4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
3I4NI 3HOWI 4QTUA 3GTJI 3M3YI 2JA8I 4A3BI 3D6WA 2VUMI 1QYPA 3M4OI 2P3YA 1I50I 4A3LI 3RZOI 1TFIA 2R93I 3LUSA 1TWFI 4A3FI 3VMHA 1TWGI 3I4MI 3ESWA 3GCFA 4NBDA 3S1QI 4A3CI 1ZB8A 1X3WA 4NBFA 1K83I 1WW9A 3GTMI 1L1OC 2F4MA 3PO3I 4MH4A 3PO2I 4A3KI 3GTMS 2JNYA 1I6HI 2NVTI 4NBGA 3PO3S 2HF1A 5C3EI 3GTGI 4A93I 1YUAA 2KPIA 3I07A 4BY1I 3GKQA 1USPA 4A3EI 5IP7I 4NBHA 1USPB 4A3II 4XX2A 1R9TI 2PK7A 5FLMI 3S1NI 4Y52I 3U50C 4NBAA 4NB9A 3CQZI 1Y1VI 2AKLA 2E2II 2DE7A 3VMIA 1Y1WI 3VB9A 3H3VJ 1ML8A 2B63I 2NVXI 1WCMI 2RBLA 3HOXI 2NVYI 5IP9I 1RO4A 4BBRI 1NUIA 5CM2M 2K5RA 3GTOI 1TWAI 3HOYI 2F4OA 4BBSI 4NOZA 3S2DI 3VMGA 2JR6A 4A3MI 4BY7I 1SFOI 3S14I 5C44I 3HOVI 1VLAA 2JA5I 4A3JI 3S16I 4QTTA 4NBBA 2E2JI 4A3GI 1TWHI 3S1MI 5C4XI 1LQLA 2NVQI 1I3QI 3GTLI 2DE6A 3Q87A 4X6AI 3K7AI 1N2FA 1ZB9A 1Y1VS 3S1RI 3S15I 3HOZI 2E2HI 3GTKI 2YU9I 4NB8A 3GTQI 4NBCA 2JS4A 4Y7NI 2R7ZI 1DL6A 2DE5A 3HOUI 3EERA 3S2HI 4A3DI 3RZDI 2BJOA 3S17I 2J6AA 5C4JI 1TWCI 1X3ZA 4BXXI 3H0GI 1RLYA 3FKII 4NBEA 3GTPI 2JA6I 2R92I 1PFTA 2JA7I
chains in the Genus database with same CATH superfamily
1N8R1 3I4NI 3HOWI 4QTUA 3GTJI 3FQQA 4RS4A 3D6WA 3CCJZ 1VQPZ 3J80f 1QYPA 5T6BA 5T64A 3M4OI 2VPWA 4E2YA 3MZLB 3RZOI 1TFIA 3CCUZ 2R93I 3LUSA 1TWFI 1TWGI 4NBDA 4A3CI 1QVGY 3CMA1 1VQ8Z 1FDIA 2GTIA 4MD9A 2F4MA 2PMZA 2JIQA 4MH4A 3PO2I 1K732 4A3KI 3NDIA 1QVGZ 2VF1A 3PO3S 2AYDA 5A2Qb 2M6NA 3F3PC 5LL6f 3G71Z 1Z02A 1K8A2 4RVHA 2OTL1 1R9TI 5FLMI 1KC81 4E32A 3U50C 1Y1VI 2E2II 3TE5B 2DE7A 3CC2Z 4NH1C 3VMIA 3G6EZ 1Y1WI 1QF8A 1YJ9Z 4E33A 3CMEZ 3NFZA 4NFRA 1KD11 2H85A 3D9XA 1WCMI 1VQ7Z 3HOXI 2K3RA 1QVFZ 4BBRI 1VQ4Z 3CCEZ 2PM9A 1VQN1 2OTJ1 4RV9A 3HOYI 1RNIA 2F4OA 3OW2Y 4BBSI 3I561 1Q821 4A3MI 1Q862 5A2Qf 1YI21 2JA5I 1TWHI 1LQLA 2I3CA 3Q87A 1N2FA 3HOZI 3MZKB 2YU9I 1VQ61 3BG1B 4NB8A 3GTQI 1RO2A 4NBCA 4Y7NI 1JWHC 2DE5A 3HOUI 5C4JI 1VQ51 2V8IA 3J80b 1M901 4BXXI 3H0GI 1Q812 3CC71 4NBEA 2JA6I 3CCRZ 2QEX1 2M48A 4E2XA 2RHBA 1ZH1A 2ZAEB 1VQM1 2O4HA 4E2WA 4E30A 2YADA 1M1K2 2JUBA 3CC41 1K731 3TDHB 2JIPA 3CXCY 2QRCB 5T67A 3ESWA 1ZB8A 5D1PA 3CCLZ 3CCU1 1WW9A 3CCV1 3GTMI 1Q16A 3CXCZ 3CCMZ 2QRDB 1K8A1 