1K732

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73200
1YJ91 1VQ81 3CCE1 1YIJZ 3CC2Z 1Q7Y1 3CPWZ 1YJWZ 1K9M2 1Q821 3CC41 1YJN1 1M901 1VQLZ 1QVFZ 1K731 1NJI2 3G6E1 3CC7Z 1YJNZ 1YHQ1 3CCR1 1VQOZ 1W2BZ 1VQPZ 3I56Z 1VQ51 1Q812 3CCRZ 2QEX1 3G711 3CCL1 1VQ91 1KQSZ 1K9M1 1KD12 3CCS1 1YITZ 3CPWY 1VQ5Z 2QEXZ 3CCJ1 1VQ9Z 1VQN1 1YJ9Z 1VQ71 1VQ8Z 3CCEZ 1NJI1 1QVFY 2OTL1 1VQ41 1VQNZ 1VQ7Z 3CC4Z 1N8R1 3CCQ1 3CCV1 1VQK1 2QA41 1W2BY 1Q811 1N8R2 3G4S1 3G6EZ 1YHQZ 1QVGZ 3I551 1VQKZ 1KD11 2QA4Z 1JJ2Z 3CMA1 1K8A2 1KQSY 1VQM1 3CCM1 1KC82 1VQ61 3I55Z 3G71Z 3CCLZ 3CME1 3OW2Z 3CCSZ 1VQ6Z 1S721 3CCJZ 3CCU1 1YI21 3CXCZ 1Q861 1YIJ1 3CC21 1Q862 2OTLZ 1YJW1 1VQ4Z 3CCUZ 1YI2Z 1K8A1 1QVGY 3CCQZ 3CCVZ 1VQL1 1JJ2Y 1KC81 2OTJ1 1Q7Y2 3G4SZ 3CC71 1VQO1 1Q822 3CMAZ 3CD61 2OTJZ 1VQP1 1M902 3OW2Y 1VQMZ 3I561 1M1K1 1K732 3CCMZ 1M1K2 3CMEZ 3CD6Z 3CXCY 1YIT1 1S72Z
chains in the Genus database with same CATH superfamily
2O4HA 3J7A4 1Q7Y1 4AYBA 2PMZA 2KPIA 2JUBA 5FLMI 2K5RA 1NUIA 3IR7A 3HOXI 1X3WA 1QVFZ 3NDIA 1NJI2 2OOYB 1YHQ1 2JS4A 2VPZA 2VPXA 2JR6A 2IZ3A 4E2WA 1WCMI 3TDHB 4BY7I 1RO0A 3G711 1SFOI 2AYDA 3CQZI 3QWUA 1VQ91 1YITZ 1PFTA 4NBHA 3J81f 3CCJ1 1VQ9Z 1YJ9Z 1VQ8Z 1NJI1 1Y1VS 5LL6f 3GTMI 1I6HI 2R92I 2AKLA 3CCQ1 2G2KA 4RVHA 4NB9A 2QA41 1VQK1 2W04A 3F3FC 4NBEA 2V8JA 1TWFI 1VQKZ 2QA4Z 1ZB8A 4A3II 3MZKB 3IF8A 3GTJI 4QTUA 3J80b 3CCM1 3JAMb 2NAPA 3CCLZ 4TNUA 1AA6A 4NB8A 4Y52I 1YI21 1Y1VI 1Q861 1YIJ1 1Q16A 4RS4A 3JAMf 1YUKA 2OTLZ 1YI2Z 2E2HI 2BJOA 1Z03A 2LIYA 2OZKA 1VQL1 1JJ2Y 2GTIA 3CC71 4X6AI 1VQO1 1QF8A 4E31A 5C4JI 1Q822 3CD61 1VQP1 2RT9A 3OW2Y 1VQMZ 4MRIA 1NP6A 4NBAA 2Q51A 1R9TI 3CD6Z 3CXCY 4A3JI 3RZDI 2WAQA 2JIRA 2V8KA 2V8IA 4EWCA 1S7MA 2IZ4A 1I50I 2M48A 2HU9A 2Q4ZA 3U50C 5C44I 1Q821 5IP9I 3M3YI 3S1QI 2RIQA 4HGYA 3D9XA 2JA8I 3G6E1 4A3CI 1Z01A 2IV2X 1TFIA 3I56Z 3MONA 3GCFA 5CM2M 3BG0B 4E2XA 1KD12 3CCS1 3VB9A 4NOZA 3KIHA 3HOUI 2E7ZA 5T64A 2E2JI 2GTHA 4DQYB 1VQ41 2JIOA 2VUGA 3I07A 4DK1A 3F3PC 1N8R1 3CCV1 4A3EI 1Y8CA 3S1NI 3I4MI 2QRCB 3S16I 3G4S1 1YHQZ 3I551 4HGZA 1KD11 1JJ2Z 3CMA1 1K8A2 1KQSY 2VPYA 5FLXb 1VQ61 