4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
3S15I 1DL6A 2JS4A 3S2HI 4BY7I 4Y52I 3ESWA 4QTUA 2J6AA 3Q87A 2NVTI 4A3CI 1Y1VI 4NBGA 1NUIA 3I4NI 1TFIA 4A3FI 1ZB8A 3VB9A 2DE5A 2PK7A 4BBRI 3PO3S 3GTJI 2R92I 3S14I 3D6WA 4A3JI 1Y1VS 2R93I 3CQZI 5C3EI 3HOUI 1ZB9A 3GTOI 3S16I 3HOZI 5C44I 3K7AI 5C4JI 2JR6A 4NBFA 1X3ZA 3PO2I 1TWGI 1K83I 1PFTA 2NVQI 1USPA 3GCFA 3M4OI 2JNYA 1Y1WI 4A3BI 4A93I 2P3YA 2NVXI 3GTMI 3EERA 4NBAA 1RLYA 1SFOI 2RBLA 5C4XI 3PO3I 2F4OA 2E2II 3GKQA 2R7ZI 3GTKI 4NBCA 3H0GI 3LUSA 4BBSI 1TWAI 4MH4A 3S17I 3U50C 3GTMS 2HF1A 3VMIA 1USPB 4XX2A 3S1MI 3I07A 3HOXI 2K5RA 1RO4A 4A3EI 4NBHA 3GTQI 2JA7I 1L1OC 1I50I 1LQLA 4NBDA 2DE7A 3S1NI 1I3QI 1TWFI 2E2HI 2F4MA 2DE6A 4NBEA 2JA5I 4QTTA 2B63I 4NB9A 2VUMI 1N2FA 3GTLI 1YUAA 1R9TI 4NOZA 3S1QI 2JA8I 4A3KI 4A3GI 1X3WA 3M3YI 2AKLA 1ML8A 3S2DI 4A3DI 2JA6I 3RZOI 4X6AI 1QYPA 2NVYI 3VMHA 3I4MI 2KPIA 3HOYI 1TWCI 1I6HI 5IP7I 3VMGA 2YU9I 3H3VJ 2BJOA 3GTPI 5CM2M 5IP9I 4Y7NI 3HOVI 3FKII 4A3II 4A3LI 3HOWI 4NB8A 4BXXI 1TWHI 1WCMI 1WW9A 3GTGI 1VLAA 4BY1I 3S1RI 5FLMI 4A3MI 3RZDI 4NBBA 2E2JI
chains in the Genus database with same CATH superfamily
2JS4A 1KQSY 3I551 3ESWA 3CCMZ 4QTUA 2GU2A 1S721 3NH8A 5D1OB 3NH5A 1K8A1 1NUIA 2KI7B 3NDIA 1KD12 3VB9A 1YITZ 1RO2A 3PO3S 2JIRA 3TDHB 1N8R2 2WB1A 3CCEZ 1VQM1 2G2KA 1M902 3HOZI 3JAMf 5C44I 3K7AI 3PO2I 5T6BA 3BG1B 1PFTA 3OW2Z 1YJNZ 4HGZA 2NVQI 1USPA 3M4OI 1YUKA 4AYBA 4DGLA 3EERA 3P5JB 3IF8A 5C4XI 4NH1C 3J81b 3G71Z 2PM9A 2I3CA 1VQ41 2F4OA 1YHQZ 3LUSA 3NFZA 2OTJ1 1NP6A 1TWAI 2JIPA 1USPB 3VMIA 4XX2A 3HOXI 3IFUA 4MD7A 4E2XA 4NBHA 1YI2Z 3KIHA 2DE7A 1TWFI 1QVGZ 2F4MA 2V8IA 1Q862 3CXCZ 1M901 1W2BY 3CXCY 2QEXZ 3CC21 3CCSZ 1YJWZ 1VQ61 2AYDA 1X0TA 1VQK1 1W2BZ 3G4SZ 1YJ91 4MD9A 1VQKZ 4A3DI 3RZOI 1VQ71 2JIOA 5A2Qf 1QYPA 4RVHA 3I4MI 5T67A 2RIQA 1S72Z 4MXUA 3CCQZ 1WZNA 3FQMA 4E2YA 3I561 2BJOA 3CC7Z 3CD61 3F3PC 3FQQA 3T4NB 2Y0SA 1QXFA 3CCE1 2LIYA 1WW9A 1Y8CA 1VLAA 2R6MA 4BY1I 3S1RI 4E2ZA 1VQN1 2VPYA 3S2HI 3TE5B 4BY7I 2J6AA 3CCRZ 4A3CI 1Y1VI 4NBGA 3NH4A 3CCUZ 3I4NI 5IT9f 4A3FI 2ZAEB 2WAQA 3CCVZ 5IT9b 3CCU1 2R93I 3CQZI 3CCR1 1Q811 3CME1 1S7MA 3EEDA 1X3ZA 1QVFZ 1VQMZ 3GTMI 2Q51A 1VQ7Z 3PO3I 