4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
2E2JI 4NOZA 4NBHA 3GTOI 4A3KI 2JA6I 1ML8A 1WW9A 3HOYI 4NB8A 4A3DI 5C44I 5C3EI 1N2FA 3Q87A 3U50C 1TWCI 4A3CI 2NVQI 1ZB8A 3HOXI 3GTPI 5FLMI 1USPA 5C4JI 3I4NI 3K7AI 4NBFA 4A3EI 4MH4A 3GKQA 4A3MI 3GTJI 2JA8I 3S1NI 2JR6A 1WCMI 3FKII 3CQZI 1R9TI 4A3JI 1L1OC 4BY1I 5C4XI 4BBSI 3VB9A 2JA7I 1YUAA 4BBRI 1I6HI 1Y1VS 1Y1WI 3GTQI 5IP7I 5IP9I 1RO4A 2NVTI 4NBEA 3H0GI 1VLAA 2JA5I 5CM2M 4BXXI 4A3II 2F4MA 3S2HI 1K83I 2F4OA 2E2II 4NB9A 3GTGI 3I07A 1X3WA 3PO3S 4XX2A 2RBLA 2JS4A 3PO3I 1LQLA 3S17I 4BY7I 1DL6A 3HOWI 3ESWA 1TFIA 4Y52I 3H3VJ 3GTMS 3RZDI 3M4OI 1I3QI 3HOVI 3S15I 4A3BI 1Y1VI 4Y7NI 4QTUA 4A93I 2YU9I 2AKLA 4NBAA 2NVXI 1TWHI 1X3ZA 3M3YI 2K5RA 1QYPA 3I4MI 2R92I 3LUSA 1SFOI 2J6AA 4A3FI 2DE5A 4QTTA 1TWAI 2P3YA 1TWGI 3S1RI 3RZOI 3S1MI 3GTMI 2B63I 2DE7A 1I50I 4A3LI 3S2DI 2R93I 3GCFA 3PO2I 2E2HI 2KPIA 4NBBA 3GTLI 3GTKI 3S14I 3VMHA 1PFTA 4X6AI 1TWFI 3EERA 2R7ZI 4NBGA 2DE6A 3HOZI 1NUIA 1RLYA 2BJOA 4NBDA 2NVYI 1ZB9A 4A3GI 3S1QI 2JNYA 3VMGA 2VUMI 3VMIA 1USPB 2PK7A 3S16I 3D6WA 2HF1A 4NBCA 3HOUI
chains in the Genus database with same CATH superfamily
3GTOI 2JA6I 1WJ2A 4CL1A 4E2YA 3CCJZ 1YJ9Z 2RPRA 5C3EI 2EGTA 2NVQI 2V8IA 3CMAZ 1Q861 2IZ3A 1USPA 3FQQA 4NBFA 4A3EI 1Z01A 3CCR1 4A3MI 1S72Z 2PMZA 1VQ61 3S1NI 1WCMI 3CQZI 3CCSZ 3F3PC 1L1OC 4RVFA 4RVDA 5C4XI 1YUAA 1I6HI 1Y8CA 2RT9A 3CCV1 4E30A 1Y1WI 3CC2Z 4MD8A 4MRIA 5IP9I 2AYDA 1VQM1 1KQSZ 1VLAA 4A3II 3EEDA 4NB9A 2O53A 2LEXA 3GTGI 3I07A 3PO3S 4XX2A 3PO3I 2JS4A 1VQ51 2OTJ1 3G6EZ 3BG1B 3S15I 1Q821 4A93I 1WZNA 4NBAA 3CCQZ 2V3VA 4E31A 1KD12 3I551 2K5RA 1AA6A 5T64A 3NH5A 3CMEZ 1NJI2 1VQ4Z 3LUSA 3IX0A 2J6AA 3FQMA 4HGYA 5FLXf 2P28A 1W2BZ 2KI7B 3RZOI 3CCE1 1VQ81 1QVGZ 4A3LI 1VQMZ 2M48A 3IR7A 1QF8A 4NBBA 3GTKI 1QXFA 3VTNA 2JUBA 1PFTA 3QWUA 4HH4A 1S721 4E33A 2DE6A 1YHQ1 4NFRA 2BJOA 1Q7Y2 2GTHA 2GU2A 3CMA1 4DK1A 2LFUA 3S1QI 1Z02A 3VMGA 3VMIA 3S16I 2V45A 1NP6A 1Z03A 3HOYI 4A3KI 1WW9A 4A3DI 1N8R2 1ZH1A 3MZLB 5C44I 5D1OB 3U50C 1VQP1 4A3CI 5D1OA 2QRDB 2QREB 2QA4Z 1ZB8A 3CCMZ 3K7AI 3G4S1 1KC82 4MH4A 2V8JA 3GTJI 1VQ71 2IZ4A 2JR6A 1YJN1 4A3JI 1R9TI 3G71Z 4RVGA 3CCEZ 1M902 1VQNZ 1RQFA 4DGLA 