1YIT1

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yit100
1QVGY 1VQP1 1QVFZ 1VQ61 1W2BY 1NJI1 1VQPZ 1VQK1 1VQ6Z 1K731 1NJI2 3CCL1 1K732 1N8R1 2QEX1 1VQ41 3CCLZ 3I561 1JJ2Z 1VQM1 1KQSZ 3CCE1 2QEXZ 3CCQ1 3CD6Z 1N8R2 1VQ91 3I56Z 3CXCY 3CC21 1YI2Z 3CCQZ 1QVFY 1YJN1 1S72Z 3CC2Z 1YJ91 1YHQ1 1YJNZ 3CCM1 1K9M1 1KD11 3CCS1 3CCMZ 3CCV1 1K9M2 1KD12 1VQKZ 1Q811 3OW2Z 3CCVZ 1JJ2Y 1KQSY 1M901 1YIT1 1VQ81 1Q812 1YITZ 1M902 1VQ4Z 3CCR1 1VQMZ 3CCEZ 1YIJ1 1VQL1 3CCRZ 1VQ9Z 1YJW1 3CCJ1 2QA41 1VQLZ 1VQN1 1Q7Y1 3G4S1 1YJ9Z 1YJWZ 3CCJZ 2OTL1 3G6E1 2QA4Z 1YHQZ 1KC81 1VQ71 1VQNZ 3G4SZ 3OW2Y 1VQO1 1Q7Y2 1VQ7Z 3CCSZ 1KC82 3CME1 1VQOZ 3CC71 3CMEZ 3CPWZ 1VQ8Z 3I551 1K8A2 2OTJ1 1Q821 3I55Z 1QVGZ 2OTJZ 1YIJZ 1M1K1 1Q822 1W2BZ 1VQ51 3G711 1M1K2 3CMA1 1Q861 1VQ5Z 3G71Z 3G6EZ 2OTLZ 3CD61 3CMAZ 1YI21 1Q862 3CPWY 3CC41 1S721 3CCU1 3CC4Z 1K8A1 3CC7Z 3CXCZ 3CCUZ
chains in the Genus database with same CATH superfamily
4DK1A 1S7MA 1QVFZ 1W2BY 5C44I 1NJI1 2NVYI 1VQ6Z 2GTIA 1TWGI 1R9TI 1K732 5IP9I 1RNIA 3LUSA 2LIYA 1N8R1 3H0GI 3NH8A 4X6AI 3S2HI 1VQM1 4A93I 3CCE1 2QEXZ 3CD6Z 2GU2A 2JIQA 4RVGA 3ESWA 2JIRA 2YU9I 1YJN1 2JA5I 2QR1B 3CC2Z 1YJ91 4E30A 2JS4A 3CCV1 5C4JI 1KD12 3TDHB 2WAQA 1VQKZ 4CL1A 4DQYB 1JJ2Y 2R6MA 5T64A 1M901 4NB8A 1Q812 2W04A 1VQ4Z 2JIOA 5C4XI 5AN9F 2M48A 4E2YA 1YIJ1 1VQLZ 3NH5A 2NAPA 1P9NA 2QA4Z 1YHQZ 1KC81 3S1NI 4MD9A 3OW2Y 1VQO1 1Q7Y2 4NBCA 3GTLI 3CME1 2JIMA 2WB1A 4A3BI 2JA6I 3HOZI 4MD7A 2B63I 1VQ8Z 2V8IA 2O53A 3I551 1QF8A 2F4OA 1QVGZ 2W03A 1TWFI 3S15I 4E32A 1VQ51 2Y0SA 1WJ2A 4RVHA 3G71Z 3IX0A 2R93I 2HU9A 5IP7I 2HF1A 1NUIA 1S721 2JUBA 4E31A 3CCU1 4HH4A 3CC7Z 1RQFA 2IZ3A 2RPRA 1RO4A 4RVFA 3JAMb 4XX2A 4NBAA 5T67A 4QTTA 3Q87A 1X3WA 2RIQA 1WCMI 3VTNA 1LQLA 1WZNA 3NDIA 1ML8A 3CCQ1 2QKDA 4A3EI 1YI2Z 3CXCY 2J6AA 1QVFY 2PM9A 3IFUA 3BG1B 4E2ZA 1YJNZ 3CCM1 1K9M1 3CCS1 5LL6f 2PK7A 3I07A 3EERA 4NBGA 1Z02A 3CCVZ 2VPXA 2KI7B 4A3KI 1YIT1 2G2KA 3KIHA 4BY7I 3T4NB 2KPIA 1I6HI 3VB9A 3GTJI 4A3MI 4MD8A 4BBSI 5T6BA 1VQ9Z 4MRIA 2V8KA 3JAMf 3D9XA 2E2JI 4A3JI 2OTL1 4NBEA 3U50C 1VQ71 3S17I 3FQQA 3MZLB 1Z01A 1Z03A 1VQOZ 