1YIT1

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yit100
3CC4Z 3I56Z 2OTJ1 1KQSZ 1VQ9Z 3CD61 3CC21 3I55Z 3CMAZ 1VQ8Z 1VQKZ 3CCQ1 1VQOZ 1K9M2 3OW2Z 1YI2Z 1VQMZ 1VQ51 1VQ41 1VQNZ 2QA4Z 1W2BZ 3G6EZ 1Q7Y2 1S721 1NJI1 3CCSZ 1YJNZ 1M902 1VQ61 1YIJZ 1YJ91 1YIT1 1N8R1 1VQ71 3CCL1 3CXCZ 3G4S1 3G71Z 3CCVZ 1M1K2 1KD12 3CCMZ 1YJW1 3CPWZ 1KQSY 1JJ2Z 3CC71 1K9M1 2QEXZ 1K732 3CME1 3CCJ1 1Q822 3CC41 1QVGZ 1YHQ1 1Q7Y1 3OW2Y 3CCRZ 1VQ91 1S72Z 1Q812 1Q862 1M901 3CCU1 1W2BY 1VQPZ 3I551 3CMA1 1QVFZ 1VQ6Z 1VQ81 1VQO1 1VQM1 3G4SZ 1M1K1 1KD11 3CXCY 2OTJZ 1K8A2 3CCS1 1YIJ1 3CD6Z 2OTL1 1K8A1 3CC2Z 1VQL1 1KC82 3CCE1 3CCQZ 3CPWY 1K731 3I561 1VQ5Z 1VQ4Z 1Q821 3CCM1 1JJ2Y 1YHQZ 1Q811 1Q861 1YJ9Z 1VQK1 1QVGY 1YITZ 1YI21 3CCUZ 1VQ7Z 3CCLZ 2QEX1 1VQN1 2QA41 3G6E1 1QVFY 3CCR1 1YJWZ 1YJN1 1NJI2 1VQP1 1N8R2 1KC81 2OTLZ 3G711 1VQLZ 3CCV1 3CC7Z 3CCEZ 3CMEZ 3CCJZ
chains in the Genus database with same CATH superfamily
1Z02A 2QKDA 2E2HI 4MD8A 3I4MI 3CD61 3CMAZ 1VQ8Z 3I07A 2RBLA 3VB9A 3CCQ1 2NVTI 1VQMZ 3S1MI 4DQYB 4AYBA 1VQ51 1RNIA 1VQ41 3MZKB 4CL1A 3G6EZ 1S721 2DE5A 3CCSZ 4Y52I 1YIT1 2ZAEB 3GTQI 5C44I 3CCL1 2V8KA 3CXCZ 2F4MA 5T67A 3G71Z 2JA5I 4QTTA 1I3QI 1PFTA 4NBHA 1SFOI 2VPZA 4RVDA 2E2II 3GTMS 3D9XA 3D6WA 2IV2X 3CC41 1Q7Y1 4NB9A 5D1OA 3CCRZ 3VMIA 1VQ91 3D2LA 1X3ZA 3CCU1 2R7ZI 3PO3S 3I551 1VQO1 5LL6f 3VTNA 2PM9A 5IP9I 1KD11 2PMZA 4NFRA 3CXCY 2KPIA 4RVGA 4MXUA 1I6HI 3KIHA 1YIJ1 2OTL1 4E2YA 3CC2Z 4BBSI 3CCE1 3RZDI 4A3EI 3I561 3IFUA 3S14I 1Y1VI 2QRCB 3TE5B 3VMHA 3NFZA 1AA6A 1YJ9Z 1VQK1 3KIFA 3J81b 4DK1A 2VPWA 2QEX1 4A3BI 2OZKA 2B63I 2AKLA 3F3PC 2NVYI 1YJWZ 4HH4A 2P28A 2DE6A 4A3FI 4MD7A 1WW9A 1VQP1 1WJ2A 1ZH1A 2VPYA 4HGZA 1KC81 3CCV1 3CC7Z 1RO2A 2R6MA 2JA7I 3H0GI 2OTJ1 4E31A 4RVHA 2KI7B 1ML8A 2K5RA 3J80b 1YI2Z 1P9NA 3S1NI 2YADA 3BG1B 1W2BZ 1TFIA 2Y0SA 1Q7Y2 2M6NA 3GTLI 3TDHB 1NJI1 2W04A 1VQ61 4BY1I 5D1OB 1Z01A 4A3CI 1VLAA 3G4S1 1KD12 2P3YA 3S15I 3CPWZ 1SIWA 1TWGI 4NH1C 5IT9f 2OOYB 3S1RI 2YU9I 1K9M1 5IT9b 3CME1 3CCJ1 2QLVB 3FQQA 1L1OC 4A3II 1S72Z 1ZB8A 1M901 4RVFA 1W2BY 3FQMA 3CMA1 1QVFZ 1VQ81 2JMOA 2JIRA 2JR6A 