4BBSI 3CCL1 2JA7I 1X0TA 5A2Qb 4BBRI 3J80b 2JIOA 2JA5I 5CM2M 1K9M2 2JIMA 3NFZA 1VQ9Z 3CCU1 1X3WA 2QA41 3S17I 2LIYA 5D1PA 4BY7I 3ESWA 1M1K1 1TFIA 3CPWY 3H3VJ 3GTMS 2QEXZ 1KD11 1KQSY 5LL6f 3T4NB 2AKLA 3CME1 2OTLZ 1QVGY 1YIJZ 3M3YI 3CCLZ 2JMOA 3CC71 5A2Qf 3J7A4 1TWGI 2W04A 4RV9A 3GTMI 4E2WA 3TE5B 2JIPA 3PO2I 3JAMf 2QLVB 1P9NA 1VQLZ 2G2KA 2I3CA 4RVHA 3J81b 4NH1C 1Q812 3VMHA 3S14I 3NDJA 3EERA 3I56Z 3CD6Z 3F3FC 2H85A 1W2BY 4MD7A 3HOZI 1YJ91 4NBDA 3CCM1 2V8KA 4E2XA 1ZB9A 4A3GI 5IT9f 3D6WA 2HF1A 4NBCA 3HOUI 2E2JI 4X6AI 1ML8A 4NB8A 1RO0A 3CCVZ 1SIWA 5AN9F 3MONA 4E32A 1JJ2Z 1VQ6Z 3JAMb 3BG0B 3HOXI 3GTPI 5FLMI 3OW2Y 3GKQA 2JA8I 1KC81 1M1K2 3IF8A 3FKII 3HKZA 4EWCA 1Q862 3VB9A 3I561 3P5JB 3GTQI 5IP7I 4NBEA 2ZAEB 5FLXb 2F4MA 1K83I 2E2II 4MONA 3TDHB 3CXCY 1DL6A 3HOWI 4Y52I 3RZDI 3M4OI 3I55Z 1I3QI 2HU9A 4A3BI 2WB1A 1Y1VI 4Y7NI 4QTUA 3KIHA 2W03A 4AYBA 1TWHI 2K3RA 1YI21 2IV2X 1QYPA 1WIIA 4TNUA 3OW2Z 1QVFZ 2YADA 3CC4Z 3CPWZ 1TWAI 2P3YA 1RNIA 2VF1A 3D2LA 3S1RI 3CCQ1 3J80f 5T6BA 1VQL1 3J81f 2B63I 1JWHC 1I50I 2DE7A 1YIJ1 2JIRA 3S2DI 2VPYA 3GCFA 1NJI1 2E2HI 1Q811 2KPIA 4MD9A 2VUGA 1VQ41 1VQ5Z 2M6NA 2RIQA 1KRLA 1TWFI 2R7ZI 3CXCZ 1Q822 4NBGA 1YUKA 2Q4ZA 5IT9b 2Y0SA 1NUIA 1FDOA 1JJ2Y 1RO2A 3CCUZ 1Q7Y1 2JNYA 2PK7A 3CCJ1 2VPXA 4NBHA 4NOZA 1M901 1S7MA 4HGZA 1QVFY 1VQK1 1N2FA 1VQOZ 2JIQA 2PM9A 3Q87A 1YHQZ 2WAQA 1TWCI 2R6MA 2OZKA 5C4JI 3I4NI 1YJWZ 3G4SZ 2QKDA 1FDIA 1VQPZ 1N8R1 4BY1I 1VQO1 4MXUA 1Y1VS 2NAPA 1RO4A 1Q16A 2NVTI 3H0GI 4BXXI 1K732 3CC41 5T67A 3S2HI 2F4OA 4DQYB 3CD61 2RHBA 2OOYB 1K8A2 2RBLA 3NH4A 1LQLA 3NH8A 2E9HA 2E7ZA 4E2ZA 2VPZA 3HOVI 2QR1B 4RS4A 3G6E1 2YU9I 1K9M1 2NVXI 1YI2Z 2VPWA 1X3ZA 2GTIA 2OOXB 1YITZ 1VQN1 3I4MI 2R92I 1SFOI 4A3FI 1YJNZ 2DE5A 4QTTA 3CC21 1VQ7Z 1VQ91 1K731 1YJW1 3MZKB 3S1MI 3CCS1 2OTJZ 2R93I 3GTLI 1VQ8Z 3D9XA 3CC7Z 3NDIA 1YIT1 4S1TA 3IFUA 2Q51A 2OTL1 2QRCB 2O4HA 3KIFA 1RLYA 2NVYI 2QEX1 3CCRZ 2VUMI 1USPB 1VQKZ 1K8A1 3G711
chains in the Genus database with same CATH topology