2PM9A 3I55Z 3G71Z 3IX0A 3D6WA 4RVGA 3CME1 1USPA 3OW2Z 3S1RI 3LUSA 1Y1WI 1VQ6Z 1S721 3CCJZ 3NH5A 2H85A 2QLVB 4MD7A 3CXCZ 3CC21 5FLXf 4NBCA 4A3FI 5C3EI 2JA7I 1Q862 1VLAA 1YJW1 4BBSI 2PK7A 1K8A1 1QVGY 3CCQZ 1K83I 3GTLI 5T6BA 2DE7A 2OTJ1 3KIFA 4NBFA 1JWHC 1RNIA 1YUAA 2YADA 4NBGA 2OTJZ 4NFRA 3CCMZ 3FQMA 2NVYI 5D1PA 1WIIA 2JIMA 1ZB9A 3J80f 3HOYI 1WZNA 3CCE1 3D2LA 1YIJZ 4S1TA 2LFUA 3GTPI 1N2FA 2OOXB 1QYPA 3PO3S 3CC41 1YJN1 2I3CA 1VQLZ 2W03A 2NVQI 4MXUA 1FDOA 2QRDB 3CC7Z 1YJNZ 4NBBA 4A93I 3CCR1 1VQOZ 3GTQI 4RVFA 2R6MA 4MONA 1VQPZ 5IT9b 1Q812 2RBLA 3CCRZ 4A3BI 3NH8A 3IFUA 4E30A 1KQSZ 2JA6I 2Y0SA 4RVDA 3CPWY 3BG1B 3EERA 4QTTA 5D1OA 1RO4A 3S2DI 2JIQA 2P3YA 1W2BY 1Q811 1N8R2 3G6EZ 1QVGZ 1X0TA 2V3VA 1WJ2A 3PO2I 2JA5I 3GTKI 3NDJA 1KC82 3MZLB 3VMGA 2YU9I 2QKDA 2NVTI 4DGLA 1ML8A 3CCSZ 3HOWI 2KI7B 3S17I 2QR1B 2B63I 1WW9A 4BBRI 2JNYA 4A3DI 1VQ4Z 1TWCI 3FQQA 3CCVZ 3H0GI 1KRLA 3ESWA 1KC81 3HOZI 3G4SZ 4BY1I 3GTMS 3M4OI 3CMAZ 1RLYA 1RQFA 1M902 3S2HI 1M1K1 1I3QI 3RZOI 3Q87A 1K732 5T67A 2M6NA 3J81b 2VUMI 1TWGI 3CMEZ 1LQLA 2GU2A 2EGTA 4A3LI 1YIT1 5IP7I 4E2YA 1S72Z 2P28A 1YJ91 3GKQA 1VQ81 3P5JB 4MD8A 3CC2Z 3CPWZ 2DE6A 4E33A 2R93I 3HKZA 1YJWZ 1K9M2 4BXXI 1SIWA 2V45A 1USPB 1M901 2VPWA 4A3KI 1K731 2O53A 2VF1A 3S14I 1W2BZ 1Z02A 1L1OC 3HOVI 2QREB 4HH4A 5C4XI 2J6AA 3I4NI 1VQ51 3H3VJ 4XX2A 2QEX1 2HF1A 3GTOI 4E32A 3CCL1 2R7ZI 2DE5A 4NH1C 4A3GI 1K9M1 4CL1A 3NH4A 1VQ5Z 3NFZA 2QEXZ 2RHBA 1VQN1 2JMOA 1VQ71 3CCEZ 2F4OA 2WB1A 1QVFY 2OTL1 1VQNZ 1VQ7Z 3T4NB 3CC4Z 2RPRA 1X3ZA 4MD9A 4Y7NI 1TWAI 4MH4A 5A2Qb 5AN9F 1VQM1 3K7AI 1FDIA 4RV9A 2LEXA 2E2II 3PO3I 5IT9f 3S1MI 3GTGI 2K3RA 5A2Qf 4NBDA 3CCU1 2NVXI 1P9NA 1TWHI 1RO2A 3CCUZ 2E9HA 4A3MI 1DL6A 4E2ZA 3VMHA 1QXFA 1Q7Y2 2ZAEB 3VTNA 3FKII 3TE5B 2F4MA 2JIPA 5D1OB 3I561 3VMIA 3EEDA 1M1K2 3S15I 1ZH1A
chains in the Genus database with same CATH topology
