1YIT1

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yit100
1VQOZ 1VQ71 1NJI2 1YITZ 1VQO1 1VQM1 3CMAZ 1K8A2 3CCE1 1QVFY 2QEX1 1W2BZ 3CCSZ 1YHQZ 1YJW1 3CCVZ 3G6EZ 3CC71 1YJ91 1YJN1 2QA4Z 3CCS1 3CCUZ 3CC4Z 1VQPZ 1VQ4Z 2QA41 1VQ7Z 3CPWY 1YIJ1 1KC81 3I551 1Q7Y1 1VQMZ 1VQ41 3CD6Z 1VQN1 1JJ2Z 3CXCZ 3CCEZ 1Q861 2QEXZ 3G711 3CD61 1YJWZ 1N8R2 3CC7Z 1YJ9Z 1YJNZ 1VQ61 3CCR1 1KQSZ 1K9M1 1QVGY 3OW2Y 2OTJZ 1YIJZ 3I55Z 3CCJZ 1K731 1VQ8Z 2OTJ1 1Q862 1VQNZ 1S72Z 3CCL1 3CCJ1 1VQ91 1W2BY 1M901 1VQ81 3CCMZ 1Q821 3G71Z 1VQ51 1K9M2 3CC21 1S721 1VQ6Z 3CCRZ 3CCQZ 3CCM1 3G4S1 2OTLZ 1M1K1 3CCQ1 1KD11 2OTL1 1KC82 1Q7Y2 1QVFZ 1VQK1 1Q811 1JJ2Y 3CXCY 3CCLZ 1VQ9Z 1VQ5Z 3CC2Z 3I56Z 1YI2Z 1M1K2 1KQSY 3G4SZ 3CPWZ 1KD12 3I561 1YI21 3CMEZ 1YIT1 1NJI1 3CMA1 1Q812 1K732 3CME1 1VQKZ 1N8R1 1K8A1 1YHQ1 3CCV1 1VQLZ 3G6E1 1M902 1Q822 1QVGZ 3CC41 3CCU1 3OW2Z 1VQL1 1VQP1
chains in the Genus database with same CATH superfamily
1VQOZ 3T4NB 1RNIA 3D9XA 3RZDI 5LL6f 1RO0A 2O4HA 3CCE1 1QVFY 4A3JI 1W2BZ 2RHBA 1Y1VS 3S2HI 2Q51A 4RVFA 3F3PC 1ZB9A 3VTNA 5IP7I 2LFUA 3MONA 2IZ4A 3CPWY 5T64A 2LEXA 1Z03A 2RPRA 4A3EI 1QF8A 3CD6Z 1VQN1 2P28A 1JJ2Z 3CCEZ 3G711 2F4MA 1VQ61 2H85A 3PO3S 2AKLA 3GTQI 1QVGY 3OW2Y 1WJ2A 5T67A 1TWAI 4Y7NI 2OTJZ 1LQLA 2Y0SA 3I4NI 4MD9A 4TNUA 1S7MA 2R92I 1I50I 1ZB8A 4RVHA 4QTUA 1VQNZ 1VLAA 1YUKA 4DQYB 3NH8A 3G71Z 1VQ51 1K9M2 1R9TI 1VQ6Z 4NBGA 2VUMI 1NUIA 4HH4A 3G4S1 3GTGI 3S2DI 2JIMA 2PK7A 4S1TA 3HKZA 2OTL1 1KC82 4MXUA 3CXCY 3ESWA 3NH5A 1QYPA 1VQ5Z 4BBSI 1KQSY 3G4SZ 1KD12 1NJI1 4NBCA 1SFOI 4X6AI 1QXFA 3MZKB 4AYBA 3RZOI 1YHQ1 4BY1I 3HOXI 3G6E1 4A3BI 2V8IA 2RT9A 1M902 2JA6I 4E32A 1Q822 2E2HI 1RQFA 3CCU1 3JAMb 2AYDA 3S1NI 3GTOI 2JIPA 1L1OC 4BBRI 2VPZA 1VQO1 1VQM1 1K8A2 5C4JI 2JMOA 4RVDA 2JA8I 2ZAEB 1YHQZ 3G6EZ 3VMHA 2QA4Z 4NFRA 1N2FA 3CCUZ 3GTMI 5CM2M 2OOXB 1KC81 3I551 2G2KA 1VQMZ 2QRCB 3CD61 2KPIA 4E2XA 4NB8A 2R6MA 3CCR1 2NVXI 2QREB 1NP6A 1Y8CA 2GTHA 2QRDB 3I55Z 3CCJZ 1VQ8Z 2OTJ1 1Q862 5IP9I 1S72Z 3I07A 3CCL1 3NDIA 1Y1WI 1M901 3CCMZ 1Q821 3D2LA 4NBEA 2RIQA 4RS4A 4A3KI 2OZKA 4EWCA 3EEDA 3CCRZ 3CCQZ 2BJOA 1SIWA 