4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
3RZOI 4A93I 3H0GI 1WW9A 1I6HI 4A3KI 3GTLI 2F4MA 4NBAA 4QTTA 3GKQA 1USPA 3D6WA 3HOVI 2JA5I 1X3ZA 1NUIA 4QTUA 4A3II 1USPB 3HOXI 2R92I 4A3GI 3U50C 3S2DI 1K83I 4BBRI 3GTQI 3HOYI 4A3LI 2JS4A 3EERA 4MH4A 1TFIA 2DE6A 2J6AA 4XX2A 2NVTI 2JA6I 3S14I 1TWCI 5C44I 1I50I 4NBBA 3CQZI 4NOZA 4NBGA 1PFTA 2F4OA 2RBLA 3VMGA 3PO2I 2DE7A 4NBFA 4NBHA 2VUMI 2NVQI 3GTMS 2KPIA 4A3FI 3GTKI 1YUAA 2AKLA 5C4JI 3S1RI 2YU9I 2JA7I 3M3YI 1L1OC 1Y1WI 2PK7A 3GTJI 4A3EI 1SFOI 4Y52I 1N2FA 4A3MI 3H3VJ 1DL6A 4NBEA 1WCMI 1TWFI 1X3WA 5C4XI 4BY1I 3S1QI 1LQLA 1TWHI 3I4NI 3GTMI 3GTPI 2JNYA 3VMIA 3PO3S 3I4MI 2BJOA 3FKII 4NB8A 5IP7I 4NB9A 3S1NI 1ML8A 3ESWA 3S2HI 4BBSI 3I07A 2E2HI 4BY7I 3VB9A 2R7ZI 3LUSA 5C3EI 2DE5A 4NBCA 4X6AI 1R9TI 1TWAI 1TWGI 3HOUI 2R93I 2HF1A 2JA8I 3PO3I 5FLMI 1QYPA 1VLAA 1Y1VS 3HOZI 3S1MI 1ZB9A 3S15I 3S17I 1RO4A 4A3CI 2K5RA 1RLYA 5CM2M 4BXXI 2B63I 1ZB8A 4Y7NI 4A3DI 3S16I 3Q87A 3GCFA 3HOWI 4A3JI 3M4OI 2E2II 3VMHA 1I3QI 2JR6A 3K7AI 2NVXI 5IP9I 3GTOI 2E2JI 3GTGI 4A3BI 1Y1VI 2NVYI 3RZDI 4NBDA 2P3YA
chains in the Genus database with same CATH superfamily
2JIQA 3NH4A 3CCR1 2NAPA 5IT9b 4NBAA 2Q51A 1VQ8Z 2V3VA 1KD11 1S721 1VQLZ 1KC82 1FDIA 2LIYA 3CCV1 4A3II 3HOXI 4HGYA 5A2Qb 2O4HA 1K83I 3KIFA 3GTQI 4NFRA 3CPWZ 3NDJA 4A3LI 1NJI1 3CCEZ 4E2YA 2QEXZ 2NVTI 1TWCI 5C44I 2HU9A 1I50I 4NBBA 1RO2A 2JIPA 1FDOA 2DE7A 2VUMI 1S72Z 3GTMS 3CC41 2IZ4A 2YU9I 2OOYB 4MD8A 4A3EI 3HKZA 3CME1 4NBEA 1TWFI 4DQYB 1YI2Z 2V8KA 2ZAEB 1KQSY 3GTMI 2QKDA 3CCJZ 3FKII 1M902 1VQK1 1M1K2 1M901 1ML8A 2GU2A 2OOXB 4BBSI 3I07A 1VQ9Z 2W04A 3VB9A 2R7ZI 5T64A 4NBCA 3QWUA 1WJ2A 1RO0A 1TWAI 3CMEZ 2VPWA 4MD9A 1Q7Y1 1QYPA 1VLAA 3F3PC 1YJ91 3S15I 5LL6f 2QLVB 1RO4A 2K5RA 4BXXI 1ZB8A 4Y7NI 3JAMb 1YHQ1 3CC7Z 3M4OI 1I3QI 2OTL1 4MRIA 2E7ZA 4A3BI 1QXFA 3RZOI 4A93I 4E30A 3GTLI 3CCQZ 1VQ51 2P28A 3CXCZ 1Q16A 1USPA 2WB1A 1NP6A 1VQOZ 1AA6A 1RQFA 3CD6Z 1W2BY 3J7A4 3KIHA 1ZH1A 5T67A 3J81f 1Q861 2OTLZ 3G4S1 3IR7A 1WZNA 2OTJZ 1VQN1 4CL1A 1KQSZ 3S14I 1VQ5Z 3FQMA 2F4OA 3VMGA 3PO2I 5FLXb 5IT9f 1K8A2 3NH8A 1KC81 4E2WA 3IFUA 3S1RI 1YIT1 2JA7I 2VPZA 3GTJI 4A3MI 1VQM1 3H3VJ 1WCMI 5D1OB 3CCS1 