1K732

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73200
1K8A1 1VQ8Z 3CCJZ 3CCQZ 3CCE1 1JJ2Y 3CXCZ 2OTLZ 1VQ5Z 3CPWY 2OTJZ 3G4SZ 3CCS1 1VQ7Z 3CCR1 1K732 1KQSY 1YHQZ 1VQL1 3CXCY 3CCSZ 1M1K1 1Q7Y2 1NJI1 3CCLZ 1YI21 3CD6Z 3CCQ1 1VQNZ 3I56Z 3CMA1 3G6E1 1M902 3CCV1 1YJ9Z 3CC7Z 3CCL1 1YI2Z 3G6EZ 1Q862 1VQN1 1KC81 3G711 3CCM1 1Q822 1N8R2 1VQ4Z 3CPWZ 1JJ2Z 3CMEZ 1VQKZ 1VQ71 1VQPZ 1VQ6Z 1YHQ1 1K9M1 1YIT1 1KD12 2OTL1 3CC2Z 3CCEZ 1VQ91 3CCJ1 1QVFZ 1Q811 3I561 1YJWZ 3OW2Y 1K731 1VQM1 3CC41 3CMAZ 1VQLZ 1KQSZ 1M1K2 2QEX1 3CCU1 1NJI2 1YITZ 1QVFY 1VQ51 1VQO1 1M901 1VQ41 1K8A2 1VQ81 1VQP1 2QA41 1VQK1 3CME1 1VQMZ 1QVGZ 1KC82 2OTJ1 1Q821 2QEXZ 1N8R1 1W2BY 3CCVZ 3OW2Z 1VQ9Z 1K9M2 1KD11 3CC21 1Q7Y1 1YJW1 2QA4Z 1VQOZ 1Q812 1S721 3G4S1 3CCMZ 1Q861 3CCRZ 3CCUZ 1VQ61 1S72Z 1QVGY 3CC71 1YJNZ 3I551 1YIJ1 1W2BZ 3CC4Z 3CD61 3G71Z 3I55Z 1YIJZ 1YJN1 1YJ91
chains in the Genus database with same CATH superfamily
3D2LA 2JA6I 2Q51A 1RO0A 2DE7A 2JA7I 3CCQZ 2DE5A 3CCE1 2JIRA 2W04A 3CPWY 3HOZI 1Z01A 3EERA 2DE6A 1VQ7Z 1K732 1P9NA 1YHQZ 2OOXB 4E33A 5C4XI 3CCSZ 4HH4A 1QF8A 1I3QI 1FDIA 5D1PA 4E2WA 1YJ9Z 1RLYA 3CCL1 3G6EZ 3TE5B 5T6BA 4A3DI 1Y1VS 1N8R2 1VQ4Z 4HGZA 1JJ2Z 2E2JI 1VQKZ 4CL1A 1WJ2A 2NAPA 2NVYI 1S7MA 3VTNA 4NBFA 2Y0SA 4E2ZA 3HOWI 3GTLI 1NP6A 1Z02A 2V8KA 3S1NI 1VQM1 1TFIA 5C4JI 1RQFA 3F3FC 1WIIA 5LL6f 1NJI2 1YITZ 1QVFY 3GKQA 4RVFA 2I3CA 4A93I 1VQP1 1Z03A 2K5RA 1KC82 3S15I 1TWGI 5A2Qb 1QYPA 1ML8A 2VUGA 1WW9A 1FDOA 2JNYA 4E30A 2QKDA 3TDHB 2JA5I 5A2Qf 4RVGA 3CC21 1Q7Y1 2Q4ZA 2P3YA 3GCFA 1Q812 3NH8A 3CCRZ 3VMGA 1QVGY 3Q87A 5AN9F 3HOVI 1TWFI 3CD61 2PM9A 1YIJZ 4NB8A 4E32A 3J81b 1K8A1 2OZKA 2GTHA 1YUAA 3J80b 3CXCZ 2OTLZ 1R9TI 1Y8CA 3G4SZ 3CCS1 5C3EI 3CCR1 1KQSY 5IP7I 2KI7B 2RPRA 3LUSA 1VQL1 3NH4A 4A3CI 3CXCY 1M1K1 2JS4A 1KRLA 2RHBA 4MONA 5T67A 3CD6Z 4QTUA 3CMA1 1M902 2IZ4A 2G2KA 1Q862 3IX0A 3FQQA 3JAMb 3G711 1Y1VI 2NVQI 5C44I 1Q822 3NDJA 1VQ71 1VQPZ 1VQ6Z 1K9M1 1KD12 2VPYA 2WB1A 3KIFA 4A3GI 3H0GI 1VQ91 3VMIA 3CCJ1 1DL6A 4NBCA 5D1OB 1K731 3GTMS 3CMAZ 3IF8A 4A3II 4AYBA 3HOYI 1AA6A 5IT9b 1VQ51 2KPIA 1VQO1 1QXFA 