2LIYA 1YJWZ 1VQKZ 1I6HI 1Q7Y2 1YIT1 2HF1A 4AYBA 1YUAA 4RVGA 2KPIA 3CCS1 3I07A 4BY1I 1VQLZ 4A3II 1JJ2Y 4NBHA 4XX2A 3JAMb 5FLXb 3I55Z 1S721 3G4SZ 2B63I 1Q861 1JJ2Z 1AA6A 3CC21 3CCQZ 1YJNZ 5CM2M 1P9NA 3GTOI 4MONA 2IZ3A 4DK1A 1YIJ1 3S2DI 2JR6A 1FDOA 1SFOI 3S14I 1K9M2 1QVFY 2QA41 3S16I 2Q4ZA 2E2JI 4A3GI 3J81f 2DE6A 5D1OA 2P28A 5D1OB 1ZB9A 3JAMf 5FLXf 3CMAZ 1Q811 3S15I 2JIRA 3FQMA 2E2HI 2E7ZA 2R7ZI 2JS4A 1M1K1 4A3DI 3S2HI 3EERA 3NH5A 3MONA 1TWCI 3CD61 1RLYA 2JIMA 1YHQ1 2JA7I 4TNUA 2JA8I 4CL1A 2VUMI 1WJ2A 4HH4A 2P3YA 2OTLZ 1I50I 2IV2X 4A3FI 3KIHA 2R6MA 2RIQA 1VQ91 1K83I 1L1OC 3VTNA 4E31A 3IF8A 4E2ZA 3IR7A 1Y8CA 2E9HA 3GTMS 3P5JB 1YUKA 1SIWA 1VQNZ 2OTJZ 4NBGA 1WIIA 2G2KA 2VPXA 1VQO1 3NH4A 2WAQA 4MD8A 5C3EI 1YI2Z 3GTGI 2Y0SA 3CCJ1 1VQP1 4A3EI 2PK7A 3S1NI 4Y52I 4NB9A 2IZ4A 3CQZI 3VB9A 1W2BY 3H3VJ 2RT9A 1ML8A 1VQ81 3D2LA 2NVXI 3HKZA 1VQ6Z 2RBLA 3I551 1K9M1 2OZKA 1Q822 2EGTA 5IP9I 1NUIA 2W04A 4HGZA 2K5RA 1X0TA 1W2BZ 1TWAI 4EWCA 3CCQ1 1YJN1 4NOZA 1RO0A 2QEXZ 3VMGA 2VPZA 4RVFA 3J81b 1NJI2 3HOVI 2QREB 3G711 4QTTA 3CC4Z 1Z01A 3S1MI 2NVQI 1I3QI 3GTLI 4X6AI 3G6E1 2OOXB 1Y1VS 1YJ91 3S1RI 1M902 2KI7B 3CME1 2O53A 3CCVZ 3GTKI 3CPWY 1VQ71 3QWUA 1VQ41 2W03A 4DGLA 3F3FC 3CCE1 3RZDI 2BJOA 1X3ZA 2GU2A 2V8KA 3CPWZ 1YITZ 1PFTA 4S1TA 3M3YI 4A3BI 3CCSZ 5IT9b 2V3VA 4A3LI 4MXUA 5AN9F 3VMHA 1S72Z 3I4MI 3GCFA 3S1QI 1N8R2 1X3WA 4NBFA 2Q51A 4DQYB 3PO3I 4MRIA 2JNYA 2NVTI 3BG0B 1YIJZ 2WB1A 3CCR1 4A93I 2QA4Z 3T4NB 1S7MA 3GKQA 4HGYA 1USPA 5IP7I 1USPB 2V45A 2QKDA 1Q7Y1 5IT9f 4NBAA 4MD7A 2AKLA 2GTHA 1QXFA 2LFUA 3KIFA 3OW2Z 3CCL1 1KQSY 1NJI1 2NVYI 1RO4A 3CCM1 2V8JA 3NH8A 3NDJA 3I56Z 1KC82 3J7A4 1YJW1 1VQK1 3CD6Z 3IFUA 1KQSZ 2JIOA 1KD12 1Z03A 1YHQZ 4BY7I 2QLVB 1NP6A 1RQFA 2JMOA 5C44I 2QR1B 1VLAA 4A3JI 2LEXA 4NBBA 1VQL1 1KRLA 3IX0A 2HU9A 5C4XI 2OOYB 2NAPA 3K7AI 1WZNA 3G4S1 1VQ9Z 1VQ5Z 2VPYA 4RVDA 1DL6A 3CC7Z 2VUGA 2RPRA 3S17I 2J6AA 1VQMZ 3EEDA 1VQOZ 3FKII 3GTPI 2R92I
chains in the Genus database with same CATH topology