3M4OI 2JIRA 3FQMA 1WIIA 4DGLA 2WB1A 4HGZA 2NVTI 3S16I 1USPB 1I6HI 3S1MI 1QVFZ 1RO4A 3FQQA 3BG0B 3CCLZ 3FKII 3J80f 2WAQA 1FDIA 1YI2Z 2I3CA 1M1K2 5AN9F 1TFIA 4DK1A 3CPWZ 3CMEZ 4BY7I 1Q812 2O53A 5IT9f 1K732 3GKQA 2M6NA 3CCV1 2DE7A 1VQLZ 3J7A4 3I4MI 2JUBA 2E9HA 1QVGZ 3CC41 3OW2Z 3KIFA 2W04A 1RLYA 1VQP1 2V3VA 4A3II 1VQ71 2GTIA 3S1QI 2V8JA 2VUGA 3CCSZ 4NB9A 3J81b 3CCVZ 3CC71 2JNYA 2JA5I 1PFTA 3CC4Z 3H3VJ 1VQPZ 1VQ4Z 1USPA 2QA41 1VQ7Z 2RBLA 3PO3I 2JIOA 1YIJ1 3S17I 4QTTA 4A3LI 1Z02A 1K83I 2J6AA 4E2YA 3CXCZ 5C3EI 4NBBA 1TWHI 2R93I 3GCFA 4A3FI 1N8R2 3CC7Z 3GTKI 2Q4ZA 1KQSZ 1K9M1 2M48A 2YU9I 1X3ZA 2QLVB 1YIJZ 2NVQI 1K731 1RO2A 4RV9A 4HGYA 1TWCI 4NBFA 5FLMI 1JWHC 3TDHB 3CCJ1 5D1PA 1W2BY 1VQ81 2E2II 2VF1A 3HOZI 3F3FC 3CC21 1S721 1ZH1A 4MD8A 3CQZI 3NDJA 3CCM1 2DE5A 4NH1C 4E33A 3J80b 3PO2I 2V45A 3S15I 3CCQ1 3IFUA 2K5RA 2NVYI 1KD11 3HOYI 3HOVI 3GTPI 1Q7Y2 2VPWA 4MRIA 2R7ZI 1JJ2Y 4A3MI 5D1OB 1X0TA 5IT9b 3CC2Z 3I56Z 2VPXA 3GTJI 3TE5B 4A3GI 2JIQA 3IR7A 1YI21 2K3RA 3JAMf 1YIT1 3M3YI 3IX0A 3CMA1 4RVGA 3K7AI 3CME1 3IF8A 1TWFI 5C4XI 1N8R1 2E7ZA 1K8A1 1ML8A 3D6WA 4A3DI 3NH4A 1WZNA 4MH4A 1VQL1 3MZLB 3GTLI 3KIHA 2JR6A 2HU9A 1TWGI 4E31A 5A2Qf 1NJI2 1YITZ 5FLXf 3CMAZ 2B63I 3S1RI 1KRLA 2QEX1 3H0GI 2OOYB 1YJW1 2VPYA 4NOZA 4E2ZA 1YJ91 1YJN1 3VMGA 3HOWI 2JA7I 2V8KA 2PMZA 3CCS1 3VB9A 2EGTA 4A93I 2PM9A 1Y1VI 1Q7Y1 1VQ41 4XX2A 5D1OA 2E2JI 1Q861 2YADA 2QEXZ 3GTMS 4A3CI 1YJWZ 1I3QI 2QR1B 5T6BA 1YJ9Z 1YJNZ 3NFZA 2P3YA 1Q16A 4E30A 1WCMI 2NAPA 3VMIA 1Z01A 2JS4A 3BG1B 1VQ91 2HF1A 2W03A 4E2WA 4CL1A 4BXXI 1P9NA 5C44I 2F4OA 2OTLZ 1M1K1 3P5JB 3Q87A 3EERA 4MD7A 1VQK1 1Q811 1FDOA 1VQ9Z 1X3WA 3S14I 3LUSA 2IZ3A 2IV2X 4MONA 3I561 1WW9A 1DL6A 4NBDA 4NBAA 3U50C 2GU2A 2DE6A 1VQKZ 4NBHA 4Y52I 2KI7B 5A2Qb 1YUAA 5FLXb 3HOUI 2QKDA 1AA6A 3QWUA 3J81f 2LIYA
chains in the Genus database with same CATH topology