5A2Qf 1QVFZ 3CC21 1VQPZ 1S7MA 3CCRZ 1VQNZ 1YIJ1 2IV2X 2JNYA 3I4MI 2BJOA 3CXCY 3ESWA 2RIQA 2V45A 3CCVZ 3CCM1 3BG1B 1YITZ 3FQQA 2DE5A 2QR1B 1X0TA 4RVGA 1VQMZ 2LFUA 2HF1A 2W03A 1YJN1 2QRCB 3D2LA 3CCSZ 3HOZI 3CC2Z 1RNIA 2PM9A 1YIJZ 4MONA 4A3CI 2I3CA 3IF8A 2B63I 2QREB 1W2BZ 1M1K1 3HOWI 2IZ3A 3VMHA 3CC4Z 3MZKB 2RHBA 3K7AI 2QA41 2JUBA 3CCMZ 2NVYI 3RZDI 4NBDA 2RT9A 4TNUA 3TDHB 3H0GI 2GTHA 2RPRA 4A3KI 2OZKA 1QVFY 1JJ2Z 4QTTA 4MXUA 3GKQA 3D9XA 3HOVI 3OW2Y 4DGLA 1NUIA 2R92I 1VQKZ 3NFZA 1Q822 2VF1A 2EGTA 2O53A 3HOYI 2JS4A 3CCL1 4E31A 3EERA 1TFIA 2J6AA 3I561 5T6BA 2KI7B 2VPYA 1K9M2 2G2KA 1K9M1 3CQZI 2JIOA 1VQ41 1YJ9Z 3J80b 3CCU1 4NBFA 1K732 2E9HA 2KPIA 2VPXA 3M3YI 1YHQZ 4Y52I 1X3WA 1Z02A 3S1QI 4BY1I 3CCLZ 2JIRA 3G711 3I56Z 1SIWA 2M6NA 3PO3S 1VQ4Z 1JJ2Y 2AYDA 3T4NB 4NB8A 3I551 1K8A1 4RS4A 2VUGA 1Q812 1Q811 1QVGY 5FLXf 2E2HI 3NH5A 5AN9F 3CCE1 4E33A 4X6AI 2QEX1 1TWGI 3HOUI 3G4SZ 3MONA 4E32A 2R93I 3PO3I 1Y1VS 3G71Z 2K3RA 1WIIA 1KD12 3OW2Z 4MD7A 1RLYA 4HGZA 5CM2M 1QF8A 3GCFA 3I55Z 4A3JI 1YJW1 2NVXI 2WAQA 3GTOI 4RVFA 2M48A 4E2XA 1Y1VI 1NJI2 1YI21 3G6E1 2LEXA 2R6MA 1WW9A 4E2ZA 1I6HI 2F4MA 3CCJ1 2Q4ZA 3NDIA 3D6WA 4RVHA 2PMZA 2JA5I 1X3ZA 4QTUA 1USPB 1VQ91 1VQ61 5D1PA 4A3GI 4HH4A 3U50C 2JIMA 4RVDA 3S2DI 4BBRI 1Z01A 1YJWZ 4MH4A 3G6EZ 2DE6A 2H85A 4XX2A 2JA6I 1YJNZ 4NOZA 4NBGA 1PFTA 2RBLA 4NBHA 3CC71 2NVQI 2JMOA 4RV9A 1QVGZ 4A3FI 3GTKI 1YUAA 2AKLA 5C4JI 1L1OC 4AYBA 1Y1WI 1VQ6Z 2PK7A 2V8JA 5D1OA 1Q821 1SFOI 1Z03A 2V8IA 1YUKA 1N2FA 3JAMf 1DL6A 2QA4Z 1Q7Y2 5C4XI 3CCQ1 3CPWY 3F3FC 1LQLA 1TWHI 2Y0SA 3I4NI 4DK1A 1P9NA 3IX0A 1VQO1 3GTPI 3VMIA 4S1TA 3BG0B 5IP7I 3CD61 4NB9A 1K731 3S1NI 3J80f 3S2HI 3CMA1 1VQ71 3MZLB 4BY7I 3LUSA 5C3EI 4NH1C 1Y8CA 2OTJ1 1R9TI 2JA8I 3P5JB 5FLMI 1VQ81 3S1MI 3EEDA 1ZB9A 3S17I 1KRLA 3TE5B 1VQL1 3J81b 3CCUZ 3VTNA 4A3DI 3S16I 2QRDB 3Q87A 2E2II 2JR6A 1Q862 2GTIA 1N8R2 5IP9I 3CMAZ 1N8R1 1VQ7Z 2E2JI 1JWHC 4EWCA 3GTGI 2YADA 2P3YA 1VQP1
chains in the Genus database with same CATH topology