1N8R1 3I4NI 3HOWI 4QTUA 3GTJI 3FQQA 4RS4A 3D6WA 3CCJZ 1VQPZ 3J80f 1QYPA 5T6BA 5T64A 3M4OI 4E2YA 3MZLB 3RZOI 1TFIA 3CCUZ 2R93I 3LUSA 1TWFI 1TWGI 4NBDA 4A3CI 1QVGY 3CMA1 1VQ8Z 2GTIA 4MD9A 2F4MA 2PMZA 4MH4A 3PO2I 1K732 4A3KI 3NDIA 1QVGZ 2VF1A 3PO3S 5A2Qb 2M6NA 3F3PC 5LL6f 3G71Z 1Z02A 1K8A2 4RVHA 2OTL1 1R9TI 5FLMI 1KC81 4E32A 3U50C 1Y1VI 2E2II 3TE5B 2DE7A 4NH1C 3VMIA 3G6EZ 3CC2Z 1Y1WI 1QF8A 1YJ9Z 4E33A 3CMEZ 3NFZA 4NFRA 1KD11 2H85A 3D9XA 1WCMI 1VQ7Z 3HOXI 2K3RA 1QVFZ 4BBRI 1VQ4Z 3CCEZ 2PM9A 1VQN1 2OTJ1 4RV9A 3HOYI 1RNIA 2F4OA 3OW2Y 4BBSI 3I561 1Q821 4A3MI 1Q862 5A2Qf 1YI21 2JA5I 1TWHI 1LQLA 2I3CA 3Q87A 1N2FA 3HOZI 3MZKB 2YU9I 1VQ61 3BG1B 4NB8A 3GTQI 1RO2A 4NBCA 4Y7NI 1JWHC 2DE5A 3HOUI 5C4JI 1VQ51 2V8IA 3J80b 1M901 4BXXI 3H0GI 1Q812 3CC71 4NBEA 2JA6I 3CCRZ 2QEX1 2M48A 4E2XA 2RHBA 1ZH1A 2ZAEB 1VQM1 2O4HA 4E2WA 4E30A 2YADA 1M1K2 2JUBA 3CC41 1K731 3TDHB 3CXCY 2QRCB 5T67A 3ESWA 1ZB8A 5D1PA 3CCLZ 3CCU1 1WW9A 3CCV1 3GTMI 3CXCZ 3CCMZ 2QRDB 1K8A1 2LIYA 1YJWZ 1VQKZ 1I6HI 1Q7Y2 1YIT1 2HF1A 4AYBA 1YUAA 4RVGA 2KPIA 3CCS1 3I07A 4BY1I 1VQLZ 4A3II 1JJ2Y 4NBHA 4XX2A 3JAMb 5FLXb 3I55Z 1S721 3G4SZ 2B63I 1Q861 1JJ2Z 3CC21 3CCQZ 1YJNZ 5CM2M 1P9NA 3GTOI 4MONA 2IZ3A 4DK1A 1YIJ1 3S2DI 2JR6A 1SFOI 3S14I 1K9M2 1QVFY 2QA41 3S16I 2Q4ZA 2E2JI 4A3GI 3J81f 2DE6A 5D1OA 2P28A 5D1OB 1ZB9A 3JAMf 5FLXf 3CMAZ 1Q811 3S15I 3FQMA 2E2HI 2R7ZI 2JS4A 1M1K1 4A3DI 3S2HI 3EERA 3NH5A 3MONA 1TWCI 3CD61 1RLYA 1YHQ1 2JA7I 4TNUA 2JA8I 4CL1A 2VUMI 4HH4A 2P3YA 2OTLZ 1I50I 4A3FI 3KIHA 2R6MA 2RIQA 1VQ91 1K83I 1L1OC 3VTNA 4E31A 3IF8A 4E2ZA 2E9HA 3GTMS 3P5JB 1YUKA 1VQNZ 2OTJZ 4NBGA 1WIIA 2G2KA 1VQO1 3NH4A 2WAQA 4MD8A 5C3EI 1YI2Z 3GTGI 2Y0SA 3CCJ1 1VQP1 4A3EI 2PK7A 3S1NI 4Y52I 4NB9A 2IZ4A 3CQZI 3VB9A 1W2BY 3H3VJ 2RT9A 1ML8A 1VQ81 2NVXI 3HKZA 1VQ6Z 2RBLA 3I551 1K9M1 2OZKA 1Q822 2EGTA 5IP9I 1NUIA 2W04A 4HGZA 2K5RA 1X0TA 1W2BZ 1TWAI 4EWCA 3CCQ1 1YJN1 4NOZA 1RO0A 2QEXZ 3VMGA 4RVFA 3J81b 1NJI2 3HOVI 2QREB 3G711 4QTTA 3CC4Z 1Z01A 3S1MI 2NVQI 1I3QI 3GTLI 4X6AI 3G6E1 2OOXB 1Y1VS 1YJ91 3S1RI 1M902 2KI7B 3CME1 2O53A 3CCVZ 3GTKI 3CPWY 1VQ71 3QWUA 1VQ41 2W03A 4DGLA 3F3FC 3CCE1 3RZDI 2BJOA 1X3ZA 2GU2A 2V8KA 3CPWZ 1YITZ 1PFTA 4S1TA 3M3YI 4A3BI 3CCSZ 5IT9b 4A3LI 4MXUA 5AN9F 3VMHA 1S72Z 3I4MI 3GCFA 3S1QI 1N8R2 1X3WA 4NBFA 2Q51A 4DQYB 3PO3I 4MRIA 2JNYA 2NVTI 3BG0B 1YIJZ 2WB1A 3CCR1 