2V45A 3CCLZ 2OOXB 3CC2Z 3CCS1 1YJW1 3H0GI 2OTJZ 4MH4A 3GTMS 2HF1A 2QR1B 3S1MI 3CCL1 3CCJ1 1RO4A 1K731 3D2LA 1VQ5Z 4A3EI 5LL6f 1I50I 1LQLA 1VQL1 4RVGA 3S1NI 1I3QI 5FLXb 4NB9A 2VUMI 1N2FA 1ZH1A 3GTLI 1NJI1 3G6EZ 1K732 2JIMA 3G4S1 2OOYB 3OW2Y 4A3GI 2IV2X 1ML8A 3S2DI 1VQ6Z 2JA6I 2M48A 4X6AI 2KPIA 1RNIA 1K9M1 1I6HI 5IP7I 2RHBA 3VMGA 2YU9I 5CM2M 2V8JA 3HOVI 1KQSZ 4MONA 4A3II 2EGTA 4BXXI 3GTGI 1Z01A 2E2JI 1Q861 2QKDA 1YJN1 3S15I 3CC4Z 3J80b 3CCM1 3Q87A 2NVTI 1VQNZ 1JJ2Y 1YIJZ 1ZB8A 3G711 4MRIA 1FDOA 4BBRI 1QVGY 1WJ2A 3D6WA 4RVFA 4A3JI 1Y1VS 4E30A 2IZ4A 4TNUA 5C3EI 4DK1A 3GTOI 3S16I 1Q822 4E33A 1KRLA 2JR6A 4NBFA 2H85A 3GCFA 2JNYA 2QRDB 1Z03A 2NVXI 2NAPA 2JMOA 1RLYA 2VPXA 1FDIA 2RBLA 3CCV1 1YIT1 2E2II 2R7ZI 1KD11 3GTKI 3CCQ1 1Q821 2GTHA 1YHQ1 3S17I 2LEXA 2QREB 3I07A 1N8R1 1VQ4Z 1Q812 3GTQI 1QVFY 2JA7I 3MZLB 3IR7A 2QA4Z 1M1K1 3MONA 4NBDA 4EWCA 2VUGA 4DQYB 2IZ3A 4CL1A 2JA5I 2OTL1 1K9M2 2P28A 1YI21 4RVDA 1VQLZ 1YUAA 1R9TI 3S1QI 2JA8I 2JIQA 3CPWZ 2PMZA 1Z02A 1X3WA 3M3YI 2AKLA 3CPWY 4HGYA 2QEX1 2NVYI 3VMHA 1M1K2 3HOYI 1TWCI 1Q7Y1 3GTPI 4E32A 3FKII 2QA41 2VF1A 3HKZA 4HH4A 1TWHI 1WCMI 2M6NA 1VQ51 2YADA 4A3MI 3CD6Z 4NBBA 1RQFA 3BG0B 1VQ8Z 1DL6A 5D1PA 4Y52I 3JAMb 3CMEZ 3I55Z 1VQOZ 1Q7Y2 3F3FC 1TFIA 1Q16A 2VPZA 2DE5A 2PK7A 3GTJI 2R92I 3S14I 1SIWA 3HOUI 1ZB9A 1VQP1 3CC41 5C4JI 2W03A 1TWGI 1WIIA 1K83I 2RPRA 3CMAZ 5D1OA 3D9XA 1Y1WI 4A3BI 4A93I 2P3YA 2RT9A 4NBAA 4NFRA 4RV9A 2QRCB 1SFOI 1JJ2Z 1YJ9Z 2JUBA 3IX0A 3G6E1 3GKQA 3CC71 2QLVB 1VQO1 4NBCA 4BBSI 5FLXf 3U50C 2E7ZA 4S1TA 3KIFA 2K5RA 2O4HA 5AN9F 1VQ91 3NDJA 1P9NA 1KC81 5A2Qb 1JWHC 1L1OC 2HU9A 2LFUA 2O53A 2V3VA 4MD8A 4E31A 5T64A 3I56Z 2E2HI 2GTIA 2DE6A 4NBEA 2B63I 4QTTA 2VPWA 1VQPZ 1NJI2 1KC82 4NOZA 1QF8A 2V8KA 3MZKB 2W04A 2OZKA 1VQ9Z 3J81f 1AA6A 4A3KI 3QWUA 1YIJ1 2K3RA 3VTNA 4RS4A 1RO0A 2OTLZ 3CMA1 1VQ81 3H3VJ 2Q4ZA 1K8A2 3J7A4 5IP9I 4Y7NI 4A3LI 3HOWI 4NB8A 3J80f 2E9HA 5FLMI 3RZDI 4E2WA 3CCJZ
chains in the Genus database with same CATH topology
