1K732

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73200
3CCM1 1YJWZ 3CC21 3CCEZ 3I551 1K732 3CC4Z 1VQMZ 1JJ2Y 1KQSY 3CMA1 1VQP1 1W2BY 1K9M1 3CC71 1YJW1 3CCUZ 1NJI1 1VQ5Z 1Q822 1K8A2 3CC41 1VQM1 1VQ9Z 3OW2Z 3CCMZ 1VQLZ 1KC82 1YI2Z 3CCQZ 2QEXZ 1YJ91 1N8R2 3CXCZ 1VQ91 3CCL1 3CME1 1VQL1 1M901 1YI21 3CCQ1 2QEX1 3CCVZ 1QVGZ 3OW2Y 3G4SZ 1S72Z 1YHQZ 1Q7Y2 1VQNZ 1YJ9Z 1K731 1YJNZ 3CCLZ 3CCV1 3CXCY 1M1K1 3I561 3CMEZ 1VQKZ 1Q861 1QVFZ 3G4S1 1S721 1YHQ1 1K9M2 1VQ6Z 1VQN1 3CPWZ 1KD11 1YJN1 1NJI2 1VQ7Z 1QVGY 1VQK1 1YIJZ 3G6EZ 1N8R1 1VQ61 1Q811 1VQ8Z 2OTLZ 3CCRZ 3I56Z 3CCSZ 1JJ2Z 1VQ71 1QVFY 1YIJ1 3G6E1 1VQ81 3CPWY 2OTL1 3CCR1 3CCS1 3G71Z 1Q7Y1 1Q821 2OTJZ 1K8A1 1YITZ 1VQO1 3CCJ1 1KC81 1VQ4Z 3G711 1M1K2 1Q862 2OTJ1 3CCE1 1YIT1 2QA4Z 3CD6Z 1KQSZ 1KD12 1VQ41 1W2BZ 1M902 3CC2Z 3I55Z 3CCU1 1VQOZ 3CCJZ 1VQ51 2QA41 3CD61 1Q812 3CMAZ 1VQPZ 3CC7Z
chains in the Genus database with same CATH superfamily
1R9TI 2ZAEB 3CCM1 2YADA 1TWFI 3CCEZ 2LEXA 1VQMZ 1JJ2Y 5IP7I 4NB8A 2NAPA 1K9M1 4NBFA 4A3CI 3FQQA 5T64A 1X3ZA 4NBEA 1NJI1 1Q822 3CC41 3J7A4 2V8IA 1Z03A 5D1OA 1VQLZ 3GTGI 2JIOA 4HH4A 4NFRA 3VTNA 4A3MI 3CXCZ 2AKLA 2AYDA 2E2II 3PO2I 3CME1 1M901 1RO2A 2VF1A 3NH8A 2QKDA 4A3FI 4QTTA 5C44I 3J80b 2WAQA 3HOWI 1VQNZ 3CCLZ 3IX0A 3CCV1 3H3VJ 1M1K1 4BY7I 1Q861 1QVFZ 1K9M2 3I4NI 1FDIA 4NH1C 1AA6A 2VPXA 1NJI2 1QVGY 3S1MI 3J81b 4MRIA 1TWGI 2JA7I 1VQ61 2O4HA 2OTLZ 3I56Z 4RVHA 5CM2M 1VQ71 3G6E1 2JA8I 1RO4A 4E31A 2JIRA 3GTPI 3F3PC 3CCS1 4CL1A 1NP6A 3S1RI 3HOYI 1WW9A 1Q7Y1 3NDJA 2VPZA 1K8A1 2J6AA 1VQO1 2RBLA 1KC81 1VQ4Z 1NUIA 3G711 1SIWA 3IF8A 1M1K2 3KIFA 1Q862 3IFUA 2Q4ZA 3S14I 3CCE1 2DE5A 2R93I 3CD6Z 2E2JI 2QR1B 3P5JB 2QA41 4RVFA 1RQFA 3Q87A 3CMAZ 2IV2X 3CC7Z 3J81f 2K3RA 3RZDI 1YJWZ 3CC21 3GTQI 3I551 1JWHC 1Y1VS 4A3GI 1K732 1VQP1 1W2BY 5FLXf 1YUAA 2V8JA 2R6MA 1VQ5Z 2KI7B 3NH5A 1K8A2 2HF1A 1KC82 3GTMS 1L1OC 4HGYA 2QEXZ 1N8R2 3I4MI 1VQ91 3CCL1 1I50I 1YI21 4NBCA 2P28A 3CCQ1 2RT9A 1DL6A 1S7MA 2RPRA 1USPA 1QVGZ 3VMHA 4Y52I 1S72Z 4A3LI 2V45A 2QRDB 3U50C 1YJ9Z 1YJNZ 2F4OA 5IP9I 4A3DI 3I561 4A3KI 1PFTA 3EERA 3G4S1 3S1NI 