1VQM1 4A93I 3H3VJ 2NAPA 5A2Qf 3J7A4 3S2HI 1R9TI 1RLYA 4NOZA 1K8A2 3CCS1 2E9HA 3NH5A 2VPXA 2QRDB 2RHBA 4MH4A 1KC82 3CPWY 4A3KI 1K731 2LIYA 2V8JA 1Q821 4X6AI 4BBRI 2Q4ZA 2K3RA 3CCUZ 1VQ7Z 2EGTA 2JA6I 2BJOA 1VQN1 2QA41 1QVFY 2GU2A 3LUSA 3HOZI 2RT9A 3CCR1 1YJN1 1NJI2 4A3LI 1Q16A 3NDIA 1TWCI 4NBBA 2OTLZ 1RO0A 2DE7A 3CCEZ 1Y1VS 3I56Z 1YUKA 2IZ3A 4NBDA 5FLXf 2NVQI 3PO2I 2LEXA 4A3MI 5CM2M 1KQSZ 4BXXI 2E2JI 5FLXb 3HOXI 3CC21 2JA8I 3QWUA 2M48A 1VQKZ 1K9M2 3CQZI 4E32A 2VUGA 1ZB9A 3S17I 1NUIA 3HOVI 1M902 1Z03A 5T6BA 1YJ91 1WCMI 2V3VA 2JNYA 2HU9A 1KRLA 1RO4A 3HOWI 3CCVZ 3GCFA 3VMGA 4A3GI 3IF8A 2AYDA 4TNUA 3CCMZ 1YJW1 1I50I 2H85A 3GTGI 1USPA 3MZLB 1DL6A 3F3FC 1KQSY 1JJ2Z 3CC71 1K732 1QYPA 1Q822 2J6AA 1QVGZ 1YHQ1 1X3WA 3S16I 1VQ6Z 3S2DI 3G4SZ 1M1K1 3HOUI 2JIOA 5D1PA 3S1QI 3Q87A 3IR7A 2WAQA 3IX0A 2OOXB 3CD6Z 1NP6A 1VQL1 3JAMf 1LQLA 4NBGA 3CCQZ 2Q51A 4S1TA 3JAMb 1VQ5Z 1VQ4Z 4NBFA 1QF8A 2JUBA 1JJ2Y 4NB8A 2PK7A 1Q811 1Q861 1QVGY 1YITZ 2G2KA 4XX2A 2I3CA 1TWFI 4RS4A 3CCLZ 3FKII 1TWAI 4RV9A 3G6E1 4HGYA 4E2XA 2F4OA 4BY7I 5A2Qb 5C4XI 5FLMI 2IZ4A 3GTKI 4A3DI 3M3YI 2VF1A 3G711 1S7MA 4NBEA 1TWHI 1FDOA 3CC4Z 2NVXI 1VQ9Z 3ESWA 4E30A 2R92I 3I55Z 2O53A 4A3JI 1VQOZ 1USPB 2V45A 3OW2Z 1X0TA 2V8IA 1FDIA 3M4OI 2LFUA 1WZNA 3GTMI 1VQNZ 5C4JI 2QA4Z 5AN9F 1N2FA 1YJNZ 4E2ZA 1YIJZ 1N8R1 1VQ71 1WIIA 2HF1A 2QR1B 3PO3I 4Y7NI 1M1K2 4NBCA 3MONA 2JIPA 3HOYI 2JIMA 4E2WA 4MRIA 3BG0B 4E33A 2QEXZ 5T64A 2WB1A 3OW2Y 2RPRA 5C3EI 1QXFA 3T4NB 1Q812 1Q862 3J81f 3I4NI 2O4HA 4QTUA 1VQPZ 4MONA 4NBAA 1JWHC 2GTHA 2RIQA 1YUAA 4MD9A 1K83I 3U50C 2OTJZ 1K8A1 1RQFA 4EWCA 2GTIA 3GTPI 3RZOI 3NH4A 5IP7I 4DGLA 3GTJI 3CCM1 2W03A 1YHQZ 2JIQA 3NH8A 2E7ZA 1Y8CA 3J80f 2JS4A 1YI21 3HKZA 3GKQA 3EERA 3EEDA 2R93I 3NDJA 3GTOI 2QREB 2VUMI 1N8R2 3P5JB 1VQLZ 1Y1WI 3K7AI 3CMEZ 3CCJZ
chains in the Genus database with same CATH topology