3NH4A 3CCR1 5IT9b 4NBAA 2Q51A 1VQ8Z 1KD11 1S721 1VQLZ 1KC82 2LIYA 3CCV1 4A3II 3HOXI 4HGYA 5A2Qb 2O4HA 1K83I 3KIFA 3GTQI 4NFRA 3CPWZ 3NDJA 4A3LI 1NJI1 3CCEZ 4E2YA 2QEXZ 2NVTI 1TWCI 5C44I 2HU9A 1I50I 4NBBA 1RO2A 2DE7A 2VUMI 1S72Z 3GTMS 3CC41 2IZ4A 2YU9I 2OOYB 4MD8A 4A3EI 3HKZA 3CME1 4NBEA 1TWFI 4DQYB 1YI2Z 2V8KA 2ZAEB 1KQSY 3GTMI 2QKDA 3CCJZ 3FKII 1M902 1VQK1 1M1K2 1M901 1ML8A 2GU2A 2OOXB 4BBSI 3I07A 1VQ9Z 2W04A 3VB9A 2R7ZI 5T64A 4NBCA 3QWUA 1RO0A 1TWAI 3CMEZ 4MD9A 1Q7Y1 1QYPA 1VLAA 3F3PC 1YJ91 3S15I 5LL6f 2QLVB 1RO4A 2K5RA 4BXXI 1ZB8A 4Y7NI 3JAMb 1YHQ1 3CC7Z 3M4OI 1I3QI 2OTL1 4MRIA 4A3BI 3RZOI 4A93I 4E30A 3GTLI 3CCQZ 1VQ51 2P28A 3CXCZ 1USPA 2WB1A 1NP6A 1VQOZ 1RQFA 3CD6Z 1W2BY 3J7A4 3KIHA 1ZH1A 5T67A 3J81f 1Q861 2OTLZ 3G4S1 2OTJZ 1VQN1 4CL1A 1KQSZ 3S14I 1VQ5Z 3FQMA 2F4OA 3VMGA 3PO2I 5FLXb 5IT9f 1K8A2 3NH8A 1KC81 4E2WA 3IFUA 3S1RI 1YIT1 2JA7I 3GTJI 4A3MI 1VQM1 3H3VJ 1WCMI 5D1OB 3CCS1 5A2Qf 1QVFZ 3CC21 1VQPZ 1S7MA 3CCRZ 1VQNZ 1YIJ1 2JNYA 3I4MI 2BJOA 3CXCY 3ESWA 2RIQA 3CCVZ 3CCM1 3BG1B 1YITZ 3FQQA 2DE5A 2QR1B 1X0TA 4RVGA 1VQMZ 2LFUA 2HF1A 2W03A 1YJN1 2QRCB 3CCSZ 3HOZI 3CC2Z 1RNIA 2PM9A 1YIJZ 4MONA 4A3CI 2I3CA 3IF8A 2B63I 2QREB 1W2BZ 1M1K1 3HOWI 2IZ3A 3VMHA 3CC4Z 3MZKB 2RHBA 3K7AI 2QA41 2JUBA 3CCMZ 2NVYI 3RZDI 4NBDA 2RT9A 4TNUA 3TDHB 3H0GI 2GTHA 2RPRA 4A3KI 2OZKA 1QVFY 1JJ2Z 4QTTA 4MXUA 3GKQA 3D9XA 3HOVI 3OW2Y 4DGLA 1NUIA 2R92I 1VQKZ 3NFZA 1Q822 2VF1A 2EGTA 2O53A 3HOYI 2JS4A 3CCL1 4E31A 3EERA 1TFIA 2J6AA 3I561 5T6BA 2KI7B 1K9M2 2G2KA 1K9M1 3CQZI 1VQ41 1YJ9Z 3J80b 3CCU1 4NBFA 1K732 2E9HA 2KPIA 3M3YI 1YHQZ 4Y52I 1X3WA 1Z02A 3S1QI 4BY1I 3CCLZ 3G711 3I56Z 2M6NA 3PO3S 1VQ4Z 1JJ2Y 3T4NB 4NB8A 3I551 1K8A1 4RS4A 2VUGA 1Q812 1Q811 1QVGY 5FLXf 2E2HI 3NH5A 5AN9F 3CCE1 4E33A 4X6AI 2QEX1 1TWGI 3HOUI 3G4SZ 3MONA 4E32A 2R93I 3PO3I 1Y1VS 3G71Z 2K3RA 1WIIA 1KD12 3OW2Z 4MD7A 1RLYA 4HGZA 5CM2M 1QF8A 3GCFA 3I55Z 4A3JI 1YJW1 2NVXI 2WAQA 3GTOI 4RVFA 2M48A 4E2XA 1Y1VI 1NJI2 1YI21 3G6E1 2R6MA 1WW9A 4E2ZA 1I6HI 2F4MA 3CCJ1 2Q4ZA 3NDIA 3D6WA 4RVHA 2PMZA 2JA5I 1X3ZA 4QTUA 1USPB 1VQ91 1VQ61 5D1PA 4A3GI 4HH4A 3U50C 4RVDA 3S2DI 4BBRI 1Z01A 1YJWZ 4MH4A 3G6EZ 2DE6A 2H85A 4XX2A 2JA6I 1YJNZ 4NOZA 4NBGA 1PFTA 2RBLA 4NBHA 3CC71 2NVQI 2JMOA 4RV9A 1QVGZ 4A3FI 3GTKI 1YUAA 2AKLA 5C4JI 1L1OC 4AYBA 1Y1WI 1VQ6Z 2PK7A 2V8JA 5D1OA 1Q821 1SFOI 1Z03A 2V8IA 