2NVXI 5D1PA 1Y1VS 2K3RA 2QLVB 1L1OC 3CMEZ 3P5JB 4DGLA 3J81f 3GTMS 2YADA 3S14I 4NBDA 1QXFA 4A3CI 3I55Z 3VMGA 3MZKB 4E2WA 1M1K1 1Q822 1USPB 1I50I 3IF8A 2JNYA 5D1OB 3CMA1 1Q861 1VQ5Z 3G6EZ 3CD61 1ZH1A 2V3VA 1Q16A 3NFZA 3K7AI 2JIPA 1K83I 2R92I 2NVQI 2F4MA 3FKII 1TFIA 3I4NI 1KRLA 3CCUZ 3D2LA 1WW9A 1QVGY 1WIIA 1VQP1 3GTPI 3CQZI 2LEXA 1VQK1 4QTUA 1K731 1Y8CA 3TE5B 3HOXI 1NJI2 2AYDA 5C3EI 3CCL1 2V8JA 3I4MI 3M3YI 1VQ41 4AYBA 3I561 1JWHC 1KQSZ 3GCFA 1N8R2 3D6WA 2R7ZI 1YUKA 4BY1I 2OOYB 3IR7A 3CCQZ 2RBLA 4HGYA 1N2FA 2DE7A 1VLAA 1YHQ1 1KD11 4BBRI 3CCMZ 1DL6A 2OZKA 1Q811 3F3PC 1USPA 4NBHA 1FDOA 1VQ81 4EWCA 1I3QI 5D1OA 3S16I 3GKQA 3PO3S 3RZDI 2QREB 1YITZ 1SFOI 1M902 2VUMI 3J81b 3CCR1 1SIWA 1VQMZ 3CCEZ 1ZB8A 2H85A 3J80f 4A3II 3F3FC 4RV9A 4TNUA 1YJW1 3CCJ1 3GTGI 2VPWA 5IT9b 4Y7NI 1VQN1 1Q7Y1 3G4S1 1YJ9Z 4MONA 1NP6A 3S1QI 2M6NA 3GTOI 1VQ7Z 1X3ZA 1KC82 3NDJA 3CC71 1FDIA 3QWUA 3CPWZ 1AA6A 3EEDA 2OTJ1 3GTKI 3RZOI 3H3VJ 2DE5A 2JR6A 1YIJZ 1W2BZ 2VF1A 4NOZA 4NB9A 1RLYA 4NFRA 1RO2A 1Y1WI 3CMAZ 1YI21 4A3LI 3VMIA 5FLXb 4MXUA 3CC41 2E7ZA 3S1MI 1RO0A 3HOVI 1ZB9A 3HKZA 2E9HA 1TWAI 1K8A1 4A3FI 4BXXI 2I3CA 2O4HA 3HOWI 5CM2M 4A3DI 1VQ61 2RHBA 1Y1VI 2P28A 5IT9f 2QRDB 1VQPZ 2IZ4A 3GTMI 3NH4A 3PO2I 2QEX1 2P3YA 3CCLZ 1JJ2Z 3VMHA 2RT9A 1VQ91 3I56Z 3CC21 2VUGA 4A3GI 4MH4A 1S72Z 3FQMA 3M4OI 3J80b 2K5RA 5FLMI 3GTQI 1TWCI 2QRCB 1K9M2 2DE6A 2IV2X 3OW2Z 1KQSY 3S1RI 5FLXf 5A2Qb 3MONA 2Q51A 3S2DI 4HGZA 1X0TA 1VQL1 3CCRZ 1PFTA 3HOYI 1QYPA 2QA41 1TWHI 3J7A4 4E33A 1YJWZ 3CCJZ 4NBFA 3G6E1 1VQNZ 3G4SZ 4E2XA 2VPZA 3CCSZ 2NVTI 3BG0B 2E2II 2JMOA 4S1TA 2OOXB 2Q4ZA 3KIFA 2PMZA 3HOUI 4RS4A 4NH1C 1K8A2 1Q821 2OTJZ 3PO3I 2EGTA 2ZAEB 3G711 2JA7I 2E2HI 1M1K2 2V45A 4NBBA 2GTHA 2VPYA 2BJOA 2OTLZ 4Y52I 1Q862 2AKLA 2LFUA 3CPWY 5A2Qf 2JA8I 1YUAA 3CC4Z 3CXCZ 4RVDA
chains in the Genus database with same CATH topology