1VQOZ 3T4NB 1RNIA 3D9XA 3RZDI 5LL6f 1RO0A 2O4HA 3CCE1 1QVFY 4A3JI 1W2BZ 2RHBA 1Y1VS 3S2HI 2Q51A 4RVFA 3F3PC 1ZB9A 3VTNA 5IP7I 2LFUA 3MONA 2IZ4A 3CPWY 5T64A 1Z03A 2RPRA 4A3EI 1QF8A 3CD6Z 1VQN1 2P28A 1JJ2Z 3CCEZ 3G711 2F4MA 1VQ61 2H85A 3PO3S 2AKLA 3GTQI 1QVGY 3OW2Y 5T67A 1TWAI 4Y7NI 2OTJZ 1LQLA 2Y0SA 3I4NI 4MD9A 4TNUA 1S7MA 2R92I 1I50I 1ZB8A 4RVHA 4QTUA 1VQNZ 1VLAA 1YUKA 4DQYB 3NH8A 3G71Z 1VQ51 1K9M2 1R9TI 1VQ6Z 4NBGA 2VUMI 1NUIA 4HH4A 3G4S1 3GTGI 3S2DI 2PK7A 4S1TA 3HKZA 2OTL1 1KC82 4MXUA 3CXCY 3ESWA 3NH5A 1QYPA 1VQ5Z 4BBSI 1KQSY 3G4SZ 1KD12 1NJI1 4NBCA 1SFOI 4X6AI 3MZKB 4AYBA 3RZOI 1YHQ1 4BY1I 3HOXI 3G6E1 4A3BI 2V8IA 2RT9A 1M902 2JA6I 4E32A 1Q822 2E2HI 1RQFA 3CCU1 3JAMb 3S1NI 3GTOI 1L1OC 4BBRI 1VQO1 1VQM1 1K8A2 5C4JI 2JMOA 4RVDA 2JA8I 2ZAEB 1YHQZ 3G6EZ 3VMHA 2QA4Z 4NFRA 1N2FA 3CCUZ 3GTMI 5CM2M 2OOXB 1KC81 3I551 2G2KA 1VQMZ 2QRCB 3CD61 2KPIA 4E2XA 4NB8A 2R6MA 3CCR1 2NVXI 2QREB 1NP6A 2GTHA 2QRDB 3I55Z 3CCJZ 1VQ8Z 2OTJ1 1Q862 5IP9I 1S72Z 3I07A 3CCL1 3NDIA 1Y1WI 1M901 3CCMZ 1Q821 4NBEA 2RIQA 4RS4A 4A3KI 2OZKA 4EWCA 3EEDA 3CCRZ 3CCQZ 2BJOA 3M4OI 3FQMA 1WIIA 4DGLA 2WB1A 4HGZA 2NVTI 3S16I 1USPB 1I6HI 3S1MI 1QVFZ 1RO4A 3FQQA 3BG0B 3CCLZ 3FKII 3J80f 2WAQA 1YI2Z 2I3CA 1M1K2 5AN9F 1TFIA 4DK1A 3CPWZ 3CMEZ 4BY7I 1Q812 2O53A 5IT9f 1K732 3GKQA 2M6NA 3CCV1 2DE7A 1VQLZ 3J7A4 3I4MI 2JUBA 2E9HA 1QVGZ 3CC41 3OW2Z 3KIFA 2W04A 1VQP1 1RLYA 4A3II 1VQ71 2GTIA 3S1QI 2V8JA 2VUGA 3CCSZ 4NB9A 3J81b 3CCVZ 3CC71 2JNYA 2JA5I 1PFTA 3CC4Z 3H3VJ 1VQPZ 1VQ4Z 1USPA 2QA41 1VQ7Z 2RBLA 3PO3I 1YIJ1 3S17I 4QTTA 4A3LI 1Z02A 1K83I 2J6AA 4E2YA 3CXCZ 5C3EI 4NBBA 1TWHI 2R93I 3GCFA 4A3FI 1N8R2 3CC7Z 3GTKI 2Q4ZA 1KQSZ 1K9M1 2M48A 2YU9I 1X3ZA 2QLVB 1YIJZ 2NVQI 1K731 1RO2A 4RV9A 4HGYA 1TWCI 4NBFA 5FLMI 1JWHC 3TDHB 3CCJ1 5D1PA 1W2BY 1VQ81 2E2II 2VF1A 3HOZI 3F3FC 3CC21 1S721 1ZH1A 4MD8A 3CQZI 3NDJA 3CCM1 2DE5A 4NH1C 4E33A 3J80b 3PO2I 3S15I 3CCQ1 3IFUA 2K5RA 2NVYI 1KD11 3HOYI 3HOVI 3GTPI 1Q7Y2 4MRIA 2R7ZI 1JJ2Y 4A3MI 5D1OB 1X0TA 5IT9b 3CC2Z 3I56Z 3GTJI 3TE5B 4A3GI 1YI21 2K3RA 3JAMf 1YIT1 3M3YI 3IX0A 3CMA1 4RVGA 3K7AI 3CME1 3IF8A 1TWFI 5C4XI 1N8R1 1K8A1 1ML8A 3D6WA 4A3DI 3NH4A 4MH4A 1VQL1 3MZLB 3GTLI 3KIHA 2JR6A 2HU9A 1TWGI 4E31A 5A2Qf 1NJI2 1YITZ 5FLXf 3CMAZ 2B63I 3S1RI 1KRLA 2QEX1 3H0GI 2OOYB 1YJW1 4NOZA 4E2ZA 1YJ91 1YJN1 3VMGA 3HOWI 2JA7I 2V8KA 2PMZA 3CCS1 3VB9A 