1YHQ1 2E9HA 2VUMI 4EWCA 4AYBA 3CQZI 4RV9A 3FKII 3TDHB 3S15I 3HOVI 3JAMb 1VQK1 5FLMI 4A3II 4NBDA 1Y1WI 1Z02A 2OOXB 1VQ8Z 1YIJ1 3CPWY 2DE6A 1QYPA 3GTOI 3CCR1 3M3YI 1X0TA 2OTJZ 1YUKA 3EEDA 3S1QI 2HU9A 1YITZ 4X6AI 5LL6f 3VB9A 1Q16A 2M6NA 1ZB9A 2V8KA 1RLYA 2JMOA 5C3EI 4TNUA 2GTHA 1W2BZ 2R7ZI 3QWUA 2JIPA 5FLXb 1M902 2JA5I 3CCJZ 1VQ51 1KRLA 4E32A 2H85A 2PM9A 2R92I 3JAMf 3HOXI 3S2DI 3IR7A 4HGZA 1QXFA 5D1OB 2F4MA 4E33A 1QF8A 2P3YA 3NDIA 3CC4Z 1KQSY 3GTMI 4Y7NI 5T6BA 2NVTI 1VQM1 3TE5B 3D6WA 2PMZA 1WIIA 5T67A 1I6HI 3GTJI 3MZKB 2IZ4A 1YJ91 3T4NB 4A93I 2E7ZA 3LUSA 1VQL1 2Q51A 4MH4A 4E30A 5C4JI 3CCVZ 4A3EI 3F3FC 3OW2Y 2KPIA 1TWCI 2VPYA 4MXUA 2K5RA 1Q7Y2 4BBSI 3BG0B 3I07A 4BXXI 1I3QI 1TWAI 2NVYI 1VQ6Z 2GTIA 2QREB 3CPWZ 1VQN1 1KD11 1VQ7Z 4NOZA 3ESWA 2M48A 1RO0A 3G6EZ 2JR6A 4E2WA 1RNIA 5A2Qf 4DK1A 3H0GI 1N2FA 3CCSZ 4E2XA 4MD8A 1Z01A 2BJOA 2IZ3A 4RVGA 2OTL1 1ML8A 2PK7A 3G71Z 2B63I 3HOUI 3M4OI 2RIQA 3S2HI 3CCJ1 4XX2A 4BBRI 2JS4A 3GTKI 3GKQA 4NBGA 2VPWA 2QA4Z 1KQSZ 1KD12 1TWHI 1VQ41 4A3BI 3CC2Z 2JNYA 1X3WA 3D9XA 3I55Z 5C4XI 3CD61 3S16I 1VQPZ 5D1PA 2JA6I 5AN9F 3KIHA 3PO3S 4NB9A 3CMA1 2W03A 4BY1I 3CC71 1YJW1 3CCUZ 4E2ZA 2JIMA 1VQ9Z 3OW2Z 2GU2A 4E2YA 3CCMZ 2V3VA 1YI2Z 1USPB 3K7AI 4NBBA 1Y1VI 3CCQZ 3S17I 1WCMI 2NVXI 3D2LA 1P9NA 2G2KA 2W04A 3HOZI 1K83I 4RS4A 1WJ2A 2QEX1 1SFOI 2QRCB 1Y8CA 3G4SZ 2I3CA 1YHQZ 1TFIA 2OOYB 2LFUA 4RVDA 2EGTA 4A3JI 1K731 5A2Qb 3RZOI 2JUBA 3CXCY 5IT9b 2E2HI 2DE7A 3CMEZ 1VQKZ 1S721 2JIQA 4MD9A 4DQYB 4QTUA 2O53A 1FDOA 1YJN1 4MD7A 4DGLA 3GTLI 3J80f 1YIJZ 3MONA 1ZB8A 2VUGA 1N8R1 1Q811 3CCRZ 2YU9I 1JJ2Z 3NH4A 1QVFY 3VMGA 2RHBA 1WZNA 2Y0SA 1VQ81 3NFZA 3BG1B 4NBAA 3VMIA 3GCFA 1Q821 3HKZA 2OTJ1 2OZKA 1YIT1 1ZH1A 5IT9f 4NBHA 2NVQI 3FQMA 3MZLB 1VLAA 3CCU1 1VQOZ 2QLVB 4MONA 2WB1A 2LIYA 3PO3I 1Q812 4S1TA 1LQLA
chains in the Genus database with same CATH topology