4DK1A 1S7MA 1QVFZ 1W2BY 5C44I 1NJI1 2NVYI 1VQ6Z 2GTIA 1TWGI 1R9TI 1K732 5IP9I 1RNIA 3LUSA 2LIYA 1N8R1 3H0GI 3NH8A 4X6AI 3S2HI 1VQM1 4A93I 3CCE1 2QEXZ 3CD6Z 2GU2A 4RVGA 3ESWA 2YU9I 1YJN1 2JA5I 2QR1B 3CC2Z 1YJ91 4E30A 2JS4A 3CCV1 5C4JI 1KD12 3TDHB 2WAQA 1VQKZ 4CL1A 4DQYB 1JJ2Y 2R6MA 5T64A 1M901 4NB8A 1Q812 2W04A 1VQ4Z 5C4XI 5AN9F 2M48A 4E2YA 1YIJ1 1VQLZ 3NH5A 1P9NA 2QA4Z 1YHQZ 1KC81 3S1NI 4MD9A 3OW2Y 1VQO1 1Q7Y2 4NBCA 3GTLI 3CME1 2WB1A 4A3BI 2JA6I 3HOZI 4MD7A 2B63I 1VQ8Z 2V8IA 2O53A 3I551 1QF8A 2F4OA 1QVGZ 2W03A 1TWFI 3S15I 4E32A 1VQ51 2Y0SA 4RVHA 3G71Z 3IX0A 2R93I 2HU9A 5IP7I 2HF1A 1NUIA 1S721 2JUBA 4E31A 3CCU1 4HH4A 3CC7Z 1RQFA 2IZ3A 2RPRA 1RO4A 4RVFA 3JAMb 4XX2A 4NBAA 5T67A 4QTTA 3Q87A 1X3WA 2RIQA 1WCMI 3VTNA 1LQLA 3NDIA 1ML8A 3CCQ1 2QKDA 4A3EI 1YI2Z 3CXCY 2J6AA 1QVFY 2PM9A 3IFUA 3BG1B 4E2ZA 1YJNZ 3CCM1 1K9M1 3CCS1 5LL6f 2PK7A 3I07A 3EERA 4NBGA 1Z02A 3CCVZ 2KI7B 4A3KI 1YIT1 2G2KA 3KIHA 4BY7I 3T4NB 2KPIA 1I6HI 3VB9A 3GTJI 4A3MI 4MD8A 4BBSI 5T6BA 1VQ9Z 4MRIA 2V8KA 3JAMf 3D9XA 2E2JI 4A3JI 2OTL1 4NBEA 3U50C 1VQ71 3S17I 3FQQA 3MZLB 1Z01A 1Z03A 1VQOZ 2NVXI 5D1PA 1Y1VS 2K3RA 2QLVB 1L1OC 3CMEZ 3P5JB 4DGLA 3J81f 3GTMS 2YADA 3S14I 4NBDA 4A3CI 3I55Z 3VMGA 3MZKB 4E2WA 1M1K1 1Q822 1USPB 1I50I 3IF8A 2JNYA 5D1OB 3CMA1 1Q861 1VQ5Z 3G6EZ 3CD61 1ZH1A 3NFZA 3K7AI 1K83I 2R92I 2NVQI 2F4MA 3FKII 1TFIA 3I4NI 1KRLA 3CCUZ 1WW9A 1QVGY 1WIIA 1VQP1 3GTPI 3CQZI 1VQK1 4QTUA 1K731 3TE5B 3HOXI 1NJI2 5C3EI 3CCL1 2V8JA 3I4MI 3M3YI 1VQ41 4AYBA 3I561 1JWHC 1KQSZ 3GCFA 1N8R2 3D6WA 2R7ZI 1YUKA 4BY1I 2OOYB 3CCQZ 2RBLA 4HGYA 1N2FA 2DE7A 1VLAA 1YHQ1 1KD11 4BBRI 3CCMZ 1DL6A 2OZKA 1Q811 3F3PC 1USPA 4NBHA 1VQ81 4EWCA 1I3QI 5D1OA 3S16I 3GKQA 3PO3S 3RZDI 2QREB 1YITZ 1SFOI 1M902 2VUMI 3J81b 3CCR1 1VQMZ 3CCEZ 1ZB8A 2H85A 3J80f 4A3II 3F3FC 4RV9A 4TNUA 1YJW1 3CCJ1 3GTGI 5IT9b 4Y7NI 1VQN1 1Q7Y1 3G4S1 1YJ9Z 4MONA 1NP6A 3S1QI 2M6NA 3GTOI 1VQ7Z 1X3ZA 1KC82 3NDJA 3CC71 3QWUA 3CPWZ 3EEDA 2OTJ1 3GTKI 3RZOI 3H3VJ 2DE5A 2JR6A 1YIJZ 1W2BZ 2VF1A 4NOZA 4NB9A 1RLYA 4NFRA 1RO2A 1Y1WI 3CMAZ 1YI21 4A3LI 3VMIA 4MXUA 5FLXb 3CC41 3S1MI 1RO0A 3HOVI 1ZB9A 3HKZA 2E9HA 1TWAI 1K8A1 4A3FI 4BXXI 2I3CA 2O4HA 3HOWI 5CM2M 4A3DI 1VQ61 2RHBA 1Y1VI 2P28A 5IT9f 2QRDB 1VQPZ 2IZ4A 3GTMI 3NH4A 3PO2I 2QEX1 2P3YA 3CCLZ 1JJ2Z 3VMHA 2RT9A 1VQ91 3I56Z 3CC21 2VUGA 4A3GI 4MH4A 1S72Z 3FQMA 3M4OI 3J80b 