2EGTA 4A93I 2PM9A 1Y1VI 1Q7Y1 1VQ41 4XX2A 5D1OA 2E2JI 1Q861 2YADA 2QEXZ 3GTMS 4A3CI 1YJWZ 1I3QI 2QR1B 5T6BA 1YJ9Z 1YJNZ 3NFZA 2P3YA 4E30A 1WCMI 3VMIA 1Z01A 2JS4A 3BG1B 1VQ91 2HF1A 2W03A 4E2WA 4CL1A 4BXXI 1P9NA 5C44I 2F4OA 2OTLZ 1M1K1 3P5JB 3Q87A 3EERA 4MD7A 1VQK1 1Q811 1VQ9Z 1X3WA 3S14I 3LUSA 2IZ3A 4MONA 3I561 1WW9A 1DL6A 4NBDA 4NBAA 3U50C 2GU2A 2DE6A 1VQKZ 4NBHA 4Y52I 2KI7B 5A2Qb 1YUAA 5FLXb 3HOUI 2QKDA 3QWUA 3J81f 2LIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  1VQ7 1;  1NJI 2;  1YIT Z;  1VQO 1;  1VQM 1;  3CMA Z;  1K8A 2;  3CCE 1;  1QVF Y;  2QEX 1;  1W2B Z;  3CCS Z;  1YHQ Z;  1YJW 1;  3CCV Z;  3G6E Z;  3CC7 1;  1YJ9 1;  1YJN 1;  2QA4 Z;  3CCS 1;  3CCU Z;  3CC4 Z;  1VQP Z;  1VQ4 Z;  2QA4 1;  1VQ7 Z;  3CPW Y;  1YIJ 1;  1KC8 1;  3I55 1;  1Q7Y 1;  1VQM Z;  1VQ4 1;  3CD6 Z;  1VQN 1;  1JJ2 Z;  3CXC Z;  3CCE Z;  1Q86 1;  2QEX Z;  3G71 1;  3CD6 1;  1YJW Z;  1N8R 2;  3CC7 Z;  1YJ9 Z;  1YJN Z;  1VQ6 1;  3CCR 1;  1KQS Z;  1K9M 1;  1QVG Y;  3OW2 Y;  2OTJ Z;  1YIJ Z;  3I55 Z;  3CCJ Z;  1K73 1;  1VQ8 Z;  2OTJ 1;  1Q86 2;  1VQN Z;  1S72 Z;  3CCL 1;  3CCJ 1;  1VQ9 1;  1W2B Y;  1M90 1;  1VQ8 1;  3CCM Z;  1Q82 1;  3G71 Z;  1VQ5 1;  1K9M 2;  3CC2 1;  1S72 1;  1VQ6 Z;  3CCR Z;  3CCQ Z;  3CCM 1;  3G4S 1;  2OTL Z;  1M1K 1;  3CCQ 1;  1KD1 1;  2OTL 1;  1KC8 2;  1Q7Y 2;  1QVF Z;  1VQK 1;  1Q81 1;  1JJ2 Y;  3CXC Y;  3CCL Z;  1VQ9 Z;  1VQ5 Z;  3CC2 Z;  3I56 Z;  1YI2 Z;  1M1K 2;  1KQS Y;  3G4S Z;  3CPW Z;  1KD1 2;  3I56 1;  1YI2 1;  3CME Z;  1YIT 1;  1NJI 1;  3CMA 1;  1Q81 2;  1K73 2;  3CME 1;  1VQK Z;  1N8R 1;  1K8A 1;  1YHQ 1;  3CCV 1;  1VQL Z;  3G6E 1;  1M90 2;  1Q82 2;  1QVG Z;  3CC4 1;  3CCU 1;  3OW2 Z;  1VQL 1;  1VQP 1; 
#chains in the Genus database with same CATH topology
 1VQO Z;  3T4N B;  1RNI A;  3D9X A;  3RZD I;  5LL6 f;  1RO0 A;  2O4H A;  3CCE 1;  1QVF Y;  4A3J I;  1W2B Z;  2RHB A;  1Y1V S;  3S2H I;  2Q51 A;  4RVF A;  3F3P C;  1ZB9 A;  3VTN A;  5IP7 I;  2LFU A;  3MON A;  2IZ4 A;  3CPW Y;  5T64 A;  2LEX A;  1Z03 A;  2RPR A;  4A3E I;  1QF8 A;  3CD6 Z;  1VQN 1;  2P28 A;  1JJ2 Z;  3CCE