1YIT1

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yit100
1VQ5Z 3G4SZ 1VQ51 3CCLZ 1W2BZ 1NJI1 3G4S1 3CCV1 1KD12 3CCL1 3CCJZ 3G71Z 3CXCZ 1Q812 1KQSZ 1JJ2Y 2OTJZ 1Q7Y1 3CCJ1 2QA4Z 3G711 1KC82 1S72Z 2OTJ1 2QA41 1S721 1Q822 3I56Z 3OW2Z 1Q7Y2 2QEXZ 3CC4Z 1K8A1 1M901 3CC2Z 3I561 3CCVZ 3CPWY 2QEX1 1VQK1 3CC41 1VQ9Z 3CC21 1K9M1 1Q861 1QVFY 1YHQZ 1K8A2 1M902 1VQ6Z 1VQ91 1QVGZ 3CCRZ 1YHQ1 1VQ61 1NJI2 1N8R1 3CMA1 3CCR1 1VQPZ 1YJWZ 1VQOZ 1VQMZ 1VQP1 3CMEZ 1YJW1 1N8R2 1VQKZ 1VQO1 1VQM1 3CME1 3CCEZ 3CXCY 3CCUZ 3CCSZ 3CCE1 3CCU1 1VQ7Z 3CCQZ 3CCS1 2OTLZ 3CMAZ 1VQNZ 1K731 1VQ71 3CCQ1 3OW2Y 2OTL1 1VQN1 3I55Z 1K9M2 1Q862 1JJ2Z 1YIJZ 3CC7Z 1M1K1 3I551 1YITZ 1W2BY 1YJNZ 1K732 1YIJ1 3CC71 1VQ8Z 1Q811 1VQLZ 1YI2Z 1YIT1 1KC81 1YJN1 1QVGY 1VQ4Z 1VQ81 1VQL1 1M1K2 1KQSY 1YI21 1Q821 3CPWZ 1VQ41 3G6EZ 3CD6Z 3G6E1 1YJ9Z 3CCMZ 1QVFZ 3CD61 1YJ91 3CCM1 1KD11
chains in the Genus database with same CATH superfamily
1TWFI 3GTOI 3MONA 3P5JB 3CCLZ 3RZDI 3CCV1 2JS4A 2KI7B 5A2Qb 3CCJZ 4TNUA 2ZAEB 1QXFA 1KQSZ 1NP6A 2DE7A 2E2II 2OTJ1 2VPZA 2JIMA 1K8A1 1M901 3CPWY 1WJ2A 4MXUA 2QEX1 4DQYB 3D6WA 4QTTA 3BG0B 4NBCA 1VQ9Z 4Y52I 1K9M1 3NDIA 3QWUA 4BBSI 1QVFY 3NH8A 2O53A 3IFUA 1RO0A 1N8R1 3M4OI 1JWHC 4A3EI 3CQZI 2F4OA 4NBAA 2P3YA 4RV9A 2AYDA 5T6BA 1VQP1 1WW9A 1VQKZ 2DE6A 1VQO1 2JUBA 1SIWA 3NH5A 2JA6I 1KRLA 3CXCY 2IZ4A 1Z03A 3CCE1 2QLVB 4CL1A 3H0GI 3BG1B 1VQ7Z 3CCS1 2PM9A 2QREB 3TE5B 1K731 2F4MA 4A3BI 1RQFA 2OTL1 2E7ZA 3PO3I 4A3KI 1YIJZ 1RNIA 3CC7Z 2M6NA 1M1K1 1I3QI 1YJNZ 3HKZA 4NH1C 2QRDB 2VUGA 1QYPA 1VQ8Z 1VQLZ 3S16I 1LQLA 1X3ZA 1TWHI 1YI21 2E2JI 2Q4ZA 4DK1A 3M3YI 5C4XI 3CCMZ 1NUIA 3GCFA 3CD61 2PK7A 3J81f 5D1OB 3VMHA 4MD7A 2K3RA 3G4SZ 3ESWA 2Q51A 3S17I 1VQ51 4NOZA 2WB1A 2PMZA 3S15I 3I4MI 1Z01A 1ZH1A 2R92I 3S1QI 3VMGA 1VLAA 2M48A 1FDIA 2DE5A 1JJ2Y 3EEDA 1Q7Y1 2QA4Z 2V8JA 3G711 1KC82 2K5RA 5D1OA 3KIHA 3TDHB 3S1MI 2VUMI 2GU2A 1S721 3I56Z 4A3II 4A3MI 3CC4Z 1P9NA 1VQK1 2JIRA 5FLXf 4Y7NI 3CC21 3F3FC 3FKII 1N2FA 1VQ6Z 4RVGA 4MD8A 2YU9I 4NBDA 1YHQ1 1AA6A 1RO4A 4QTUA 5IT9b 4MONA 3CCR1 5CM2M 1WZNA 3JAMf 3GTQI 1YUAA 5T64A 1YJW1 