1YUKA 1N2FA 3JAMf 1DL6A 2QA4Z 1Q7Y2 5C4XI 3CCQ1 3CPWY 3F3FC 1LQLA 1TWHI 2Y0SA 3I4NI 4DK1A 1P9NA 3IX0A 1VQO1 3GTPI 3VMIA 4S1TA 3BG0B 5IP7I 3CD61 4NB9A 1K731 3S1NI 3J80f 3S2HI 3CMA1 1VQ71 3MZLB 4BY7I 3LUSA 5C3EI 4NH1C 2OTJ1 1R9TI 2JA8I 3P5JB 5FLMI 1VQ81 3S1MI 3EEDA 1ZB9A 3S17I 1KRLA 3TE5B 1VQL1 3J81b 3CCUZ 3VTNA 4A3DI 3S16I 2QRDB 3Q87A 2E2II 2JR6A 1Q862 2GTIA 1N8R2 5IP9I 3CMAZ 1N8R1 1VQ7Z 2E2JI 1JWHC 4EWCA 3GTGI 2YADA 2P3YA 1VQP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO I;  4A93 I;  3H0G I;  1WW9 A;  1I6H I;  4A3K I;  3GTL I;  2F4M A;  4NBA A;  4QTT A;  3GKQ A;  1USP A;  3D6W A;  3HOV I;  2JA5 I;  1X3Z A;  1NUI A;  4QTU A;  4A3I I;  1USP B;  3HOX I;  2R92 I;  4A3G I;  3U50 C;  3S2D I;  1K83 I;  4BBR I;  3GTQ I;  3HOY I;  4A3L I;  2JS4 A;  3EER A;  4MH4 A;  1TFI A;  2DE6 A;  2J6A A;  4XX2 A;  2NVT I;  2JA6 I;  3S14 I;  1TWC I;  5C44 I;  1I50 I;  4NBB A;  3CQZ I;  4NOZ A;  4NBG A;  1PFT A;  2F4O A;  2RBL A;  3VMG A;  3PO2 I;  2DE7 A;  4NBF A;  4NBH A;  2VUM I;  2NVQ I;  3GTM S;  2KPI A;  4A3F I;  3GTK I;  1YUA A;  2AKL A;  5C4J I;  3S1R I;  2YU9 I;  2JA7 I;  3M3Y I;  1L1O C;  1Y1W I;  2PK7 A;  3GTJ I;  4A3E I;  1SFO I;  4Y52 I;  1N2F A;  4A3M I;  3H3V J;  1DL6 A;  4NBE A;  1WCM I;  1TWF I;  1X3W A;  5C4X I;  4BY1 I;  3S1Q I;  1LQL A;  1TWH I;  3I4N I;  3GTM I;  3GTP I;  2JNY A;  3VMI A;  3PO3 S;  3I4M I;  2BJO A;  3FKI I;  4NB8 A;  5IP7 I;  4NB9 A;  3S1N I;  1ML8 A;  3ESW A;  3S2H I;  4BBS I;  3I07 A;  2E2H I;  4BY7 I;  3VB9 A;  2R7Z I;  3LUS A;  5C3E I;  2DE5 A;  4NBC A;  4X6A I;  1R9T I;  1TWA I;  1TWG I;  3HOU I;  2R93 I;  2HF1 A;  2JA8 I;  3PO3 I;  5FLM I;  1QYP A;  1VLA A;  1Y1V S;  3HOZ I;  3S1M I;  1ZB9 A;  3S15 I;  3S17 I;  1RO4 A;  4A3C I;  2K5R A;  1RLY A;  5CM2 M;  4BXX I;  2B63 I;  1ZB8 A;  4Y7N I;  4A3D I;  3S16 I;  3Q87 A;  3GCF A;  3HOW I;  4A3J I;  3M4O I;  2E2I I;  3VMH A;  1I3Q I;  2JR6 A;  3K7A I;  2NVX I;  5IP9 I;  3GTO I;  2E2J I;  3GTG I;  4A3B I;  1Y1V I;  2NVY I;  3RZD I;  4NBD A;  2P3Y A; 
#chains in the Genus database with same CATH topology