Z;  3G71 1;  2F4M A;  1VQ6 1;  2H85 A;  3PO3 S;  2AKL A;  3GTQ I;  1QVG Y;  3OW2 Y;  1WJ2 A;  5T67 A;  1TWA I;  4Y7N I;  2OTJ Z;  1LQL A;  2Y0S A;  3I4N I;  4MD9 A;  4TNU A;  1S7M A;  2R92 I;  1I50 I;  1ZB8 A;  4RVH A;  4QTU A;  1VQN Z;  1VLA A;  1YUK A;  4DQY B;  3NH8 A;  3G71 Z;  1VQ5 1;  1K9M 2;  1R9T I;  1VQ6 Z;  4NBG A;  2VUM I;  1NUI A;  4HH4 A;  3G4S 1;  3GTG I;  3S2D I;  2JIM A;  2PK7 A;  4S1T A;  3HKZ A;  2OTL 1;  1KC8 2;  4MXU A;  3CXC Y;  3ESW A;  3NH5 A;  1QYP A;  1VQ5 Z;  4BBS I;  1KQS Y;  3G4S Z;  1KD1 2;  1NJI 1;  4NBC A;  1SFO I;  4X6A I;  1QXF A;  3MZK B;  4AYB A;  3RZO I;  1YHQ 1;  4BY1 I;  3HOX I;  3G6E 1;  4A3B I;  2V8I A;  2RT9 A;  1M90 2;  2JA6 I;  4E32 A;  1Q82 2;  2E2H I;  1RQF A;  3CCU 1;  3JAM b;  2AYD A;  3S1N I;  3GTO I;  2JIP A;  1L1O C;  4BBR I;  2VPZ A;  1VQO 1;  1VQM 1;  1K8A 2;  5C4J I;  2JMO A;  4RVD A;  2JA8 I;  2ZAE B;  1YHQ Z;  3G6E Z;  3VMH A;  2QA4 Z;  4NFR A;  1N2F A;  3CCU Z;  3GTM I;  5CM2 M;  2OOX B;  1KC8 1;  3I55 1;  2G2K A;  1VQM Z;  2QRC B;  3CD6 1;  2KPI A;  4E2X A;  4NB8 A;  2R6M A;  3CCR 1;  2NVX I;  2QRE B;  1NP6 A;  1Y8C A;  2GTH A;  2QRD B;  3I55 Z;  3CCJ Z;  1VQ8 Z;  2OTJ 1;  1Q86 2;  5IP9 I;  1S72 Z;  3I07 A;  3CCL 1;  3NDI A;  1Y1W I;  1M90 1;  3CCM Z;  1Q82 1;  3D2L A;  4NBE A;  2RIQ A;  4RS4 A;  4A3K I;  2OZK A;  4EWC A;  3EED A;  3CCR Z;  3CCQ Z;  2BJO A;  1SIW A;  3M4O I;  2JIR A;  3FQM A;  1WII A;  4DGL A;  2WB1 A;  4HGZ A;  2NVT I;  3S16 I;  1USP B;  1I6H I;  3S1M I;  1QVF Z;  1RO4 A;  3FQQ A;  3BG0 B;  3CCL Z;  3FKI I;  3J80 f;  2WAQ A;  1FDI A;  1YI2 Z;  2I3C A;  1M1K 2;  5AN9 F;  1TFI A;  4DK1 A;  3CPW Z;  3CME Z;  4BY7 I;  1Q81 2;  2O53 A;  5IT9 f;  1K73 2;  3GKQ A;  2M6N A;  3CCV 1;  2DE7 A;  1VQL Z;  3J7A 4;  3I4M I;  2JUB A;  2E9H A;  1QVG Z;  3CC4 1;  3OW2 Z;  3KIF A;  2W04 A;  1RLY A;  1VQP 1;  2V3V A;  4A3I I;  1VQ7 1;  2GTI A;  3S1Q I;  2V8J A;  2VUG A;  3CCS Z;  4NB9 A;  3J81 b;  3CCV Z;  3CC7 1;  2JNY A;  2JA5 I;  1PFT A;  3CC4 Z;  3H3V J;  1VQP Z;  1VQ4 Z;  1USP A;  2QA4 1;  1VQ7 Z;  2RBL A;  3PO3 I;  