3NDJA 3PO3S 2JIQA 4NBBA 2H85A 1VQM1 3CME1 3NFZA 3CCUZ 4MRIA 2VPWA 4RVFA 1S7MA 3GTGI 5A2Qf 1I6HI 3CCQZ 3CMAZ 3S1NI 2JMOA 2JA5I 3H3VJ 1VQN1 3OW2Y 2YADA 4BBRI 1Q862 5LL6f 1PFTA 3I551 1YITZ 2VF1A 2OZKA 4EWCA 1KC81 1QVGY 3VTNA 3I07A 2WAQA 4HGZA 3CPWZ 1VQ41 3G6EZ 4E31A 1RO2A 2BJOA 2IZ3A 1QVFZ 3GTMI 2JA7I 1TWAI 1Q16A 1YJ91 1Y8CA 2W04A 2O4HA 3S14I 1KD12 2RBLA 3CCL1 4S1TA 3J80f 3CXCZ 1Q812 2V8KA 1RLYA 2OTJZ 3CCJ1 1Y1VS 4NBGA 1Z02A 4NFRA 4E2WA 5D1PA 2QEXZ 2LIYA 2HU9A 2JIPA 1TWGI 1Q861 3GTPI 1K8A2 1M902 1VQ91 1X3WA 1NJI2 3CMA1 2VPYA 2R7ZI 1VQPZ 4NB8A 4E32A 4DGLA 1VQOZ 2P28A 2V45A 2E9HA 1N8R2 3CCEZ 3GKQA 5C44I 3Q87A 3CCSZ 4A93I 1Y1VI 4BY1I 2JR6A 2OTLZ 3D9XA 4A3GI 1VQ71 3MZLB 1ML8A 4NB9A 2HF1A 1JJ2Z 4XX2A 3GTMS 4BXXI 1W2BY 3FQMA 1I50I 4A3DI 1K732 1YIJ1 3CC71 1Q811 1YI2Z 2RT9A 1YJN1 3HOVI 3VB9A 3HOXI 1VQ81 2GTHA 1VQL1 1M1K2 2QKDA 3K7AI 4X6AI 3CD6Z 4A3CI 2QR1B 3J7A4 3EERA 5IT9f 4HGYA 3HOYI 3CCM1 1USPB 1VQ5Z 2Y0SA 3MZKB 3LUSA 1Y1WI 1SFOI 2B63I 3I4NI 2JA8I 2I3CA 1FDOA 1W2BZ 1NJI1 3G4S1 1R9TI 2QRCB 2G2KA 3KIFA 2R93I 2J6AA 3G71Z 3GTKI 3S2HI 5IP9I 2LFUA 4AYBA 1K83I 1USPA 1S72Z 3NH4A 4BY7I 2AKLA 3HOWI 2V3VA 2QA41 1Q822 2LEXA 3RZOI 2OOYB 2VPXA 5C3EI 3OW2Z 1Q7Y2 1DL6A 4E30A 3CC2Z 3I561 3FQQA 3CCVZ 3F3PC 2V8IA 4E33A 5AN9F 3CC41 1WCMI 3IX0A 4NBFA 1X0TA 1ZB9A 4RVDA 2NVYI 3J80b 1YHQZ 1QVGZ 3CCRZ 3IR7A 3D2LA 4RS4A 2RHBA 1VQ61 1WIIA 3PO2I 1YJWZ 3U50C 2EGTA 3S2DI 2RIQA 2JNYA 3J81b 3HOUI 1VQMZ 1QF8A 3CMEZ 3S1RI 4RVHA 1TFIA 2RPRA 5FLMI 2GTIA 4A3FI 1TWCI 2R6MA 3GTJI 4MD9A 3HOZI 3CCU1 4E2ZA 1VQNZ 4NBEA 2KPIA 3CCQ1 2IV2X 3I55Z 5C4JI 3GTLI 1K9M2 1L1OC 2W03A 2NVQI 3IF8A 4NBHA 4A3LI 3VMIA 1YIT1 5FLXb 2E2HI 5IP7I 4E2YA 1VQ4Z 1ZB8A 1KQSY 3T4NB 2JIOA 2NVXI 1Q821 4HH4A 1YUKA 5T67A 2NAPA 4E2XA 3G6E1 1YJ9Z 2NVTI 2OOXB 4A3JI 3JAMb 4MH4A 1KD11
chains in the Genus database with same CATH topology