1R9TI 2ZAEB 3CCM1 2YADA 1TWFI 3CCEZ 1VQMZ 1JJ2Y 5IP7I 4NB8A 1K9M1 4NBFA 4A3CI 3FQQA 5T64A 1X3ZA 4NBEA 1NJI1 1Q822 3CC41 3J7A4 2V8IA 1Z03A 5D1OA 1VQLZ 3GTGI 4HH4A 4NFRA 3VTNA 4A3MI 3CXCZ 2AKLA 2E2II 3PO2I 3CME1 1M901 1RO2A 2VF1A 3NH8A 2QKDA 4A3FI 4QTTA 5C44I 3J80b 2WAQA 3HOWI 1VQNZ 3CCLZ 3IX0A 3CCV1 3H3VJ 1M1K1 4BY7I 1Q861 1QVFZ 1K9M2 3I4NI 4NH1C 1NJI2 1QVGY 3S1MI 3J81b 4MRIA 1TWGI 2JA7I 1VQ61 2O4HA 2OTLZ 3I56Z 4RVHA 5CM2M 1VQ71 3G6E1 2JA8I 1RO4A 4E31A 3GTPI 3F3PC 3CCS1 4CL1A 1NP6A 3S1RI 3HOYI 1WW9A 1Q7Y1 3NDJA 1K8A1 2J6AA 1VQO1 2RBLA 1KC81 1VQ4Z 1NUIA 3G711 3IF8A 1M1K2 3KIFA 1Q862 3IFUA 2Q4ZA 3S14I 3CCE1 2DE5A 2R93I 3CD6Z 2E2JI 2QR1B 3P5JB 2QA41 4RVFA 1RQFA 3Q87A 3CMAZ 3CC7Z 3J81f 2K3RA 3RZDI 1YJWZ 3CC21 3GTQI 3I551 1JWHC 1Y1VS 4A3GI 1K732 1VQP1 1W2BY 5FLXf 1YUAA 2V8JA 2R6MA 1VQ5Z 2KI7B 3NH5A 1K8A2 2HF1A 1KC82 3GTMS 1L1OC 4HGYA 2QEXZ 1N8R2 3I4MI 1VQ91 3CCL1 1I50I 1YI21 4NBCA 2P28A 3CCQ1 2RT9A 1DL6A 1S7MA 2RPRA 1USPA 1QVGZ 3VMHA 4Y52I 1S72Z 4A3LI 2QRDB 3U50C 1YJ9Z 1YJNZ 2F4OA 5IP9I 4A3DI 3I561 4A3KI 1PFTA 3EERA 3G4S1 3S1NI 1YHQ1 2E9HA 2VUMI 4EWCA 4AYBA 3CQZI 4RV9A 3FKII 3TDHB 3S15I 3HOVI 3JAMb 1VQK1 5FLMI 4A3II 4NBDA 1Y1WI 1Z02A 2OOXB 1VQ8Z 1YIJ1 3CPWY 2DE6A 1QYPA 3GTOI 3CCR1 3M3YI 1X0TA 2OTJZ 1YUKA 3EEDA 3S1QI 2HU9A 1YITZ 4X6AI 5LL6f 3VB9A 2M6NA 1ZB9A 2V8KA 1RLYA 2JMOA 5C3EI 4TNUA 2GTHA 1W2BZ 2R7ZI 3QWUA 5FLXb 1M902 2JA5I 1VQ51 3CCJZ 1KRLA 4E32A 2H85A 2PM9A 2R92I 3JAMf 3HOXI 3S2DI 4HGZA 5D1OB 2F4MA 4E33A 1QF8A 2P3YA 3NDIA 3CC4Z 1KQSY 3GTMI 4Y7NI 5T6BA 2NVTI 1VQM1 3TE5B 3D6WA 2PMZA 1WIIA 5T67A 1I6HI 3GTJI 3MZKB 2IZ4A 1YJ91 3T4NB 4A93I 3LUSA 1VQL1 2Q51A 4MH4A 4E30A 5C4JI 3CCVZ 4A3EI 3F3FC 3OW2Y 2KPIA 1TWCI 4MXUA 2K5RA 1Q7Y2 4BBSI 3BG0B 3I07A 4BXXI 1I3QI 1TWAI 2NVYI 1VQ6Z 2GTIA 2QREB 3CPWZ 1VQN1 1KD11 1VQ7Z 4NOZA 3ESWA 2M48A 1RO0A 3G6EZ 2JR6A 4E2WA 1RNIA 5A2Qf 4DK1A 3H0GI 1N2FA 3CCSZ 4E2XA 4MD8A 1Z01A 2BJOA 2IZ3A 4RVGA 2OTL1 1ML8A 2PK7A 3G71Z 2B63I 3HOUI 3M4OI 2RIQA 3S2HI 3CCJ1 4XX2A 4BBRI 2JS4A 3GTKI 3GKQA 4NBGA 2QA4Z 1KQSZ 1KD12 1TWHI 1VQ41 4A3BI 3CC2Z 2JNYA 1X3WA 3D9XA 3I55Z 5C4XI 3CD61 3S16I 1VQPZ 5D1PA 2JA6I 5AN9F 3KIHA 3PO3S 4NB9A 3CMA1 2W03A 4BY1I 3CC71 1YJW1 3CCUZ 4E2ZA 1VQ9Z 3OW2Z 2GU2A 4E2YA 3CCMZ 1YI2Z 1USPB 3K7AI 4NBBA 1Y1VI 3CCQZ 3S17I 1WCMI 2NVXI 1P9NA 2G2KA 2W04A 3HOZI 1K83I 4RS4A 2QEX1 1SFOI 2QRCB 