3BG1B 3S17I 4E31A 1VQ81 2QA41 2VPZA 1YUKA 2WAQA 1N8R1 1W2BY 4RVHA 3OW2Z 4NB9A 1RO4A 2NVTI 2RT9A 3MONA 3RZOI 4NH1C 2JIMA 2M6NA 2QLVB 3CCMZ 2QR1B 3GTMI 3S14I 5CM2M 1X3WA 1VQ61 2B63I 2LIYA 3BG0B 1W2BZ 3CC4Z 3J81f 3I07A 3G71Z 3H3VJ 4RVDA 2F4MA 4MD9A 3MZLB 4A3LI 3S1MI 3PO2I 1ZH1A 4HGYA 1USPB 2H85A 1Q16A 3GTQI 2O4HA 2NVXI 3I4NI 1NUIA 4A3BI 1Q7Y2 3EEDA 4NFRA 4DGLA 1YI21 4BY1I 1VQNZ 3I56Z 3G6E1 5FLXf 3CC7Z 1WCMI 3MZKB 4RS4A 4BBSI 1VQN1 3CCM1 2JIQA 2E2HI 3PO3S 3QWUA 3CMEZ 2R6MA 3GTOI 1YHQ1 3K7AI 1YIT1 1ZB8A 4NBHA 4MH4A 2OTL1 4MD7A 2O53A 4NBBA 3VB9A 4MRIA 2IV2X 4BXXI 2EGTA 3I561 2GU2A 2M48A 1SIWA 2V45A 3VMHA 4MXUA 4NBEA 4A3JI 2P28A 4QTTA 3I4MI 1I50I 2QRDB 3CC41 1KQSZ 2E7ZA 1M1K2 2QEX1 4Y7NI 1X3ZA 3F3PC 1X0TA 3D9XA 4A3MI 1M901 5D1OA 1VQ41 1QVGZ 4DQYB 4EWCA 1Q821 2AYDA 4BY7I 1PFTA 2QEXZ 3J7A4 4Y52I 2VPXA 4RV9A 1VQ9Z 1K9M2 1KD11 2PK7A 3HKZA 2AKLA 3NFZA 2YADA 3GTGI 2IZ3A 2QREB 1S721 3NH5A 3S2HI 3IFUA 4NOZA 1L1OC 1VLAA 2VUMI 3M3YI 2V8IA 2R92I 1YJNZ 3I551 3ESWA 1WZNA 5FLMI 1TWCI 1YJ91 3U50C 3FKII 1VQ8Z 3CCJZ 1RNIA 2ZAEB 1JJ2Y 2YU9I 1VQ5Z 2OTJZ 3GTPI 2JUBA 3IR7A 3J80f 3S2DI 2E2II 2VF1A 2LFUA 4S1TA 1ZB9A 5IT9f 2R7ZI 2PMZA 3FQMA 4MD8A 1NJI1 2GTIA 3CCLZ 1Y1WI 3CCQ1 1SFOI 5IP9I 3CCV1 5T64A 1TWHI 1YI2Z 4A3KI 1KC81 5FLXb 3CPWZ 2V8JA 4NBGA 2OOYB 3S16I 2E9HA 3M4OI 3CC2Z 3CCEZ 3S1QI 3KIHA 3CQZI 1QVFZ 1Q811 1YJWZ 3HOXI 3S1RI 3OW2Y 2F4OA 2JIOA 2HU9A 1VQLZ 3HOUI 4TNUA 3GTJI 1N2FA 2V3VA 3CCU1 2JR6A 4NBDA 3RZDI 4E2YA 1USPA 1K8A2 1RO2A 2JIPA 3CME1 1VQK1 1VQMZ 2RIQA 4A3FI 2OTJ1 2HF1A 3PO3I 3CCVZ 1K83I 4DK1A 3GTKI 2BJOA 2RBLA 4E2XA 2W03A 2R93I 1LQLA 1YJW1 2K3RA 2QA4Z 2QRCB 3D6WA 1VQOZ 1TWAI 3JAMf 2JMOA 3T4NB 3G4S1 3NDIA 1Q861 1I6HI 3CCUZ 2LEXA 4NBAA 1JWHC 2JA8I 4A3EI 2VPWA 1S72Z 3CC71 2J6AA 1YIJ1 4X6AI 4XX2A 3P5JB 3I55Z 1YJN1 4BBRI
chains in the Genus database with same CATH topology