 2JIQ A;  3NH4 A;  3CCR 1;  2NAP A;  5IT9 b;  4NBA A;  2Q51 A;  1VQ8 Z;  2V3V A;  1KD1 1;  1S72 1;  1VQL Z;  1KC8 2;  1FDI A;  2LIY A;  3CCV 1;  4A3I I;  3HOX I;  4HGY A;  5A2Q b;  2O4H A;  1K83 I;  3KIF A;  3GTQ I;  4NFR A;  3CPW Z;  3NDJ A;  4A3L I;  1NJI 1;  3CCE Z;  4E2Y A;  2QEX Z;  2NVT I;  1TWC I;  5C44 I;  2HU9 A;  1I50 I;  4NBB A;  1RO2 A;  2JIP A;  1FDO A;  2DE7 A;  2VUM I;  1S72 Z;  3GTM S;  3CC4 1;  2IZ4 A;  2YU9 I;  2OOY B;  4MD8 A;  4A3E I;  3HKZ A;  3CME 1;  4NBE A;  1TWF I;  4DQY B;  1YI2 Z;  2V8K A;  2ZAE B;  1KQS Y;  3GTM I;  2QKD A;  3CCJ Z;  3FKI I;  1M90 2;  1VQK 1;  1M1K 2;  1M90 1;  1ML8 A;  2GU2 A;  2OOX B;  4BBS I;  3I07 A;  1VQ9 Z;  2W04 A;  3VB9 A;  2R7Z I;  5T64 A;  4NBC A;  3QWU A;  1WJ2 A;  1RO0 A;  1TWA I;  3CME Z;  2VPW A;  4MD9 A;  1Q7Y 1;  1QYP A;  1VLA A;  3F3P C;  1YJ9 1;  3S15 I;  5LL6 f;  2QLV B;  1RO4 A;  2K5R A;  4BXX I;  1ZB8 A;  4Y7N I;  3JAM b;  1YHQ 1;  3CC7 Z;  3M4O I;  1I3Q I;  2OTL 1;  4MRI A;  2E7Z A;  4A3B I;  1QXF A;  3RZO I;  4A93 I;  4E30 A;  3GTL I;  3CCQ Z;  1VQ5 1;  2P28 A;  3CXC Z;  1Q16 A;  1USP A;  2WB1 A;  1NP6 A;  1VQO Z;  1AA6 A;  1RQF A;  3CD6 Z;  1W2B Y;  3J7A 4;  3KIH A;  1ZH1 A;  5T67 A;  3J81 f;  1Q86 1;  2OTL Z;  3G4S 1;  3IR7 A;  1WZN A;  2OTJ Z;  1VQN 1;  4CL1 A;  1KQS Z;  3S14 I;  1VQ5 Z;  3FQM A;  2F4O A;  3VMG A;  3PO2 I;  5FLX b;  5IT9 f;  1K8A 2;  3NH8 A;  1KC8 1;  4E2W A;  3IFU A;  3S1R I;  1YIT 1;  2JA7 I;  2VPZ A;  3GTJ I;  4A3M I;  1VQM 1;  3H3V J;  1WCM I;  5D1O B;  3CCS 1;  5A2Q f;  1QVF Z;  3CC2 1;  1VQP Z;  1S7M A;  3CCR Z;  1VQN Z;  1YIJ 1;  2IV2 X;  2JNY A;  3I4M I;  2BJO A;  3CXC Y;  3ESW A;  2RIQ A;  2V45 A;  3CCV Z;  3CCM 1;  3BG1 B;  1YIT Z;  3FQQ A;  2DE5 A;  2QR1 B;  1X0T A;  4RVG A;  1VQM Z;  2LFU A;  2HF1 A;  2W03 A;  1YJN 1;  2QRC B;  3D2L A;  3CCS Z;  3HOZ I;  3CC2 Z;  1RNI A;  2PM9 A;  1YIJ Z;  4MON A;  4A3C I;  2I3C A;  3IF8 A;  2B63 I;  2QRE B;  1W2B Z;  1M1K 1;  3HOW I;  2IZ3 A;  3VMH A;  3CC4 Z;  3MZK B;  2RHB A;  3K7A I;  2QA4 1;  2JUB A;  3CCM Z;  2NVY I;  3RZD I;  4NBD A;  2RT9 A;  4TNU A;  3TDH B;  3H0G I;  2GTH A;  2RPR A;  4A3K I;  2OZK A;  1QVF Y;  1JJ2 Z;  4QTT A;  4MXU A;  3GKQ A;  3D9X A;  3HOV I;  3OW2 