2JIO A;  1YIJ 1;  3S17 I;  4QTT A;  4A3L I;  1Z02 A;  1K83 I;  2J6A A;  4E2Y A;  3CXC Z;  5C3E I;  4NBB A;  1TWH I;  2R93 I;  3GCF A;  4A3F I;  1N8R 2;  3CC7 Z;  3GTK I;  2Q4Z A;  1KQS Z;  1K9M 1;  2M48 A;  2YU9 I;  1X3Z A;  2QLV B;  1YIJ Z;  2NVQ I;  1K73 1;  1RO2 A;  4RV9 A;  4HGY A;  1TWC I;  4NBF A;  5FLM I;  1JWH C;  3TDH B;  3CCJ 1;  5D1P A;  1W2B Y;  1VQ8 1;  2E2I I;  2VF1 A;  3HOZ I;  3F3F C;  3CC2 1;  1S72 1;  1ZH1 A;  4MD8 A;  3CQZ I;  3NDJ A;  3CCM 1;  2DE5 A;  4NH1 C;  4E33 A;  3J80 b;  3PO2 I;  2V45 A;  3S15 I;  3CCQ 1;  3IFU A;  2K5R A;  2NVY I;  1KD1 1;  3HOY I;  3HOV I;  3GTP I;  1Q7Y 2;  2VPW A;  4MRI A;  2R7Z I;  1JJ2 Y;  4A3M I;  5D1O B;  1X0T A;  5IT9 b;  3CC2 Z;  3I56 Z;  2VPX A;  3GTJ I;  3TE5 B;  4A3G I;  2JIQ A;  3IR7 A;  1YI2 1;  2K3R A;  3JAM f;  1YIT 1;  3M3Y I;  3IX0 A;  3CMA 1;  4RVG A;  3K7A I;  3CME 1;  3IF8 A;  1TWF I;  5C4X I;  1N8R 1;  2E7Z A;  1K8A 1;  1ML8 A;  3D6W A;  4A3D I;  3NH4 A;  1WZN A;  4MH4 A;  1VQL 1;  3MZL B;  3GTL I;  3KIH A;  2JR6 A;  2HU9 A;  1TWG I;  4E31 A;  5A2Q f;  1NJI 2;  1YIT Z;  5FLX f;  3CMA Z;  2B63 I;  3S1R I;  1KRL A;  2QEX 1;  3H0G I;  2OOY B;  1YJW 1;  2VPY A;  4NOZ A;  4E2Z A;  1YJ9 1;  1YJN 1;  3VMG A;  3HOW I;  2JA7 I;  2V8K A;  2PMZ A;  3CCS 1;  3VB9 A;  2EGT A;  4A93 I;  2PM9 A;  1Y1V I;  1Q7Y 1;  1VQ4 1;  4XX2 A;  5D1O A;  2E2J I;  1Q86 1;  2YAD A;  2QEX Z;  3GTM S;  4A3C I;  1YJW Z;  1I3Q I;  2QR1 B;  5T6B A;  1YJ9 Z;  1YJN Z;  3NFZ A;  2P3Y A;  1Q16 A;  4E30 A;  1WCM I;  2NAP A;  3VMI A;  1Z01 A;  2JS4 A;  3BG1 B;  1VQ9 1;  2HF1 A;  2W03 A;  4E2W A;  4CL1 A;  4BXX I;  1P9N A;  5C44 I;  2F4O A;  2OTL Z;  1M1K 1;  3P5J B;  3Q87 A;  3EER A;  4MD7 A;  1VQK 1;  1Q81 1;  1FDO A;  1VQ9 Z;  1X3W A;  3S14 I;  3LUS A;  2IZ3 A;  2IV2 X;  4MON A;  3I56 1;  1WW9 A;  1DL6 A;  4NBD A;  4NBA A;  3U50 C;  2GU2 A;  2DE6 A;  1VQK Z;  4NBH A;  4Y52 I;  2KI7 B;  5A2Q b;  1YUA A;  5FLX b;  3HOU I;  2QKD A;  1AA6 A;  3QWU A;  3J81 f;  2LIY A; 
#chains in the Genus database with same CATH homology