1Z02A 2QKDA 2E2HI 4MD8A 3I4MI 3CD61 3CMAZ 1VQ8Z 3I07A 2RBLA 3VB9A 3CCQ1 2NVTI 1VQMZ 3S1MI 4DQYB 4AYBA 1VQ51 1RNIA 1VQ41 3MZKB 4CL1A 3G6EZ 1S721 2DE5A 3CCSZ 4Y52I 1YIT1 2ZAEB 3GTQI 5C44I 3CCL1 2V8KA 3CXCZ 2F4MA 5T67A 3G71Z 2JA5I 4QTTA 1I3QI 1PFTA 4NBHA 1SFOI 4RVDA 2E2II 3GTMS 3D9XA 3D6WA 3CC41 1Q7Y1 4NB9A 5D1OA 3CCRZ 3VMIA 1VQ91 1X3ZA 3CCU1 2R7ZI 3PO3S 3I551 1VQO1 5LL6f 3VTNA 2PM9A 5IP9I 1KD11 2PMZA 4NFRA 3CXCY 2KPIA 4RVGA 4MXUA 1I6HI 3KIHA 1YIJ1 2OTL1 4E2YA 3CC2Z 4BBSI 3CCE1 3RZDI 4A3EI 3I561 3IFUA 3S14I 1Y1VI 2QRCB 3TE5B 3VMHA 3NFZA 1YJ9Z 1VQK1 3KIFA 3J81b 4DK1A 2QEX1 4A3BI 2OZKA 2B63I 2AKLA 3F3PC 2NVYI 1YJWZ 4HH4A 2P28A 2DE6A 4A3FI 4MD7A 1WW9A 1VQP1 1ZH1A 4HGZA 1KC81 3CCV1 3CC7Z 1RO2A 2R6MA 2JA7I 3H0GI 2OTJ1 4E31A 4RVHA 2KI7B 1ML8A 2K5RA 3J80b 1YI2Z 1P9NA 3S1NI 2YADA 3BG1B 1W2BZ 1TFIA 2Y0SA 1Q7Y2 2M6NA 3GTLI 3TDHB 1NJI1 2W04A 1VQ61 4BY1I 5D1OB 1Z01A 4A3CI 1VLAA 3G4S1 1KD12 2P3YA 3S15I 3CPWZ 1TWGI 4NH1C 5IT9f 2OOYB 3S1RI 2YU9I 1K9M1 5IT9b 3CME1 3CCJ1 2QLVB 3FQQA 1L1OC 4A3II 1S72Z 1ZB8A 1M901 4RVFA 1W2BY 3FQMA 3CMA1 1QVFZ 1VQ81 2JMOA 2JR6A 1VQM1 4A93I 3H3VJ 5A2Qf 3J7A4 3S2HI 1R9TI 1RLYA 4NOZA 1K8A2 3CCS1 2E9HA 3NH5A 2QRDB 2RHBA 4MH4A 1KC82 3CPWY 4A3KI 1K731 2LIYA 2V8JA 1Q821 4X6AI 4BBRI 2Q4ZA 2K3RA 3CCUZ 1VQ7Z 2EGTA 2JA6I 2BJOA 1VQN1 2QA41 1QVFY 2GU2A 3LUSA 3HOZI 2RT9A 3CCR1 1YJN1 1NJI2 4A3LI 3NDIA 1TWCI 4NBBA 2OTLZ 1RO0A 2DE7A 3CCEZ 1Y1VS 3I56Z 1YUKA 2IZ3A 4NBDA 5FLXf 2NVQI 3PO2I 4A3MI 5CM2M 1KQSZ 4BXXI 2E2JI 5FLXb 3HOXI 3CC21 2JA8I 3QWUA 2M48A 1VQKZ 1K9M2 3CQZI 4E32A 2VUGA 1ZB9A 3S17I 1NUIA 3HOVI 1M902 1Z03A 5T6BA 1YJ91 1WCMI 2JNYA 2HU9A 1KRLA 1RO4A 3HOWI 3CCVZ 3GCFA 3VMGA 4A3GI 3IF8A 4TNUA 3CCMZ 1YJW1 1I50I 2H85A 3GTGI 1USPA 3MZLB 1DL6A 3F3FC 1KQSY 1JJ2Z 3CC71 1K732 1QYPA 1Q822 2J6AA 1QVGZ 1YHQ1 1X3WA 3S16I 1VQ6Z 3S2DI 3G4SZ 1M1K1 3HOUI 5D1PA 3S1QI 3Q87A 2WAQA 3IX0A 2OOXB 3CD6Z 1NP6A 1VQL1 3JAMf 1LQLA 4NBGA 3CCQZ 2Q51A 4S1TA 3JAMb 1VQ5Z 1VQ4Z 4NBFA 1QF8A 2JUBA 1JJ2Y 4NB8A 2PK7A 1Q811 1Q861 1QVGY 1YITZ 2G2KA 4XX2A 2I3CA 1TWFI 4RS4A 3CCLZ 3FKII 1TWAI 4RV9A 3G6E1 4HGYA 4E2XA 2F4OA 4BY7I 5A2Qb 5C4XI 5FLMI 2IZ4A 3GTKI 4A3DI 3M3YI 2VF1A 3G711 1S7MA 4NBEA 1TWHI 3CC4Z 2NVXI 1VQ9Z 3ESWA 4E30A 2R92I 3I55Z 2O53A 4A3JI 1VQOZ 1USPB 3OW2Z 1X0TA 2V8IA 3M4OI 2LFUA 3GTMI 1VQNZ 5C4JI 2QA4Z 5AN9F 1N2FA 1YJNZ 4E2ZA 1YIJZ 