2JA6I 2Q51A 1RO0A 2DE7A 2JA7I 3CCQZ 2DE5A 3CCE1 2W04A 3CPWY 3HOZI 1Z01A 3EERA 2DE6A 1VQ7Z 1K732 1P9NA 1YHQZ 2OOXB 4E33A 5C4XI 3CCSZ 4HH4A 1QF8A 1I3QI 5D1PA 4E2WA 1YJ9Z 1RLYA 3CCL1 3G6EZ 3TE5B 5T6BA 4A3DI 1Y1VS 1N8R2 1VQ4Z 4HGZA 1JJ2Z 2E2JI 1VQKZ 4CL1A 2NVYI 1S7MA 3VTNA 4NBFA 2Y0SA 4E2ZA 3HOWI 3GTLI 1NP6A 1Z02A 2V8KA 3S1NI 1VQM1 1TFIA 5C4JI 1RQFA 3F3FC 1WIIA 5LL6f 1NJI2 1YITZ 1QVFY 3GKQA 4RVFA 2I3CA 4A93I 1VQP1 1Z03A 2K5RA 1KC82 3S15I 1TWGI 5A2Qb 1QYPA 1ML8A 2VUGA 1WW9A 2JNYA 4E30A 2QKDA 3TDHB 2JA5I 5A2Qf 4RVGA 1Q7Y1 3CC21 2Q4ZA 2P3YA 3GCFA 1Q812 3NH8A 3CCRZ 3VMGA 1QVGY 3Q87A 5AN9F 3HOVI 1TWFI 3CD61 2PM9A 1YIJZ 4NB8A 4E32A 3J81b 1K8A1 2OZKA 2GTHA 1YUAA 3J80b 3CXCZ 2OTLZ 1R9TI 3G4SZ 3CCS1 5C3EI 3CCR1 1KQSY 5IP7I 2KI7B 2RPRA 3LUSA 1VQL1 3NH4A 4A3CI 3CXCY 1M1K1 2JS4A 1KRLA 2RHBA 4MONA 5T67A 3CD6Z 4QTUA 3CMA1 1M902 2IZ4A 2G2KA 1Q862 3IX0A 3FQQA 3JAMb 3G711 1Y1VI 2NVQI 5C44I 1Q822 3NDJA 1VQ71 1VQPZ 1VQ6Z 1K9M1 1KD12 2WB1A 3KIFA 4A3GI 3H0GI 1VQ91 3VMIA 3CCJ1 1DL6A 4NBCA 5D1OB 1K731 3GTMS 3CMAZ 3IF8A 4A3II 4AYBA 3HOYI 5IT9b 1VQ51 2KPIA 1VQO1 3BG1B 3S17I 4E31A 1VQ81 2QA41 1YUKA 2WAQA 1N8R1 1W2BY 4RVHA 3OW2Z 4NB9A 1RO4A 2NVTI 2RT9A 3MONA 3RZOI 4NH1C 2M6NA 2QLVB 3CCMZ 2QR1B 3GTMI 3S14I 5CM2M 1X3WA 1VQ61 2B63I 2LIYA 3BG0B 1W2BZ 3CC4Z 3J81f 3I07A 3G71Z 3H3VJ 4RVDA 2F4MA 4MD9A 3MZLB 4A3LI 3S1MI 3PO2I 1ZH1A 4HGYA 1USPB 2H85A 3GTQI 2O4HA 2NVXI 3I4NI 1NUIA 4A3BI 1Q7Y2 3EEDA 4NFRA 4DGLA 1YI21 4BY1I 1VQNZ 3I56Z 3G6E1 5FLXf 3CC7Z 1WCMI 3MZKB 4RS4A 4BBSI 1VQN1 3CCM1 2E2HI 3PO3S 3QWUA 3CMEZ 2R6MA 3GTOI 1YHQ1 3K7AI 1YIT1 1ZB8A 4NBHA 4MH4A 2OTL1 4MD7A 2O53A 4NBBA 3VB9A 4MRIA 4BXXI 2EGTA 3I561 2GU2A 2M48A 3VMHA 4MXUA 4NBEA 4A3JI 2P28A 4QTTA 3I4MI 1I50I 2QRDB 3CC41 1KQSZ 1M1K2 2QEX1 4Y7NI 1X3ZA 3F3PC 1X0TA 3D9XA 4A3MI 1M901 5D1OA 1VQ41 1QVGZ 4DQYB 4EWCA 1Q821 4BY7I 1PFTA 2QEXZ 3J7A4 4Y52I 4RV9A 1VQ9Z 1K9M2 1KD11 2PK7A 3HKZA 2AKLA 3NFZA 2YADA 3GTGI 2IZ3A 2QREB 1S721 3NH5A 3S2HI 3IFUA 4NOZA 1L1OC 1VLAA 2VUMI 3M3YI 2V8IA 2R92I 1YJNZ 3I551 3ESWA 5FLMI 1TWCI 1YJ91 3U50C 3FKII 1VQ8Z 3CCJZ 1RNIA 2ZAEB 1JJ2Y 2YU9I 1VQ5Z 2OTJZ 3GTPI 2JUBA 3J80f 3S2DI 2E2II 2VF1A 2LFUA 4S1TA 1ZB9A 5IT9f 2R7ZI 2PMZA 3FQMA 4MD8A 1NJI1 2GTIA 3CCLZ 1Y1WI 3CCQ1 1SFOI 5IP9I 3CCV1 5T64A 1TWHI 1YI2Z 4A3KI 1KC81 5FLXb 3CPWZ 2V8JA 4NBGA 2OOYB 3S16I 2E9HA 3M4OI 3CC2Z 3CCEZ 