3GTOI 2JA6I 4CL1A 4E2YA 3CCJZ 1YJ9Z 2RPRA 5C3EI 2EGTA 2NVQI 2V8IA 3CMAZ 1Q861 2IZ3A 1USPA 3FQQA 4NBFA 4A3EI 1Z01A 3CCR1 4A3MI 1S72Z 2PMZA 1VQ61 3S1NI 1WCMI 3CQZI 3CCSZ 3F3PC 1L1OC 4RVFA 4RVDA 5C4XI 1YUAA 1I6HI 2RT9A 3CCV1 4E30A 1Y1WI 3CC2Z 4MD8A 4MRIA 5IP9I 1VQM1 1KQSZ 1VLAA 4A3II 3EEDA 4NB9A 2O53A 3GTGI 3I07A 3PO3S 4XX2A 3PO3I 2JS4A 1VQ51 2OTJ1 3G6EZ 3BG1B 3S15I 1Q821 4A93I 4NBAA 3CCQZ 1KD12 4E31A 3I551 2K5RA 5T64A 3NH5A 3CMEZ 1NJI2 1VQ4Z 3LUSA 3IX0A 2J6AA 3FQMA 4HGYA 5FLXf 2P28A 1W2BZ 2KI7B 3RZOI 3CCE1 1VQ81 1QVGZ 4A3LI 1VQMZ 2M48A 1QF8A 4NBBA 3GTKI 3VTNA 2JUBA 1PFTA 3QWUA 4HH4A 1S721 4E33A 2DE6A 1YHQ1 4NFRA 2BJOA 1Q7Y2 2GTHA 2GU2A 3CMA1 4DK1A 2LFUA 3S1QI 1Z02A 3VMGA 3VMIA 3S16I 1NP6A 1Z03A 3HOYI 4A3KI 1WW9A 4A3DI 1N8R2 1ZH1A 3MZLB 5C44I 5D1OB 3U50C 1VQP1 4A3CI 5D1OA 2QRDB 2QREB 2QA4Z 1ZB8A 3CCMZ 3K7AI 3G4S1 1KC82 4MH4A 2V8JA 3GTJI 1VQ71 2IZ4A 2JR6A 1YJN1 4A3JI 1R9TI 3G71Z 4RVGA 3CCEZ 1M902 1VQNZ 1RQFA 4DGLA 4BBSI 3CCL1 2JA7I 1X0TA 5A2Qb 4BBRI 3J80b 2JA5I 5CM2M 1K9M2 3NFZA 1VQ9Z 3CCU1 1X3WA 2QA41 3S17I 2LIYA 5D1PA 4BY7I 3ESWA 1M1K1 1TFIA 3CPWY 3H3VJ 3GTMS 2QEXZ 1KD11 1KQSY 5LL6f 3T4NB 2AKLA 3CME1 2OTLZ 1QVGY 1YIJZ 3M3YI 3CCLZ 2JMOA 3CC71 5A2Qf 3J7A4 1TWGI 2W04A 4RV9A 3GTMI 4E2WA 3TE5B 3PO2I 3JAMf 2QLVB 1P9NA 1VQLZ 2G2KA 2I3CA 4RVHA 3J81b 4NH1C 1Q812 3VMHA 3S14I 3NDJA 3EERA 3I56Z 3CD6Z 3F3FC 2H85A 1W2BY 4MD7A 3HOZI 1YJ91 4NBDA 3CCM1 2V8KA 4E2XA 1ZB9A 4A3GI 5IT9f 3D6WA 2HF1A 4NBCA 3HOUI 2E2JI 4X6AI 1ML8A 4NB8A 1RO0A 3CCVZ 5AN9F 3MONA 4E32A 1JJ2Z 1VQ6Z 3JAMb 3BG0B 3HOXI 3GTPI 5FLMI 3OW2Y 3GKQA 2JA8I 1KC81 1M1K2 3IF8A 3FKII 3HKZA 4EWCA 1Q862 3VB9A 3I561 3P5JB 3GTQI 5IP7I 4NBEA 2ZAEB 5FLXb 2F4MA 1K83I 2E2II 4MONA 3TDHB 3CXCY 1DL6A 3HOWI 4Y52I 3RZDI 3M4OI 3I55Z 1I3QI 2HU9A 4A3BI 2WB1A 1Y1VI 4Y7NI 4QTUA 3KIHA 2W03A 4AYBA 1TWHI 2K3RA 1YI21 1QYPA 1WIIA 4TNUA 3OW2Z 1QVFZ 2YADA 3CC4Z 3CPWZ 1TWAI 2P3YA 1RNIA 2VF1A 3S1RI 3CCQ1 3J80f 5T6BA 1VQL1 3J81f 2B63I 1JWHC 1I50I 2DE7A 1YIJ1 3S2DI 1NJI1 3GCFA 2E2HI 1Q811 2KPIA 4MD9A 2VUGA 1VQ41 1VQ5Z 2M6NA 2RIQA 1KRLA 1TWFI 2R7ZI 3CXCZ 1Q822 4NBGA 1YUKA 2Q4ZA 5IT9b 2Y0SA 1NUIA 1JJ2Y 1RO2A 3CCUZ 1Q7Y1 2JNYA 2PK7A 3CCJ1 4NOZA 4NBHA 1M901 1S7MA 4HGZA 1QVFY 1VQK1 1N2FA 1VQOZ 2PM9A 3Q87A 1YHQZ 2WAQA 1TWCI 2R6MA 2OZKA 5C4JI 3I4NI 1YJWZ 3G4SZ 2QKDA 1VQPZ 1N8R1 4BY1I 1VQO1 4MXUA 1Y1VS 