2JS4A 1KQSY 3I551 3ESWA 3CCMZ 4QTUA 2GU2A 1S721 3NH8A 5D1OB 3NH5A 1K8A1 1NUIA 2KI7B 3NDIA 1KD12 3VB9A 1YITZ 1RO2A 3PO3S 3TDHB 1N8R2 2WB1A 3CCEZ 1VQM1 2G2KA 1M902 3HOZI 3JAMf 5C44I 3K7AI 3PO2I 5T6BA 3BG1B 1PFTA 3OW2Z 1YJNZ 4HGZA 2NVQI 1USPA 3M4OI 1YUKA 4AYBA 4DGLA 3EERA 3P5JB 3IF8A 5C4XI 4NH1C 3J81b 3G71Z 2PM9A 2I3CA 1VQ41 2F4OA 1YHQZ 3LUSA 3NFZA 2OTJ1 1NP6A 1TWAI 3VMIA 1USPB 4XX2A 3HOXI 3IFUA 4MD7A 4E2XA 4NBHA 1YI2Z 3KIHA 2DE7A 1TWFI 1QVGZ 2F4MA 2V8IA 1Q862 3CXCZ 1M901 1W2BY 3CXCY 2QEXZ 3CC21 3CCSZ 1YJWZ 1VQ61 1X0TA 1VQK1 1W2BZ 3G4SZ 1YJ91 4MD9A 1VQKZ 4A3DI 3RZOI 1VQ71 5A2Qf 1QYPA 4RVHA 3I4MI 5T67A 2RIQA 1S72Z 4MXUA 3CCQZ 3FQMA 4E2YA 3I561 2BJOA 3CC7Z 3CD61 3F3PC 3FQQA 3T4NB 2Y0SA 3CCE1 2LIYA 1WW9A 1VLAA 2R6MA 4BY1I 3S1RI 4E2ZA 1VQN1 3S2HI 3TE5B 4BY7I 2J6AA 3CCRZ 4A3CI 1Y1VI 4NBGA 3NH4A 3CCUZ 3I4NI 5IT9f 4A3FI 2ZAEB 2WAQA 3CCVZ 5IT9b 3CCU1 2R93I 3CQZI 3CCR1 1Q811 3CME1 1S7MA 3EEDA 1X3ZA 1QVFZ 1VQMZ 3GTMI 2Q51A 1VQ7Z 3PO3I 3CCLZ 2OOXB 3CC2Z 3CCS1 1YJW1 3H0GI 2OTJZ 4MH4A 3GTMS 2HF1A 2QR1B 3S1MI 3CCL1 3CCJ1 1RO4A 1K731 1VQ5Z 4A3EI 5LL6f 1I50I 1LQLA 1VQL1 4RVGA 3S1NI 1I3QI 5FLXb 4NB9A 2VUMI 1N2FA 1ZH1A 3GTLI 1NJI1 3G6EZ 1K732 3G4S1 2OOYB 3OW2Y 4A3GI 1ML8A 3S2DI 1VQ6Z 2JA6I 2M48A 4X6AI 2KPIA 1RNIA 1K9M1 1I6HI 5IP7I 2RHBA 3VMGA 2YU9I 5CM2M 2V8JA 3HOVI 1KQSZ 4MONA 4A3II 2EGTA 4BXXI 3GTGI 1Z01A 2E2JI 1Q861 2QKDA 1YJN1 3S15I 3CC4Z 3J80b 3CCM1 3Q87A 2NVTI 1VQNZ 1JJ2Y 1YIJZ 1ZB8A 3G711 4MRIA 4BBRI 1QVGY 3D6WA 4RVFA 4A3JI 1Y1VS 4E30A 2IZ4A 4TNUA 5C3EI 4DK1A 3GTOI 3S16I 1Q822 4E33A 1KRLA 2JR6A 4NBFA 2H85A 3GCFA 2JNYA 2QRDB 1Z03A 2NVXI 2JMOA 1RLYA 2RBLA 3CCV1 1YIT1 2E2II 2R7ZI 1KD11 3GTKI 3CCQ1 1Q821 2GTHA 1YHQ1 3S17I 2QREB 3I07A 1N8R1 1VQ4Z 1Q812 3GTQI 1QVFY 2JA7I 3MZLB 2QA4Z 1M1K1 3MONA 4NBDA 4EWCA 2VUGA 4DQYB 2IZ3A 4CL1A 2JA5I 2OTL1 1K9M2 2P28A 1YI21 4RVDA 1VQLZ 1YUAA 1R9TI 3S1QI 2JA8I 3CPWZ 2PMZA 1Z02A 1X3WA 3M3YI 2AKLA 3CPWY 4HGYA 2QEX1 2NVYI 3VMHA 1M1K2 3HOYI 1TWCI 1Q7Y1 3GTPI 4E32A 3FKII 2QA41 2VF1A 3HKZA 4HH4A 1TWHI 1WCMI 2M6NA 1VQ51 2YADA 4A3MI 3CD6Z 4NBBA 1RQFA 3BG0B 1VQ8Z 1DL6A 5D1PA 4Y52I 3JAMb 3CMEZ 3I55Z 1VQOZ 1Q7Y2 3F3FC 1TFIA 2DE5A 2PK7A 3GTJI 2R92I 3S14I 3HOUI 1ZB9A 1VQP1 3CC41 5C4JI 2W03A 1TWGI 1WIIA 1K83I 2RPRA 3CMAZ 5D1OA 3D9XA 1Y1WI 4A3BI 4A93I 2P3YA 2RT9A 4NBAA 4NFRA 4RV9A 2QRCB 1SFOI 1JJ2Z 1YJ9Z 