3S1QI 3KIHA 3CQZI 1QVFZ 1Q811 1YJWZ 3HOXI 3S1RI 3OW2Y 2F4OA 2HU9A 1VQLZ 3HOUI 4TNUA 3GTJI 1N2FA 3CCU1 2JR6A 4NBDA 3RZDI 4E2YA 1USPA 1K8A2 1RO2A 1VQK1 3CME1 1VQMZ 2RIQA 4A3FI 2OTJ1 2HF1A 3PO3I 3CCVZ 1K83I 4DK1A 3GTKI 2BJOA 2RBLA 4E2XA 2W03A 2R93I 1LQLA 1YJW1 2K3RA 2QA4Z 2QRCB 3D6WA 1VQOZ 1TWAI 3JAMf 2JMOA 3T4NB 3G4S1 3NDIA 1Q861 1I6HI 3CCUZ 4NBAA 1JWHC 2JA8I 4A3EI 1S72Z 3CC71 2J6AA 1YIJ1 4X6AI 4XX2A 3P5JB 3I55Z 1YJN1 4BBRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 1;  1VQ8 Z;  3CCJ Z;  3CCQ Z;  3CCE 1;  1JJ2 Y;  3CXC Z;  2OTL Z;  1VQ5 Z;  3CPW Y;  2OTJ Z;  3G4S Z;  3CCS 1;  1VQ7 Z;  3CCR 1;  1K73 2;  1KQS Y;  1YHQ Z;  1VQL 1;  3CXC Y;  3CCS Z;  1M1K 1;  1Q7Y 2;  1NJI 1;  3CCL Z;  1YI2 1;  3CD6 Z;  3CCQ 1;  1VQN Z;  3I56 Z;  3CMA 1;  3G6E 1;  1M90 2;  3CCV 1;  1YJ9 Z;  3CC7 Z;  3CCL 1;  1YI2 Z;  3G6E Z;  1Q86 2;  1VQN 1;  1KC8 1;  3G71 1;  3CCM 1;  1Q82 2;  1N8R 2;  1VQ4 Z;  3CPW Z;  1JJ2 Z;  3CME Z;  1VQK Z;  1VQ7 1;  1VQP Z;  1VQ6 Z;  1YHQ 1;  1K9M 1;  1YIT 1;  1KD1 2;  2OTL 1;  3CC2 Z;  3CCE Z;  1VQ9 1;  3CCJ 1;  1QVF Z;  1Q81 1;  3I56 1;  1YJW Z;  3OW2 Y;  1K73 1;  1VQM 1;  3CC4 1;  3CMA Z;  1VQL Z;  1KQS Z;  1M1K 2;  2QEX 1;  3CCU 1;  1NJI 2;  1YIT Z;  1QVF Y;  1VQ5 1;  1VQO 1;  1M90 1;  1VQ4 1;  1K8A 2;  1VQ8 1;  1VQP 1;  2QA4 1;  1VQK 1;  3CME 1;  1VQM Z;  1QVG Z;  1KC8 2;  2OTJ 1;  1Q82 1;  2QEX Z;  1N8R 1;  1W2B Y;  3CCV Z;  3OW2 Z;  1VQ9 Z;  1K9M 2;  1KD1 1;  3CC2 1;  1Q7Y 1;  1YJW 1;  2QA4 Z;  1VQO Z;  1Q81 2;  1S72 1;  3G4S 1;  3CCM Z;  1Q86 1;  3CCR Z;  3CCU Z;  1VQ6 1;  1S72 Z;  1QVG Y;  3CC7 1;  1YJN Z;  3I55 1;  1YIJ 1;  1W2B Z;  3CC4 Z;  3CD6 1;  3G71 Z;  3I55 Z;  1YIJ Z;  1YJN 1;  1YJ9 1; 
#chains in the Genus database with same CATH topology
 3D2L A;  2JA6 I;  2Q51 A;  1RO0 A;  2DE7 A;  2JA7 I;  3CCQ Z;  2DE5 A;  3CCE 1;  2JIR A;  2W04 A;  3CPW Y;  3HOZ I;  1Z01 A;  3EER A;  2DE6 A;  1VQ7 Z;  1K73 2;  1P9N A;  1YHQ Z;  2OOX B;  4E33 A;  5C4X I;  3CCS Z;  4HH4 A;  1QF8 A;  1I3Q I;  1FDI A;  5D1P A;  4E2W A;  1YJ9 Z;  1RLY A;  3CCL 1;  3G6E Z;  3TE5 B;  5T6B