3G4SZ 2I3CA 1YHQZ 1TFIA 2OOYB 2LFUA 4RVDA 2EGTA 4A3JI 1K731 5A2Qb 3RZOI 2JUBA 3CXCY 5IT9b 2E2HI 2DE7A 3CMEZ 1VQKZ 1S721 4MD9A 4DQYB 4QTUA 2O53A 1YJN1 4MD7A 4DGLA 3GTLI 3J80f 1YIJZ 3MONA 1ZB8A 2VUGA 1N8R1 1Q811 3CCRZ 2YU9I 1JJ2Z 3NH4A 1QVFY 3VMGA 2RHBA 2Y0SA 1VQ81 3NFZA 3BG1B 4NBAA 3VMIA 3GCFA 1Q821 3HKZA 2OTJ1 2OZKA 1YIT1 1ZH1A 5IT9f 4NBHA 2NVQI 3FQMA 3MZLB 1VLAA 3CCU1 1VQOZ 2QLVB 4MONA 2WB1A 2LIYA 3PO3I 1Q812 4S1TA 1LQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM 1;  1YJW Z;  3CC2 1;  3CCE Z;  3I55 1;  1K73 2;  3CC4 Z;  1VQM Z;  1JJ2 Y;  1KQS Y;  3CMA 1;  1VQP 1;  1W2B Y;  1K9M 1;  3CC7 1;  1YJW 1;  3CCU Z;  1NJI 1;  1VQ5 Z;  1Q82 2;  1K8A 2;  3CC4 1;  1VQM 1;  1VQ9 Z;  3OW2 Z;  3CCM Z;  1VQL Z;  1KC8 2;  1YI2 Z;  3CCQ Z;  2QEX Z;  1YJ9 1;  1N8R 2;  3CXC Z;  1VQ9 1;  3CCL 1;  3CME 1;  1VQL 1;  1M90 1;  1YI2 1;  3CCQ 1;  2QEX 1;  3CCV Z;  1QVG Z;  3OW2 Y;  3G4S Z;  1S72 Z;  1YHQ Z;  1Q7Y 2;  1VQN Z;  1YJ9 Z;  1K73 1;  1YJN Z;  3CCL Z;  3CCV 1;  3CXC Y;  1M1K 1;  3I56 1;  3CME Z;  1VQK Z;  1Q86 1;  1QVF Z;  3G4S 1;  1S72 1;  1YHQ 1;  1K9M 2;  1VQ6 Z;  1VQN 1;  3CPW Z;  1KD1 1;  1YJN 1;  1NJI 2;  1VQ7 Z;  1QVG Y;  1VQK 1;  1YIJ Z;  3G6E Z;  1N8R 1;  1VQ6 1;  1Q81 1;  1VQ8 Z;  2OTL Z;  3CCR Z;  3I56 Z;  3CCS Z;  1JJ2 Z;  1VQ7 1;  1QVF Y;  1YIJ 1;  3G6E 1;  1VQ8 1;  3CPW Y;  2OTL 1;  3CCR 1;  3CCS 1;  3G71 Z;  1Q7Y 1;  1Q82 1;  2OTJ Z;  1K8A 1;  1YIT Z;  1VQO 1;  3CCJ 1;  1KC8 1;  1VQ4 Z;  3G71 1;  1M1K 2;  1Q86 2;  2OTJ 1;  3CCE 1;  1YIT 1;  2QA4 Z;  3CD6 Z;  1KQS Z;  1KD1 2;  1VQ4 1;  1W2B Z;  1M90 2;  3CC2 Z;  3I55 Z;  3CCU 1;  1VQO Z;  3CCJ Z;  1VQ5 1;  2QA4 1;  3CD6 1;  1Q81 2;  3CMA Z;  1VQP Z;  3CC7 Z; 
#chains in the Genus database with same CATH topology
 1R9T I;  2ZAE B;  3CCM 1;  2YAD A;  1TWF I;  3CCE Z;  2LEX A;  1VQM Z;  1JJ2 Y;  5IP7 I;  4NB8 A;  2NAP A;  1K9M 1;  4NBF A;  4A3C I;  3FQQ A;  5T64 A;  1X3Z A;  4NBE A;  1NJI 1;  1Q82 2;  3CC4 1;  3J7A 4;  2V8I A;  1Z03 A;  5D1O A;  1VQL Z;  3GTG I;  2JIO A;  4HH4 A;  4NFR A;  3VTN A;  4A3M I;  3CXC Z;  2AKL A;  