2JUBA 3IX0A 3G6E1 3GKQA 3CC71 2QLVB 1VQO1 4NBCA 4BBSI 5FLXf 3U50C 4S1TA 3KIFA 2K5RA 2O4HA 5AN9F 1VQ91 3NDJA 1P9NA 1KC81 5A2Qb 1JWHC 1L1OC 2HU9A 2LFUA 2O53A 4MD8A 4E31A 5T64A 3I56Z 2E2HI 2GTIA 2DE6A 4NBEA 2B63I 4QTTA 1VQPZ 1NJI2 1KC82 4NOZA 1QF8A 2V8KA 3MZKB 2W04A 2OZKA 1VQ9Z 3J81f 4A3KI 3QWUA 1YIJ1 2K3RA 3VTNA 4RS4A 1RO0A 2OTLZ 3CMA1 1VQ81 3H3VJ 2Q4ZA 1K8A2 3J7A4 5IP9I 4Y7NI 4A3LI 3HOWI 4NB8A 3J80f 2E9HA 5FLMI 3RZDI 4E2WA 3CCJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 I;  1DL6 A;  2JS4 A;  3S2H I;  4BY7 I;  4Y52 I;  3ESW A;  4QTU A;  2J6A A;  3Q87 A;  2NVT I;  4A3C I;  1Y1V I;  4NBG A;  1NUI A;  3I4N I;  1TFI A;  4A3F I;  1ZB8 A;  3VB9 A;  2DE5 A;  2PK7 A;  4BBR I;  3PO3 S;  3GTJ I;  2R92 I;  3S14 I;  3D6W A;  4A3J I;  1Y1V S;  2R93 I;  3CQZ I;  5C3E I;  3HOU I;  1ZB9 A;  3GTO I;  3S16 I;  3HOZ I;  5C44 I;  3K7A I;  5C4J I;  2JR6 A;  4NBF A;  1X3Z A;  3PO2 I;  1TWG I;  1K83 I;  1PFT A;  2NVQ I;  1USP A;  3GCF A;  3M4O I;  2JNY A;  1Y1W I;  4A3B I;  4A93 I;  2P3Y A;  2NVX I;  3GTM I;  3EER A;  4NBA A;  1RLY A;  1SFO I;  2RBL A;  5C4X I;  3PO3 I;  2F4O A;  2E2I I;  3GKQ A;  2R7Z I;  3GTK I;  4NBC A;  3H0G I;  3LUS A;  4BBS I;  1TWA I;  4MH4 A;  3S17 I;  3U50 C;  3GTM S;  2HF1 A;  3VMI A;  1USP B;  4XX2 A;  3S1M I;  3I07 A;  3HOX I;  2K5R A;  1RO4 A;  4A3E I;  4NBH A;  3GTQ I;  2JA7 I;  1L1O C;  1I50 I;  1LQL A;  4NBD A;  2DE7 A;  3S1N I;  1I3Q I;  1TWF I;  2E2H I;  2F4M A;  2DE6 A;  4NBE A;  2JA5 I;  4QTT A;  2B63 I;  4NB9 A;  2VUM I;  1N2F A;  3GTL I;  1YUA A;  1R9T I;  4NOZ A;  3S1Q I;  2JA8 I;  4A3K I;  4A3G I;  1X3W A;  3M3Y I;  2AKL A;  1ML8 A;  3S2D I;  4A3D I;  2JA6 I;  3RZO I;  4X6A I;  1QYP A;  2NVY I;  3VMH A;  3I4M I;  2KPI A;  3HOY I;  1TWC I;  1I6H I;  5IP7 I;  3VMG A;  2YU9 I;  3H3V J;  2BJO A;  3GTP I;  5CM2 M;  5IP9 I;  4Y7N I;  3HOV I;  3FKI I;  4A3I I;  4A3L I;  3HOW I;  4NB8 A;  4BXX I;  1TWH I;  1WCM I;  1WW9 A;  3GTG I;  1VLA A;  4BY1 I;  3S1R I;  5FLM I;  4A3M I;  3RZD I;  4NBB A;  2E2J I; 
#chains in the Genus database with same CATH topology