4A93I 2QA4Z 3T4NB 1S7MA 3GKQA 4HGYA 1USPA 5IP7I 1USPB 2QKDA 1Q7Y1 5IT9f 4NBAA 4MD7A 2AKLA 2GTHA 2LFUA 3KIFA 3OW2Z 3CCL1 1KQSY 1NJI1 2NVYI 1RO4A 3CCM1 2V8JA 3NH8A 3NDJA 3I56Z 1KC82 3J7A4 1YJW1 1VQK1 3CD6Z 3IFUA 1KQSZ 1KD12 1Z03A 1YHQZ 4BY7I 2QLVB 1NP6A 1RQFA 2JMOA 5C44I 2QR1B 1VLAA 4A3JI 4NBBA 1VQL1 1KRLA 3IX0A 2HU9A 5C4XI 2OOYB 3K7AI 3G4S1 1VQ9Z 1VQ5Z 4RVDA 1DL6A 3CC7Z 2VUGA 2RPRA 3S17I 2J6AA 1VQMZ 3EEDA 1VQOZ 3FKII 3GTPI 2R92I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N I;  3HOW I;  4QTU A;  3GTJ I;  3M3Y I;  2JA8 I;  4A3B I;  3D6W A;  2VUM I;  1QYP A;  3M4O I;  2P3Y A;  1I50 I;  4A3L I;  3RZO I;  1TFI A;  2R93 I;  3LUS A;  1TWF I;  4A3F I;  3VMH A;  1TWG I;  3I4M I;  3ESW A;  3GCF A;  4NBD A;  3S1Q I;  4A3C I;  1ZB8 A;  1X3W A;  4NBF A;  1K83 I;  1WW9 A;  3GTM I;  1L1O C;  2F4M A;  3PO3 I;  4MH4 A;  3PO2 I;  4A3K I;  3GTM S;  2JNY A;  1I6H I;  2NVT I;  4NBG A;  3PO3 S;  2HF1 A;  5C3E I;  3GTG I;  4A93 I;  1YUA A;  2KPI A;  3I07 A;  4BY1 I;  3GKQ A;  1USP A;  4A3E I;  5IP7 I;  4NBH A;  1USP B;  4A3I I;  4XX2 A;  1R9T I;  2PK7 A;  5FLM I;  3S1N I;  4Y52 I;  3U50 C;  4NBA A;  4NB9 A;  3CQZ I;  1Y1V I;  2AKL A;  2E2I I;  2DE7 A;  3VMI A;  1Y1W I;  3VB9 A;  3H3V J;  1ML8 A;  2B63 I;  2NVX I;  1WCM I;  2RBL A;  3HOX I;  2NVY I;  5IP9 I;  1RO4 A;  4BBR I;  1NUI A;  5CM2 M;  2K5R A;  3GTO I;  1TWA I;  3HOY I;  2F4O A;  4BBS I;  4NOZ A;  3S2D I;  3VMG A;  2JR6 A;  4A3M I;  4BY7 I;  1SFO I;  3S14 I;  5C44 I;  3HOV I;  1VLA A;  2JA5 I;  4A3J I;  3S16 I;  4QTT A;  4NBB A;  2E2J I;  4A3G I;  1TWH I;  3S1M I;  5C4X I;  1LQL A;  2NVQ I;  1I3Q I;  3GTL I;  2DE6 A;  3Q87 A;  4X6A I;  3K7A I;  1N2F A;  1ZB9 A;  1Y1V S;  3S1R I;  3S15 I;  3HOZ I;  2E2H I;  3GTK I;  2YU9 I;  4NB8 A;  3GTQ I;  4NBC A;  2JS4 A;  4Y7N I;  2R7Z I;  1DL6 A;  2DE5 A;  3HOU I;  3EER A;  3S2H I;  4A3D I;  3RZD I;  2BJO A;  3S17 I;  2J6A A;  5C4J I;  1TWC I;  1X3Z A;  4BXX I;  3H0G I;  1RLY A;  3FKI I;  4NBE A;  3GTP I;  2JA6 I;  2R92 I;  1PFT A;  2JA7 I; 
#chains in the Genus database with same CATH topology