 1VQO Z;  3T4N B;  1RNI A;  3D9X A;  3RZD I;  5LL6 f;  1RO0 A;  2O4H A;  3CCE 1;  1QVF Y;  4A3J I;  1W2B Z;  2RHB A;  1Y1V S;  3S2H I;  2Q51 A;  4RVF A;  3F3P C;  1ZB9 A;  3VTN A;  5IP7 I;  2LFU A;  3MON A;  2IZ4 A;  3CPW Y;  5T64 A;  1Z03 A;  2RPR A;  4A3E I;  1QF8 A;  3CD6 Z;  1VQN 1;  2P28 A;  1JJ2 Z;  3CCE Z;  3G71 1;  2F4M A;  1VQ6 1;  2H85 A;  3PO3 S;  2AKL A;  3GTQ I;  1QVG Y;  3OW2 Y;  5T67 A;  1TWA I;  4Y7N I;  2OTJ Z;  1LQL A;  2Y0S A;  3I4N I;  4MD9 A;  4TNU A;  1S7M A;  2R92 I;  1I50 I;  1ZB8 A;  4RVH A;  4QTU A;  1VQN Z;  1VLA A;  1YUK A;  4DQY B;  3NH8 A;  3G71 Z;  1VQ5 1;  1K9M 2;  1R9T I;  1VQ6 Z;  4NBG A;  2VUM I;  1NUI A;  4HH4 A;  3G4S 1;  3GTG I;  3S2D I;  2PK7 A;  4S1T A;  3HKZ A;  2OTL 1;  1KC8 2;  4MXU A;  3CXC Y;  3ESW A;  3NH5 A;  1QYP A;  1VQ5 Z;  4BBS I;  1KQS Y;  3G4S Z;  1KD1 2;  1NJI 1;  4NBC A;  1SFO I;  4X6A I;  3MZK B;  4AYB A;  3RZO I;  1YHQ 1;  4BY1 I;  3HOX I;  3G6E 1;  4A3B I;  2V8I A;  2RT9 A;  1M90 2;  2JA6 I;  4E32 A;  1Q82 2;  2E2H I;  1RQF A;  3CCU 1;  3JAM b;  3S1N I;  3GTO I;  1L1O C;  4BBR I;  1VQO 1;  1VQM 1;  1K8A 2;  5C4J I;  2JMO A;  4RVD A;  2JA8 I;  2ZAE B;  1YHQ Z;  3G6E Z;  3VMH A;  2QA4 Z;  4NFR A;  1N2F A;  3CCU Z;  3GTM I;  5CM2 M;  2OOX B;  1KC8 1;  3I55 1;  2G2K A;  1VQM Z;  2QRC B;  3CD6 1;  2KPI A;  4E2X A;  4NB8 A;  2R6M A;  3CCR 1;  2NVX I;  2QRE B;  1NP6 A;  2GTH A;  2QRD B;  3I55 Z;  3CCJ Z;  1VQ8 Z;  2OTJ 1;  1Q86 2;  5IP9 I;  1S72 Z;  3I07 A;  3CCL 1;  3NDI A;  1Y1W I;  1M90 1;  3CCM Z;  1Q82 1;  4NBE A;  2RIQ A;  4RS4 A;  4A3K I;  2OZK A;  4EWC A;  3EED A;  3CCR Z;  3CCQ Z;  2BJO A;  3M4O I;  3FQM A;  1WII A;  4DGL A;  2WB1 A;  4HGZ A;  2NVT I;  3S16 I;  1USP B;  1I6H I;  3S1M I;  1QVF Z;  1RO4 A;  3FQQ A;  3BG0 B;  3CCL Z;  3FKI I;  3J80 f;  2WAQ A;  1YI2 Z;  2I3C A;  1M1K 2;  5AN9 F;  1TFI A;  4DK1 A;  3CPW Z;  3CME Z;  4BY7 I;  1Q81 2;  2O53 A;  5IT9 f;  1K73 2;  3GKQ A;  2M6N A;  3CCV 1;  2DE7 A;  1VQL Z;  3J7A 4;  3I4M I;  2JUB A;  2E9H A;  1QVG Z;  3CC4 1;  3OW2 Z;  3KIF A;  2W04 A;  1VQP 1;  1RLY A;  4A3I I;  1VQ7 1;  2GTI A;  3S1Q I;  2V8J