1TWFI 3GTOI 3MONA 3P5JB 3CCLZ 3RZDI 3CCV1 2JS4A 2KI7B 5A2Qb 3CCJZ 4TNUA 2ZAEB 1KQSZ 1NP6A 2DE7A 2E2II 2OTJ1 1K8A1 1M901 3CPWY 2QEX1 4MXUA 4DQYB 3D6WA 4QTTA 3BG0B 4NBCA 1VQ9Z 4Y52I 1K9M1 3NDIA 3QWUA 4BBSI 1QVFY 3NH8A 2O53A 3IFUA 1RO0A 1N8R1 3M4OI 1JWHC 4A3EI 3CQZI 2F4OA 4NBAA 2P3YA 4RV9A 5T6BA 1VQP1 1WW9A 1VQKZ 2DE6A 1VQO1 2JUBA 3NH5A 2JA6I 1KRLA 3CXCY 2IZ4A 1Z03A 3CCE1 2QLVB 4CL1A 3H0GI 3BG1B 1VQ7Z 3CCS1 2PM9A 2QREB 3TE5B 1K731 2F4MA 4A3BI 1RQFA 2OTL1 3PO3I 4A3KI 1YIJZ 1RNIA 3CC7Z 2M6NA 1M1K1 1I3QI 1YJNZ 3HKZA 4NH1C 2QRDB 2VUGA 1QYPA 1VQ8Z 1VQLZ 3S16I 1LQLA 1X3ZA 1TWHI 1YI21 2E2JI 2Q4ZA 4DK1A 3M3YI 5C4XI 3CCMZ 1NUIA 3GCFA 3CD61 2PK7A 3J81f 5D1OB 3VMHA 4MD7A 2K3RA 3G4SZ 3ESWA 2Q51A 3S17I 1VQ51 4NOZA 2WB1A 2PMZA 3S15I 3I4MI 1Z01A 1ZH1A 2R92I 3S1QI 3VMGA 1VLAA 2M48A 2DE5A 1JJ2Y 3EEDA 1Q7Y1 2QA4Z 2V8JA 3G711 1KC82 2K5RA 5D1OA 3KIHA 3TDHB 3S1MI 2VUMI 2GU2A 1S721 3I56Z 4A3II 4A3MI 3CC4Z 1P9NA 1VQK1 5FLXf 4Y7NI 3CC21 3F3FC 3FKII 1N2FA 1VQ6Z 4RVGA 4MD8A 2YU9I 4NBDA 1YHQ1 1RO4A 4QTUA 5IT9b 4MONA 3CCR1 5CM2M 3JAMf 3GTQI 1YUAA 5T64A 1YJW1 3NDJA 3PO3S 4NBBA 2H85A 1VQM1 3CME1 3NFZA 3CCUZ 4MRIA 4RVFA 1S7MA 3GTGI 5A2Qf 1I6HI 3CCQZ 3CMAZ 3S1NI 2JMOA 2JA5I 3H3VJ 1VQN1 3OW2Y 2YADA 4BBRI 1Q862 5LL6f 1PFTA 3I551 1YITZ 2VF1A 2OZKA 4EWCA 1KC81 1QVGY 3VTNA 3I07A 2WAQA 4HGZA 3CPWZ 1VQ41 3G6EZ 4E31A 1RO2A 2BJOA 2IZ3A 1QVFZ 3GTMI 2JA7I 1TWAI 1YJ91 2W04A 2O4HA 3S14I 1KD12 2RBLA 3CCL1 4S1TA 3J80f 3CXCZ 1Q812 2V8KA 1RLYA 2OTJZ 3CCJ1 1Y1VS 4NBGA 1Z02A 4NFRA 4E2WA 5D1PA 2QEXZ 2LIYA 2HU9A 1TWGI 1Q861 3GTPI 1K8A2 1M902 1VQ91 1X3WA 1NJI2 3CMA1 2R7ZI 1VQPZ 4NB8A 1VQOZ 4E32A 4DGLA 2P28A 2E9HA 1N8R2 3CCEZ 3GKQA 5C44I 3Q87A 3CCSZ 4A93I 1Y1VI 4BY1I 2JR6A 2OTLZ 3D9XA 4A3GI 1VQ71 3MZLB 1ML8A 4NB9A 2HF1A 1JJ2Z 4XX2A 3GTMS 4BXXI 1W2BY 3FQMA 1I50I 4A3DI 1K732 1YIJ1 3CC71 1Q811 1YI2Z 2RT9A 1YJN1 3HOVI 3VB9A 3HOXI 1VQ81 2GTHA 1VQL1 1M1K2 2QKDA 3K7AI 4X6AI 3CD6Z 4A3CI 2QR1B 3J7A4 3EERA 5IT9f 4HGYA 3HOYI 3CCM1 1USPB 1VQ5Z 2Y0SA 3MZKB 3LUSA 1Y1WI 1SFOI 2B63I 3I4NI 2JA8I 2I3CA 1W2BZ 1NJI1 3G4S1 1R9TI 2QRCB 2G2KA 3KIFA 2R93I 2J6AA 3G71Z 3GTKI 3S2HI 5IP9I 2LFUA 4AYBA 1K83I 1USPA 1S72Z 3NH4A 4BY7I 2AKLA 3HOWI 2QA41 1Q822 3RZOI 2OOYB 5C3EI 3OW2Z 1Q7Y2 1DL6A 4E30A 3CC2Z 3I561 3FQQA 3F3PC 2V8IA 4E33A 5AN9F 3CCVZ 3CC41 1WCMI 3IX0A 4NBFA 1X0TA 1ZB9A 4RVDA 2NVYI 3J80b 