1RO4A 2NVTI 3H0GI 4BXXI 1K732 3CC41 5T67A 3S2HI 2F4OA 4DQYB 3CD61 2RHBA 2OOYB 1K8A2 2RBLA 3NH4A 1LQLA 3NH8A 2E9HA 4E2ZA 3HOVI 2QR1B 4RS4A 3G6E1 2YU9I 1K9M1 2NVXI 1YI2Z 1X3ZA 2GTIA 2OOXB 1YITZ 1VQN1 3I4MI 2R92I 1SFOI 4A3FI 1YJNZ 2DE5A 4QTTA 3CC21 1VQ7Z 1VQ91 1K731 1YJW1 3MZKB 3S1MI 3CCS1 2OTJZ 2R93I 3GTLI 1VQ8Z 3D9XA 3CC7Z 3NDIA 1YIT1 4S1TA 3IFUA 2Q51A 2OTL1 2QRCB 2O4HA 3KIFA 1RLYA 2NVYI 2QEX1 3CCRZ 2VUMI 1USPB 1VQKZ 1K8A1 3G711
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J I;  4NOZ A;  4NBH A;  3GTO I;  4A3K I;  2JA6 I;  1ML8 A;  1WW9 A;  3HOY I;  4NB8 A;  4A3D I;  5C44 I;  5C3E I;  1N2F A;  3Q87 A;  3U50 C;  1TWC I;  4A3C I;  2NVQ I;  1ZB8 A;  3HOX I;  3GTP I;  5FLM I;  1USP A;  5C4J I;  3I4N I;  3K7A I;  4NBF A;  4A3E I;  4MH4 A;  3GKQ A;  4A3M I;  3GTJ I;  2JA8 I;  3S1N I;  2JR6 A;  1WCM I;  3FKI I;  3CQZ I;  1R9T I;  4A3J I;  1L1O C;  4BY1 I;  5C4X I;  4BBS I;  3VB9 A;  2JA7 I;  1YUA A;  4BBR I;  1I6H I;  1Y1V S;  1Y1W I;  3GTQ I;  5IP7 I;  5IP9 I;  1RO4 A;  2NVT I;  4NBE A;  3H0G I;  1VLA A;  2JA5 I;  5CM2 M;  4BXX I;  4A3I I;  2F4M A;  3S2H I;  1K83 I;  2F4O A;  2E2I I;  4NB9 A;  3GTG I;  3I07 A;  1X3W A;  3PO3 S;  4XX2 A;  2RBL A;  2JS4 A;  3PO3 I;  1LQL A;  3S17 I;  4BY7 I;  1DL6 A;  3HOW I;  3ESW A;  1TFI A;  4Y52 I;  3H3V J;  3GTM S;  3RZD I;  3M4O I;  1I3Q I;  3HOV I;  3S15 I;  4A3B I;  1Y1V I;  4Y7N I;  4QTU A;  4A93 I;  2YU9 I;  2AKL A;  4NBA A;  2NVX I;  1TWH I;  1X3Z A;  3M3Y I;  2K5R A;  1QYP A;  3I4M I;  2R92 I;  3LUS A;  1SFO I;  2J6A A;  4A3F I;  2DE5 A;  4QTT A;  1TWA I;  2P3Y A;  1TWG I;  3S1R I;  3RZO I;  3S1M I;  3GTM I;  2B63 I;  2DE7 A;  1I50 I;  4A3L I;  3S2D I;  2R93 I;  3GCF A;  3PO2 I;  2E2H I;  2KPI A;  4NBB A;  3GTL I;  3GTK I;  3S14 I;  3VMH A;  1PFT A;  4X6A I;  1TWF I;  3EER A;  2R7Z I;  4NBG A;  2DE6 A;  3HOZ I;  1NUI A;  1RLY A;  2BJO A;  4NBD A;  2NVY I;  1ZB9 A;  4A3G I;  3S1Q I;  2JNY A;  3VMG A;  2VUM I;  3VMI A;  1USP B;  2PK7 A;  3S16 I;  3D6W A;  2HF1 A;  4NBC A;  3HOU I; 
#chains in the Genus database with same CATH topology
