  1RLY A;  3D67 A;  3WT4 A;  1YUK A;  1CBX A;  4HGY A;  4FWU A;  2Q43 A;  3SJE A;  3PB6 X;  5C4X I;  4P6Y A;  1VHE A;  2O4H A;  2C1C A;  3H8G A;  2PM9 A;  3VAT A;  2PMZ A;  3G71 Z;  1ZB8 A;  4E2Z A;  2Y0S A;  4PXB A;  1LOK A;  1VQM 1;  1Z01 A;  3GTP I;  1VQL Z;  2CTC A;  2M48 A;  3IFE A;  1TWA I;  1YIJ Z;  4G1P A;  1F2O A;  2GU2 A;  4MXU A;  2ZEF A;  4NB9 A;  1TXR A;  4A38 A;  3I55 1;  1JQG A;  3OW2 Z;  1OBR A;  2PJ1 A;  4A3K I;  4P44 A;  3FEC A;  3FQQ A;  1R9T I;  5HVG A;  4OKO A;  4NBD A;  3G6E Z;  3CPW Z;  2DE5 A;  5CBM A;  4IAV A;  2NVQ I;  4K3N A;  1NUI A;  4E31 A;  2JR6 A;  1Y0Y A;  4MCQ A;  2PJ8 A;  4NB8 A;  1AMP A;  3D6W A;  2QLV B;  1Y1V I;  1LAM A;  1Q81 2;  1XRY A;  3KZW A;  4BBS I;  1YI2 1;  3CCE 1;  2PVW A;  2HF1 A;  1VQO Z;  4P4I A;  3D7D A;  1Q7L A;  2ZOF A;  3FKI I;  3KR4 A;  2OOY B;  1S7M A;  2NYQ A;  3B3T A;  3IX0 A;  4MHY A;  2BCO A;  1TWG I;  4MCS A;  2F8H A;  1TKF A;  3CCM Z;  4AXV A;  1TWH I;  4OC1 A;  3D7F A;  2W03 A;  3IO1 A;  3SI0 A;  1YME A;  3CCR Z;  3D4U A;  2K5R A;  4ZY0 A;  2JBK A;  2QA4 Z;  5JH9 A;  1KC8 2;  3CCV Z;  3SJF A;  3GTO I;  3EER A;  1M4L A;  3CPA A;  1KRL A;  3J80 b;  3H8E A;  3KR5 A;  2PJ2 A;  3GKQ A;  4BY7 I;  3BI1 A;  3PO3 S;  2ZEH A;  3QNV A;  3I07 A;  1RO2 A;  3CCQ 1;  3D68 A;  2AFS A;  4MD7 A;  3VMI A;  1QMU A;  2B63 I;  2WZN A;  3RBU A;  4GM5 A;  4B6Z A;  2ANP A;  1KQS Z;  3TE5 B;  4DGL A;  3D7H A;  1RQF A;  3NH8 A;  1XBU A;  4JZ0 A;  1CPS A;  3M4O I;  1DL6 A;  1XMB A;  1ELM P;  1CP6 A;  4MMO A;  2LIY A;  5C3E I;  3GTL I;  3SJG A;  3CXC Z;  2PIZ A;  3CD6 Z;  1VQP 1;  4P4F A;  4PPZ A;  2PJ0 A;  3TX8 A;  3PBE A;  1HEE A;  2R6M A;  8CPA A;  1VQ5 Z;  4A3G I;  1TWC I;  1X0T A;  5JM6 A;  1VGY A;  1YJW Z;  3DGV A;  3S1N I;  3CC2 1;  2ZEP A;  5IT9 f;  3B7I A;  4PXE A;  4A3J I;  1R43 A;  1FT7 A;  2AFW A;  3IWW A;  3RZA A;  1HDU A;  2GTI A;  1LFW A;  5F09 A;  1YIT Z;  3SI2 A;  3BI0 A;  5K8M A;  1TF9 A;  3PO3 I;  5IB9 A;  3HUV A;  3H3V J;  7CPA A;  2OTL 1;  1S72 Z;  1QQ9 A;  5K8N A;  3S2H I;  4DUK A;  1ARL A;  1VQK 1;  2HU9 A;  4A3D I;  3KHZ A;  1X3Z A;  2PJ5 A;  3S9N A;  3VTN A;  2ZOG A;  3RZD I;  