1YHQZ 1QVGZ 3CCRZ 4RS4A 2RHBA 1VQ61 1WIIA 3PO2I 1YJWZ 3U50C 2EGTA 3S2DI 2RIQA 2JNYA 3J81b 3HOUI 1VQMZ 1QF8A 3CMEZ 3S1RI 4RVHA 1TFIA 2RPRA 5FLMI 2GTIA 4A3FI 1TWCI 2R6MA 3GTJI 4MD9A 3HOZI 3CCU1 4E2ZA 1VQNZ 4NBEA 2KPIA 3CCQ1 3I55Z 5C4JI 3GTLI 1K9M2 1L1OC 2W03A 2NVQI 3IF8A 4NBHA 4A3LI 3VMIA 1YIT1 5FLXb 2E2HI 5IP7I 4E2YA 1VQ4Z 1ZB8A 1KQSY 3T4NB 2NVXI 1Q821 4HH4A 1YUKA 5T67A 4E2XA 3G6E1 1YJ9Z 2NVTI 2OOXB 4A3JI 3JAMb 4MH4A 1KD11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 Z;  3G4S Z;  1VQ5 1;  3CCL Z;  1W2B Z;  1NJI 1;  3G4S 1;  3CCV 1;  1KD1 2;  3CCL 1;  3CCJ Z;  3G71 Z;  3CXC Z;  1Q81 2;  1KQS Z;  1JJ2 Y;  2OTJ Z;  1Q7Y 1;  3CCJ 1;  2QA4 Z;  3G71 1;  1KC8 2;  1S72 Z;  2OTJ 1;  2QA4 1;  1S72 1;  1Q82 2;  3I56 Z;  3OW2 Z;  1Q7Y 2;  2QEX Z;  3CC4 Z;  1K8A 1;  1M90 1;  3CC2 Z;  3I56 1;  3CCV Z;  3CPW Y;  2QEX 1;  1VQK 1;  3CC4 1;  1VQ9 Z;  3CC2 1;  1K9M 1;  1Q86 1;  1QVF Y;  1YHQ Z;  1K8A 2;  1M90 2;  1VQ6 Z;  1VQ9 1;  1QVG Z;  3CCR Z;  1YHQ 1;  1VQ6 1;  1NJI 2;  1N8R 1;  3CMA 1;  3CCR 1;  1VQP Z;  1YJW Z;  1VQO Z;  1VQM Z;  1VQP 1;  3CME Z;  1YJW 1;  1N8R 2;  1VQK Z;  1VQO 1;  1VQM 1;  3CME 1;  3CCE Z;  3CXC Y;  3CCU Z;  3CCS Z;  3CCE 1;  3CCU 1;  1VQ7 Z;  3CCQ Z;  3CCS 1;  2OTL Z;  3CMA Z;  1VQN Z;  1K73 1;  1VQ7 1;  3CCQ 1;  3OW2 Y;  2OTL 1;  1VQN 1;  3I55 Z;  1K9M 2;  1Q86 2;  1JJ2 Z;  1YIJ Z;  3CC7 Z;  1M1K 1;  3I55 1;  1YIT Z;  1W2B Y;  1YJN Z;  1K73 2;  1YIJ 1;  3CC7 1;  1VQ8 Z;  1Q81 1;  1VQL Z;  1YI2 Z;  1YIT 1;  1KC8 1;  1YJN 1;  1QVG Y;  1VQ4 Z;  1VQ8 1;  1VQL 1;  1M1K 2;  1KQS Y;  1YI2 1;  1Q82 1;  3CPW Z;  1VQ4 1;  3G6E Z;  3CD6 Z;  3G6E 1;  1YJ9 Z;  3CCM Z;  1QVF Z;  3CD6 1;  1YJ9 1;  3CCM 1;  1KD1 1; 
#chains in the Genus database with same CATH topology
 1TWF I;  3GTO I;  3MON A;  3P5J B;  3CCL Z;  3RZD I;  3CCV 1;  2JS4 A;  2KI7 B;  5A2Q b;  3CCJ Z;  4TNU A;  2ZAE B;  1QXF A;  1KQS Z;  1NP6 A;  2DE7 A;  2E2I I;  2OTJ 1;  2VPZ A;  2JIM A;  1K8A 1;  1M90 1;  3CPW Y;  1WJ2 A;  4MXU A;  2QEX 1;  4DQY B;  3D6W A;  4QTT A;  3BG0 B;  4NBC A;  1VQ9 Z;  4Y52 I;  1K9M 1;  