 3GTO I;  2JA6 I;  1WJ2 A;  4CL1 A;  4E2Y A;  3CCJ Z;  1YJ9 Z;  2RPR A;  5C3E I;  2EGT A;  2NVQ I;  2V8I A;  3CMA Z;  1Q86 1;  2IZ3 A;  1USP A;  3FQQ A;  4NBF A;  4A3E I;  1Z01 A;  3CCR 1;  4A3M I;  1S72 Z;  2PMZ A;  1VQ6 1;  3S1N I;  1WCM I;  3CQZ I;  3CCS Z;  3F3P C;  1L1O C;  4RVF A;  4RVD A;  5C4X I;  1YUA A;  1I6H I;  1Y8C A;  2RT9 A;  3CCV 1;  4E30 A;  1Y1W I;  3CC2 Z;  4MD8 A;  4MRI A;  5IP9 I;  2AYD A;  1VQM 1;  1KQS Z;  1VLA A;  4A3I I;  3EED A;  4NB9 A;  2O53 A;  2LEX A;  3GTG I;  3I07 A;  3PO3 S;  4XX2 A;  3PO3 I;  2JS4 A;  1VQ5 1;  2OTJ 1;  3G6E Z;  3BG1 B;  3S15 I;  1Q82 1;  4A93 I;  1WZN A;  4NBA A;  3CCQ Z;  2V3V A;  4E31 A;  1KD1 2;  3I55 1;  2K5R A;  1AA6 A;  5T64 A;  3NH5 A;  3CME Z;  1NJI 2;  1VQ4 Z;  3LUS A;  3IX0 A;  2J6A A;  3FQM A;  4HGY A;  5FLX f;  2P28 A;  1W2B Z;  2KI7 B;  3RZO I;  3CCE 1;  1VQ8 1;  1QVG Z;  4A3L I;  1VQM Z;  2M48 A;  3IR7 A;  1QF8 A;  4NBB A;  3GTK I;  1QXF A;  3VTN A;  2JUB A;  1PFT A;  3QWU A;  4HH4 A;  1S72 1;  4E33 A;  2DE6 A;  1YHQ 1;  4NFR A;  2BJO A;  1Q7Y 2;  2GTH A;  2GU2 A;  3CMA 1;  4DK1 A;  2LFU A;  3S1Q I;  1Z02 A;  3VMG A;  3VMI A;  3S16 I;  2V45 A;  1NP6 A;  1Z03 A;  3HOY I;  4A3K I;  1WW9 A;  4A3D I;  1N8R 2;  1ZH1 A;  3MZL B;  5C44 I;  5D1O B;  3U50 C;  1VQP 1;  4A3C I;  5D1O A;  2QRD B;  2QRE B;  2QA4 Z;  1ZB8 A;  3CCM Z;  3K7A I;  3G4S 1;  1KC8 2;  4MH4 A;  2V8J A;  3GTJ I;  1VQ7 1;  2IZ4 A;  2JR6 A;  1YJN 1;  4A3J I;  1R9T I;  3G71 Z;  4RVG A;  3CCE Z;  1M90 2;  1VQN Z;  1RQF A;  4DGL A;  4BBS I;  3CCL 1;  2JA7 I;  1X0T A;  5A2Q b;  4BBR I;  3J80 b;  2JIO A;  2JA5 I;  5CM2 M;  1K9M 2;  2JIM A;  3NFZ A;  1VQ9 Z;  3CCU 1;  1X3W A;  2QA4 1;  3S17 I;  2LIY A;  5D1P A;  4BY7 I;  3ESW A;  1M1K 1;  1TFI A;  3CPW Y;  3H3V J;  3GTM S;  2QEX Z;  1KD1 1;  1KQS Y;  5LL6 f;  3T4N B;  2AKL A;  3CME 1;  2OTL Z;  1QVG Y;  1YIJ Z;  3M3Y I;  3CCL Z;  2JMO A;  3CC7 1;  5A2Q f;  3J7A 4;  1TWG I;  2W04 A;  4RV9 A;  3GTM I;  4E2W A;  3TE5 B;  2JIP A;  3PO2 I;  3JAM f;  2QLV B;  1P9N A;  1VQL Z;  2G2K A;  2I3C A;  4RVH A;  3J81 b;  4NH1 C;  1Q81 2;  3VMH A;  3S14 I;  3NDJ A;  3EER A;  3I56 Z;  3CD6 Z;  3F3F C;  2H85 A;  1W2B Y;  4MD7 A;  3HOZ I;  1YJ9 1;  4NBD A;  3CCM 