 2JS4 A;  1KQS Y;  3I55 1;  3ESW A;  3CCM Z;  4QTU A;  2GU2 A;  1S72 1;  3NH8 A;  5D1O B;  3NH5 A;  1K8A 1;  1NUI A;  2KI7 B;  3NDI A;  1KD1 2;  3VB9 A;  1YIT Z;  1RO2 A;  3PO3 S;  2JIR A;  3TDH B;  1N8R 2;  2WB1 A;  3CCE Z;  1VQM 1;  2G2K A;  1M90 2;  3HOZ I;  3JAM f;  5C44 I;  3K7A I;  3PO2 I;  5T6B A;  3BG1 B;  1PFT A;  3OW2 Z;  1YJN Z;  4HGZ A;  2NVQ I;  1USP A;  3M4O I;  1YUK A;  4AYB A;  4DGL A;  3EER A;  3P5J B;  3IF8 A;  5C4X I;  4NH1 C;  3J81 b;  3G71 Z;  2PM9 A;  2I3C A;  1VQ4 1;  2F4O A;  1YHQ Z;  3LUS A;  3NFZ A;  2OTJ 1;  1NP6 A;  1TWA I;  2JIP A;  1USP B;  3VMI A;  4XX2 A;  3HOX I;  3IFU A;  4MD7 A;  4E2X A;  4NBH A;  1YI2 Z;  3KIH A;  2DE7 A;  1TWF I;  1QVG Z;  2F4M A;  2V8I A;  1Q86 2;  3CXC Z;  1M90 1;  1W2B Y;  3CXC Y;  2QEX Z;  3CC2 1;  3CCS Z;  1YJW Z;  1VQ6 1;  2AYD A;  1X0T A;  1VQK 1;  1W2B Z;  3G4S Z;  1YJ9 1;  4MD9 A;  1VQK Z;  4A3D I;  3RZO I;  1VQ7 1;  2JIO A;  5A2Q f;  1QYP A;  4RVH A;  3I4M I;  5T67 A;  2RIQ A;  1S72 Z;  4MXU A;  3CCQ Z;  1WZN A;  3FQM A;  4E2Y A;  3I56 1;  2BJO A;  3CC7 Z;  3CD6 1;  3F3P C;  3FQQ A;  3T4N B;  2Y0S A;  1QXF A;  3CCE 1;  2LIY A;  1WW9 A;  1Y8C A;  1VLA A;  2R6M A;  4BY1 I;  3S1R I;  4E2Z A;  1VQN 1;  2VPY A;  3S2H I;  3TE5 B;  4BY7 I;  2J6A A;  3CCR Z;  4A3C I;  1Y1V I;  4NBG A;  3NH4 A;  3CCU Z;  3I4N I;  5IT9 f;  4A3F I;  2ZAE B;  2WAQ A;  3CCV Z;  5IT9 b;  3CCU 1;  2R93 I;  3CQZ I;  3CCR 1;  1Q81 1;  3CME 1;  1S7M A;  3EED A;  1X3Z A;  1QVF Z;  1VQM Z;  3GTM I;  2Q51 A;  1VQ7 Z;  3PO3 I;  2V45 A;  3CCL Z;  2OOX B;  3CC2 Z;  3CCS 1;  1YJW 1;  3H0G I;  2OTJ Z;  4MH4 A;  3GTM S;  2HF1 A;  2QR1 B;  3S1M I;  3CCL 1;  3CCJ 1;  1RO4 A;  1K73 1;  3D2L A;  1VQ5 Z;  4A3E I;  5LL6 f;  1I50 I;  1LQL A;  1VQL 1;  4RVG A;  3S1N I;  1I3Q I;  5FLX b;  4NB9 A;  2VUM I;  1N2F A;  1ZH1 A;  3GTL I;  1NJI 1;  3G6E Z;  1K73 2;  2JIM A;  3G4S 1;  2OOY B;  3OW2 Y;  4A3G I;  2IV2 X;  1ML8 A;  3S2D I;  1VQ6 Z;  2JA6 I;  2M48 A;  4X6A I;  2KPI A;  1RNI A;  1K9M 1;  1I6H I;  5IP7 I;  2RHB A;  3VMG A;  2YU9 I;  5CM2 M;  2V8J A;  3HOV I;  1KQS Z;  4MON A;  4A3I I;  2EGT A;  4BXX I;  3GTG I;  1Z01 A;  2E2J I;  1Q86 1;  2QKD A;  1YJN 1;  3S15 I;  3CC4 Z;  3J80 b;  3CCM 1;  3Q87 