1N8R1 1VQ71 1WIIA 2HF1A 2QR1B 3PO3I 4Y7NI 1M1K2 4NBCA 3MONA 3HOYI 4E2WA 4MRIA 3BG0B 4E33A 2QEXZ 5T64A 2WB1A 3OW2Y 2RPRA 5C3EI 3T4NB 1Q812 1Q862 3J81f 3I4NI 2O4HA 4QTUA 1VQPZ 4MONA 4NBAA 1JWHC 2GTHA 2RIQA 1YUAA 4MD9A 1K83I 3U50C 2OTJZ 1K8A1 1RQFA 4EWCA 2GTIA 3GTPI 3RZOI 3NH4A 5IP7I 4DGLA 3GTJI 3CCM1 2W03A 1YHQZ 3NH8A 3J80f 2JS4A 1YI21 3HKZA 3GKQA 3EERA 3EEDA 2R93I 3NDJA 3GTOI 2QREB 2VUMI 1N8R2 3P5JB 1VQLZ 1Y1WI 3K7AI 3CMEZ 3CCJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Z;  3I56 Z;  2OTJ 1;  1KQS Z;  1VQ9 Z;  3CD6 1;  3CC2 1;  3I55 Z;  3CMA Z;  1VQ8 Z;  1VQK Z;  3CCQ 1;  1VQO Z;  1K9M 2;  3OW2 Z;  1YI2 Z;  1VQM Z;  1VQ5 1;  1VQ4 1;  1VQN Z;  2QA4 Z;  1W2B Z;  3G6E Z;  1Q7Y 2;  1S72 1;  1NJI 1;  3CCS Z;  1YJN Z;  1M90 2;  1VQ6 1;  1YIJ Z;  1YJ9 1;  1YIT 1;  1N8R 1;  1VQ7 1;  3CCL 1;  3CXC Z;  3G4S 1;  3G71 Z;  3CCV Z;  1M1K 2;  1KD1 2;  3CCM Z;  1YJW 1;  3CPW Z;  1KQS Y;  1JJ2 Z;  3CC7 1;  1K9M 1;  2QEX Z;  1K73 2;  3CME 1;  3CCJ 1;  1Q82 2;  3CC4 1;  1QVG Z;  1YHQ 1;  1Q7Y 1;  3OW2 Y;  3CCR Z;  1VQ9 1;  1S72 Z;  1Q81 2;  1Q86 2;  1M90 1;  3CCU 1;  1W2B Y;  1VQP Z;  3I55 1;  3CMA 1;  1QVF Z;  1VQ6 Z;  1VQ8 1;  1VQO 1;  1VQM 1;  3G4S Z;  1M1K 1;  1KD1 1;  3CXC Y;  2OTJ Z;  1K8A 2;  3CCS 1;  1YIJ 1;  3CD6 Z;  2OTL 1;  1K8A 1;  3CC2 Z;  1VQL 1;  1KC8 2;  3CCE 1;  3CCQ Z;  3CPW Y;  1K73 1;  3I56 1;  1VQ5 Z;  1VQ4 Z;  1Q82 1;  3CCM 1;  1JJ2 Y;  1YHQ Z;  1Q81 1;  1Q86 1;  1YJ9 Z;  1VQK 1;  1QVG Y;  1YIT Z;  1YI2 1;  3CCU Z;  1VQ7 Z;  3CCL Z;  2QEX 1;  1VQN 1;  2QA4 1;  3G6E 1;  1QVF Y;  3CCR 1;  1YJW Z;  1YJN 1;  1NJI 2;  1VQP 1;  1N8R 2;  1KC8 1;  2OTL Z;  3G71 1;  1VQL Z;  3CCV 1;  3CC7 Z;  3CCE Z;  3CME Z;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 1Z02 A;  2QKD A;  2E2H I;  4MD8 A;  3I4M I;  3CD6 1;  3CMA Z;  1VQ8 Z;  3I07 A;  2RBL A;  3VB9 A;  3CCQ 1;  2NVT I;  1VQM Z;  3S1M I;  4DQY B;  4AYB A;  1VQ5 1;  1RNI A;  1VQ4 1;  3MZK B;  4CL1 A;  3G6E Z;  1S72 1;  2DE5 A;  3CCS Z;  4Y52 I;  1YIT 1;  2ZAE B;  3GTQ I;  5C44 I;  3CCL 1;  2V8K A;  3CXC Z;  2F4M A;  5T67 A;  