2K5RA 5FLMI 3GTQI 1TWCI 2QRCB 1K9M2 2DE6A 3OW2Z 1KQSY 3S1RI 5FLXf 5A2Qb 3MONA 2Q51A 3S2DI 4HGZA 1X0TA 1VQL1 3CCRZ 1PFTA 3HOYI 1QYPA 2QA41 1TWHI 3J7A4 4E33A 1YJWZ 3CCJZ 4NBFA 3G6E1 1VQNZ 3G4SZ 4E2XA 3CCSZ 2NVTI 3BG0B 2E2II 2JMOA 4S1TA 2OOXB 2Q4ZA 3KIFA 2PMZA 3HOUI 4RS4A 4NH1C 1K8A2 1Q821 2OTJZ 3PO3I 2EGTA 2ZAEB 3G711 2JA7I 2E2HI 1M1K2 4NBBA 2GTHA 2BJOA 2OTLZ 4Y52I 1Q862 2AKLA 2LFUA 3CPWY 5A2Qf 2JA8I 1YUAA 3CC4Z 3CXCZ 4RVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Y;  1VQP 1;  1QVF Z;  1VQ6 1;  1W2B Y;  1NJI 1;  1VQP Z;  1VQK 1;  1VQ6 Z;  1K73 1;  1NJI 2;  3CCL 1;  1K73 2;  1N8R 1;  2QEX 1;  1VQ4 1;  3CCL Z;  3I56 1;  1JJ2 Z;  1VQM 1;  1KQS Z;  3CCE 1;  2QEX Z;  3CCQ 1;  3CD6 Z;  1N8R 2;  1VQ9 1;  3I56 Z;  3CXC Y;  3CC2 1;  1YI2 Z;  3CCQ Z;  1QVF Y;  1YJN 1;  1S72 Z;  3CC2 Z;  1YJ9 1;  1YHQ 1;  1YJN Z;  3CCM 1;  1K9M 1;  1KD1 1;  3CCS 1;  3CCM Z;  3CCV 1;  1K9M 2;  1KD1 2;  1VQK Z;  1Q81 1;  3OW2 Z;  3CCV Z;  1JJ2 Y;  1KQS Y;  1M90 1;  1YIT 1;  1VQ8 1;  1Q81 2;  1YIT Z;  1M90 2;  1VQ4 Z;  3CCR 1;  1VQM Z;  3CCE Z;  1YIJ 1;  1VQL 1;  3CCR Z;  1VQ9 Z;  1YJW 1;  3CCJ 1;  2QA4 1;  1VQL Z;  1VQN 1;  1Q7Y 1;  3G4S 1;  1YJ9 Z;  1YJW Z;  3CCJ Z;  2OTL 1;  3G6E 1;  2QA4 Z;  1YHQ Z;  1KC8 1;  1VQ7 1;  1VQN Z;  3G4S Z;  3OW2 Y;  1VQO 1;  1Q7Y 2;  1VQ7 Z;  3CCS Z;  1KC8 2;  3CME 1;  1VQO Z;  3CC7 1;  3CME Z;  3CPW Z;  1VQ8 Z;  3I55 1;  1K8A 2;  2OTJ 1;  1Q82 1;  3I55 Z;  1QVG Z;  2OTJ Z;  1YIJ Z;  1M1K 1;  1Q82 2;  1W2B Z;  1VQ5 1;  3G71 1;  1M1K 2;  3CMA 1;  1Q86 1;  1VQ5 Z;  3G71 Z;  3G6E Z;  2OTL Z;  3CD6 1;  3CMA Z;  1YI2 1;  1Q86 2;  3CPW Y;  3CC4 1;  1S72 1;  3CCU 1;  3CC4 Z;  1K8A 1;  3CC7 Z;  3CXC Z;  3CCU Z; 
#chains in the Genus database with same CATH topology
 4DK1 A;  1S7M A;  1QVF Z;  1W2B Y;  5C44 I;  1NJI 1;  2NVY I;  1VQ6 Z;  2GTI A;  1TWG I;  1R9T I;  1K73 2;  5IP9 I;  1RNI A;  3LUS A;  2LIY A;  1N8R 1;  3H0G I;  3NH8 A;  4X6A I;  3S2H I;  1VQM 1;  4A93 I;  3CCE 1;  2QEX Z;  3CD6 Z;  2GU2 A;  2JIQ A;  4RVG A;  3ESW A;  2JIR A;  2YU9 I;  1YJN 1;  2JA5 I;  2QR1 B;  3CC2 