 1N8R 1;  3I4N I;  3HOW I;  4QTU A;  3GTJ I;  3FQQ A;  4RS4 A;  3D6W A;  3CCJ Z;  1VQP Z;  3J80 f;  1QYP A;  5T6B A;  5T64 A;  3M4O I;  2VPW A;  4E2Y A;  3MZL B;  3RZO I;  1TFI A;  3CCU Z;  2R93 I;  3LUS A;  1TWF I;  1TWG I;  4NBD A;  4A3C I;  1QVG Y;  3CMA 1;  1VQ8 Z;  1FDI A;  2GTI A;  4MD9 A;  2F4M A;  2PMZ A;  2JIQ A;  4MH4 A;  3PO2 I;  1K73 2;  4A3K I;  3NDI A;  1QVG Z;  2VF1 A;  3PO3 S;  2AYD A;  5A2Q b;  2M6N A;  3F3P C;  5LL6 f;  3G71 Z;  1Z02 A;  1K8A 2;  4RVH A;  2OTL 1;  1R9T I;  5FLM I;  1KC8 1;  4E32 A;  3U50 C;  1Y1V I;  2E2I I;  3TE5 B;  2DE7 A;  3CC2 Z;  4NH1 C;  3VMI A;  3G6E Z;  1Y1W I;  1QF8 A;  1YJ9 Z;  4E33 A;  3CME Z;  3NFZ A;  4NFR A;  1KD1 1;  2H85 A;  3D9X A;  1WCM I;  1VQ7 Z;  3HOX I;  2K3R A;  1QVF Z;  4BBR I;  1VQ4 Z;  3CCE Z;  2PM9 A;  1VQN 1;  2OTJ 1;  4RV9 A;  3HOY I;  1RNI A;  2F4O A;  3OW2 Y;  4BBS I;  3I56 1;  1Q82 1;  4A3M I;  1Q86 2;  5A2Q f;  1YI2 1;  2JA5 I;  1TWH I;  1LQL A;  2I3C A;  3Q87 A;  1N2F A;  3HOZ I;  3MZK B;  2YU9 I;  1VQ6 1;  3BG1 B;  4NB8 A;  3GTQ I;  1RO2 A;  4NBC A;  4Y7N I;  1JWH C;  2DE5 A;  3HOU I;  5C4J I;  1VQ5 1;  2V8I A;  3J80 b;  1M90 1;  4BXX I;  3H0G I;  1Q81 2;  3CC7 1;  4NBE A;  2JA6 I;  3CCR Z;  2QEX 1;  2M48 A;  4E2X A;  2RHB A;  1ZH1 A;  2ZAE B;  1VQM 1;  2O4H A;  4E2W A;  4E30 A;  2YAD A;  1M1K 2;  2JUB A;  3CC4 1;  1K73 1;  3TDH B;  2JIP A;  3CXC Y;  2QRC B;  5T67 A;  3ESW A;  1ZB8 A;  5D1P A;  3CCL Z;  3CCU 1;  1WW9 A;  3CCV 1;  3GTM I;  1Q16 A;  3CXC Z;  3CCM Z;  2QRD B;  1K8A 1;  2LIY A;  1YJW Z;  1VQK Z;  1I6H I;  1Q7Y 2;  1YIT 1;  2HF1 A;  4AYB A;  1YUA A;  4RVG A;  2KPI A;  3CCS 1;  3I07 A;  4BY1 I;  1VQL Z;  4A3I I;  1JJ2 Y;  4NBH A;  4XX2 A;  3JAM b;  5FLX b;  3I55 Z;  1S72 1;  3G4S Z;  2B63 I;  1Q86 1;  1JJ2 Z;  1AA6 A;  3CC2 1;  3CCQ Z;  1YJN Z;  5CM2 M;  1P9N A;  3GTO I;  4MON A;  2IZ3 A;  4DK1 A;  1YIJ 1;  3S2D I;  2JR6 A;  1FDO A;  1SFO I;  3S14 I;  1K9M 2;  1QVF Y;  2QA4 1;  3S16 I;  2Q4Z A;  2E2J I;  4A3G I;  3J81 f;  2DE6 A;  5D1O A;  2P28 A;  5D1O B;  1ZB9 A;  3JAM f;  5FLX f;  3CMA Z;  1Q81 1;  3S15 I;  2JIR A;  3FQM A;  2E2H I;  2E7Z A;  2R7Z I;  2JS4 A;  1M1K 1;  4A3D I;  3S2H I;  3EER A;  3NH5 A;  3MON A;  1TWC I;  3CD6 