A;  4A3D I;  1Y1V S;  1N8R 2;  1VQ4 Z;  4HGZ A;  1JJ2 Z;  2E2J I;  1VQK Z;  4CL1 A;  1WJ2 A;  2NAP A;  2NVY I;  1S7M A;  3VTN A;  4NBF A;  2Y0S A;  4E2Z A;  3HOW I;  3GTL I;  1NP6 A;  1Z02 A;  2V8K A;  3S1N I;  1VQM 1;  1TFI A;  5C4J I;  1RQF A;  3F3F C;  1WII A;  5LL6 f;  1NJI 2;  1YIT Z;  1QVF Y;  3GKQ A;  4RVF A;  2I3C A;  4A93 I;  1VQP 1;  1Z03 A;  2K5R A;  1KC8 2;  3S15 I;  1TWG I;  5A2Q b;  1QYP A;  1ML8 A;  2VUG A;  1WW9 A;  1FDO A;  2JNY A;  4E30 A;  2QKD A;  3TDH B;  2JA5 I;  5A2Q f;  4RVG A;  3CC2 1;  1Q7Y 1;  2Q4Z A;  2P3Y A;  3GCF A;  1Q81 2;  3NH8 A;  3CCR Z;  3VMG A;  1QVG Y;  3Q87 A;  5AN9 F;  3HOV I;  1TWF I;  3CD6 1;  2PM9 A;  1YIJ Z;  4NB8 A;  4E32 A;  3J81 b;  1K8A 1;  2OZK A;  2GTH A;  1YUA A;  3J80 b;  3CXC Z;  2OTL Z;  1R9T I;  1Y8C A;  3G4S Z;  3CCS 1;  5C3E I;  3CCR 1;  1KQS Y;  5IP7 I;  2KI7 B;  2RPR A;  3LUS A;  1VQL 1;  3NH4 A;  4A3C I;  3CXC Y;  1M1K 1;  2JS4 A;  1KRL A;  2RHB A;  4MON A;  5T67 A;  3CD6 Z;  4QTU A;  3CMA 1;  1M90 2;  2IZ4 A;  2G2K A;  1Q86 2;  3IX0 A;  3FQQ A;  3JAM b;  3G71 1;  1Y1V I;  2NVQ I;  5C44 I;  1Q82 2;  3NDJ A;  1VQ7 1;  1VQP Z;  1VQ6 Z;  1K9M 1;  1KD1 2;  2VPY A;  2WB1 A;  3KIF A;  4A3G I;  3H0G I;  1VQ9 1;  3VMI A;  3CCJ 1;  1DL6 A;  4NBC A;  5D1O B;  1K73 1;  3GTM S;  3CMA Z;  3IF8 A;  4A3I I;  4AYB A;  3HOY I;  1AA6 A;  5IT9 b;  1VQ5 1;  2KPI A;  1VQO 1;  1QXF A;  3BG1 B;  3S17 I;  4E31 A;  1VQ8 1;  2QA4 1;  2VPZ A;  1YUK A;  2WAQ A;  1N8R 1;  1W2B Y;  4RVH A;  3OW2 Z;  4NB9 A;  1RO4 A;  2NVT I;  2RT9 A;  3MON A;  3RZO I;  4NH1 C;  2JIM A;  2M6N A;  2QLV B;  3CCM Z;  2QR1 B;  3GTM I;  3S14 I;  5CM2 M;  1X3W A;  1VQ6 1;  2B63 I;  2LIY A;  3BG0 B;  1W2B Z;  3CC4 Z;  3J81 f;  3I07 A;  3G71 Z;  3H3V J;  4RVD A;  2F4M A;  4MD9 A;  3MZL B;  4A3L I;  3S1M I;  3PO2 I;  1ZH1 A;  4HGY A;  1USP B;  2H85 A;  1Q16 A;  3GTQ I;  2O4H A;  2NVX I;  3I4N I;  1NUI A;  4A3B I;  1Q7Y 2;  3EED A;  4NFR A;  4DGL A;  1YI2 1;  4BY1 I;  1VQN Z;  3I56 Z;  3G6E 1;  5FLX f;  3CC7 Z;  1WCM I;  3MZK B;  4RS4 A;  4BBS I;  1VQN 1;  3CCM 1;  2JIQ A;  