2AYD A;  2E2I I;  3PO2 I;  3CME 1;  1M90 1;  1RO2 A;  2VF1 A;  3NH8 A;  2QKD A;  4A3F I;  4QTT A;  5C44 I;  3J80 b;  2WAQ A;  3HOW I;  1VQN Z;  3CCL Z;  3IX0 A;  3CCV 1;  3H3V J;  1M1K 1;  4BY7 I;  1Q86 1;  1QVF Z;  1K9M 2;  3I4N I;  1FDI A;  4NH1 C;  1AA6 A;  2VPX A;  1NJI 2;  1QVG Y;  3S1M I;  3J81 b;  4MRI A;  1TWG I;  2JA7 I;  1VQ6 1;  2O4H A;  2OTL Z;  3I56 Z;  4RVH A;  5CM2 M;  1VQ7 1;  3G6E 1;  2JA8 I;  1RO4 A;  4E31 A;  2JIR A;  3GTP I;  3F3P C;  3CCS 1;  4CL1 A;  1NP6 A;  3S1R I;  3HOY I;  1WW9 A;  1Q7Y 1;  3NDJ A;  2VPZ A;  1K8A 1;  2J6A A;  1VQO 1;  2RBL A;  1KC8 1;  1VQ4 Z;  1NUI A;  3G71 1;  1SIW A;  3IF8 A;  1M1K 2;  3KIF A;  1Q86 2;  3IFU A;  2Q4Z A;  3S14 I;  3CCE 1;  2DE5 A;  2R93 I;  3CD6 Z;  2E2J I;  2QR1 B;  3P5J B;  2QA4 1;  4RVF A;  1RQF A;  3Q87 A;  3CMA Z;  2IV2 X;  3CC7 Z;  3J81 f;  2K3R A;  3RZD I;  1YJW Z;  3CC2 1;  3GTQ I;  3I55 1;  1JWH C;  1Y1V S;  4A3G I;  1K73 2;  1VQP 1;  1W2B Y;  5FLX f;  1YUA A;  2V8J A;  2R6M A;  1VQ5 Z;  2KI7 B;  3NH5 A;  1K8A 2;  2HF1 A;  1KC8 2;  3GTM S;  1L1O C;  4HGY A;  2QEX Z;  1N8R 2;  3I4M I;  1VQ9 1;  3CCL 1;  1I50 I;  1YI2 1;  4NBC A;  2P28 A;  3CCQ 1;  2RT9 A;  1DL6 A;  1S7M A;  2RPR A;  1USP A;  1QVG Z;  3VMH A;  4Y52 I;  1S72 Z;  4A3L I;  2V45 A;  2QRD B;  3U50 C;  1YJ9 Z;  1YJN Z;  2F4O A;  5IP9 I;  4A3D I;  3I56 1;  4A3K I;  1PFT A;  3EER A;  3G4S 1;  3S1N I;  1YHQ 1;  2E9H A;  2VUM I;  4EWC A;  4AYB A;  3CQZ I;  4RV9 A;  3FKI I;  3TDH B;  3S15 I;  3HOV I;  3JAM b;  1VQK 1;  5FLM I;  4A3I I;  4NBD A;  1Y1W I;  1Z02 A;  2OOX B;  1VQ8 Z;  1YIJ 1;  3CPW Y;  2DE6 A;  1QYP A;  3GTO I;  3CCR 1;  3M3Y I;  1X0T A;  2OTJ Z;  1YUK A;  3EED A;  3S1Q I;  2HU9 A;  1YIT Z;  4X6A I;  5LL6 f;  3VB9 A;  1Q16 A;  2M6N A;  1ZB9 A;  2V8K A;  1RLY A;  2JMO A;  5C3E I;  4TNU A;  2GTH A;  1W2B Z;  2R7Z I;  3QWU A;  2JIP A;  5FLX b;  1M90 2;  2JA5 I;  3CCJ Z;  1VQ5 1;  1KRL A;  4E32 A;  2H85 A;  2PM9 A;  2R92 I;  3JAM f;  3HOX I;  3S2D I;  3IR7 A;  4HGZ A;  1QXF A;  5D1O B;  2F4M A;  4E33 A;  1QF8 A;  2P3Y A;  3NDI A;  3CC4 Z;  1KQS Y;  