Z;  1YJ9 1;  4E30 A;  2JS4 A;  3CCV 1;  5C4J I;  1KD1 2;  3TDH B;  2WAQ A;  1VQK Z;  4CL1 A;  4DQY B;  1JJ2 Y;  2R6M A;  5T64 A;  1M90 1;  4NB8 A;  1Q81 2;  2W04 A;  1VQ4 Z;  2JIO A;  5C4X I;  5AN9 F;  2M48 A;  4E2Y A;  1YIJ 1;  1VQL Z;  3NH5 A;  2NAP A;  1P9N A;  2QA4 Z;  1YHQ Z;  1KC8 1;  3S1N I;  4MD9 A;  3OW2 Y;  1VQO 1;  1Q7Y 2;  4NBC A;  3GTL I;  3CME 1;  2JIM A;  2WB1 A;  4A3B I;  2JA6 I;  3HOZ I;  4MD7 A;  2B63 I;  1VQ8 Z;  2V8I A;  2O53 A;  3I55 1;  1QF8 A;  2F4O A;  1QVG Z;  2W03 A;  1TWF I;  3S15 I;  4E32 A;  1VQ5 1;  2Y0S A;  1WJ2 A;  4RVH A;  3G71 Z;  3IX0 A;  2R93 I;  2HU9 A;  5IP7 I;  2HF1 A;  1NUI A;  1S72 1;  2JUB A;  4E31 A;  3CCU 1;  4HH4 A;  3CC7 Z;  1RQF A;  2IZ3 A;  2RPR A;  1RO4 A;  4RVF A;  3JAM b;  4XX2 A;  4NBA A;  5T67 A;  4QTT A;  3Q87 A;  1X3W A;  2RIQ A;  1WCM I;  3VTN A;  1LQL A;  1WZN A;  3NDI A;  1ML8 A;  3CCQ 1;  2QKD A;  4A3E I;  1YI2 Z;  3CXC Y;  2J6A A;  1QVF Y;  2PM9 A;  3IFU A;  3BG1 B;  4E2Z A;  1YJN Z;  3CCM 1;  1K9M 1;  3CCS 1;  5LL6 f;  2PK7 A;  3I07 A;  3EER A;  4NBG A;  1Z02 A;  3CCV Z;  2VPX A;  2KI7 B;  4A3K I;  1YIT 1;  2G2K A;  3KIH A;  4BY7 I;  3T4N B;  2KPI A;  1I6H I;  3VB9 A;  3GTJ I;  4A3M I;  4MD8 A;  4BBS I;  5T6B A;  1VQ9 Z;  4MRI A;  2V8K A;  3JAM f;  3D9X A;  2E2J I;  4A3J I;  2OTL 1;  4NBE A;  3U50 C;  1VQ7 1;  3S17 I;  3FQQ A;  3MZL B;  1Z01 A;  1Z03 A;  1VQO Z;  2NVX I;  5D1P A;  1Y1V S;  2K3R A;  2QLV B;  1L1O C;  3CME Z;  3P5J B;  4DGL A;  3J81 f;  3GTM S;  2YAD A;  3S14 I;  4NBD A;  1QXF A;  4A3C I;  3I55 Z;  3VMG A;  3MZK B;  4E2W A;  1M1K 1;  1Q82 2;  1USP B;  1I50 I;  3IF8 A;  2JNY A;  5D1O B;  3CMA 1;  1Q86 1;  1VQ5 Z;  3G6E Z;  3CD6 1;  1ZH1 A;  2V3V A;  1Q16 A;  3NFZ A;  3K7A I;  2JIP A;  1K83 I;  2R92 I;  2NVQ I;  2F4M A;  3FKI I;  1TFI A;  3I4N I;  1KRL A;  3CCU Z;  3D2L A;  1WW9 A;  1QVG Y;  1WII A;  1VQP 1;  3GTP I;  3CQZ I;  2LEX A;  1VQK 1;  4QTU A;  1K73 1;  1Y8C A;  3TE5 B;  3HOX I;  1NJI 2;  2AYD A;  5C3E I;  3CCL 1;  2V8J A;  3I4M I;  3M3Y I;  1VQ4 1;  4AYB A;  3I56 1;  1JWH C;  1KQS Z;  3GCF A;  