A;  2NVT I;  1VQN Z;  1JJ2 Y;  1YIJ Z;  1ZB8 A;  3G71 1;  4MRI A;  1FDO A;  4BBR I;  1QVG Y;  1WJ2 A;  3D6W A;  4RVF A;  4A3J I;  1Y1V S;  4E30 A;  2IZ4 A;  4TNU A;  5C3E I;  4DK1 A;  3GTO I;  3S16 I;  1Q82 2;  4E33 A;  1KRL A;  2JR6 A;  4NBF A;  2H85 A;  3GCF A;  2JNY A;  2QRD B;  1Z03 A;  2NVX I;  2NAP A;  2JMO A;  1RLY A;  2VPX A;  1FDI A;  2RBL A;  3CCV 1;  1YIT 1;  2E2I I;  2R7Z I;  1KD1 1;  3GTK I;  3CCQ 1;  1Q82 1;  2GTH A;  1YHQ 1;  3S17 I;  2LEX A;  2QRE B;  3I07 A;  1N8R 1;  1VQ4 Z;  1Q81 2;  3GTQ I;  1QVF Y;  2JA7 I;  3MZL B;  3IR7 A;  2QA4 Z;  1M1K 1;  3MON A;  4NBD A;  4EWC A;  2VUG A;  4DQY B;  2IZ3 A;  4CL1 A;  2JA5 I;  2OTL 1;  1K9M 2;  2P28 A;  1YI2 1;  4RVD A;  1VQL Z;  1YUA A;  1R9T I;  3S1Q I;  2JA8 I;  2JIQ A;  3CPW Z;  2PMZ A;  1Z02 A;  1X3W A;  3M3Y I;  2AKL A;  3CPW Y;  4HGY A;  2QEX 1;  2NVY I;  3VMH A;  1M1K 2;  3HOY I;  1TWC I;  1Q7Y 1;  3GTP I;  4E32 A;  3FKI I;  2QA4 1;  2VF1 A;  3HKZ A;  4HH4 A;  1TWH I;  1WCM I;  2M6N A;  1VQ5 1;  2YAD A;  4A3M I;  3CD6 Z;  4NBB A;  1RQF A;  3BG0 B;  1VQ8 Z;  1DL6 A;  5D1P A;  4Y52 I;  3JAM b;  3CME Z;  3I55 Z;  1VQO Z;  1Q7Y 2;  3F3F C;  1TFI A;  1Q16 A;  2VPZ A;  2DE5 A;  2PK7 A;  3GTJ I;  2R92 I;  3S14 I;  1SIW A;  3HOU I;  1ZB9 A;  1VQP 1;  3CC4 1;  5C4J I;  2W03 A;  1TWG I;  1WII A;  1K83 I;  2RPR A;  3CMA Z;  5D1O A;  3D9X A;  1Y1W I;  4A3B I;  4A93 I;  2P3Y A;  2RT9 A;  4NBA A;  4NFR A;  4RV9 A;  2QRC B;  1SFO I;  1JJ2 Z;  1YJ9 Z;  2JUB A;  3IX0 A;  3G6E 1;  3GKQ A;  3CC7 1;  2QLV B;  1VQO 1;  4NBC A;  4BBS I;  5FLX f;  3U50 C;  2E7Z A;  4S1T A;  3KIF A;  2K5R A;  2O4H A;  5AN9 F;  1VQ9 1;  3NDJ A;  1P9N A;  1KC8 1;  5A2Q b;  1JWH C;  1L1O C;  2HU9 A;  2LFU A;  2O53 A;  2V3V A;  4MD8 A;  4E31 A;  5T64 A;  3I56 Z;  2E2H I;  2GTI A;  2DE6 A;  4NBE A;  2B63 I;  4QTT A;  2VPW A;  1VQP Z;  1NJI 2;  1KC8 2;  4NOZ A;  1QF8 A;  2V8K A;  3MZK B;  2W04 A;  2OZK A;  1VQ9 Z;  3J81 f;  1AA6 A;  4A3K I;  3QWU A;  1YIJ 1;  2K3R A;  3VTN A;  4RS4 A;  1RO0 A;  2OTL Z;  3CMA 1;  1VQ8 1;  3H3V J;  2Q4Z A;  1K8A 2;  3J7A 4;  5IP9 I;  4Y7N I;  4A3L I;  3HOW I;  4NB8 A;  3J80 f;  2E9H A;  5FLM I;  3RZD I;  4E2W A;  3CCJ Z; 