Y;  4DGL A;  1NUI A;  2R92 I;  1VQK Z;  3NFZ A;  1Q82 2;  2VF1 A;  2EGT A;  2O53 A;  3HOY I;  2JS4 A;  3CCL 1;  4E31 A;  3EER A;  1TFI A;  2J6A A;  3I56 1;  5T6B A;  2KI7 B;  2VPY A;  1K9M 2;  2G2K A;  1K9M 1;  3CQZ I;  2JIO A;  1VQ4 1;  1YJ9 Z;  3J80 b;  3CCU 1;  4NBF A;  1K73 2;  2E9H A;  2KPI A;  2VPX A;  3M3Y I;  1YHQ Z;  4Y52 I;  1X3W A;  1Z02 A;  3S1Q I;  4BY1 I;  3CCL Z;  2JIR A;  3G71 1;  3I56 Z;  1SIW A;  2M6N A;  3PO3 S;  1VQ4 Z;  1JJ2 Y;  2AYD A;  3T4N B;  4NB8 A;  3I55 1;  1K8A 1;  4RS4 A;  2VUG A;  1Q81 2;  1Q81 1;  1QVG Y;  5FLX f;  2E2H I;  3NH5 A;  5AN9 F;  3CCE 1;  4E33 A;  4X6A I;  2QEX 1;  1TWG I;  3HOU I;  3G4S Z;  3MON A;  4E32 A;  2R93 I;  3PO3 I;  1Y1V S;  3G71 Z;  2K3R A;  1WII A;  1KD1 2;  3OW2 Z;  4MD7 A;  1RLY A;  4HGZ A;  5CM2 M;  1QF8 A;  3GCF A;  3I55 Z;  4A3J I;  1YJW 1;  2NVX I;  2WAQ A;  3GTO I;  4RVF A;  2M48 A;  4E2X A;  1Y1V I;  1NJI 2;  1YI2 1;  3G6E 1;  2LEX A;  2R6M A;  1WW9 A;  4E2Z A;  1I6H I;  2F4M A;  3CCJ 1;  2Q4Z A;  3NDI A;  3D6W A;  4RVH A;  2PMZ A;  2JA5 I;  1X3Z A;  4QTU A;  1USP B;  1VQ9 1;  1VQ6 1;  5D1P A;  4A3G I;  4HH4 A;  3U50 C;  2JIM A;  4RVD A;  3S2D I;  4BBR I;  1Z01 A;  1YJW Z;  4MH4 A;  3G6E Z;  2DE6 A;  2H85 A;  4XX2 A;  2JA6 I;  1YJN Z;  4NOZ A;  4NBG A;  1PFT A;  2RBL A;  4NBH A;  3CC7 1;  2NVQ I;  2JMO A;  4RV9 A;  1QVG Z;  4A3F I;  3GTK I;  1YUA A;  2AKL A;  5C4J I;  1L1O C;  4AYB A;  1Y1W I;  1VQ6 Z;  2PK7 A;  2V8J A;  5D1O A;  1Q82 1;  1SFO I;  1Z03 A;  2V8I A;  1YUK A;  1N2F A;  3JAM f;  1DL6 A;  2QA4 Z;  1Q7Y 2;  5C4X I;  3CCQ 1;  3CPW Y;  3F3F C;  1LQL A;  1TWH I;  2Y0S A;  3I4N I;  4DK1 A;  1P9N A;  3IX0 A;  1VQO 1;  3GTP I;  3VMI A;  4S1T A;  3BG0 B;  5IP7 I;  3CD6 1;  4NB9 A;  1K73 1;  3S1N I;  3J80 f;  3S2H I;  3CMA 1;  1VQ7 1;  3MZL B;  4BY7 I;  3LUS A;  5C3E I;  4NH1 C;  1Y8C A;  2OTJ 1;  1R9T I;  2JA8 I;  3P5J B;  5FLM I;  1VQ8 1;  3S1M I;  3EED A;  1ZB9 A;  3S17 I;  1KRL A;  3TE5 B;  1VQL 1;  3J81 b;  3CCU Z;  3VTN A;  4A3D I;  3S16 I;  2QRD B;  3Q87 A;  2E2I I;  2JR6 A;  1Q86 2;  2GTI A;  1N8R 2;  5IP9 I;  3CMA Z;  1N8R 1;  1VQ7 Z;  2E2J I;  1JWH C;  4EWC A;  3GTG I;  2YAD A;  2P3Y A;  1VQP 1; 