3NDI A;  3QWU A;  4BBS I;  1QVF Y;  3NH8 A;  2O53 A;  3IFU A;  1RO0 A;  1N8R 1;  3M4O I;  1JWH C;  4A3E I;  3CQZ I;  2F4O A;  4NBA A;  2P3Y A;  4RV9 A;  2AYD A;  5T6B A;  1VQP 1;  1WW9 A;  1VQK Z;  2DE6 A;  1VQO 1;  2JUB A;  1SIW A;  3NH5 A;  2JA6 I;  1KRL A;  3CXC Y;  2IZ4 A;  1Z03 A;  3CCE 1;  2QLV B;  4CL1 A;  3H0G I;  3BG1 B;  1VQ7 Z;  3CCS 1;  2PM9 A;  2QRE B;  3TE5 B;  1K73 1;  2F4M A;  4A3B I;  1RQF A;  2OTL 1;  2E7Z A;  3PO3 I;  4A3K I;  1YIJ Z;  1RNI A;  3CC7 Z;  2M6N A;  1M1K 1;  1I3Q I;  1YJN Z;  3HKZ A;  4NH1 C;  2QRD B;  2VUG A;  1QYP A;  1VQ8 Z;  1VQL Z;  3S16 I;  1LQL A;  1X3Z A;  1TWH I;  1YI2 1;  2E2J I;  2Q4Z A;  4DK1 A;  3M3Y I;  5C4X I;  3CCM Z;  1NUI A;  3GCF A;  3CD6 1;  2PK7 A;  3J81 f;  5D1O B;  3VMH A;  4MD7 A;  2K3R A;  3G4S Z;  3ESW A;  2Q51 A;  3S17 I;  1VQ5 1;  4NOZ A;  2WB1 A;  2PMZ A;  3S15 I;  3I4M I;  1Z01 A;  1ZH1 A;  2R92 I;  3S1Q I;  3VMG A;  1VLA A;  2M48 A;  1FDI A;  2DE5 A;  1JJ2 Y;  3EED A;  1Q7Y 1;  2QA4 Z;  2V8J A;  3G71 1;  1KC8 2;  2K5R A;  5D1O A;  3KIH A;  3TDH B;  3S1M I;  2VUM I;  2GU2 A;  1S72 1;  3I56 Z;  4A3I I;  4A3M I;  3CC4 Z;  1P9N A;  1VQK 1;  2JIR A;  5FLX f;  4Y7N I;  3CC2 1;  3F3F C;  3FKI I;  1N2F A;  1VQ6 Z;  4RVG A;  4MD8 A;  2YU9 I;  4NBD A;  1YHQ 1;  1AA6 A;  1RO4 A;  4QTU A;  5IT9 b;  4MON A;  3CCR 1;  5CM2 M;  1WZN A;  3JAM f;  3GTQ I;  1YUA A;  5T64 A;  1YJW 1;  3NDJ A;  3PO3 S;  2JIQ A;  4NBB A;  2H85 A;  1VQM 1;  3CME 1;  3NFZ A;  3CCU Z;  4MRI A;  2VPW A;  4RVF A;  1S7M A;  3GTG I;  5A2Q f;  1I6H I;  3CCQ Z;  3CMA Z;  3S1N I;  2JMO A;  2JA5 I;  3H3V J;  1VQN 1;  3OW2 Y;  2YAD A;  4BBR I;  1Q86 2;  5LL6 f;  1PFT A;  3I55 1;  1YIT Z;  2VF1 A;  2OZK A;  4EWC A;  1KC8 1;  1QVG Y;  3VTN A;  3I07 A;  2WAQ A;  4HGZ A;  3CPW Z;  1VQ4 1;  3G6E Z;  4E31 A;  1RO2 A;  2BJO A;  2IZ3 A;  1QVF Z;  3GTM I;  2JA7 I;  1TWA I;  1Q16 A;  1YJ9 1;  1Y8C A;  2W04 A;  2O4H A;  3S14 I;  1KD1 2;  2RBL A;  3CCL 1;  4S1T A;  3J80 f;  3CXC Z;  1Q81 2;  2V8K A;  1RLY A;  2OTJ Z;  3CCJ 1;  1Y1V S;  4NBG A;  1Z02 A;  4NFR A;  4E2W A;  5D1P A;  