1N8R 2;  3D6W A;  2R7Z I;  1YUK A;  4BY1 I;  2OOY B;  3IR7 A;  3CCQ Z;  2RBL A;  4HGY A;  1N2F A;  2DE7 A;  1VLA A;  1YHQ 1;  1KD1 1;  4BBR I;  3CCM Z;  1DL6 A;  2OZK A;  1Q81 1;  3F3P C;  1USP A;  4NBH A;  1FDO A;  1VQ8 1;  4EWC A;  1I3Q I;  5D1O A;  3S16 I;  3GKQ A;  3PO3 S;  3RZD I;  2QRE B;  1YIT Z;  1SFO I;  1M90 2;  2VUM I;  3J81 b;  3CCR 1;  1SIW A;  1VQM Z;  3CCE Z;  1ZB8 A;  2H85 A;  3J80 f;  4A3I I;  3F3F C;  4RV9 A;  4TNU A;  1YJW 1;  3CCJ 1;  3GTG I;  2VPW A;  5IT9 b;  4Y7N I;  1VQN 1;  1Q7Y 1;  3G4S 1;  1YJ9 Z;  4MON A;  1NP6 A;  3S1Q I;  2M6N A;  3GTO I;  1VQ7 Z;  1X3Z A;  1KC8 2;  3NDJ A;  3CC7 1;  1FDI A;  3QWU A;  3CPW Z;  1AA6 A;  3EED A;  2OTJ 1;  3GTK I;  3RZO I;  3H3V J;  2DE5 A;  2JR6 A;  1YIJ Z;  1W2B Z;  2VF1 A;  4NOZ A;  4NB9 A;  1RLY A;  4NFR A;  1RO2 A;  1Y1W I;  3CMA Z;  1YI2 1;  4A3L I;  3VMI A;  5FLX b;  4MXU A;  3CC4 1;  2E7Z A;  3S1M I;  1RO0 A;  3HOV I;  1ZB9 A;  3HKZ A;  2E9H A;  1TWA I;  1K8A 1;  4A3F I;  4BXX I;  2I3C A;  2O4H A;  3HOW I;  5CM2 M;  4A3D I;  1VQ6 1;  2RHB A;  1Y1V I;  2P28 A;  5IT9 f;  2QRD B;  1VQP Z;  2IZ4 A;  3GTM I;  3NH4 A;  3PO2 I;  2QEX 1;  2P3Y A;  3CCL Z;  1JJ2 Z;  3VMH A;  2RT9 A;  1VQ9 1;  3I56 Z;  3CC2 1;  2VUG A;  4A3G I;  4MH4 A;  1S72 Z;  3FQM A;  3M4O I;  3J80 b;  2K5R A;  5FLM I;  3GTQ I;  1TWC I;  2QRC B;  1K9M 2;  2DE6 A;  2IV2 X;  3OW2 Z;  1KQS Y;  3S1R I;  5FLX f;  5A2Q b;  3MON A;  2Q51 A;  3S2D I;  4HGZ A;  1X0T A;  1VQL 1;  3CCR Z;  1PFT A;  3HOY I;  1QYP A;  2QA4 1;  1TWH I;  3J7A 4;  4E33 A;  1YJW Z;  3CCJ Z;  4NBF A;  3G6E 1;  1VQN Z;  3G4S Z;  4E2X A;  2VPZ A;  3CCS Z;  2NVT I;  3BG0 B;  2E2I I;  2JMO A;  4S1T A;  2OOX B;  2Q4Z A;  3KIF A;  2PMZ A;  3HOU I;  4RS4 A;  4NH1 C;  1K8A 2;  1Q82 1;  2OTJ Z;  3PO3 I;  2EGT A;  2ZAE B;  3G71 1;  2JA7 I;  2E2H I;  1M1K 2;  2V45 A;  4NBB A;  2GTH A;  2VPY A;  2BJO A;  2OTL Z;  4Y52 I;  1Q86 2;  2AKL A;  2LFU A;  3CPW Y;  5A2Q f;  2JA8 I;  1YUA A;  3CC4 Z;  3CXC Z;  4RVD A; 
#chains in the Genus database with same CATH homology