1;  1RLY A;  2JIM A;  1YHQ 1;  2JA7 I;  4TNU A;  2JA8 I;  4CL1 A;  2VUM I;  1WJ2 A;  4HH4 A;  2P3Y A;  2OTL Z;  1I50 I;  2IV2 X;  4A3F I;  3KIH A;  2R6M A;  2RIQ A;  1VQ9 1;  1K83 I;  1L1O C;  3VTN A;  4E31 A;  3IF8 A;  4E2Z A;  3IR7 A;  1Y8C A;  2E9H A;  3GTM S;  3P5J B;  1YUK A;  1SIW A;  1VQN Z;  2OTJ Z;  4NBG A;  1WII A;  2G2K A;  2VPX A;  1VQO 1;  3NH4 A;  2WAQ A;  4MD8 A;  5C3E I;  1YI2 Z;  3GTG I;  2Y0S A;  3CCJ 1;  1VQP 1;  4A3E I;  2PK7 A;  3S1N I;  4Y52 I;  4NB9 A;  2IZ4 A;  3CQZ I;  3VB9 A;  1W2B Y;  3H3V J;  2RT9 A;  1ML8 A;  1VQ8 1;  3D2L A;  2NVX I;  3HKZ A;  1VQ6 Z;  2RBL A;  3I55 1;  1K9M 1;  2OZK A;  1Q82 2;  2EGT A;  5IP9 I;  1NUI A;  2W04 A;  4HGZ A;  2K5R A;  1X0T A;  1W2B Z;  1TWA I;  4EWC A;  3CCQ 1;  1YJN 1;  4NOZ A;  1RO0 A;  2QEX Z;  3VMG A;  2VPZ A;  4RVF A;  3J81 b;  1NJI 2;  3HOV I;  2QRE B;  3G71 1;  4QTT A;  3CC4 Z;  1Z01 A;  3S1M I;  2NVQ I;  1I3Q I;  3GTL I;  4X6A I;  3G6E 1;  2OOX B;  1Y1V S;  1YJ9 1;  3S1R I;  1M90 2;  2KI7 B;  3CME 1;  2O53 A;  3CCV Z;  3GTK I;  3CPW Y;  1VQ7 1;  3QWU A;  1VQ4 1;  2W03 A;  4DGL A;  3F3F C;  3CCE 1;  3RZD I;  2BJO A;  1X3Z A;  2GU2 A;  2V8K A;  3CPW Z;  1YIT Z;  1PFT A;  4S1T A;  3M3Y I;  4A3B I;  3CCS Z;  5IT9 b;  2V3V A;  4A3L I;  4MXU A;  5AN9 F;  3VMH A;  1S72 Z;  3I4M I;  3GCF A;  3S1Q I;  1N8R 2;  1X3W A;  4NBF A;  2Q51 A;  4DQY B;  3PO3 I;  4MRI A;  2JNY A;  2NVT I;  3BG0 B;  1YIJ Z;  2WB1 A;  3CCR 1;  4A93 I;  2QA4 Z;  3T4N B;  1S7M A;  3GKQ A;  4HGY A;  1USP A;  5IP7 I;  1USP B;  2V45 A;  2QKD A;  1Q7Y 1;  5IT9 f;  4NBA A;  4MD7 A;  2AKL A;  2GTH A;  1QXF A;  2LFU A;  3KIF A;  3OW2 Z;  3CCL 1;  1KQS Y;  1NJI 1;  2NVY I;  1RO4 A;  3CCM 1;  2V8J A;  3NH8 A;  3NDJ A;  3I56 Z;  1KC8 2;  3J7A 4;  1YJW 1;  1VQK 1;  3CD6 Z;  3IFU A;  1KQS Z;  2JIO A;  1KD1 2;  1Z03 A;  1YHQ Z;  4BY7 I;  2QLV B;  1NP6 A;  1RQF A;  2JMO A;  5C44 I;  2QR1 B;  1VLA A;  4A3J I;  2LEX A;  4NBB A;  1VQL 1;  1KRL A;  3IX0 A;  2HU9 A;  5C4X I;  2OOY B;  2NAP A;  3K7A I;  1WZN A;  3G4S 1;  1VQ9 Z;  1VQ5 Z;  2VPY A;  4RVD A;  1DL6 A;  3CC7 Z;  2VUG A;  2RPR A;  3S17 I;  2J6A A;  1VQM Z;  3EED A;  1VQO Z;  3FKI I;  3GTP I;  2R92 I; 