2QEX Z;  2LIY A;  2HU9 A;  2JIP A;  1TWG I;  1Q86 1;  3GTP I;  1K8A 2;  1M90 2;  1VQ9 1;  1X3W A;  1NJI 2;  3CMA 1;  2VPY A;  2R7Z I;  1VQP Z;  4NB8 A;  4E32 A;  4DGL A;  1VQO Z;  2P28 A;  2V45 A;  2E9H A;  1N8R 2;  3CCE Z;  3GKQ A;  5C44 I;  3Q87 A;  3CCS Z;  4A93 I;  1Y1V I;  4BY1 I;  2JR6 A;  2OTL Z;  3D9X A;  4A3G I;  1VQ7 1;  3MZL B;  1ML8 A;  4NB9 A;  2HF1 A;  1JJ2 Z;  4XX2 A;  3GTM S;  4BXX I;  1W2B Y;  3FQM A;  1I50 I;  4A3D I;  1K73 2;  1YIJ 1;  3CC7 1;  1Q81 1;  1YI2 Z;  2RT9 A;  1YJN 1;  3HOV I;  3VB9 A;  3HOX I;  1VQ8 1;  2GTH A;  1VQL 1;  1M1K 2;  2QKD A;  3K7A I;  4X6A I;  3CD6 Z;  4A3C I;  2QR1 B;  3J7A 4;  3EER A;  5IT9 f;  4HGY A;  3HOY I;  3CCM 1;  1USP B;  1VQ5 Z;  2Y0S A;  3MZK B;  3LUS A;  1Y1W I;  1SFO I;  2B63 I;  3I4N I;  2JA8 I;  2I3C A;  1FDO A;  1W2B Z;  1NJI 1;  3G4S 1;  1R9T I;  2QRC B;  2G2K A;  3KIF A;  2R93 I;  2J6A A;  3G71 Z;  3GTK I;  3S2H I;  5IP9 I;  2LFU A;  4AYB A;  1K83 I;  1USP A;  1S72 Z;  3NH4 A;  4BY7 I;  2AKL A;  3HOW I;  2V3V A;  2QA4 1;  1Q82 2;  2LEX A;  3RZO I;  2OOY B;  2VPX A;  5C3E I;  3OW2 Z;  1Q7Y 2;  1DL6 A;  4E30 A;  3CC2 Z;  3I56 1;  3FQQ A;  3CCV Z;  3F3P C;  2V8I A;  4E33 A;  5AN9 F;  3CC4 1;  1WCM I;  3IX0 A;  4NBF A;  1X0T A;  1ZB9 A;  4RVD A;  2NVY I;  3J80 b;  1YHQ Z;  1QVG Z;  3CCR Z;  3IR7 A;  3D2L A;  4RS4 A;  2RHB A;  1VQ6 1;  1WII A;  3PO2 I;  1YJW Z;  3U50 C;  2EGT A;  3S2D I;  2RIQ A;  2JNY A;  3J81 b;  3HOU I;  1VQM Z;  1QF8 A;  3CME Z;  3S1R I;  4RVH A;  1TFI A;  2RPR A;  5FLM I;  2GTI A;  4A3F I;  1TWC I;  2R6M A;  3GTJ I;  4MD9 A;  3HOZ I;  3CCU 1;  4E2Z A;  1VQN Z;  4NBE A;  2KPI A;  3CCQ 1;  2IV2 X;  3I55 Z;  5C4J I;  3GTL I;  1K9M 2;  1L1O C;  2W03 A;  2NVQ I;  3IF8 A;  4NBH A;  4A3L I;  3VMI A;  1YIT 1;  5FLX b;  2E2H I;  5IP7 I;  4E2Y A;  1VQ4 Z;  1ZB8 A;  1KQS Y;  3T4N B;  2JIO A;  2NVX I;  1Q82 1;  4HH4 A;  1YUK A;  5T67 A;  2NAP A;  4E2X A;  3G6E 1;  1YJ9 Z;  2NVT I;  2OOX B;  4A3J I;  3JAM b;  4MH4 A;  1KD1 1; 
#chains in the Genus database with same CATH homology