#chains in the Genus database with same CATH homology
 3NH4 A;  3CCR 1;  5IT9 b;  4NBA A;  2Q51 A;  1VQ8 Z;  1KD1 1;  1S72 1;  1VQL Z;  1KC8 2;  2LIY A;  3CCV 1;  4A3I I;  3HOX I;  4HGY A;  5A2Q b;  2O4H A;  1K83 I;  3KIF A;  3GTQ I;  4NFR A;  3CPW Z;  3NDJ A;  4A3L I;  1NJI 1;  3CCE Z;  4E2Y A;  2QEX Z;  2NVT I;  1TWC I;  5C44 I;  2HU9 A;  1I50 I;  4NBB A;  1RO2 A;  2DE7 A;  2VUM I;  1S72 Z;  3GTM S;  3CC4 1;  2IZ4 A;  2YU9 I;  2OOY B;  4MD8 A;  4A3E I;  3HKZ A;  3CME 1;  4NBE A;  1TWF I;  4DQY B;  1YI2 Z;  2V8K A;  2ZAE B;  1KQS Y;  3GTM I;  2QKD A;  3CCJ Z;  3FKI I;  1M90 2;  1VQK 1;  1M1K 2;  1M90 1;  1ML8 A;  2GU2 A;  2OOX B;  4BBS I;  3I07 A;  1VQ9 Z;  2W04 A;  3VB9 A;  2R7Z I;  5T64 A;  4NBC A;  3QWU A;  1RO0 A;  1TWA I;  3CME Z;  4MD9 A;  1Q7Y 1;  1QYP A;  1VLA A;  3F3P C;  1YJ9 1;  3S15 I;  5LL6 f;  2QLV B;  1RO4 A;  2K5R A;  4BXX I;  1ZB8 A;  4Y7N I;  3JAM b;  1YHQ 1;  3CC7 Z;  3M4O I;  1I3Q I;  2OTL 1;  4MRI A;  4A3B I;  3RZO I;  4A93 I;  4E30 A;  3GTL I;  3CCQ Z;  1VQ5 1;  2P28 A;  3CXC Z;  1USP A;  2WB1 A;  1NP6 A;  1VQO Z;  1RQF A;  3CD6 Z;  1W2B Y;  3J7A 4;  3KIH A;  1ZH1 A;  5T67 A;  3J81 f;  1Q86 1;  2OTL Z;  3G4S 1;  2OTJ Z;  1VQN 1;  4CL1 A;  1KQS Z;  3S14 I;  1VQ5 Z;  3FQM A;  2F4O A;  3VMG A;  3PO2 I;  5FLX b;  5IT9 f;  1K8A 2;  3NH8 A;  1KC8 1;  4E2W A;  3IFU A;  3S1R I;  1YIT 1;  2JA7 I;  3GTJ I;  4A3M I;  1VQM 1;  3H3V J;  1WCM I;  5D1O B;  3CCS 1;  5A2Q f;  1QVF Z;  3CC2 1;  1VQP Z;  1S7M A;  3CCR Z;  1VQN Z;  1YIJ 1;  2JNY A;  3I4M I;  2BJO A;  3CXC Y;  3ESW A;  2RIQ A;  3CCV Z;  3CCM 1;  3BG1 B;  1YIT Z;  3FQQ A;  2DE5 A;  2QR1 B;  1X0T A;  4RVG A;  1VQM Z;  2LFU A;  2HF1 A;  2W03 A;  1YJN 1;  2QRC B;  3CCS Z;  3HOZ I;  3CC2 Z;  1RNI A;  2PM9 A;  1YIJ Z;  4MON A;  4A3C I;  2I3C A;  3IF8 A;  2B63 I;  2QRE B;  1W2B Z;  1M1K 1;  3HOW I;  2IZ3 A;  3VMH A;  3CC4 Z;  3MZK B;  2RHB A;  3K7A I;  2QA4 1;  2JUB A;  3CCM Z;  2NVY I;  3RZD I;  4NBD A;  2RT9 A;  4TNU A;  3TDH B;  3H0G I;  2GTH A;  2RPR A;  4A3K I;  2OZK A;  1QVF Y;  1JJ2 Z;  4QTT A;  4MXU A;  3GKQ A;  3D9X A;  3HOV I;  3OW2 Y;  