1;  2V8K A;  4E2X A;  1ZB9 A;  4A3G I;  5IT9 f;  3D6W A;  2HF1 A;  4NBC A;  3HOU I;  2E2J I;  4X6A I;  1ML8 A;  4NB8 A;  1RO0 A;  3CCV Z;  1SIW A;  5AN9 F;  3MON A;  4E32 A;  1JJ2 Z;  1VQ6 Z;  3JAM b;  3BG0 B;  3HOX I;  3GTP I;  5FLM I;  3OW2 Y;  3GKQ A;  2JA8 I;  1KC8 1;  1M1K 2;  3IF8 A;  3FKI I;  3HKZ A;  4EWC A;  1Q86 2;  3VB9 A;  3I56 1;  3P5J B;  3GTQ I;  5IP7 I;  4NBE A;  2ZAE B;  5FLX b;  2F4M A;  1K83 I;  2E2I I;  4MON A;  3TDH B;  3CXC Y;  1DL6 A;  3HOW I;  4Y52 I;  3RZD I;  3M4O I;  3I55 Z;  1I3Q I;  2HU9 A;  4A3B I;  2WB1 A;  1Y1V I;  4Y7N I;  4QTU A;  3KIH A;  2W03 A;  4AYB A;  1TWH I;  2K3R A;  1YI2 1;  2IV2 X;  1QYP A;  1WII A;  4TNU A;  3OW2 Z;  1QVF Z;  2YAD A;  3CC4 Z;  3CPW Z;  1TWA I;  2P3Y A;  1RNI A;  2VF1 A;  3D2L A;  3S1R I;  3CCQ 1;  3J80 f;  5T6B A;  1VQL 1;  3J81 f;  2B63 I;  1JWH C;  1I50 I;  2DE7 A;  1YIJ 1;  2JIR A;  3S2D I;  2VPY A;  3GCF A;  1NJI 1;  2E2H I;  1Q81 1;  2KPI A;  4MD9 A;  2VUG A;  1VQ4 1;  1VQ5 Z;  2M6N A;  2RIQ A;  1KRL A;  1TWF I;  2R7Z I;  3CXC Z;  1Q82 2;  4NBG A;  1YUK A;  2Q4Z A;  5IT9 b;  2Y0S A;  1NUI A;  1FDO A;  1JJ2 Y;  1RO2 A;  3CCU Z;  1Q7Y 1;  2JNY A;  2PK7 A;  3CCJ 1;  2VPX A;  4NBH A;  4NOZ A;  1M90 1;  1S7M A;  4HGZ A;  1QVF Y;  1VQK 1;  1N2F A;  1VQO Z;  2JIQ A;  2PM9 A;  3Q87 A;  1YHQ Z;  2WAQ A;  1TWC I;  2R6M A;  2OZK A;  5C4J I;  3I4N I;  1YJW Z;  3G4S Z;  2QKD A;  1FDI A;  1VQP Z;  1N8R 1;  4BY1 I;  1VQO 1;  4MXU A;  1Y1V S;  2NAP A;  1RO4 A;  1Q16 A;  2NVT I;  3H0G I;  4BXX I;  1K73 2;  3CC4 1;  5T67 A;  3S2H I;  2F4O A;  4DQY B;  3CD6 1;  2RHB A;  2OOY B;  1K8A 2;  2RBL A;  3NH4 A;  1LQL A;  3NH8 A;  2E9H A;  2E7Z A;  4E2Z A;  2VPZ A;  3HOV I;  2QR1 B;  4RS4 A;  3G6E 1;  2YU9 I;  1K9M 1;  2NVX I;  1YI2 Z;  2VPW A;  1X3Z A;  2GTI A;  2OOX B;  1YIT Z;  1VQN 1;  3I4M I;  2R92 I;  1SFO I;  4A3F I;  1YJN Z;  2DE5 A;  4QTT A;  3CC2 1;  1VQ7 Z;  1VQ9 1;  1K73 1;  1YJW 1;  3MZK B;  3S1M I;  3CCS 1;  2OTJ Z;  2R93 I;  3GTL I;  1VQ8 Z;  3D9X A;  3CC7 Z;  3NDI A;  1YIT 1;  4S1T A;  3IFU A;  2Q51 A;  2OTL 1;  2QRC B;  2O4H A;  3KIF A;  1RLY A;  2NVY I;  2QEX 1;  3CCR Z;  2VUM I;  1USP B;  1VQK Z;  1K8A 1;  3G71 1; 