3G71 Z;  2JA5 I;  4QTT A;  1I3Q I;  1PFT A;  4NBH A;  1SFO I;  2VPZ A;  4RVD A;  2E2I I;  3GTM S;  3D9X A;  3D6W A;  2IV2 X;  3CC4 1;  1Q7Y 1;  4NB9 A;  5D1O A;  3CCR Z;  3VMI A;  1VQ9 1;  3D2L A;  1X3Z A;  3CCU 1;  2R7Z I;  3PO3 S;  3I55 1;  1VQO 1;  5LL6 f;  3VTN A;  2PM9 A;  5IP9 I;  1KD1 1;  2PMZ A;  4NFR A;  3CXC Y;  2KPI A;  4RVG A;  4MXU A;  1I6H I;  3KIH A;  1YIJ 1;  2OTL 1;  4E2Y A;  3CC2 Z;  4BBS I;  3CCE 1;  3RZD I;  4A3E I;  3I56 1;  3IFU A;  3S14 I;  1Y1V I;  2QRC B;  3TE5 B;  3VMH A;  3NFZ A;  1AA6 A;  1YJ9 Z;  1VQK 1;  3KIF A;  3J81 b;  4DK1 A;  2VPW A;  2QEX 1;  4A3B I;  2OZK A;  2B63 I;  2AKL A;  3F3P C;  2NVY I;  1YJW Z;  4HH4 A;  2P28 A;  2DE6 A;  4A3F I;  4MD7 A;  1WW9 A;  1VQP 1;  1WJ2 A;  1ZH1 A;  2VPY A;  4HGZ A;  1KC8 1;  3CCV 1;  3CC7 Z;  1RO2 A;  2R6M A;  2JA7 I;  3H0G I;  2OTJ 1;  4E31 A;  4RVH A;  2KI7 B;  1ML8 A;  2K5R A;  3J80 b;  1YI2 Z;  1P9N A;  3S1N I;  2YAD A;  3BG1 B;  1W2B Z;  1TFI A;  2Y0S A;  1Q7Y 2;  2M6N A;  3GTL I;  3TDH B;  1NJI 1;  2W04 A;  1VQ6 1;  4BY1 I;  5D1O B;  1Z01 A;  4A3C I;  1VLA A;  3G4S 1;  1KD1 2;  2P3Y A;  3S15 I;  3CPW Z;  1SIW A;  1TWG I;  4NH1 C;  5IT9 f;  2OOY B;  3S1R I;  2YU9 I;  1K9M 1;  5IT9 b;  3CME 1;  3CCJ 1;  2QLV B;  3FQQ A;  1L1O C;  4A3I I;  1S72 Z;  1ZB8 A;  1M90 1;  4RVF A;  1W2B Y;  3FQM A;  3CMA 1;  1QVF Z;  1VQ8 1;  2JMO A;  2JIR A;  2JR6 A;  1VQM 1;  4A93 I;  3H3V J;  2NAP A;  5A2Q f;  3J7A 4;  3S2H I;  1R9T I;  1RLY A;  4NOZ A;  1K8A 2;  3CCS 1;  2E9H A;  3NH5 A;  2VPX A;  2QRD B;  2RHB A;  4MH4 A;  1KC8 2;  3CPW Y;  4A3K I;  1K73 1;  2LIY A;  2V8J A;  1Q82 1;  4X6A I;  4BBR I;  2Q4Z A;  2K3R A;  3CCU Z;  1VQ7 Z;  2EGT A;  2JA6 I;  2BJO A;  1VQN 1;  2QA4 1;  1QVF Y;  2GU2 A;  3LUS A;  3HOZ I;  2RT9 A;  3CCR 1;  1YJN 1;  1NJI 2;  4A3L I;  1Q16 A;  3NDI A;  1TWC I;  4NBB A;  2OTL Z;  1RO0 A;  2DE7 A;  3CCE Z;  1Y1V S;  3I56 Z;  1YUK A;  2IZ3 A;  4NBD A;  5FLX f;  2NVQ I;  3PO2 I;  2LEX A;  4A3M I;  5CM2 M;  1KQS Z;  4BXX I;  2E2J I;  5FLX b;  3HOX I;  3CC2 1;  2JA8 I;  3QWU A;  2M48 A;  1VQK Z;  1K9M 