2O4HA 3J7A4 1Q7Y1 4AYBA 2PMZA 2KPIA 2JUBA 5FLMI 2K5RA 1NUIA 3HOXI 1X3WA 1QVFZ 3NDIA 1NJI2 2OOYB 1YHQ1 2JS4A 2JR6A 2IZ3A 4E2WA 1WCMI 3TDHB 4BY7I 1RO0A 3G711 1SFOI 1VQ91 3CQZI 3QWUA 1YITZ 1PFTA 4NBHA 3J81f 3CCJ1 1VQ9Z 1YJ9Z 1VQ8Z 1NJI1 1Y1VS 5LL6f 3GTMI 1I6HI 2R92I 2AKLA 3CCQ1 2G2KA 4RVHA 4NB9A 2QA41 1VQK1 2W04A 3F3FC 4NBEA 2V8JA 1TWFI 1VQKZ 2QA4Z 1ZB8A 4A3II 3MZKB 3IF8A 3GTJI 4QTUA 3J80b 3CCM1 3JAMb 3CCLZ 4TNUA 4NB8A 4Y52I 1YI21 1Y1VI 1Q861 1YIJ1 4RS4A 3JAMf 1YUKA 2OTLZ 1YI2Z 2E2HI 2BJOA 1Z03A 2LIYA 2OZKA 1VQL1 1JJ2Y 2GTIA 3CC71 4X6AI 1VQO1 1QF8A 4E31A 5C4JI 1Q822 3CD61 1VQP1 2RT9A 3OW2Y 1VQMZ 4MRIA 1NP6A 4NBAA 2Q51A 1R9TI 3CD6Z 3CXCY 4A3JI 3RZDI 2WAQA 2V8KA 2V8IA 4EWCA 1S7MA 2IZ4A 1I50I 2M48A 2HU9A 2Q4ZA 3U50C 5C44I 1Q821 5IP9I 3M3YI 3S1QI 2RIQA 4HGYA 3D9XA 2JA8I 3G6E1 4A3CI 1Z01A 1TFIA 3I56Z 3MONA 3GCFA 5CM2M 3BG0B 4E2XA 1KD12 3CCS1 3VB9A 4NOZA 3KIHA 3HOUI 5T64A 2E2JI 2GTHA 4DQYB 1VQ41 2VUGA 3I07A 4DK1A 3F3PC 1N8R1 3CCV1 4A3EI 3S1NI 3I4MI 2QRCB 3S16I 3G4S1 1YHQZ 3I551 4HGZA 1KD11 1JJ2Z 3CMA1 1K8A2 1KQSY 5FLXb 1VQ61 2PM9A 3I55Z 3G71Z 3IX0A 3D6WA 4RVGA 3CME1 1USPA 3OW2Z 3S1RI 3LUSA 1Y1WI 1VQ6Z 1S721 3CCJZ 3NH5A 2H85A 2QLVB 4MD7A 3CXCZ 3CC21 5FLXf 4NBCA 4A3FI 5C3EI 2JA7I 1Q862 1VLAA 1YJW1 4BBSI 2PK7A 1K8A1 1QVGY 3CCQZ 1K83I 3GTLI 5T6BA 2DE7A 2OTJ1 3KIFA 4NBFA 1JWHC 1RNIA 1YUAA 2YADA 4NBGA 2OTJZ 4NFRA 3CCMZ 3FQMA 2NVYI 5D1PA 1WIIA 1ZB9A 3J80f 3HOYI 3CCE1 1YIJZ 4S1TA 2LFUA 3GTPI 1N2FA 2OOXB 1QYPA 3PO3S 3CC41 1YJN1 2I3CA 1VQLZ 2W03A 2NVQI 4MXUA 2QRDB 3CC7Z 1YJNZ 4NBBA 4A93I 3CCR1 1VQOZ 3GTQI 4RVFA 2R6MA 4MONA 1VQPZ 5IT9b 1Q812 2RBLA 3CCRZ 4A3BI 3NH8A 3IFUA 4E30A 1KQSZ 2JA6I 2Y0SA 4RVDA 3CPWY 3BG1B 3EERA 4QTTA 5D1OA 1RO4A 3S2DI 2P3YA 1W2BY 1Q811 1N8R2 3G6EZ 1QVGZ 1X0TA 3PO2I 2JA5I 3GTKI 3NDJA 1KC82 3MZLB 3VMGA 2YU9I 2QKDA 2NVTI 4DGLA 1ML8A 3CCSZ 3HOWI 2KI7B 3S17I 2QR1B 2B63I 1WW9A 4BBRI 2JNYA 4A3DI 1VQ4Z 1TWCI 3FQQA 3CCVZ 3H0GI 1KRLA 3ESWA 1KC81 3HOZI 3G4SZ 4BY1I 3GTMS 3M4OI 3CMAZ 1RLYA 1RQFA 1M902 3S2HI 1M1K1 1I3QI 3RZOI 3Q87A 1K732 5T67A 2M6NA 3J81b 2VUMI 1TWGI 3CMEZ 1LQLA 2GU2A 2EGTA 4A3LI 1YIT1 5IP7I 4E2YA 1S72Z 2P28A 1YJ91 3GKQA 1VQ81 3P5JB 4MD8A 3CC2Z 3CPWZ 2DE6A 4E33A 2R93I 3HKZA 1YJWZ 1K9M2 4BXXI 1USPB 1M901 4A3KI 1K731 2O53A 2VF1A 3S14I 1W2BZ 1Z02A 1L1OC 3HOVI 2QREB 4HH4A 5C4XI 2J6AA 3I4NI 1VQ51 3H3VJ 4XX2A 