A;  2VUG A;  3CCS Z;  4NB9 A;  3J81 b;  3CCV Z;  3CC7 1;  2JNY A;  2JA5 I;  1PFT A;  3CC4 Z;  3H3V J;  1VQP Z;  1VQ4 Z;  1USP A;  2QA4 1;  1VQ7 Z;  2RBL A;  3PO3 I;  1YIJ 1;  3S17 I;  4QTT A;  4A3L I;  1Z02 A;  1K83 I;  2J6A A;  4E2Y A;  3CXC Z;  5C3E I;  4NBB A;  1TWH I;  2R93 I;  3GCF A;  4A3F I;  1N8R 2;  3CC7 Z;  3GTK I;  2Q4Z A;  1KQS Z;  1K9M 1;  2M48 A;  2YU9 I;  1X3Z A;  2QLV B;  1YIJ Z;  2NVQ I;  1K73 1;  1RO2 A;  4RV9 A;  4HGY A;  1TWC I;  4NBF A;  5FLM I;  1JWH C;  3TDH B;  3CCJ 1;  5D1P A;  1W2B Y;  1VQ8 1;  2E2I I;  2VF1 A;  3HOZ I;  3F3F C;  3CC2 1;  1S72 1;  1ZH1 A;  4MD8 A;  3CQZ I;  3NDJ A;  3CCM 1;  2DE5 A;  4NH1 C;  4E33 A;  3J80 b;  3PO2 I;  3S15 I;  3CCQ 1;  3IFU A;  2K5R A;  2NVY I;  1KD1 1;  3HOY I;  3HOV I;  3GTP I;  1Q7Y 2;  4MRI A;  2R7Z I;  1JJ2 Y;  4A3M I;  5D1O B;  1X0T A;  5IT9 b;  3CC2 Z;  3I56 Z;  3GTJ I;  3TE5 B;  4A3G I;  1YI2 1;  2K3R A;  3JAM f;  1YIT 1;  3M3Y I;  3IX0 A;  3CMA 1;  4RVG A;  3K7A I;  3CME 1;  3IF8 A;  1TWF I;  5C4X I;  1N8R 1;  1K8A 1;  1ML8 A;  3D6W A;  4A3D I;  3NH4 A;  4MH4 A;  1VQL 1;  3MZL B;  3GTL I;  3KIH A;  2JR6 A;  2HU9 A;  1TWG I;  4E31 A;  5A2Q f;  1NJI 2;  1YIT Z;  5FLX f;  3CMA Z;  2B63 I;  3S1R I;  1KRL A;  2QEX 1;  3H0G I;  2OOY B;  1YJW 1;  4NOZ A;  4E2Z A;  1YJ9 1;  1YJN 1;  3VMG A;  3HOW I;  2JA7 I;  2V8K A;  2PMZ A;  3CCS 1;  3VB9 A;  2EGT A;  4A93 I;  2PM9 A;  1Y1V I;  1Q7Y 1;  1VQ4 1;  4XX2 A;  5D1O A;  2E2J I;  1Q86 1;  2YAD A;  2QEX Z;  3GTM S;  4A3C I;  1YJW Z;  1I3Q I;  2QR1 B;  5T6B A;  1YJ9 Z;  1YJN Z;  3NFZ A;  2P3Y A;  4E30 A;  1WCM I;  3VMI A;  1Z01 A;  2JS4 A;  3BG1 B;  1VQ9 1;  2HF1 A;  2W03 A;  4E2W A;  4CL1 A;  4BXX I;  1P9N A;  5C44 I;  2F4O A;  2OTL Z;  1M1K 1;  3P5J B;  3Q87 A;  3EER A;  4MD7 A;  1VQK 1;  1Q81 1;  1VQ9 Z;  1X3W A;  3S14 I;  3LUS A;  2IZ3 A;  4MON A;  3I56 1;  1WW9 A;  1DL6 A;  4NBD A;  4NBA A;  3U50 C;  2GU2 A;  2DE6 A;  1VQK Z;  4NBH A;  4Y52 I;  2KI7 B;  5A2Q b;  1YUA A;  5FLX b;  3HOU I;  2QKD A;  3QWU A;  3J81 f;  2LIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...