 1TWF I;  3GTO I;  3MON A;  3P5J B;  3CCL Z;  3RZD I;  3CCV 1;  2JS4 A;  2KI7 B;  5A2Q b;  3CCJ Z;  4TNU A;  2ZAE B;  1KQS Z;  1NP6 A;  2DE7 A;  2E2I I;  2OTJ 1;  1K8A 1;  1M90 1;  3CPW Y;  2QEX 1;  4MXU A;  4DQY B;  3D6W A;  4QTT A;  3BG0 B;  4NBC A;  1VQ9 Z;  4Y52 I;  1K9M 1;  3NDI A;  3QWU A;  4BBS I;  1QVF Y;  3NH8 A;  2O53 A;  3IFU A;  1RO0 A;  1N8R 1;  3M4O I;  1JWH C;  4A3E I;  3CQZ I;  2F4O A;  4NBA A;  2P3Y A;  4RV9 A;  5T6B A;  1VQP 1;  1WW9 A;  1VQK Z;  2DE6 A;  1VQO 1;  2JUB A;  3NH5 A;  2JA6 I;  1KRL A;  3CXC Y;  2IZ4 A;  1Z03 A;  3CCE 1;  2QLV B;  4CL1 A;  3H0G I;  3BG1 B;  1VQ7 Z;  3CCS 1;  2PM9 A;  2QRE B;  3TE5 B;  1K73 1;  2F4M A;  4A3B I;  1RQF A;  2OTL 1;  3PO3 I;  4A3K I;  1YIJ Z;  1RNI A;  3CC7 Z;  2M6N A;  1M1K 1;  1I3Q I;  1YJN Z;  3HKZ A;  4NH1 C;  2QRD B;  2VUG A;  1QYP A;  1VQ8 Z;  1VQL Z;  3S16 I;  1LQL A;  1X3Z A;  1TWH I;  1YI2 1;  2E2J I;  2Q4Z A;  4DK1 A;  3M3Y I;  5C4X I;  3CCM Z;  1NUI A;  3GCF A;  3CD6 1;  2PK7 A;  3J81 f;  5D1O B;  3VMH A;  4MD7 A;  2K3R A;  3G4S Z;  3ESW A;  2Q51 A;  3S17 I;  1VQ5 1;  4NOZ A;  2WB1 A;  2PMZ A;  3S15 I;  3I4M I;  1Z01 A;  1ZH1 A;  2R92 I;  3S1Q I;  3VMG A;  1VLA A;  2M48 A;  2DE5 A;  1JJ2 Y;  3EED A;  1Q7Y 1;  2QA4 Z;  2V8J A;  3G71 1;  1KC8 2;  2K5R A;  5D1O A;  3KIH A;  3TDH B;  3S1M I;  2VUM I;  2GU2 A;  1S72 1;  3I56 Z;  4A3I I;  4A3M I;  3CC4 Z;  1P9N A;  1VQK 1;  5FLX f;  4Y7N I;  3CC2 1;  3F3F C;  3FKI I;  1N2F A;  1VQ6 Z;  4RVG A;  4MD8 A;  2YU9 I;  4NBD A;  1YHQ 1;  1RO4 A;  4QTU A;  5IT9 b;  4MON A;  3CCR 1;  5CM2 M;  3JAM f;  3GTQ I;  1YUA A;  5T64 A;  1YJW 1;  3NDJ A;  3PO3 S;  4NBB A;  2H85 A;  1VQM 1;  3CME 1;  3NFZ A;  3CCU Z;  4MRI A;  4RVF A;  1S7M A;  3GTG I;  5A2Q f;  1I6H I;  3CCQ Z;  3CMA Z;  3S1N I;  2JMO A;  2JA5 I;  3H3V J;  1VQN 1;  3OW2 Y;  2YAD A;  4BBR I;  1Q86 2;  5LL6 f;  1PFT A;  3I55 1;  1YIT Z;  2VF1 A;  2OZK A;  4EWC A;  1KC8 1;  1QVG Y;  3VTN A;  3I07 A;  2WAQ A;  4HGZ A;  3CPW Z;  1VQ4 1;  3G6E Z;  4E31 A;  1RO2 A;  2BJO A;  2IZ3 A;  1QVF Z;  3GTM I;  2JA7 I;  1TWA I;  1YJ9 1;  2W04 A;  2O4H A;  3S14 I;  1KD1 