2QEX1 2HF1A 3GTOI 4E32A 3CCL1 2R7ZI 2DE5A 4NH1C 4A3GI 1K9M1 4CL1A 3NH4A 1VQ5Z 3NFZA 2QEXZ 2RHBA 1VQN1 2JMOA 1VQ71 3CCEZ 2F4OA 2WB1A 1QVFY 2OTL1 1VQNZ 1VQ7Z 3T4NB 3CC4Z 2RPRA 1X3ZA 4MD9A 4Y7NI 1TWAI 4MH4A 5A2Qb 5AN9F 1VQM1 3K7AI 4RV9A 2E2II 3PO3I 5IT9f 3S1MI 3GTGI 2K3RA 5A2Qf 4NBDA 3CCU1 2NVXI 1P9NA 1TWHI 1RO2A 3CCUZ 2E9HA 4A3MI 1DL6A 4E2ZA 3VMHA 1Q7Y2 2ZAEB 3VTNA 3FKII 3TE5B 2F4MA 5D1OB 3I561 3VMIA 3EEDA 1M1K2 3S15I 1ZH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 1;  1VQ8 1;  3CCE 1;  1YIJ Z;  3CC2 Z;  1Q7Y 1;  3CPW Z;  1YJW Z;  1K9M 2;  1Q82 1;  3CC4 1;  1YJN 1;  1M90 1;  1VQL Z;  1QVF Z;  1K73 1;  1NJI 2;  3G6E 1;  3CC7 Z;  1YJN Z;  1YHQ 1;  3CCR 1;  1VQO Z;  1W2B Z;  1VQP Z;  3I56 Z;  1VQ5 1;  1Q81 2;  3CCR Z;  2QEX 1;  3G71 1;  3CCL 1;  1VQ9 1;  1KQS Z;  1K9M 1;  1KD1 2;  3CCS 1;  1YIT Z;  3CPW Y;  1VQ5 Z;  2QEX Z;  3CCJ 1;  1VQ9 Z;  1VQN 1;  1YJ9 Z;  1VQ7 1;  1VQ8 Z;  3CCE Z;  1NJI 1;  1QVF Y;  2OTL 1;  1VQ4 1;  1VQN Z;  1VQ7 Z;  3CC4 Z;  1N8R 1;  3CCQ 1;  3CCV 1;  1VQK 1;  2QA4 1;  1W2B Y;  1Q81 1;  1N8R 2;  3G4S 1;  3G6E Z;  1YHQ Z;  1QVG Z;  3I55 1;  1VQK Z;  1KD1 1;  2QA4 Z;  1JJ2 Z;  3CMA 1;  1K8A 2;  1KQS Y;  1VQM 1;  3CCM 1;  1KC8 2;  1VQ6 1;  3I55 Z;  3G71 Z;  3CCL Z;  3CME 1;  3OW2 Z;  3CCS Z;  1VQ6 Z;  1S72 1;  3CCJ Z;  3CCU 1;  1YI2 1;  3CXC Z;  1Q86 1;  1YIJ 1;  3CC2 1;  1Q86 2;  2OTL Z;  1YJW 1;  1VQ4 Z;  3CCU Z;  1YI2 Z;  1K8A 1;  1QVG Y;  3CCQ Z;  3CCV Z;  1VQL 1;  1JJ2 Y;  1KC8 1;  2OTJ 1;  1Q7Y 2;  3G4S Z;  3CC7 1;  1VQO 1;  1Q82 2;  3CMA Z;  3CD6 1;  2OTJ Z;  1VQP 1;  1M90 2;  3OW2 Y;  1VQM Z;  3I56 1;  1M1K 1;  1K73 2;  3CCM Z;  1M1K 2;  3CME Z;  3CD6 Z;  3CXC Y;  1YIT 1;  1S72 Z; 
#chains in the Genus database with same CATH topology
 2O4H A;  3J7A 4;  1Q7Y 1;  4AYB A;  2PMZ A;  2KPI A;  2JUB A;  5FLM I;  2K5R A;  1NUI A;  3IR7 A;  3HOX I;  1X3W A;  1QVF Z;  3NDI A;  1NJI 2;  2OOY B;  1YHQ 1;  2JS4 A;  2VPZ A;  2VPX A;  2JR6 A;  2IZ3 A;  4E2W A;  1WCM I;  3TDH B;  4BY7 I;  1RO0 A;  3G71 1;  1SFO I;  2AYD A;  3CQZ I;  3QWU A;  1VQ9 1;  1YIT Z;  1PFT