#chains in the Genus database with same CATH homology
 1N8R 1;  3I4N I;  3HOW I;  4QTU A;  3GTJ I;  3FQQ A;  4RS4 A;  3D6W A;  3CCJ Z;  1VQP Z;  3J80 f;  1QYP A;  5T6B A;  5T64 A;  3M4O I;  4E2Y A;  3MZL B;  3RZO I;  1TFI A;  3CCU Z;  2R93 I;  3LUS A;  1TWF I;  1TWG I;  4NBD A;  4A3C I;  1QVG Y;  3CMA 1;  1VQ8 Z;  2GTI A;  4MD9 A;  2F4M A;  2PMZ A;  4MH4 A;  3PO2 I;  1K73 2;  4A3K I;  3NDI A;  1QVG Z;  2VF1 A;  3PO3 S;  5A2Q b;  2M6N A;  3F3P C;  5LL6 f;  3G71 Z;  1Z02 A;  1K8A 2;  4RVH A;  2OTL 1;  1R9T I;  5FLM I;  1KC8 1;  4E32 A;  3U50 C;  1Y1V I;  2E2I I;  3TE5 B;  2DE7 A;  4NH1 C;  3VMI A;  3G6E Z;  3CC2 Z;  1Y1W I;  1QF8 A;  1YJ9 Z;  4E33 A;  3CME Z;  3NFZ A;  4NFR A;  1KD1 1;  2H85 A;  3D9X A;  1WCM I;  1VQ7 Z;  3HOX I;  2K3R A;  1QVF Z;  4BBR I;  1VQ4 Z;  3CCE Z;  2PM9 A;  1VQN 1;  2OTJ 1;  4RV9 A;  3HOY I;  1RNI A;  2F4O A;  3OW2 Y;  4BBS I;  3I56 1;  1Q82 1;  4A3M I;  1Q86 2;  5A2Q f;  1YI2 1;  2JA5 I;  1TWH I;  1LQL A;  2I3C A;  3Q87 A;  1N2F A;  3HOZ I;  3MZK B;  2YU9 I;  1VQ6 1;  3BG1 B;  4NB8 A;  3GTQ I;  1RO2 A;  4NBC A;  4Y7N I;  1JWH C;  2DE5 A;  3HOU I;  5C4J I;  1VQ5 1;  2V8I A;  3J80 b;  1M90 1;  4BXX I;  3H0G I;  1Q81 2;  3CC7 1;  4NBE A;  2JA6 I;  3CCR Z;  2QEX 1;  2M48 A;  4E2X A;  2RHB A;  1ZH1 A;  2ZAE B;  1VQM 1;  2O4H A;  4E2W A;  4E30 A;  2YAD A;  1M1K 2;  2JUB A;  3CC4 1;  1K73 1;  3TDH B;  3CXC Y;  2QRC B;  5T67 A;  3ESW A;  1ZB8 A;  5D1P A;  3CCL Z;  3CCU 1;  1WW9 A;  3CCV 1;  3GTM I;  3CXC Z;  3CCM Z;  2QRD B;  1K8A 1;  2LIY A;  1YJW Z;  1VQK Z;  1I6H I;  1Q7Y 2;  1YIT 1;  2HF1 A;  4AYB A;  1YUA A;  4RVG A;  2KPI A;  3CCS 1;  3I07 A;  4BY1 I;  1VQL Z;  4A3I I;  1JJ2 Y;  4NBH A;  4XX2 A;  3JAM b;  5FLX b;  3I55 Z;  1S72 1;  3G4S Z;  2B63 I;  1Q86 1;  1JJ2 Z;  3CC2 1;  3CCQ Z;  1YJN Z;  5CM2 M;  1P9N A;  3GTO I;  4MON A;  2IZ3 A;  4DK1 A;  1YIJ 1;  3S2D I;  2JR6 A;  1SFO I;  3S14 I;  1K9M 2;  1QVF Y;  2QA4 1;  3S16 I;  2Q4Z A;  2E2J I;  4A3G I;  3J81 f;  2DE6 A;  5D1O A;  2P28 A;  5D1O B;  1ZB9 A;  3JAM f;  5FLX f;  3CMA Z;  1Q81 1;  3S15 I;  3FQM A;  2E2H I;  2R7Z I;  2JS4 A;  