2;  2RBL A;  3CCL 1;  4S1T A;  3J80 f;  3CXC Z;  1Q81 2;  2V8K A;  1RLY A;  2OTJ Z;  3CCJ 1;  1Y1V S;  4NBG A;  1Z02 A;  4NFR A;  4E2W A;  5D1P A;  2QEX Z;  2LIY A;  2HU9 A;  1TWG I;  1Q86 1;  3GTP I;  1K8A 2;  1M90 2;  1VQ9 1;  1X3W A;  1NJI 2;  3CMA 1;  2R7Z I;  1VQP Z;  4NB8 A;  1VQO Z;  4E32 A;  4DGL A;  2P28 A;  2E9H A;  1N8R 2;  3CCE Z;  3GKQ A;  5C44 I;  3Q87 A;  3CCS Z;  4A93 I;  1Y1V I;  4BY1 I;  2JR6 A;  2OTL Z;  3D9X A;  4A3G I;  1VQ7 1;  3MZL B;  1ML8 A;  4NB9 A;  2HF1 A;  1JJ2 Z;  4XX2 A;  3GTM S;  4BXX I;  1W2B Y;  3FQM A;  1I50 I;  4A3D I;  1K73 2;  1YIJ 1;  3CC7 1;  1Q81 1;  1YI2 Z;  2RT9 A;  1YJN 1;  3HOV I;  3VB9 A;  3HOX I;  1VQ8 1;  2GTH A;  1VQL 1;  1M1K 2;  2QKD A;  3K7A I;  4X6A I;  3CD6 Z;  4A3C I;  2QR1 B;  3J7A 4;  3EER A;  5IT9 f;  4HGY A;  3HOY I;  3CCM 1;  1USP B;  1VQ5 Z;  2Y0S A;  3MZK B;  3LUS A;  1Y1W I;  1SFO I;  2B63 I;  3I4N I;  2JA8 I;  2I3C A;  1W2B Z;  1NJI 1;  3G4S 1;  1R9T I;  2QRC B;  2G2K A;  3KIF A;  2R93 I;  2J6A A;  3G71 Z;  3GTK I;  3S2H I;  5IP9 I;  2LFU A;  4AYB A;  1K83 I;  1USP A;  1S72 Z;  3NH4 A;  4BY7 I;  2AKL A;  3HOW I;  2QA4 1;  1Q82 2;  3RZO I;  2OOY B;  5C3E I;  3OW2 Z;  1Q7Y 2;  1DL6 A;  4E30 A;  3CC2 Z;  3I56 1;  3FQQ A;  3F3P C;  2V8I A;  4E33 A;  5AN9 F;  3CCV Z;  3CC4 1;  1WCM I;  3IX0 A;  4NBF A;  1X0T A;  1ZB9 A;  4RVD A;  2NVY I;  3J80 b;  1YHQ Z;  1QVG Z;  3CCR Z;  4RS4 A;  2RHB A;  1VQ6 1;  1WII A;  3PO2 I;  1YJW Z;  3U50 C;  2EGT A;  3S2D I;  2RIQ A;  2JNY A;  3J81 b;  3HOU I;  1VQM Z;  1QF8 A;  3CME Z;  3S1R I;  4RVH A;  1TFI A;  2RPR A;  5FLM I;  2GTI A;  4A3F I;  1TWC I;  2R6M A;  3GTJ I;  4MD9 A;  3HOZ I;  3CCU 1;  4E2Z A;  1VQN Z;  4NBE A;  2KPI A;  3CCQ 1;  3I55 Z;  5C4J I;  3GTL I;  1K9M 2;  1L1O C;  2W03 A;  2NVQ I;  3IF8 A;  4NBH A;  4A3L I;  3VMI A;  1YIT 1;  5FLX b;  2E2H I;  5IP7 I;  4E2Y A;  1VQ4 Z;  1ZB8 A;  1KQS Y;  3T4N B;  2NVX I;  1Q82 1;  4HH4 A;  1YUK A;  5T67 A;  4E2X A;  3G6E 1;  1YJ9 Z;  2NVT I;  2OOX B;  4A3J I;  3JAM b;  4MH4 A;  1KD1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...