2;  3CQZ I;  4E32 A;  2VUG A;  1ZB9 A;  3S17 I;  1NUI A;  3HOV I;  1M90 2;  1Z03 A;  5T6B A;  1YJ9 1;  1WCM I;  2V3V A;  2JNY A;  2HU9 A;  1KRL A;  1RO4 A;  3HOW I;  3CCV Z;  3GCF A;  3VMG A;  4A3G I;  3IF8 A;  2AYD A;  4TNU A;  3CCM Z;  1YJW 1;  1I50 I;  2H85 A;  3GTG I;  1USP A;  3MZL B;  1DL6 A;  3F3F C;  1KQS Y;  1JJ2 Z;  3CC7 1;  1K73 2;  1QYP A;  1Q82 2;  2J6A A;  1QVG Z;  1YHQ 1;  1X3W A;  3S16 I;  1VQ6 Z;  3S2D I;  3G4S Z;  1M1K 1;  3HOU I;  2JIO A;  5D1P A;  3S1Q I;  3Q87 A;  3IR7 A;  2WAQ A;  3IX0 A;  2OOX B;  3CD6 Z;  1NP6 A;  1VQL 1;  3JAM f;  1LQL A;  4NBG A;  3CCQ Z;  2Q51 A;  4S1T A;  3JAM b;  1VQ5 Z;  1VQ4 Z;  4NBF A;  1QF8 A;  2JUB A;  1JJ2 Y;  4NB8 A;  2PK7 A;  1Q81 1;  1Q86 1;  1QVG Y;  1YIT Z;  2G2K A;  4XX2 A;  2I3C A;  1TWF I;  4RS4 A;  3CCL Z;  3FKI I;  1TWA I;  4RV9 A;  3G6E 1;  4HGY A;  4E2X A;  2F4O A;  4BY7 I;  5A2Q b;  5C4X I;  5FLM I;  2IZ4 A;  3GTK I;  4A3D I;  3M3Y I;  2VF1 A;  3G71 1;  1S7M A;  4NBE A;  1TWH I;  1FDO A;  3CC4 Z;  2NVX I;  1VQ9 Z;  3ESW A;  4E30 A;  2R92 I;  3I55 Z;  2O53 A;  4A3J I;  1VQO Z;  1USP B;  2V45 A;  3OW2 Z;  1X0T A;  2V8I A;  1FDI A;  3M4O I;  2LFU A;  1WZN A;  3GTM I;  1VQN Z;  5C4J I;  2QA4 Z;  5AN9 F;  1N2F A;  1YJN Z;  4E2Z A;  1YIJ Z;  1N8R 1;  1VQ7 1;  1WII A;  2HF1 A;  2QR1 B;  3PO3 I;  4Y7N I;  1M1K 2;  4NBC A;  3MON A;  2JIP A;  3HOY I;  2JIM A;  4E2W A;  4MRI A;  3BG0 B;  4E33 A;  2QEX Z;  5T64 A;  2WB1 A;  3OW2 Y;  2RPR A;  5C3E I;  1QXF A;  3T4N B;  1Q81 2;  1Q86 2;  3J81 f;  3I4N I;  2O4H A;  4QTU A;  1VQP Z;  4MON A;  4NBA A;  1JWH C;  2GTH A;  2RIQ A;  1YUA A;  4MD9 A;  1K83 I;  3U50 C;  2OTJ Z;  1K8A 1;  1RQF A;  4EWC A;  2GTI A;  3GTP I;  3RZO I;  3NH4 A;  5IP7 I;  4DGL A;  3GTJ I;  3CCM 1;  2W03 A;  1YHQ Z;  2JIQ A;  3NH8 A;  2E7Z A;  1Y8C A;  3J80 f;  2JS4 A;  1YI2 1;  3HKZ A;  3GKQ A;  3EER A;  3EED A;  2R93 I;  3NDJ A;  3GTO I;  2QRE B;  2VUM I;  1N8R 2;  3P5J B;  1VQL Z;  1Y1W I;  3K7A I;  3CME Z;  3CCJ Z; 
#chains in the Genus database with same CATH homology