2E2H I;  3PO3 S;  3QWU A;  3CME Z;  2R6M A;  3GTO I;  1YHQ 1;  3K7A I;  1YIT 1;  1ZB8 A;  4NBH A;  4MH4 A;  2OTL 1;  4MD7 A;  2O53 A;  4NBB A;  3VB9 A;  4MRI A;  2IV2 X;  4BXX I;  2EGT A;  3I56 1;  2GU2 A;  2M48 A;  1SIW A;  2V45 A;  3VMH A;  4MXU A;  4NBE A;  4A3J I;  2P28 A;  4QTT A;  3I4M I;  1I50 I;  2QRD B;  3CC4 1;  1KQS Z;  2E7Z A;  1M1K 2;  2QEX 1;  4Y7N I;  1X3Z A;  3F3P C;  1X0T A;  3D9X A;  4A3M I;  1M90 1;  5D1O A;  1VQ4 1;  1QVG Z;  4DQY B;  4EWC A;  1Q82 1;  2AYD A;  4BY7 I;  1PFT A;  2QEX Z;  3J7A 4;  4Y52 I;  2VPX A;  4RV9 A;  1VQ9 Z;  1K9M 2;  1KD1 1;  2PK7 A;  3HKZ A;  2AKL A;  3NFZ A;  2YAD A;  3GTG I;  2IZ3 A;  2QRE B;  1S72 1;  3NH5 A;  3S2H I;  3IFU A;  4NOZ A;  1L1O C;  1VLA A;  2VUM I;  3M3Y I;  2V8I A;  2R92 I;  1YJN Z;  3I55 1;  3ESW A;  1WZN A;  5FLM I;  1TWC I;  1YJ9 1;  3U50 C;  3FKI I;  1VQ8 Z;  3CCJ Z;  1RNI A;  2ZAE B;  1JJ2 Y;  2YU9 I;  1VQ5 Z;  2OTJ Z;  3GTP I;  2JUB A;  3IR7 A;  3J80 f;  3S2D I;  2E2I I;  2VF1 A;  2LFU A;  4S1T A;  1ZB9 A;  5IT9 f;  2R7Z I;  2PMZ A;  3FQM A;  4MD8 A;  1NJI 1;  2GTI A;  3CCL Z;  1Y1W I;  3CCQ 1;  1SFO I;  5IP9 I;  3CCV 1;  5T64 A;  1TWH I;  1YI2 Z;  4A3K I;  1KC8 1;  5FLX b;  3CPW Z;  2V8J A;  4NBG A;  2OOY B;  3S16 I;  2E9H A;  3M4O I;  3CC2 Z;  3CCE Z;  3S1Q I;  3KIH A;  3CQZ I;  1QVF Z;  1Q81 1;  1YJW Z;  3HOX I;  3S1R I;  3OW2 Y;  2F4O A;  2JIO A;  2HU9 A;  1VQL Z;  3HOU I;  4TNU A;  3GTJ I;  1N2F A;  2V3V A;  3CCU 1;  2JR6 A;  4NBD A;  3RZD I;  4E2Y A;  1USP A;  1K8A 2;  1RO2 A;  2JIP A;  3CME 1;  1VQK 1;  1VQM Z;  2RIQ A;  4A3F I;  2OTJ 1;  2HF1 A;  3PO3 I;  3CCV Z;  1K83 I;  4DK1 A;  3GTK I;  2BJO A;  2RBL A;  4E2X A;  2W03 A;  2R93 I;  1LQL A;  1YJW 1;  2K3R A;  2QA4 Z;  2QRC B;  3D6W A;  1VQO Z;  1TWA I;  3JAM f;  2JMO A;  3T4N B;  3G4S 1;  3NDI A;  1Q86 1;  1I6H I;  3CCU Z;  2LEX A;  4NBA A;  1JWH C;  2JA8 I;  4A3E I;  2VPW A;  1S72 Z;  3CC7 1;  2J6A A;  1YIJ 1;  4X6A I;  4XX2 A;  3P5J B;  3I55 Z;  1YJN 1;  4BBR I; 
#chains in the Genus database with same CATH homology