4DGL A;  1NUI A;  2R92 I;  1VQK Z;  3NFZ A;  1Q82 2;  2VF1 A;  2EGT A;  2O53 A;  3HOY I;  2JS4 A;  3CCL 1;  4E31 A;  3EER A;  1TFI A;  2J6A A;  3I56 1;  5T6B A;  2KI7 B;  1K9M 2;  2G2K A;  1K9M 1;  3CQZ I;  1VQ4 1;  1YJ9 Z;  3J80 b;  3CCU 1;  4NBF A;  1K73 2;  2E9H A;  2KPI A;  3M3Y I;  1YHQ Z;  4Y52 I;  1X3W A;  1Z02 A;  3S1Q I;  4BY1 I;  3CCL Z;  3G71 1;  3I56 Z;  2M6N A;  3PO3 S;  1VQ4 Z;  1JJ2 Y;  3T4N B;  4NB8 A;  3I55 1;  1K8A 1;  4RS4 A;  2VUG A;  1Q81 2;  1Q81 1;  1QVG Y;  5FLX f;  2E2H I;  3NH5 A;  5AN9 F;  3CCE 1;  4E33 A;  4X6A I;  2QEX 1;  1TWG I;  3HOU I;  3G4S Z;  3MON A;  4E32 A;  2R93 I;  3PO3 I;  1Y1V S;  3G71 Z;  2K3R A;  1WII A;  1KD1 2;  3OW2 Z;  4MD7 A;  1RLY A;  4HGZ A;  5CM2 M;  1QF8 A;  3GCF A;  3I55 Z;  4A3J I;  1YJW 1;  2NVX I;  2WAQ A;  3GTO I;  4RVF A;  2M48 A;  4E2X A;  1Y1V I;  1NJI 2;  1YI2 1;  3G6E 1;  2R6M A;  1WW9 A;  4E2Z A;  1I6H I;  2F4M A;  3CCJ 1;  2Q4Z A;  3NDI A;  3D6W A;  4RVH A;  2PMZ A;  2JA5 I;  1X3Z A;  4QTU A;  1USP B;  1VQ9 1;  1VQ6 1;  5D1P A;  4A3G I;  4HH4 A;  3U50 C;  4RVD A;  3S2D I;  4BBR I;  1Z01 A;  1YJW Z;  4MH4 A;  3G6E Z;  2DE6 A;  2H85 A;  4XX2 A;  2JA6 I;  1YJN Z;  4NOZ A;  4NBG A;  1PFT A;  2RBL A;  4NBH A;  3CC7 1;  2NVQ I;  2JMO A;  4RV9 A;  1QVG Z;  4A3F I;  3GTK I;  1YUA A;  2AKL A;  5C4J I;  1L1O C;  4AYB A;  1Y1W I;  1VQ6 Z;  2PK7 A;  2V8J A;  5D1O A;  1Q82 1;  1SFO I;  1Z03 A;  2V8I A;  1YUK A;  1N2F A;  3JAM f;  1DL6 A;  2QA4 Z;  1Q7Y 2;  5C4X I;  3CCQ 1;  3CPW Y;  3F3F C;  1LQL A;  1TWH I;  2Y0S A;  3I4N I;  4DK1 A;  1P9N A;  3IX0 A;  1VQO 1;  3GTP I;  3VMI A;  4S1T A;  3BG0 B;  5IP7 I;  3CD6 1;  4NB9 A;  1K73 1;  3S1N I;  3J80 f;  3S2H I;  3CMA 1;  1VQ7 1;  3MZL B;  4BY7 I;  3LUS A;  5C3E I;  4NH1 C;  2OTJ 1;  1R9T I;  2JA8 I;  3P5J B;  5FLM I;  1VQ8 1;  3S1M I;  3EED A;  1ZB9 A;  3S17 I;  1KRL A;  3TE5 B;  1VQL 1;  3J81 b;  3CCU Z;  3VTN A;  4A3D I;  3S16 I;  2QRD B;  3Q87 A;  2E2I I;  2JR6 A;  1Q86 2;  2GTI A;  1N8R 2;  5IP9 I;  3CMA Z;  1N8R 1;  1VQ7 Z;  2E2J I;  1JWH C;  4EWC A;  3GTG I;  2YAD A;  2P3Y A;  1VQP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...