 1Z02 A;  2QKD A;  2E2H I;  4MD8 A;  3I4M I;  3CD6 1;  3CMA Z;  1VQ8 Z;  3I07 A;  2RBL A;  3VB9 A;  3CCQ 1;  2NVT I;  1VQM Z;  3S1M I;  4DQY B;  4AYB A;  1VQ5 1;  1RNI A;  1VQ4 1;  3MZK B;  4CL1 A;  3G6E Z;  1S72 1;  2DE5 A;  3CCS Z;  4Y52 I;  1YIT 1;  2ZAE B;  3GTQ I;  5C44 I;  3CCL 1;  2V8K A;  3CXC Z;  2F4M A;  5T67 A;  3G71 Z;  2JA5 I;  4QTT A;  1I3Q I;  1PFT A;  4NBH A;  1SFO I;  4RVD A;  2E2I I;  3GTM S;  3D9X A;  3D6W A;  3CC4 1;  1Q7Y 1;  4NB9 A;  5D1O A;  3CCR Z;  3VMI A;  1VQ9 1;  1X3Z A;  3CCU 1;  2R7Z I;  3PO3 S;  3I55 1;  1VQO 1;  5LL6 f;  3VTN A;  2PM9 A;  5IP9 I;  1KD1 1;  2PMZ A;  4NFR A;  3CXC Y;  2KPI A;  4RVG A;  4MXU A;  1I6H I;  3KIH A;  1YIJ 1;  2OTL 1;  4E2Y A;  3CC2 Z;  4BBS I;  3CCE 1;  3RZD I;  4A3E I;  3I56 1;  3IFU A;  3S14 I;  1Y1V I;  2QRC B;  3TE5 B;  3VMH A;  3NFZ A;  1YJ9 Z;  1VQK 1;  3KIF A;  3J81 b;  4DK1 A;  2QEX 1;  4A3B I;  2OZK A;  2B63 I;  2AKL A;  3F3P C;  2NVY I;  1YJW Z;  4HH4 A;  2P28 A;  2DE6 A;  4A3F I;  4MD7 A;  1WW9 A;  1VQP 1;  1ZH1 A;  4HGZ A;  1KC8 1;  3CCV 1;  3CC7 Z;  1RO2 A;  2R6M A;  2JA7 I;  3H0G I;  2OTJ 1;  4E31 A;  4RVH A;  2KI7 B;  1ML8 A;  2K5R A;  3J80 b;  1YI2 Z;  1P9N A;  3S1N I;  2YAD A;  3BG1 B;  1W2B Z;  1TFI A;  2Y0S A;  1Q7Y 2;  2M6N A;  3GTL I;  3TDH B;  1NJI 1;  2W04 A;  1VQ6 1;  4BY1 I;  5D1O B;  1Z01 A;  4A3C I;  1VLA A;  3G4S 1;  1KD1 2;  2P3Y A;  3S15 I;  3CPW Z;  1TWG I;  4NH1 C;  5IT9 f;  2OOY B;  3S1R I;  2YU9 I;  1K9M 1;  5IT9 b;  3CME 1;  3CCJ 1;  2QLV B;  3FQQ A;  1L1O C;  4A3I I;  1S72 Z;  1ZB8 A;  1M90 1;  4RVF A;  1W2B Y;  3FQM A;  3CMA 1;  1QVF Z;  1VQ8 1;  2JMO A;  2JR6 A;  1VQM 1;  4A93 I;  3H3V J;  5A2Q f;  3J7A 4;  3S2H I;  1R9T I;  1RLY A;  4NOZ A;  1K8A 2;  3CCS 1;  2E9H A;  3NH5 A;  2QRD B;  2RHB A;  4MH4 A;  1KC8 2;  3CPW Y;  4A3K I;  1K73 1;  2LIY A;  2V8J A;  1Q82 1;  4X6A I;  4BBR I;  2Q4Z A;  2K3R A;  3CCU Z;  1VQ7 Z;  2EGT A;  2JA6 I;  2BJO A;  1VQN 1;  2QA4 1;  1QVF Y;  2GU2 A;  3LUS A;  3HOZ I;  2RT9 A;  3CCR 1;  1YJN 1;  1NJI 2;  4A3L I;  3NDI A;  1TWC I;  4NBB A;  2OTL Z;  1RO0 A;  2DE7 A;  3CCE Z;  1Y1V S;  3I56 Z;  