1M1K 1;  4A3D I;  3S2H I;  3EER A;  3NH5 A;  3MON A;  1TWC I;  3CD6 1;  1RLY A;  1YHQ 1;  2JA7 I;  4TNU A;  2JA8 I;  4CL1 A;  2VUM I;  4HH4 A;  2P3Y A;  2OTL Z;  1I50 I;  4A3F I;  3KIH A;  2R6M A;  2RIQ A;  1VQ9 1;  1K83 I;  1L1O C;  3VTN A;  4E31 A;  3IF8 A;  4E2Z A;  2E9H A;  3GTM S;  3P5J B;  1YUK A;  1VQN Z;  2OTJ Z;  4NBG A;  1WII A;  2G2K A;  1VQO 1;  3NH4 A;  2WAQ A;  4MD8 A;  5C3E I;  1YI2 Z;  3GTG I;  2Y0S A;  3CCJ 1;  1VQP 1;  4A3E I;  2PK7 A;  3S1N I;  4Y52 I;  4NB9 A;  2IZ4 A;  3CQZ I;  3VB9 A;  1W2B Y;  3H3V J;  2RT9 A;  1ML8 A;  1VQ8 1;  2NVX I;  3HKZ A;  1VQ6 Z;  2RBL A;  3I55 1;  1K9M 1;  2OZK A;  1Q82 2;  2EGT A;  5IP9 I;  1NUI A;  2W04 A;  4HGZ A;  2K5R A;  1X0T A;  1W2B Z;  1TWA I;  4EWC A;  3CCQ 1;  1YJN 1;  4NOZ A;  1RO0 A;  2QEX Z;  3VMG A;  4RVF A;  3J81 b;  1NJI 2;  3HOV I;  2QRE B;  3G71 1;  4QTT A;  3CC4 Z;  1Z01 A;  3S1M I;  2NVQ I;  1I3Q I;  3GTL I;  4X6A I;  3G6E 1;  2OOX B;  1Y1V S;  1YJ9 1;  3S1R I;  1M90 2;  2KI7 B;  3CME 1;  2O53 A;  3CCV Z;  3GTK I;  3CPW Y;  1VQ7 1;  3QWU A;  1VQ4 1;  2W03 A;  4DGL A;  3F3F C;  3CCE 1;  3RZD I;  2BJO A;  1X3Z A;  2GU2 A;  2V8K A;  3CPW Z;  1YIT Z;  1PFT A;  4S1T A;  3M3Y I;  4A3B I;  3CCS Z;  5IT9 b;  4A3L I;  4MXU A;  5AN9 F;  3VMH A;  1S72 Z;  3I4M I;  3GCF A;  3S1Q I;  1N8R 2;  1X3W A;  4NBF A;  2Q51 A;  4DQY B;  3PO3 I;  4MRI A;  2JNY A;  2NVT I;  3BG0 B;  1YIJ Z;  2WB1 A;  3CCR 1;  4A93 I;  2QA4 Z;  3T4N B;  1S7M A;  3GKQ A;  4HGY A;  1USP A;  5IP7 I;  1USP B;  2QKD A;  1Q7Y 1;  5IT9 f;  4NBA A;  4MD7 A;  2AKL A;  2GTH A;  2LFU A;  3KIF A;  3OW2 Z;  3CCL 1;  1KQS Y;  1NJI 1;  2NVY I;  1RO4 A;  3CCM 1;  2V8J A;  3NH8 A;  3NDJ A;  3I56 Z;  1KC8 2;  3J7A 4;  1YJW 1;  1VQK 1;  3CD6 Z;  3IFU A;  1KQS Z;  1KD1 2;  1Z03 A;  1YHQ Z;  4BY7 I;  2QLV B;  1NP6 A;  1RQF A;  2JMO A;  5C44 I;  2QR1 B;  1VLA A;  4A3J I;  4NBB A;  1VQL 1;  1KRL A;  3IX0 A;  2HU9 A;  5C4X I;  2OOY B;  3K7A I;  3G4S 1;  1VQ9 Z;  1VQ5 Z;  4RVD A;  1DL6 A;  3CC7 Z;  2VUG A;  2RPR A;  3S17 I;  2J6A A;  1VQM Z;  3EED A;  1VQO Z;  3FKI I;  3GTP I;  2R92 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...