2RT9 A;  1ZLI A;  2RPR A;  1CX8 A;  1TF8 A;  3CPW Y;  1RTQ A;  1W2B Z;  4F9U A;  3CCL 1;  1Q7Y 1;  1SFO I;  5C44 I;  5A2Q b;  1I3Q I;  5IP9 I;  4OC2 A;  2PVV A;  5HVH A;  3OW2 Y;  1YIT 1;  1Z03 A;  3CMA Z;  4F9V A;  1Z02 A;  4OID A;  4P45 A;  3B3C A;  1CPX A;  1ZG9 A;  1VQO 1;  4YU9 A;  4NBB A;  4NOZ A;  5I4M A;  3N5F A;  3VMH A;  3H0G I;  4NFR A;  2XEG A;  4DYO A;  3HOY I;  2J9A A;  5HVF A;  2GTH A;  2OTJ Z;  5K8P A;  2BJO A;  3NH5 A;  2IZ4 A;  4P4D A;  1Z8L A;  4A3F I;  5D1O A;  1Q81 1;  2CF4 A;  3HLP A;  1K9M 2;  1CG2 A;  2ZED A;  1VQ8 Z;  3K2K A;  4DJL A;  2JEW A;  4A94 A;  2AFO A;  4RVF A;  3BG0 B;  3CDX A;  3T4N B;  4E30 A;  1NJI 1;  1GYT A;  2EK8 A;  3J80 f;  3CCJ 1;  1YJN 1;  2XEI A;  5LL6 f;  1Z2L A;  2V8V A;  2E2H I;  1NJI 2;  2ZEM A;  2P3Y A;  5LYD A;  2EWB A;  2RIQ A;  2E2J I;  2RBL A;  5J1Q A;  4IHM A;  1WW9 A;  3GCF A;  5ELY A;  4NGT A;  3CCR 1;  2LFU A;  3DLJ A;  3MZL B;  2VUG A;  4F8Z A;  5JGF A;  4NBG A;  3LUS A;  1YUA A;  4NBC A;  4DQY B;  3CCV 1;  4RVG A;  3I4M I;  3S15 I;  3S1Q I;  3IEH A;  4RVH A;  4Y52 I;  4MD8 A;  3HOZ I;  2QRE B;  3NDI A;  5D8N A;  1YW6 A;  2ZEG A;  2V8K A;  1CP7 A;  3PBB A;  1UWY A;  4PXD A;  4MHZ A;  1VQ9 Z;  4NGS A;  3I1U A;  3NDJ A;  3KIF A;  1VIX A;  4RV9 A;  1YJ9 1;  1Y7E A;  2R93 I;  1N8R 1;  4BBR I;  5IP7 I;  1VQN Z;  3PFE A;  3LMS A;  4WWV A;  1Q7Y 2;  3RAM A;  3CCS 1;  1ZB9 A;  1VQ5 1;  2PJB A;  4IK2 A;  2PJ6 A;  1VQ4 1;  4A39 A;  4RS4 A;  2H85 A;  2PJ9 A;  2AFU A;  3CT9 A;  1LQL A;  3CC2 Z;  3CCM 1;  1HDQ A;  2DE7 A;  2AKL A;  2Q51 A;  2G2K A;  1M90 1;  2JA7 I;  1EE3 P;  3GLJ A;  2ABZ A;  4CL1 A;  3KL9 A;  3VMG A;  2ZEL A;  2JA8 I;  3QWU A;  4NBH A;  3I4N I;  3L2N A;  2F4M A;  3IJ3 A;  2IMO A;  4EFD A;  2PJ3 A;  4WJB A;  5IT9 b;  2G9D A;  3PB8 X;  2NVY I;  3S1R I;  4NGQ A;  4MRI A;  2JUB A;  4QTU A;  4E32 A;  1BPM A;  3K7A I;  2POK A;  3BXM A;  3CQZ I;  4EWC A;  1RO0 A;  1YI2 Z;  1KD1 1;  1KC8 1;  2K3R A;  3GTJ I;  2J6A A;  1M1K 1;  3B2Y A;  4A3I I;  1ML8 A;  3RZO I;  1KWM A;  3CC4 1;  1TWF I;  3U50 C;  1Y0R A;  3JAM b;  3IIB A;  2NSM A;  2PJ4 A;  4UF4 A;  3BG1 B;  5D1O B;  1M1K 2;  1I50 