#chains in the Genus database with same CATH homology
 3GTO I;  2JA6 I;  4CL1 A;  4E2Y A;  3CCJ Z;  1YJ9 Z;  2RPR A;  5C3E I;  2EGT A;  2NVQ I;  2V8I A;  3CMA Z;  1Q86 1;  2IZ3 A;  1USP A;  3FQQ A;  4NBF A;  4A3E I;  1Z01 A;  3CCR 1;  4A3M I;  1S72 Z;  2PMZ A;  1VQ6 1;  3S1N I;  1WCM I;  3CQZ I;  3CCS Z;  3F3P C;  1L1O C;  4RVF A;  4RVD A;  5C4X I;  1YUA A;  1I6H I;  2RT9 A;  3CCV 1;  4E30 A;  1Y1W I;  3CC2 Z;  4MD8 A;  4MRI A;  5IP9 I;  1VQM 1;  1KQS Z;  1VLA A;  4A3I I;  3EED A;  4NB9 A;  2O53 A;  3GTG I;  3I07 A;  3PO3 S;  4XX2 A;  3PO3 I;  2JS4 A;  1VQ5 1;  2OTJ 1;  3G6E Z;  3BG1 B;  3S15 I;  1Q82 1;  4A93 I;  4NBA A;  3CCQ Z;  1KD1 2;  4E31 A;  3I55 1;  2K5R A;  5T64 A;  3NH5 A;  3CME Z;  1NJI 2;  1VQ4 Z;  3LUS A;  3IX0 A;  2J6A A;  3FQM A;  4HGY A;  5FLX f;  2P28 A;  1W2B Z;  2KI7 B;  3RZO I;  3CCE 1;  1VQ8 1;  1QVG Z;  4A3L I;  1VQM Z;  2M48 A;  1QF8 A;  4NBB A;  3GTK I;  3VTN A;  2JUB A;  1PFT A;  3QWU A;  4HH4 A;  1S72 1;  4E33 A;  2DE6 A;  1YHQ 1;  4NFR A;  2BJO A;  1Q7Y 2;  2GTH A;  2GU2 A;  3CMA 1;  4DK1 A;  2LFU A;  3S1Q I;  1Z02 A;  3VMG A;  3VMI A;  3S16 I;  1NP6 A;  1Z03 A;  3HOY I;  4A3K I;  1WW9 A;  4A3D I;  1N8R 2;  1ZH1 A;  3MZL B;  5C44 I;  5D1O B;  3U50 C;  1VQP 1;  4A3C I;  5D1O A;  2QRD B;  2QRE B;  2QA4 Z;  1ZB8 A;  3CCM Z;  3K7A I;  3G4S 1;  1KC8 2;  4MH4 A;  2V8J A;  3GTJ I;  1VQ7 1;  2IZ4 A;  2JR6 A;  1YJN 1;  4A3J I;  1R9T I;  3G71 Z;  4RVG A;  3CCE Z;  1M90 2;  1VQN Z;  1RQF A;  4DGL A;  4BBS I;  3CCL 1;  2JA7 I;  1X0T A;  5A2Q b;  4BBR I;  3J80 b;  2JA5 I;  5CM2 M;  1K9M 2;  3NFZ A;  1VQ9 Z;  3CCU 1;  1X3W A;  2QA4 1;  3S17 I;  2LIY A;  5D1P A;  4BY7 I;  3ESW A;  1M1K 1;  1TFI A;  3CPW Y;  3H3V J;  3GTM S;  2QEX Z;  1KD1 1;  1KQS Y;  5LL6 f;  3T4N B;  2AKL A;  3CME 1;  2OTL Z;  1QVG Y;  1YIJ Z;  3M3Y I;  3CCL Z;  2JMO A;  3CC7 1;  5A2Q f;  3J7A 4;  1TWG I;  2W04 A;  4RV9 A;  3GTM I;  4E2W A;  3TE5 B;  3PO2 I;  3JAM f;  2QLV B;  1P9N A;  1VQL Z;  2G2K A;  2I3C A;  4RVH A;  3J81 b;  4NH1 C;  1Q81 2;  3VMH A;  3S14 I;  3NDJ A;  3EER A;  3I56 Z;  3CD6 Z;  3F3F C;  2H85 A;  1W2B Y;  