A;  4NBH A;  3J81 f;  3CCJ 1;  1VQ9 Z;  1YJ9 Z;  1VQ8 Z;  1NJI 1;  1Y1V S;  5LL6 f;  3GTM I;  1I6H I;  2R92 I;  2AKL A;  3CCQ 1;  2G2K A;  4RVH A;  4NB9 A;  2QA4 1;  1VQK 1;  2W04 A;  3F3F C;  4NBE A;  2V8J A;  1TWF I;  1VQK Z;  2QA4 Z;  1ZB8 A;  4A3I I;  3MZK B;  3IF8 A;  3GTJ I;  4QTU A;  3J80 b;  3CCM 1;  3JAM b;  2NAP A;  3CCL Z;  4TNU A;  1AA6 A;  4NB8 A;  4Y52 I;  1YI2 1;  1Y1V I;  1Q86 1;  1YIJ 1;  1Q16 A;  4RS4 A;  3JAM f;  1YUK A;  2OTL Z;  1YI2 Z;  2E2H I;  2BJO A;  1Z03 A;  2LIY A;  2OZK A;  1VQL 1;  1JJ2 Y;  2GTI A;  3CC7 1;  4X6A I;  1VQO 1;  1QF8 A;  4E31 A;  5C4J I;  1Q82 2;  3CD6 1;  1VQP 1;  2RT9 A;  3OW2 Y;  1VQM Z;  4MRI A;  1NP6 A;  4NBA A;  2Q51 A;  1R9T I;  3CD6 Z;  3CXC Y;  4A3J I;  3RZD I;  2WAQ A;  2JIR A;  2V8K A;  2V8I A;  4EWC A;  1S7M A;  2IZ4 A;  1I50 I;  2M48 A;  2HU9 A;  2Q4Z A;  3U50 C;  5C44 I;  1Q82 1;  5IP9 I;  3M3Y I;  3S1Q I;  2RIQ A;  4HGY A;  3D9X A;  2JA8 I;  3G6E 1;  4A3C I;  1Z01 A;  2IV2 X;  1TFI A;  3I56 Z;  3MON A;  3GCF A;  5CM2 M;  3BG0 B;  4E2X A;  1KD1 2;  3CCS 1;  3VB9 A;  4NOZ A;  3KIH A;  3HOU I;  2E7Z A;  5T64 A;  2E2J I;  2GTH A;  4DQY B;  1VQ4 1;  2JIO A;  2VUG A;  3I07 A;  4DK1 A;  3F3P C;  1N8R 1;  3CCV 1;  4A3E I;  1Y8C A;  3S1N I;  3I4M I;  2QRC B;  3S16 I;  3G4S 1;  1YHQ Z;  3I55 1;  4HGZ A;  1KD1 1;  1JJ2 Z;  3CMA 1;  1K8A 2;  1KQS Y;  2VPY A;  5FLX b;  1VQ6 1;  2PM9 A;  3I55 Z;  3G71 Z;  3IX0 A;  3D6W A;  4RVG A;  3CME 1;  1USP A;  3OW2 Z;  3S1R I;  3LUS A;  1Y1W I;  1VQ6 Z;  1S72 1;  3CCJ Z;  3NH5 A;  2H85 A;  2QLV B;  4MD7 A;  3CXC Z;  3CC2 1;  5FLX f;  4NBC A;  4A3F I;  5C3E I;  2JA7 I;  1Q86 2;  1VLA A;  1YJW 1;  4BBS I;  2PK7 A;  1K8A 1;  1QVG Y;  3CCQ Z;  1K83 I;  3GTL I;  5T6B A;  2DE7 A;  2OTJ 1;  3KIF A;  4NBF A;  1JWH C;  1RNI A;  1YUA A;  2YAD A;  4NBG A;  2OTJ Z;  4NFR A;  3CCM Z;  3FQM A;  2NVY I;  5D1P A;  1WII A;  2JIM A;  1ZB9 A;  3J80 f;  3HOY I;  1WZN A;  3CCE 1;  3D2L A;  1YIJ Z;  4S1T A;  2LFU A;  3GTP I;  1N2F A;  2OOX B;  1QYP A;  3PO3 S;  3CC4 1;  1YJN 1;  2I3C A;  1VQL Z;  2W03 A;  2NVQ I;  