 4DK1 A;  1S7M A;  1QVF Z;  1W2B Y;  5C44 I;  1NJI 1;  2NVY I;  1VQ6 Z;  2GTI A;  1TWG I;  1R9T I;  1K73 2;  5IP9 I;  1RNI A;  3LUS A;  2LIY A;  1N8R 1;  3H0G I;  3NH8 A;  4X6A I;  3S2H I;  1VQM 1;  4A93 I;  3CCE 1;  2QEX Z;  3CD6 Z;  2GU2 A;  4RVG A;  3ESW A;  2YU9 I;  1YJN 1;  2JA5 I;  2QR1 B;  3CC2 Z;  1YJ9 1;  4E30 A;  2JS4 A;  3CCV 1;  5C4J I;  1KD1 2;  3TDH B;  2WAQ A;  1VQK Z;  4CL1 A;  4DQY B;  1JJ2 Y;  2R6M A;  5T64 A;  1M90 1;  4NB8 A;  1Q81 2;  2W04 A;  1VQ4 Z;  5C4X I;  5AN9 F;  2M48 A;  4E2Y A;  1YIJ 1;  1VQL Z;  3NH5 A;  1P9N A;  2QA4 Z;  1YHQ Z;  1KC8 1;  3S1N I;  4MD9 A;  3OW2 Y;  1VQO 1;  1Q7Y 2;  4NBC A;  3GTL I;  3CME 1;  2WB1 A;  4A3B I;  2JA6 I;  3HOZ I;  4MD7 A;  2B63 I;  1VQ8 Z;  2V8I A;  2O53 A;  3I55 1;  1QF8 A;  2F4O A;  1QVG Z;  2W03 A;  1TWF I;  3S15 I;  4E32 A;  1VQ5 1;  2Y0S A;  4RVH A;  3G71 Z;  3IX0 A;  2R93 I;  2HU9 A;  5IP7 I;  2HF1 A;  1NUI A;  1S72 1;  2JUB A;  4E31 A;  3CCU 1;  4HH4 A;  3CC7 Z;  1RQF A;  2IZ3 A;  2RPR A;  1RO4 A;  4RVF A;  3JAM b;  4XX2 A;  4NBA A;  5T67 A;  4QTT A;  3Q87 A;  1X3W A;  2RIQ A;  1WCM I;  3VTN A;  1LQL A;  3NDI A;  1ML8 A;  3CCQ 1;  2QKD A;  4A3E I;  1YI2 Z;  3CXC Y;  2J6A A;  1QVF Y;  2PM9 A;  3IFU A;  3BG1 B;  4E2Z A;  1YJN Z;  3CCM 1;  1K9M 1;  3CCS 1;  5LL6 f;  2PK7 A;  3I07 A;  3EER A;  4NBG A;  1Z02 A;  3CCV Z;  2KI7 B;  4A3K I;  1YIT 1;  2G2K A;  3KIH A;  4BY7 I;  3T4N B;  2KPI A;  1I6H I;  3VB9 A;  3GTJ I;  4A3M I;  4MD8 A;  4BBS I;  5T6B A;  1VQ9 Z;  4MRI A;  2V8K A;  3JAM f;  3D9X A;  2E2J I;  4A3J I;  2OTL 1;  4NBE A;  3U50 C;  1VQ7 1;  3S17 I;  3FQQ A;  3MZL B;  1Z01 A;  1Z03 A;  1VQO Z;  2NVX I;  5D1P A;  1Y1V S;  2K3R A;  2QLV B;  1L1O C;  3CME Z;  3P5J B;  4DGL A;  3J81 f;  3GTM S;  2YAD A;  3S14 I;  4NBD A;  4A3C I;  3I55 Z;  3VMG A;  3MZK B;  4E2W A;  1M1K 1;  1Q82 2;  1USP B;  1I50 I;  3IF8 A;  2JNY A;  5D1O B;  3CMA 1;  1Q86 1;  1VQ5 Z;  3G6E Z;  3CD6 1;  1ZH1 A;  3NFZ A;  3K7A I;  1K83 I;  2R92 I;  2NVQ I;  2F4M A;  3FKI I;  1TFI A;  3I4N I;  1KRL A;  3CCU Z;  1WW9 A;  1QVG Y;  1WII A;  1VQP 1;  3GTP I;  3CQZ I;  1VQK 1;  4QTU