1YUK A;  2IZ3 A;  4NBD A;  5FLX f;  2NVQ I;  3PO2 I;  4A3M I;  5CM2 M;  1KQS Z;  4BXX I;  2E2J I;  5FLX b;  3HOX I;  3CC2 1;  2JA8 I;  3QWU A;  2M48 A;  1VQK Z;  1K9M 2;  3CQZ I;  4E32 A;  2VUG A;  1ZB9 A;  3S17 I;  1NUI A;  3HOV I;  1M90 2;  1Z03 A;  5T6B A;  1YJ9 1;  1WCM I;  2JNY A;  2HU9 A;  1KRL A;  1RO4 A;  3HOW I;  3CCV Z;  3GCF A;  3VMG A;  4A3G I;  3IF8 A;  4TNU A;  3CCM Z;  1YJW 1;  1I50 I;  2H85 A;  3GTG I;  1USP A;  3MZL B;  1DL6 A;  3F3F C;  1KQS Y;  1JJ2 Z;  3CC7 1;  1K73 2;  1QYP A;  1Q82 2;  2J6A A;  1QVG Z;  1YHQ 1;  1X3W A;  3S16 I;  1VQ6 Z;  3S2D I;  3G4S Z;  1M1K 1;  3HOU I;  5D1P A;  3S1Q I;  3Q87 A;  2WAQ A;  3IX0 A;  2OOX B;  3CD6 Z;  1NP6 A;  1VQL 1;  3JAM f;  1LQL A;  4NBG A;  3CCQ Z;  2Q51 A;  4S1T A;  3JAM b;  1VQ5 Z;  1VQ4 Z;  4NBF A;  1QF8 A;  2JUB A;  1JJ2 Y;  4NB8 A;  2PK7 A;  1Q81 1;  1Q86 1;  1QVG Y;  1YIT Z;  2G2K A;  4XX2 A;  2I3C A;  1TWF I;  4RS4 A;  3CCL Z;  3FKI I;  1TWA I;  4RV9 A;  3G6E 1;  4HGY A;  4E2X A;  2F4O A;  4BY7 I;  5A2Q b;  5C4X I;  5FLM I;  2IZ4 A;  3GTK I;  4A3D I;  3M3Y I;  2VF1 A;  3G71 1;  1S7M A;  4NBE A;  1TWH I;  3CC4 Z;  2NVX I;  1VQ9 Z;  3ESW A;  4E30 A;  2R92 I;  3I55 Z;  2O53 A;  4A3J I;  1VQO Z;  1USP B;  3OW2 Z;  1X0T A;  2V8I A;  3M4O I;  2LFU A;  3GTM I;  1VQN Z;  5C4J I;  2QA4 Z;  5AN9 F;  1N2F A;  1YJN Z;  4E2Z A;  1YIJ Z;  1N8R 1;  1VQ7 1;  1WII A;  2HF1 A;  2QR1 B;  3PO3 I;  4Y7N I;  1M1K 2;  4NBC A;  3MON A;  3HOY I;  4E2W A;  4MRI A;  3BG0 B;  4E33 A;  2QEX Z;  5T64 A;  2WB1 A;  3OW2 Y;  2RPR A;  5C3E I;  3T4N B;  1Q81 2;  1Q86 2;  3J81 f;  3I4N I;  2O4H A;  4QTU A;  1VQP Z;  4MON A;  4NBA A;  1JWH C;  2GTH A;  2RIQ A;  1YUA A;  4MD9 A;  1K83 I;  3U50 C;  2OTJ Z;  1K8A 1;  1RQF A;  4EWC A;  2GTI A;  3GTP I;  3RZO I;  3NH4 A;  5IP7 I;  4DGL A;  3GTJ I;  3CCM 1;  2W03 A;  1YHQ Z;  3NH8 A;  3J80 f;  2JS4 A;  1YI2 1;  3HKZ A;  3GKQ A;  3EER A;  3EED A;  2R93 I;  3NDJ A;  3GTO I;  2QRE B;  2VUM I;  1N8R 2;  3P5J B;  1VQL Z;  1Y1W I;  3K7A I;  3CME Z;  3CCJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...