4MXU A;  1FDO A;  2QRD B;  3CC7 Z;  1YJN Z;  4NBB A;  4A93 I;  3CCR 1;  1VQO Z;  3GTQ I;  4RVF A;  2R6M A;  4MON A;  1VQP Z;  5IT9 b;  1Q81 2;  2RBL A;  3CCR Z;  4A3B I;  3NH8 A;  3IFU A;  4E30 A;  1KQS Z;  2JA6 I;  2Y0S A;  4RVD A;  3CPW Y;  3BG1 B;  3EER A;  4QTT A;  5D1O A;  1RO4 A;  3S2D I;  2JIQ A;  2P3Y A;  1W2B Y;  1Q81 1;  1N8R 2;  3G6E Z;  1QVG Z;  1X0T A;  2V3V A;  1WJ2 A;  3PO2 I;  2JA5 I;  3GTK I;  3NDJ A;  1KC8 2;  3MZL B;  3VMG A;  2YU9 I;  2QKD A;  2NVT I;  4DGL A;  1ML8 A;  3CCS Z;  3HOW I;  2KI7 B;  3S17 I;  2QR1 B;  2B63 I;  1WW9 A;  4BBR I;  2JNY A;  4A3D I;  1VQ4 Z;  1TWC I;  3FQQ A;  3CCV Z;  3H0G I;  1KRL A;  3ESW A;  1KC8 1;  3HOZ I;  3G4S Z;  4BY1 I;  3GTM S;  3M4O I;  3CMA Z;  1RLY A;  1RQF A;  1M90 2;  3S2H I;  1M1K 1;  1I3Q I;  3RZO I;  3Q87 A;  1K73 2;  5T67 A;  2M6N A;  3J81 b;  2VUM I;  1TWG I;  3CME Z;  1LQL A;  2GU2 A;  2EGT A;  4A3L I;  1YIT 1;  5IP7 I;  4E2Y A;  1S72 Z;  2P28 A;  1YJ9 1;  3GKQ A;  1VQ8 1;  3P5J B;  4MD8 A;  3CC2 Z;  3CPW Z;  2DE6 A;  4E33 A;  2R93 I;  3HKZ A;  1YJW Z;  1K9M 2;  4BXX I;  1SIW A;  2V45 A;  1USP B;  1M90 1;  2VPW A;  4A3K I;  1K73 1;  2O53 A;  2VF1 A;  3S14 I;  1W2B Z;  1Z02 A;  1L1O C;  3HOV I;  2QRE B;  4HH4 A;  5C4X I;  2J6A A;  3I4N I;  1VQ5 1;  3H3V J;  4XX2 A;  2QEX 1;  2HF1 A;  3GTO I;  4E32 A;  3CCL 1;  2R7Z I;  2DE5 A;  4NH1 C;  4A3G I;  1K9M 1;  4CL1 A;  3NH4 A;  1VQ5 Z;  3NFZ A;  2QEX Z;  2RHB A;  1VQN 1;  2JMO A;  1VQ7 1;  3CCE Z;  2F4O A;  2WB1 A;  1QVF Y;  2OTL 1;  1VQN Z;  1VQ7 Z;  3T4N B;  3CC4 Z;  2RPR A;  1X3Z A;  4MD9 A;  4Y7N I;  1TWA I;  4MH4 A;  5A2Q b;  5AN9 F;  1VQM 1;  3K7A I;  1FDI A;  4RV9 A;  2LEX A;  2E2I I;  3PO3 I;  5IT9 f;  3S1M I;  3GTG I;  2K3R A;  5A2Q f;  4NBD A;  3CCU 1;  2NVX I;  1P9N A;  1TWH I;  1RO2 A;  3CCU Z;  2E9H A;  4A3M I;  1DL6 A;  4E2Z A;  3VMH A;  1QXF A;  1Q7Y 2;  2ZAE B;  3VTN A;  3FKI I;  3TE5 B;  2F4M A;  2JIP A;  5D1O B;  3I56 1;  3VMI A;  3EED A;  1M1K 2;  3S15 I;  1ZH1 A; 
#chains in the Genus database with same CATH homology