4MD7 A;  3HOZ I;  1YJ9 1;  4NBD A;  3CCM 1;  2V8K A;  4E2X A;  1ZB9 A;  4A3G I;  5IT9 f;  3D6W A;  2HF1 A;  4NBC A;  3HOU I;  2E2J I;  4X6A I;  1ML8 A;  4NB8 A;  1RO0 A;  3CCV Z;  5AN9 F;  3MON A;  4E32 A;  1JJ2 Z;  1VQ6 Z;  3JAM b;  3BG0 B;  3HOX I;  3GTP I;  5FLM I;  3OW2 Y;  3GKQ A;  2JA8 I;  1KC8 1;  1M1K 2;  3IF8 A;  3FKI I;  3HKZ A;  4EWC A;  1Q86 2;  3VB9 A;  3I56 1;  3P5J B;  3GTQ I;  5IP7 I;  4NBE A;  2ZAE B;  5FLX b;  2F4M A;  1K83 I;  2E2I I;  4MON A;  3TDH B;  3CXC Y;  1DL6 A;  3HOW I;  4Y52 I;  3RZD I;  3M4O I;  3I55 Z;  1I3Q I;  2HU9 A;  4A3B I;  2WB1 A;  1Y1V I;  4Y7N I;  4QTU A;  3KIH A;  2W03 A;  4AYB A;  1TWH I;  2K3R A;  1YI2 1;  1QYP A;  1WII A;  4TNU A;  3OW2 Z;  1QVF Z;  2YAD A;  3CC4 Z;  3CPW Z;  1TWA I;  2P3Y A;  1RNI A;  2VF1 A;  3S1R I;  3CCQ 1;  3J80 f;  5T6B A;  1VQL 1;  3J81 f;  2B63 I;  1JWH C;  1I50 I;  2DE7 A;  1YIJ 1;  3S2D I;  1NJI 1;  3GCF A;  2E2H I;  1Q81 1;  2KPI A;  4MD9 A;  2VUG A;  1VQ4 1;  1VQ5 Z;  2M6N A;  2RIQ A;  1KRL A;  1TWF I;  2R7Z I;  3CXC Z;  1Q82 2;  4NBG A;  1YUK A;  2Q4Z A;  5IT9 b;  2Y0S A;  1NUI A;  1JJ2 Y;  1RO2 A;  3CCU Z;  1Q7Y 1;  2JNY A;  2PK7 A;  3CCJ 1;  4NOZ A;  4NBH A;  1M90 1;  1S7M A;  4HGZ A;  1QVF Y;  1VQK 1;  1N2F A;  1VQO Z;  2PM9 A;  3Q87 A;  1YHQ Z;  2WAQ A;  1TWC I;  2R6M A;  2OZK A;  5C4J I;  3I4N I;  1YJW Z;  3G4S Z;  2QKD A;  1VQP Z;  1N8R 1;  4BY1 I;  1VQO 1;  4MXU A;  1Y1V S;  1RO4 A;  2NVT I;  3H0G I;  4BXX I;  1K73 2;  3CC4 1;  5T67 A;  3S2H I;  2F4O A;  4DQY B;  3CD6 1;  2RHB A;  2OOY B;  1K8A 2;  2RBL A;  3NH4 A;  1LQL A;  3NH8 A;  2E9H A;  4E2Z A;  3HOV I;  2QR1 B;  4RS4 A;  3G6E 1;  2YU9 I;  1K9M 1;  2NVX I;  1YI2 Z;  1X3Z A;  2GTI A;  2OOX B;  1YIT Z;  1VQN 1;  3I4M I;  2R92 I;  1SFO I;  4A3F I;  1YJN Z;  2DE5 A;  4QTT A;  3CC2 1;  1VQ7 Z;  1VQ9 1;  1K73 1;  1YJW 1;  3MZK B;  3S1M I;  3CCS 1;  2OTJ Z;  2R93 I;  3GTL I;  1VQ8 Z;  3D9X A;  3CC7 Z;  3NDI A;  1YIT 1;  4S1T A;  3IFU A;  2Q51 A;  2OTL 1;  2QRC B;  2O4H A;  3KIF A;  1RLY A;  2NVY I;  2QEX 1;  3CCR Z;  2VUM I;  1USP B;  1VQK Z;  1K8A 1;  3G71 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...