 2JA6 I;  2Q51 A;  1RO0 A;  2DE7 A;  2JA7 I;  3CCQ Z;  2DE5 A;  3CCE 1;  2W04 A;  3CPW Y;  3HOZ I;  1Z01 A;  3EER A;  2DE6 A;  1VQ7 Z;  1K73 2;  1P9N A;  1YHQ Z;  2OOX B;  4E33 A;  5C4X I;  3CCS Z;  4HH4 A;  1QF8 A;  1I3Q I;  5D1P A;  4E2W A;  1YJ9 Z;  1RLY A;  3CCL 1;  3G6E Z;  3TE5 B;  5T6B A;  4A3D I;  1Y1V S;  1N8R 2;  1VQ4 Z;  4HGZ A;  1JJ2 Z;  2E2J I;  1VQK Z;  4CL1 A;  2NVY I;  1S7M A;  3VTN A;  4NBF A;  2Y0S A;  4E2Z A;  3HOW I;  3GTL I;  1NP6 A;  1Z02 A;  2V8K A;  3S1N I;  1VQM 1;  1TFI A;  5C4J I;  1RQF A;  3F3F C;  1WII A;  5LL6 f;  1NJI 2;  1YIT Z;  1QVF Y;  3GKQ A;  4RVF A;  2I3C A;  4A93 I;  1VQP 1;  1Z03 A;  2K5R A;  1KC8 2;  3S15 I;  1TWG I;  5A2Q b;  1QYP A;  1ML8 A;  2VUG A;  1WW9 A;  2JNY A;  4E30 A;  2QKD A;  3TDH B;  2JA5 I;  5A2Q f;  4RVG A;  1Q7Y 1;  3CC2 1;  2Q4Z A;  2P3Y A;  3GCF A;  1Q81 2;  3NH8 A;  3CCR Z;  3VMG A;  1QVG Y;  3Q87 A;  5AN9 F;  3HOV I;  1TWF I;  3CD6 1;  2PM9 A;  1YIJ Z;  4NB8 A;  4E32 A;  3J81 b;  1K8A 1;  2OZK A;  2GTH A;  1YUA A;  3J80 b;  3CXC Z;  2OTL Z;  1R9T I;  3G4S Z;  3CCS 1;  5C3E I;  3CCR 1;  1KQS Y;  5IP7 I;  2KI7 B;  2RPR A;  3LUS A;  1VQL 1;  3NH4 A;  4A3C I;  3CXC Y;  1M1K 1;  2JS4 A;  1KRL A;  2RHB A;  4MON A;  5T67 A;  3CD6 Z;  4QTU A;  3CMA 1;  1M90 2;  2IZ4 A;  2G2K A;  1Q86 2;  3IX0 A;  3FQQ A;  3JAM b;  3G71 1;  1Y1V I;  2NVQ I;  5C44 I;  1Q82 2;  3NDJ A;  1VQ7 1;  1VQP Z;  1VQ6 Z;  1K9M 1;  1KD1 2;  2WB1 A;  3KIF A;  4A3G I;  3H0G I;  1VQ9 1;  3VMI A;  3CCJ 1;  1DL6 A;  4NBC A;  5D1O B;  1K73 1;  3GTM S;  3CMA Z;  3IF8 A;  4A3I I;  4AYB A;  3HOY I;  5IT9 b;  1VQ5 1;  2KPI A;  1VQO 1;  3BG1 B;  3S17 I;  4E31 A;  1VQ8 1;  2QA4 1;  1YUK A;  2WAQ A;  1N8R 1;  1W2B Y;  4RVH A;  3OW2 Z;  4NB9 A;  1RO4 A;  2NVT I;  2RT9 A;  3MON A;  3RZO I;  4NH1 C;  2M6N A;  2QLV B;  3CCM Z;  2QR1 B;  3GTM I;  3S14 I;  5CM2 M;  1X3W A;  1VQ6 1;  2B63 I;  2LIY A;  3BG0 B;  1W2B Z;  3CC4 Z;  3J81 f;  3I07 A;  3G71 Z;  3H3V J;  4RVD A;  2F4M A;  4MD9 A;  3MZL B;  4A3L I;  3S1M I;  3PO2 I;  1ZH1 A;  4HGY A;  1USP B;  2H85 A;  3GTQ I;  2O4H A;  2NVX I;  3I4N I;  1NUI A;  4A3B I;  