 2O4H A;  3J7A 4;  1Q7Y 1;  4AYB A;  2PMZ A;  2KPI A;  2JUB A;  5FLM I;  2K5R A;  1NUI A;  3HOX I;  1X3W A;  1QVF Z;  3NDI A;  1NJI 2;  2OOY B;  1YHQ 1;  2JS4 A;  2JR6 A;  2IZ3 A;  4E2W A;  1WCM I;  3TDH B;  4BY7 I;  1RO0 A;  3G71 1;  1SFO I;  1VQ9 1;  3CQZ I;  3QWU A;  1YIT Z;  1PFT A;  4NBH A;  3J81 f;  3CCJ 1;  1VQ9 Z;  1YJ9 Z;  1VQ8 Z;  1NJI 1;  1Y1V S;  5LL6 f;  3GTM I;  1I6H I;  2R92 I;  2AKL A;  3CCQ 1;  2G2K A;  4RVH A;  4NB9 A;  2QA4 1;  1VQK 1;  2W04 A;  3F3F C;  4NBE A;  2V8J A;  1TWF I;  1VQK Z;  2QA4 Z;  1ZB8 A;  4A3I I;  3MZK B;  3IF8 A;  3GTJ I;  4QTU A;  3J80 b;  3CCM 1;  3JAM b;  3CCL Z;  4TNU A;  4NB8 A;  4Y52 I;  1YI2 1;  1Y1V I;  1Q86 1;  1YIJ 1;  4RS4 A;  3JAM f;  1YUK A;  2OTL Z;  1YI2 Z;  2E2H I;  2BJO A;  1Z03 A;  2LIY A;  2OZK A;  1VQL 1;  1JJ2 Y;  2GTI A;  3CC7 1;  4X6A I;  1VQO 1;  1QF8 A;  4E31 A;  5C4J I;  1Q82 2;  3CD6 1;  1VQP 1;  2RT9 A;  3OW2 Y;  1VQM Z;  4MRI A;  1NP6 A;  4NBA A;  2Q51 A;  1R9T I;  3CD6 Z;  3CXC Y;  4A3J I;  3RZD I;  2WAQ A;  2V8K A;  2V8I A;  4EWC A;  1S7M A;  2IZ4 A;  1I50 I;  2M48 A;  2HU9 A;  2Q4Z A;  3U50 C;  5C44 I;  1Q82 1;  5IP9 I;  3M3Y I;  3S1Q I;  2RIQ A;  4HGY A;  3D9X A;  2JA8 I;  3G6E 1;  4A3C I;  1Z01 A;  1TFI A;  3I56 Z;  3MON A;  3GCF A;  5CM2 M;  3BG0 B;  4E2X A;  1KD1 2;  3CCS 1;  3VB9 A;  4NOZ A;  3KIH A;  3HOU I;  5T64 A;  2E2J I;  2GTH A;  4DQY B;  1VQ4 1;  2VUG A;  3I07 A;  4DK1 A;  3F3P C;  1N8R 1;  3CCV 1;  4A3E I;  3S1N I;  3I4M I;  2QRC B;  3S16 I;  3G4S 1;  1YHQ Z;  3I55 1;  4HGZ A;  1KD1 1;  1JJ2 Z;  3CMA 1;  1K8A 2;  1KQS Y;  5FLX b;  1VQ6 1;  2PM9 A;  3I55 Z;  3G71 Z;  3IX0 A;  3D6W A;  4RVG A;  3CME 1;  1USP A;  3OW2 Z;  3S1R I;  3LUS A;  1Y1W I;  1VQ6 Z;  1S72 1;  3CCJ Z;  3NH5 A;  2H85 A;  2QLV B;  4MD7 A;  3CXC Z;  3CC2 1;  5FLX f;  4NBC A;  4A3F I;  5C3E I;  2JA7 I;  1Q86 2;  1VLA A;  1YJW 1;  4BBS I;  2PK7 A;  1K8A 1;  1QVG Y;  3CCQ Z;  1K83 I;  3GTL I;  5T6B A;  2DE7 A;  2OTJ 1;  3KIF A;  4NBF A;  1JWH C;  1RNI A;  1YUA A;  2YAD A;  4NBG A;  2OTJ Z;  4NFR A;  3CCM Z;  3FQM A;  2NVY I;  5D1P A;  1WII A;  1ZB9 A;  3J80 f;  3HOY