3GTM I;  4Y7N I;  5T6B A;  2NVT I;  1VQM 1;  3TE5 B;  3D6W A;  2PMZ A;  1WII A;  5T67 A;  1I6H I;  3GTJ I;  3MZK B;  2IZ4 A;  1YJ9 1;  3T4N B;  4A93 I;  2E7Z A;  3LUS A;  1VQL 1;  2Q51 A;  4MH4 A;  4E30 A;  5C4J I;  3CCV Z;  4A3E I;  3F3F C;  3OW2 Y;  2KPI A;  1TWC I;  2VPY A;  4MXU A;  2K5R A;  1Q7Y 2;  4BBS I;  3BG0 B;  3I07 A;  4BXX I;  1I3Q I;  1TWA I;  2NVY I;  1VQ6 Z;  2GTI A;  2QRE B;  3CPW Z;  1VQN 1;  1KD1 1;  1VQ7 Z;  4NOZ A;  3ESW A;  2M48 A;  1RO0 A;  3G6E Z;  2JR6 A;  4E2W A;  1RNI A;  5A2Q f;  4DK1 A;  3H0G I;  1N2F A;  3CCS Z;  4E2X A;  4MD8 A;  1Z01 A;  2BJO A;  2IZ3 A;  4RVG A;  2OTL 1;  1ML8 A;  2PK7 A;  3G71 Z;  2B63 I;  3HOU I;  3M4O I;  2RIQ A;  3S2H I;  3CCJ 1;  4XX2 A;  4BBR I;  2JS4 A;  3GTK I;  3GKQ A;  4NBG A;  2VPW A;  2QA4 Z;  1KQS Z;  1KD1 2;  1TWH I;  1VQ4 1;  4A3B I;  3CC2 Z;  2JNY A;  1X3W A;  3D9X A;  3I55 Z;  5C4X I;  3CD6 1;  3S16 I;  1VQP Z;  5D1P A;  2JA6 I;  5AN9 F;  3KIH A;  3PO3 S;  4NB9 A;  3CMA 1;  2W03 A;  4BY1 I;  3CC7 1;  1YJW 1;  3CCU Z;  4E2Z A;  2JIM A;  1VQ9 Z;  3OW2 Z;  2GU2 A;  4E2Y A;  3CCM Z;  2V3V A;  1YI2 Z;  1USP B;  3K7A I;  4NBB A;  1Y1V I;  3CCQ Z;  3S17 I;  1WCM I;  2NVX I;  3D2L A;  1P9N A;  2G2K A;  2W04 A;  3HOZ I;  1K83 I;  4RS4 A;  1WJ2 A;  2QEX 1;  1SFO I;  2QRC B;  1Y8C A;  3G4S Z;  2I3C A;  1YHQ Z;  1TFI A;  2OOY B;  2LFU A;  4RVD A;  2EGT A;  4A3J I;  1K73 1;  5A2Q b;  3RZO I;  2JUB A;  3CXC Y;  5IT9 b;  2E2H I;  2DE7 A;  3CME Z;  1VQK Z;  1S72 1;  2JIQ A;  4MD9 A;  4DQY B;  4QTU A;  2O53 A;  1FDO A;  1YJN 1;  4MD7 A;  4DGL A;  3GTL I;  3J80 f;  1YIJ Z;  3MON A;  1ZB8 A;  2VUG A;  1N8R 1;  1Q81 1;  3CCR Z;  2YU9 I;  1JJ2 Z;  3NH4 A;  1QVF Y;  3VMG A;  2RHB A;  1WZN A;  2Y0S A;  1VQ8 1;  3NFZ A;  3BG1 B;  4NBA A;  3VMI A;  3GCF A;  1Q82 1;  3HKZ A;  2OTJ 1;  2OZK A;  1YIT 1;  1ZH1 A;  5IT9 f;  4NBH A;  2NVQ I;  3FQM A;  3MZL B;  1VLA A;  3CCU 1;  1VQO Z;  2QLV B;  4MON A;  2WB1 A;  2LIY A;  3PO3 I;  1Q81 2;  4S1T A;  1LQL A; 
#chains in the Genus database with same CATH homology