1Q7Y 2;  3EED A;  4NFR A;  4DGL A;  1YI2 1;  4BY1 I;  1VQN Z;  3I56 Z;  3G6E 1;  5FLX f;  3CC7 Z;  1WCM I;  3MZK B;  4RS4 A;  4BBS I;  1VQN 1;  3CCM 1;  2E2H I;  3PO3 S;  3QWU A;  3CME Z;  2R6M A;  3GTO I;  1YHQ 1;  3K7A I;  1YIT 1;  1ZB8 A;  4NBH A;  4MH4 A;  2OTL 1;  4MD7 A;  2O53 A;  4NBB A;  3VB9 A;  4MRI A;  4BXX I;  2EGT A;  3I56 1;  2GU2 A;  2M48 A;  3VMH A;  4MXU A;  4NBE A;  4A3J I;  2P28 A;  4QTT A;  3I4M I;  1I50 I;  2QRD B;  3CC4 1;  1KQS Z;  1M1K 2;  2QEX 1;  4Y7N I;  1X3Z A;  3F3P C;  1X0T A;  3D9X A;  4A3M I;  1M90 1;  5D1O A;  1VQ4 1;  1QVG Z;  4DQY B;  4EWC A;  1Q82 1;  4BY7 I;  1PFT A;  2QEX Z;  3J7A 4;  4Y52 I;  4RV9 A;  1VQ9 Z;  1K9M 2;  1KD1 1;  2PK7 A;  3HKZ A;  2AKL A;  3NFZ A;  2YAD A;  3GTG I;  2IZ3 A;  2QRE B;  1S72 1;  3NH5 A;  3S2H I;  3IFU A;  4NOZ A;  1L1O C;  1VLA A;  2VUM I;  3M3Y I;  2V8I A;  2R92 I;  1YJN Z;  3I55 1;  3ESW A;  5FLM I;  1TWC I;  1YJ9 1;  3U50 C;  3FKI I;  1VQ8 Z;  3CCJ Z;  1RNI A;  2ZAE B;  1JJ2 Y;  2YU9 I;  1VQ5 Z;  2OTJ Z;  3GTP I;  2JUB A;  3J80 f;  3S2D I;  2E2I I;  2VF1 A;  2LFU A;  4S1T A;  1ZB9 A;  5IT9 f;  2R7Z I;  2PMZ A;  3FQM A;  4MD8 A;  1NJI 1;  2GTI A;  3CCL Z;  1Y1W I;  3CCQ 1;  1SFO I;  5IP9 I;  3CCV 1;  5T64 A;  1TWH I;  1YI2 Z;  4A3K I;  1KC8 1;  5FLX b;  3CPW Z;  2V8J A;  4NBG A;  2OOY B;  3S16 I;  2E9H A;  3M4O I;  3CC2 Z;  3CCE Z;  3S1Q I;  3KIH A;  3CQZ I;  1QVF Z;  1Q81 1;  1YJW Z;  3HOX I;  3S1R I;  3OW2 Y;  2F4O A;  2HU9 A;  1VQL Z;  3HOU I;  4TNU A;  3GTJ I;  1N2F A;  3CCU 1;  2JR6 A;  4NBD A;  3RZD I;  4E2Y A;  1USP A;  1K8A 2;  1RO2 A;  1VQK 1;  3CME 1;  1VQM Z;  2RIQ A;  4A3F I;  2OTJ 1;  2HF1 A;  3PO3 I;  3CCV Z;  1K83 I;  4DK1 A;  3GTK I;  2BJO A;  2RBL A;  4E2X A;  2W03 A;  2R93 I;  1LQL A;  1YJW 1;  2K3R A;  2QA4 Z;  2QRC B;  3D6W A;  1VQO Z;  1TWA I;  3JAM f;  2JMO A;  3T4N B;  3G4S 1;  3NDI A;  1Q86 1;  1I6H I;  3CCU Z;  4NBA A;  1JWH C;  2JA8 I;  4A3E I;  1S72 Z;  3CC7 1;  2J6A A;  1YIJ 1;  4X6A I;  4XX2 A;  3P5J B;  3I55 Z;  1YJN 1;  4BBR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...