I;  3CCE 1;  1YIJ Z;  4S1T A;  2LFU A;  3GTP I;  1N2F A;  2OOX B;  1QYP A;  3PO3 S;  3CC4 1;  1YJN 1;  2I3C A;  1VQL Z;  2W03 A;  2NVQ I;  4MXU A;  2QRD B;  3CC7 Z;  1YJN Z;  4NBB A;  4A93 I;  3CCR 1;  1VQO Z;  3GTQ I;  4RVF A;  2R6M A;  4MON A;  1VQP Z;  5IT9 b;  1Q81 2;  2RBL A;  3CCR Z;  4A3B I;  3NH8 A;  3IFU A;  4E30 A;  1KQS Z;  2JA6 I;  2Y0S A;  4RVD A;  3CPW Y;  3BG1 B;  3EER A;  4QTT A;  5D1O A;  1RO4 A;  3S2D I;  2P3Y A;  1W2B Y;  1Q81 1;  1N8R 2;  3G6E Z;  1QVG Z;  1X0T A;  3PO2 I;  2JA5 I;  3GTK I;  3NDJ A;  1KC8 2;  3MZL B;  3VMG A;  2YU9 I;  2QKD A;  2NVT I;  4DGL A;  1ML8 A;  3CCS Z;  3HOW I;  2KI7 B;  3S17 I;  2QR1 B;  2B63 I;  1WW9 A;  4BBR I;  2JNY A;  4A3D I;  1VQ4 Z;  1TWC I;  3FQQ A;  3CCV Z;  3H0G I;  1KRL A;  3ESW A;  1KC8 1;  3HOZ I;  3G4S Z;  4BY1 I;  3GTM S;  3M4O I;  3CMA Z;  1RLY A;  1RQF A;  1M90 2;  3S2H I;  1M1K 1;  1I3Q I;  3RZO I;  3Q87 A;  1K73 2;  5T67 A;  2M6N A;  3J81 b;  2VUM I;  1TWG I;  3CME Z;  1LQL A;  2GU2 A;  2EGT A;  4A3L I;  1YIT 1;  5IP7 I;  4E2Y A;  1S72 Z;  2P28 A;  1YJ9 1;  3GKQ A;  1VQ8 1;  3P5J B;  4MD8 A;  3CC2 Z;  3CPW Z;  2DE6 A;  4E33 A;  2R93 I;  3HKZ A;  1YJW Z;  1K9M 2;  4BXX I;  1USP B;  1M90 1;  4A3K I;  1K73 1;  2O53 A;  2VF1 A;  3S14 I;  1W2B Z;  1Z02 A;  1L1O C;  3HOV I;  2QRE B;  4HH4 A;  5C4X I;  2J6A A;  3I4N I;  1VQ5 1;  3H3V J;  4XX2 A;  2QEX 1;  2HF1 A;  3GTO I;  4E32 A;  3CCL 1;  2R7Z I;  2DE5 A;  4NH1 C;  4A3G I;  1K9M 1;  4CL1 A;  3NH4 A;  1VQ5 Z;  3NFZ A;  2QEX Z;  2RHB A;  1VQN 1;  2JMO A;  1VQ7 1;  3CCE Z;  2F4O A;  2WB1 A;  1QVF Y;  2OTL 1;  1VQN Z;  1VQ7 Z;  3T4N B;  3CC4 Z;  2RPR A;  1X3Z A;  4MD9 A;  4Y7N I;  1TWA I;  4MH4 A;  5A2Q b;  5AN9 F;  1VQM 1;  3K7A I;  4RV9 A;  2E2I I;  3PO3 I;  5IT9 f;  3S1M I;  3GTG I;  2K3R A;  5A2Q f;  4NBD A;  3CCU 1;  2NVX I;  1P9N A;  1TWH I;  1RO2 A;  3CCU Z;  2E9H A;  4A3M I;  1DL6 A;  4E2Z A;  3VMH A;  1Q7Y 2;  2ZAE B;  3VTN A;  3FKI I;  3TE5 B;  2F4M A;  5D1O B;  3I56 1;  3VMI A;  3EED A;  1M1K 2;  3S15 I;  1ZH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...