 1R9T I;  2ZAE B;  3CCM 1;  2YAD A;  1TWF I;  3CCE Z;  1VQM Z;  1JJ2 Y;  5IP7 I;  4NB8 A;  1K9M 1;  4NBF A;  4A3C I;  3FQQ A;  5T64 A;  1X3Z A;  4NBE A;  1NJI 1;  1Q82 2;  3CC4 1;  3J7A 4;  2V8I A;  1Z03 A;  5D1O A;  1VQL Z;  3GTG I;  4HH4 A;  4NFR A;  3VTN A;  4A3M I;  3CXC Z;  2AKL A;  2E2I I;  3PO2 I;  3CME 1;  1M90 1;  1RO2 A;  2VF1 A;  3NH8 A;  2QKD A;  4A3F I;  4QTT A;  5C44 I;  3J80 b;  2WAQ A;  3HOW I;  1VQN Z;  3CCL Z;  3IX0 A;  3CCV 1;  3H3V J;  1M1K 1;  4BY7 I;  1Q86 1;  1QVF Z;  1K9M 2;  3I4N I;  4NH1 C;  1NJI 2;  1QVG Y;  3S1M I;  3J81 b;  4MRI A;  1TWG I;  2JA7 I;  1VQ6 1;  2O4H A;  2OTL Z;  3I56 Z;  4RVH A;  5CM2 M;  1VQ7 1;  3G6E 1;  2JA8 I;  1RO4 A;  4E31 A;  3GTP I;  3F3P C;  3CCS 1;  4CL1 A;  1NP6 A;  3S1R I;  3HOY I;  1WW9 A;  1Q7Y 1;  3NDJ A;  1K8A 1;  2J6A A;  1VQO 1;  2RBL A;  1KC8 1;  1VQ4 Z;  1NUI A;  3G71 1;  3IF8 A;  1M1K 2;  3KIF A;  1Q86 2;  3IFU A;  2Q4Z A;  3S14 I;  3CCE 1;  2DE5 A;  2R93 I;  3CD6 Z;  2E2J I;  2QR1 B;  3P5J B;  2QA4 1;  4RVF A;  1RQF A;  3Q87 A;  3CMA Z;  3CC7 Z;  3J81 f;  2K3R A;  3RZD I;  1YJW Z;  3CC2 1;  3GTQ I;  3I55 1;  1JWH C;  1Y1V S;  4A3G I;  1K73 2;  1VQP 1;  1W2B Y;  5FLX f;  1YUA A;  2V8J A;  2R6M A;  1VQ5 Z;  2KI7 B;  3NH5 A;  1K8A 2;  2HF1 A;  1KC8 2;  3GTM S;  1L1O C;  4HGY A;  2QEX Z;  1N8R 2;  3I4M I;  1VQ9 1;  3CCL 1;  1I50 I;  1YI2 1;  4NBC A;  2P28 A;  3CCQ 1;  2RT9 A;  1DL6 A;  1S7M A;  2RPR A;  1USP A;  1QVG Z;  3VMH A;  4Y52 I;  1S72 Z;  4A3L I;  2QRD B;  3U50 C;  1YJ9 Z;  1YJN Z;  2F4O A;  5IP9 I;  4A3D I;  3I56 1;  4A3K I;  1PFT A;  3EER A;  3G4S 1;  3S1N I;  1YHQ 1;  2E9H A;  2VUM I;  4EWC A;  4AYB A;  3CQZ I;  4RV9 A;  3FKI I;  3TDH B;  3S15 I;  3HOV I;  3JAM b;  1VQK 1;  5FLM I;  4A3I I;  4NBD A;  1Y1W I;  1Z02 A;  2OOX B;  1VQ8 Z;  1YIJ 1;  3CPW Y;  2DE6 A;  1QYP A;  3GTO I;  3CCR 1;  3M3Y I;  1X0T A;  2OTJ Z;  1YUK A;  3EED A;  3S1Q I;  2HU9 A;  1YIT Z;  4X6A I;  5LL6 f;  3VB9 A;  2M6N A;  1ZB9 A;  2V8K A;  1RLY A;  2JMO A;  5C3E I;  4TNU A;  2GTH A;  1W2B Z;  2R7Z I;  3QWU A;  5FLX b;  1M90 2;  2JA5 I;  1VQ5 1;  3CCJ Z;  1KRL A;  4E32 