#chains in the Genus database with same CATH homology
 2JS4 A;  1KQS Y;  3I55 1;  3ESW A;  3CCM Z;  4QTU A;  2GU2 A;  1S72 1;  3NH8 A;  5D1O B;  3NH5 A;  1K8A 1;  1NUI A;  2KI7 B;  3NDI A;  1KD1 2;  3VB9 A;  1YIT Z;  1RO2 A;  3PO3 S;  3TDH B;  1N8R 2;  2WB1 A;  3CCE Z;  1VQM 1;  2G2K A;  1M90 2;  3HOZ I;  3JAM f;  5C44 I;  3K7A I;  3PO2 I;  5T6B A;  3BG1 B;  1PFT A;  3OW2 Z;  1YJN Z;  4HGZ A;  2NVQ I;  1USP A;  3M4O I;  1YUK A;  4AYB A;  4DGL A;  3EER A;  3P5J B;  3IF8 A;  5C4X I;  4NH1 C;  3J81 b;  3G71 Z;  2PM9 A;  2I3C A;  1VQ4 1;  2F4O A;  1YHQ Z;  3LUS A;  3NFZ A;  2OTJ 1;  1NP6 A;  1TWA I;  3VMI A;  1USP B;  4XX2 A;  3HOX I;  3IFU A;  4MD7 A;  4E2X A;  4NBH A;  1YI2 Z;  3KIH A;  2DE7 A;  1TWF I;  1QVG Z;  2F4M A;  2V8I A;  1Q86 2;  3CXC Z;  1M90 1;  1W2B Y;  3CXC Y;  2QEX Z;  3CC2 1;  3CCS Z;  1YJW Z;  1VQ6 1;  1X0T A;  1VQK 1;  1W2B Z;  3G4S Z;  1YJ9 1;  4MD9 A;  1VQK Z;  4A3D I;  3RZO I;  1VQ7 1;  5A2Q f;  1QYP A;  4RVH A;  3I4M I;  5T67 A;  2RIQ A;  1S72 Z;  4MXU A;  3CCQ Z;  3FQM A;  4E2Y A;  3I56 1;  2BJO A;  3CC7 Z;  3CD6 1;  3F3P C;  3FQQ A;  3T4N B;  2Y0S A;  3CCE 1;  2LIY A;  1WW9 A;  1VLA A;  2R6M A;  4BY1 I;  3S1R I;  4E2Z A;  1VQN 1;  3S2H I;  3TE5 B;  4BY7 I;  2J6A A;  3CCR Z;  4A3C I;  1Y1V I;  4NBG A;  3NH4 A;  3CCU Z;  3I4N I;  5IT9 f;  4A3F I;  2ZAE B;  2WAQ A;  3CCV Z;  5IT9 b;  3CCU 1;  2R93 I;  3CQZ I;  3CCR 1;  1Q81 1;  3CME 1;  1S7M A;  3EED A;  1X3Z A;  1QVF Z;  1VQM Z;  3GTM I;  2Q51 A;  1VQ7 Z;  3PO3 I;  3CCL Z;  2OOX B;  3CC2 Z;  3CCS 1;  1YJW 1;  3H0G I;  2OTJ Z;  4MH4 A;  3GTM S;  2HF1 A;  2QR1 B;  3S1M I;  3CCL 1;  3CCJ 1;  1RO4 A;  1K73 1;  1VQ5 Z;  4A3E I;  5LL6 f;  1I50 I;  1LQL A;  1VQL 1;  4RVG A;  3S1N I;  1I3Q I;  5FLX b;  4NB9 A;  2VUM I;  1N2F A;  1ZH1 A;  3GTL I;  1NJI 1;  3G6E Z;  1K73 2;  3G4S 1;  2OOY B;  3OW2 Y;  4A3G I;  1ML8 A;  3S2D I;  1VQ6 Z;  2JA6 I;  2M48 A;  4X6A I;  2KPI A;  1RNI A;  1K9M 1;  1I6H I;  5IP7 I;  2RHB A;  3VMG A;  2YU9 I;  5CM2 M;  2V8J A;  3HOV I;  1KQS Z;  4MON A;  4A3I I;  2EGT A;  4BXX I;  3GTG I;  1Z01 A;  2E2J I;  1Q86 1;  2QKD A;  