A;  1K73 1;  3TE5 B;  3HOX I;  1NJI 2;  5C3E I;  3CCL 1;  2V8J A;  3I4M I;  3M3Y I;  1VQ4 1;  4AYB A;  3I56 1;  1JWH C;  1KQS Z;  3GCF A;  1N8R 2;  3D6W A;  2R7Z I;  1YUK A;  4BY1 I;  2OOY B;  3CCQ Z;  2RBL A;  4HGY A;  1N2F A;  2DE7 A;  1VLA A;  1YHQ 1;  1KD1 1;  4BBR I;  3CCM Z;  1DL6 A;  2OZK A;  1Q81 1;  3F3P C;  1USP A;  4NBH A;  1VQ8 1;  4EWC A;  1I3Q I;  5D1O A;  3S16 I;  3GKQ A;  3PO3 S;  3RZD I;  2QRE B;  1YIT Z;  1SFO I;  1M90 2;  2VUM I;  3J81 b;  3CCR 1;  1VQM Z;  3CCE Z;  1ZB8 A;  2H85 A;  3J80 f;  4A3I I;  3F3F C;  4RV9 A;  4TNU A;  1YJW 1;  3CCJ 1;  3GTG I;  5IT9 b;  4Y7N I;  1VQN 1;  1Q7Y 1;  3G4S 1;  1YJ9 Z;  4MON A;  1NP6 A;  3S1Q I;  2M6N A;  3GTO I;  1VQ7 Z;  1X3Z A;  1KC8 2;  3NDJ A;  3CC7 1;  3QWU A;  3CPW Z;  3EED A;  2OTJ 1;  3GTK I;  3RZO I;  3H3V J;  2DE5 A;  2JR6 A;  1YIJ Z;  1W2B Z;  2VF1 A;  4NOZ A;  4NB9 A;  1RLY A;  4NFR A;  1RO2 A;  1Y1W I;  3CMA Z;  1YI2 1;  4A3L I;  3VMI A;  4MXU A;  5FLX b;  3CC4 1;  3S1M I;  1RO0 A;  3HOV I;  1ZB9 A;  3HKZ A;  2E9H A;  1TWA I;  1K8A 1;  4A3F I;  4BXX I;  2I3C A;  2O4H A;  3HOW I;  5CM2 M;  4A3D I;  1VQ6 1;  2RHB A;  1Y1V I;  2P28 A;  5IT9 f;  2QRD B;  1VQP Z;  2IZ4 A;  3GTM I;  3NH4 A;  3PO2 I;  2QEX 1;  2P3Y A;  3CCL Z;  1JJ2 Z;  3VMH A;  2RT9 A;  1VQ9 1;  3I56 Z;  3CC2 1;  2VUG A;  4A3G I;  4MH4 A;  1S72 Z;  3FQM A;  3M4O I;  3J80 b;  2K5R A;  5FLM I;  3GTQ I;  1TWC I;  2QRC B;  1K9M 2;  2DE6 A;  3OW2 Z;  1KQS Y;  3S1R I;  5FLX f;  5A2Q b;  3MON A;  2Q51 A;  3S2D I;  4HGZ A;  1X0T A;  1VQL 1;  3CCR Z;  1PFT A;  3HOY I;  1QYP A;  2QA4 1;  1TWH I;  3J7A 4;  4E33 A;  1YJW Z;  3CCJ Z;  4NBF A;  3G6E 1;  1VQN Z;  3G4S Z;  4E2X A;  3CCS Z;  2NVT I;  3BG0 B;  2E2I I;  2JMO A;  4S1T A;  2OOX B;  2Q4Z A;  3KIF A;  2PMZ A;  3HOU I;  4RS4 A;  4NH1 C;  1K8A 2;  1Q82 1;  2OTJ Z;  3PO3 I;  2EGT A;  2ZAE B;  3G71 1;  2JA7 I;  2E2H I;  1M1K 2;  4NBB A;  2GTH A;  2BJO A;  2OTL Z;  4Y52 I;  1Q86 2;  2AKL A;  2LFU A;  3CPW Y;  5A2Q f;  2JA8 I;  1YUA A;  3CC4 Z;  3CXC Z;  4RVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...