A;  2H85 A;  2PM9 A;  2R92 I;  3JAM f;  3HOX I;  3S2D I;  4HGZ A;  5D1O B;  2F4M A;  4E33 A;  1QF8 A;  2P3Y A;  3NDI A;  3CC4 Z;  1KQS Y;  3GTM I;  4Y7N I;  5T6B A;  2NVT I;  1VQM 1;  3TE5 B;  3D6W A;  2PMZ A;  1WII A;  5T67 A;  1I6H I;  3GTJ I;  3MZK B;  2IZ4 A;  1YJ9 1;  3T4N B;  4A93 I;  3LUS A;  1VQL 1;  2Q51 A;  4MH4 A;  4E30 A;  5C4J I;  3CCV Z;  4A3E I;  3F3F C;  3OW2 Y;  2KPI A;  1TWC I;  4MXU A;  2K5R A;  1Q7Y 2;  4BBS I;  3BG0 B;  3I07 A;  4BXX I;  1I3Q I;  1TWA I;  2NVY I;  1VQ6 Z;  2GTI A;  2QRE B;  3CPW Z;  1VQN 1;  1KD1 1;  1VQ7 Z;  4NOZ A;  3ESW A;  2M48 A;  1RO0 A;  3G6E Z;  2JR6 A;  4E2W A;  1RNI A;  5A2Q f;  4DK1 A;  3H0G I;  1N2F A;  3CCS Z;  4E2X A;  4MD8 A;  1Z01 A;  2BJO A;  2IZ3 A;  4RVG A;  2OTL 1;  1ML8 A;  2PK7 A;  3G71 Z;  2B63 I;  3HOU I;  3M4O I;  2RIQ A;  3S2H I;  3CCJ 1;  4XX2 A;  4BBR I;  2JS4 A;  3GTK I;  3GKQ A;  4NBG A;  2QA4 Z;  1KQS Z;  1KD1 2;  1TWH I;  1VQ4 1;  4A3B I;  3CC2 Z;  2JNY A;  1X3W A;  3D9X A;  3I55 Z;  5C4X I;  3CD6 1;  3S16 I;  1VQP Z;  5D1P A;  2JA6 I;  5AN9 F;  3KIH A;  3PO3 S;  4NB9 A;  3CMA 1;  2W03 A;  4BY1 I;  3CC7 1;  1YJW 1;  3CCU Z;  4E2Z A;  1VQ9 Z;  3OW2 Z;  2GU2 A;  4E2Y A;  3CCM Z;  1YI2 Z;  1USP B;  3K7A I;  4NBB A;  1Y1V I;  3CCQ Z;  3S17 I;  1WCM I;  2NVX I;  1P9N A;  2G2K A;  2W04 A;  3HOZ I;  1K83 I;  4RS4 A;  2QEX 1;  1SFO I;  2QRC B;  3G4S Z;  2I3C A;  1YHQ Z;  1TFI A;  2OOY B;  2LFU A;  4RVD A;  2EGT A;  4A3J I;  1K73 1;  5A2Q b;  3RZO I;  2JUB A;  3CXC Y;  5IT9 b;  2E2H I;  2DE7 A;  3CME Z;  1VQK Z;  1S72 1;  4MD9 A;  4DQY B;  4QTU A;  2O53 A;  1YJN 1;  4MD7 A;  4DGL A;  3GTL I;  3J80 f;  1YIJ Z;  3MON A;  1ZB8 A;  2VUG A;  1N8R 1;  1Q81 1;  3CCR Z;  2YU9 I;  1JJ2 Z;  3NH4 A;  1QVF Y;  3VMG A;  2RHB A;  2Y0S A;  1VQ8 1;  3NFZ A;  3BG1 B;  4NBA A;  3VMI A;  3GCF A;  1Q82 1;  3HKZ A;  2OTJ 1;  2OZK A;  1YIT 1;  1ZH1 A;  5IT9 f;  4NBH A;  2NVQ I;  3FQM A;  3MZL B;  1VLA A;  3CCU 1;  1VQO Z;  2QLV B;  4MON A;  2WB1 A;  2LIY A;  3PO3 I;  1Q81 2;  4S1T A;  1LQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...