I;  4ZX8 A;  1BAV A;  5C4J I;  3FEE A;  3EED A;  5FLX f;  1YSJ A;  1ZLH A;  2I3C A;  3GTQ I;  2OTJ 1;  2JNY A;  1QVF Z;  1F57 A;  3FF3 A;  3G71 1;  3GTK I;  2AFX A;  1IY7 A;  1QVG Z;  1PFT A;  1Y1V S;  2YAD A;  1BPN A;  1JJ2 Y;  4ZY2 A;  4RVD A;  4UEE A;  2QRC B;  4LQG A;  2WYR A;  4A3L I;  1JJ2 Z;  2ZAE B;  3CCE Z;  2E9H A;  1QVG Y;  2OOT A;  4MD9 A;  1Q86 1;  1WII A;  2EGT A;  3G4S Z;  1R3N A;  1Z5R A;  3M3Y I;  3JAM f;  3S14 I;  3VH9 A;  5T64 A;  3HOU I;  5D1P A;  2GRE A;  3TC8 A;  1K9M 1;  5CPA A;  3ISX A;  2KI7 B;  1ZH1 A;  4UEF A;  3LWU A;  3D66 A;  4Z65 A;  4NGR A;  4X3R A;  4HH4 A;  3WC5 A;  3GUX A;  3HOX I;  4A3M I;  1AYE A;  1PCA A;  2RB7 A;  4MON A;  3VB9 A;  2RFH A;  5LYL A;  4KSI A;  2V8G A;  2C6P A;  3I56 Z;  3FED A;  5D29 A;  1S72 1;  4CPA A;  4EWT A;  4FBE A;  3GTG I;  1P9N A;  1FNO A;  2QEX Z;  1XJO A;  4NGP A;  3CCU Z;  3CC7 1;  4UEZ A;  3KGQ A;  1NP6 A;  2PCU A;  1BLL E;  2C6C A;  1TKJ A;  2JMO A;  1ZG8 A;  4R7M A;  3F3P C;  1L1O C;  3WC7 A;  1K8A 2;  3K9T A;  2F7V A;  1YJ9 Z;  3ESW A;  3KQX A;  1ZG7 A;  2QA4 1;  1Q82 1;  2XEF A;  2JA5 I;  5AN9 F;  1RNI A;  3CCS Z;  3HOV I;  4JYW A;  2GLJ A;  3HKZ A;  4MHP A;  4MCP A;  2CIJ A;  5HXD A;  1M90 2;  1RO4 A;  1VQM Z;  4ONW A;  1IGB A;  1YJW 1;  4OC4 A;  1N2F A;  2W04 A;  3PB9 X;  4NJR A;  3FJU A;  3MON A;  5LRK A;  1YHQ Z;  3I55 Z;  2BO9 A;  3S16 I;  3CD6 1;  4BY1 I;  1VQ7 Z;  2V8H A;  3FH4 A;  4NH1 C;  2BOA A;  4UIA A;  1F2P A;  2QYV A;  3CME Z;  2PJA A;  2E2I I;  1NSA A;  3MN8 A;  1VQN 1;  3S2D I;  4R6T A;  5LRJ A;  2VL1 A;  4NBA A;  4Y7N I;  2F4O A;  3V7Z A;  4AYB A;  4W9Y A;  4E2Y A;  3PB4 X;  4BD9 A;  3BHX A;  3PRT A;  3VAR A;  3PEI A;  2AFM A;  4TWE A;  2AFZ A;  1YHQ 1;  3J81 f;  3TDH B;  4OC0 A;  3NFZ A;  2DE6 A;  2JS4 A;  4MCR A;  3PB7 X;  1VLA A;  4E2X A;  4TNU A;  1PYT B;  3MRU A;  4OIW A;  2OTL Z;  3WAB A;  5T6B A;  2NVX I;  3S9M A;  4NGN A;  5A2Q f;  3H8F A;  3G6E 1;  3MZK B;  3KAS A;  2Q4Z A;  1XFO A;  3FMC A;  3GTM S;  3SJX A;  1Q86 2;  3HOW I;  1VQ6 Z;  3B3S A;  3PO2 I;  2PRQ A;  2V8J A;  5CM2 M;  4Q7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...