1YJN 1;  3S15 I;  3CC4 Z;  3J80 b;  3CCM 1;  3Q87 A;  2NVT I;  1VQN Z;  1JJ2 Y;  1YIJ Z;  1ZB8 A;  3G71 1;  4MRI A;  4BBR I;  1QVG Y;  3D6W A;  4RVF A;  4A3J I;  1Y1V S;  4E30 A;  2IZ4 A;  4TNU A;  5C3E I;  4DK1 A;  3GTO I;  3S16 I;  1Q82 2;  4E33 A;  1KRL A;  2JR6 A;  4NBF A;  2H85 A;  3GCF A;  2JNY A;  2QRD B;  1Z03 A;  2NVX I;  2JMO A;  1RLY A;  2RBL A;  3CCV 1;  1YIT 1;  2E2I I;  2R7Z I;  1KD1 1;  3GTK I;  3CCQ 1;  1Q82 1;  2GTH A;  1YHQ 1;  3S17 I;  2QRE B;  3I07 A;  1N8R 1;  1VQ4 Z;  1Q81 2;  3GTQ I;  1QVF Y;  2JA7 I;  3MZL B;  2QA4 Z;  1M1K 1;  3MON A;  4NBD A;  4EWC A;  2VUG A;  4DQY B;  2IZ3 A;  4CL1 A;  2JA5 I;  2OTL 1;  1K9M 2;  2P28 A;  1YI2 1;  4RVD A;  1VQL Z;  1YUA A;  1R9T I;  3S1Q I;  2JA8 I;  3CPW Z;  2PMZ A;  1Z02 A;  1X3W A;  3M3Y I;  2AKL A;  3CPW Y;  4HGY A;  2QEX 1;  2NVY I;  3VMH A;  1M1K 2;  3HOY I;  1TWC I;  1Q7Y 1;  3GTP I;  4E32 A;  3FKI I;  2QA4 1;  2VF1 A;  3HKZ A;  4HH4 A;  1TWH I;  1WCM I;  2M6N A;  1VQ5 1;  2YAD A;  4A3M I;  3CD6 Z;  4NBB A;  1RQF A;  3BG0 B;  1VQ8 Z;  1DL6 A;  5D1P A;  4Y52 I;  3JAM b;  3CME Z;  3I55 Z;  1VQO Z;  1Q7Y 2;  3F3F C;  1TFI A;  2DE5 A;  2PK7 A;  3GTJ I;  2R92 I;  3S14 I;  3HOU I;  1ZB9 A;  1VQP 1;  3CC4 1;  5C4J I;  2W03 A;  1TWG I;  1WII A;  1K83 I;  2RPR A;  3CMA Z;  5D1O A;  3D9X A;  1Y1W I;  4A3B I;  4A93 I;  2P3Y A;  2RT9 A;  4NBA A;  4NFR A;  4RV9 A;  2QRC B;  1SFO I;  1JJ2 Z;  1YJ9 Z;  2JUB A;  3IX0 A;  3G6E 1;  3GKQ A;  3CC7 1;  2QLV B;  1VQO 1;  4NBC A;  4BBS I;  5FLX f;  3U50 C;  4S1T A;  3KIF A;  2K5R A;  2O4H A;  5AN9 F;  1VQ9 1;  3NDJ A;  1P9N A;  1KC8 1;  5A2Q b;  1JWH C;  1L1O C;  2HU9 A;  2LFU A;  2O53 A;  4MD8 A;  4E31 A;  5T64 A;  3I56 Z;  2E2H I;  2GTI A;  2DE6 A;  4NBE A;  2B63 I;  4QTT A;  1VQP Z;  1NJI 2;  1KC8 2;  4NOZ A;  1QF8 A;  2V8K A;  3MZK B;  2W04 A;  2OZK A;  1VQ9 Z;  3J81 f;  4A3K I;  3QWU A;  1YIJ 1;  2K3R A;  3VTN A;  4RS4 A;  1RO0 A;  2OTL Z;  3CMA 1;  1VQ8 1;  3H3V J;  2Q4Z A;  1K8A 2;  3J7A 4;  5IP9 I;  4Y7N I;  4A3L I;  3HOW I;  4NB8 A;  3J80 f;  2E9H A;  5FLM I;  3RZD I;  4E2W A;  3CCJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...