4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
3S14I 1YUAA 3VB9A 3S1QI 2HF1A 2PK7A 3RZOI 2AKLA 4NBBA 1SFOI 1USPB 3I4MI 3I4NI 4NBDA 4Y7NI 4NBFA 3GTOI 3GTJI 5IP9I 4A3II 5C4XI 4A3FI 2JR6A 1NUIA 3FKII 1I3QI 5C44I 4NBAA 2YU9I 2J6AA 3GTKI 2NVYI 3S15I 3GTQI 3I07A 5IP7I 3H3VJ 1R9TI 2B63I 4A3MI 1RO4A 1L1OC 4NOZA 1Y1WI 1VLAA 4NBGA 4NB8A 2R93I 3HOXI 4QTUA 1TWHI 1USPA 2F4OA 2JNYA 4NBCA 2P3YA 4BY7I 3Q87A 3S1RI 1ZB8A 4A3JI 2BJOA 2DE6A 3K7AI 1K83I 3CQZI 4MH4A 4X6AI 1ML8A 3LUSA 2R92I 3VMIA 2JA6I 1WCMI 2KPIA 1DL6A 2K5RA 3M4OI 2DE5A 1LQLA 3H0GI 1I50I 2R7ZI 3ESWA 3GTPI 1TFIA 3U50C 5C3EI 5C4JI 4XX2A 1I6HI 1ZB9A 3RZDI 3GTMI 3PO2I 1N2FA 3S2HI 3GKQA 1RLYA 4Y52I 3S17I 3GCFA 2E2II 1TWFI 4A3KI 2NVTI 4A3CI 4NBHA 2JS4A 3EERA 2JA5I 3GTMS 1X3WA 2JA8I 3S2DI 1Y1VI 3HOUI 1TWAI 1PFTA 4A93I 3GTLI 1TWGI 2DE7A 2JA7I 4A3LI 3VMGA 4BY1I 1TWCI 1WW9A 1Y1VS 3S16I 4A3DI 2F4MA 5FLMI 3HOZI 2NVXI 1QYPA 3S1NI 2E2HI 4NBEA 3M3YI 4NB9A 4A3EI 2NVQI 4BBSI 3PO3I 4BBRI 3GTGI 2VUMI 3HOYI 3HOVI 4QTTA 3D6WA 3HOWI 2E2JI 4BXXI 3S1MI 5CM2M 3VMHA 4A3GI 4A3BI 1X3ZA 2RBLA 3PO3S
chains in the Genus database with same CATH superfamily
3NDJA 3CMAZ 1AA6A 3CMEZ 3CCMZ 3KIHA 1SFOI 2QLVB 3EEDA 4Y7NI 2QEX1 5IP9I 4A3FI 1YJW1 2GTHA 1YIJ1 5IT9f 1K8A2 3G6E1 5C44I 3KIFA 3I551 1YITZ 1WJ2A 3GTQI 3I07A 1YJ9Z 2VUGA 4A3MI 2QRDB 1RO4A 3CC7Z 3VTNA 2M6NA 3CCJZ 4QTUA 1QVGZ 2F4OA 2EGTA 4NBCA 1VQ71 2Y0SA 1VQ81 3CPWZ 1Q812 4BY7I 5T67A 2BJOA 2DE6A 2K3RA 5FLXb 4MH4A 3CXCZ 2R92I 2V8KA 3J7A4 1QVFY 5LL6f 1DL6A 1VQP1 1M901 4MXUA 1VQ4Z 2OTL1 2LFUA 5C4JI 1WZNA 3CCEZ 2HU9A 2QRCB 3G711 1ZB9A 3GTMI 3PO2I 1VQO1 3S2HI 3GKQA 1RLYA 1RO2A 3TE5B 2NVTI 4NBHA 1Q16A 2JA5I 3GTMS 1YHQ1 2WAQA 2V3VA 1PFTA 4A93I 1Q822 1QVFZ 1WIIA 2V8IA 2O4HA 3CCR1 1KC81 1WW9A 3D2LA 5FLMI 1VQK1 1Q7Y2 2ZAEB 4NB9A 1Y8CA 1K732 3PO3I 1YJWZ 4BBRI 3GTGI 2GU2A 1YIJZ 3D6WA 2QA41 3G6EZ 3S1MI 5CM2M 3I55Z 2LEXA 1RO0A 2I3CA 5D1PA 3PO3S 4E2YA 3VB9A 4RVDA 2RIQA 1N8R1 4TNUA 2PK7A 4MD9A 3I4MI 2PM9A 4NBFA 1KD11 3GTOI 3GTJI 1VQ7Z 4RS4A 4DGLA 4NBAA 2YU9I 1M1K1 2J6AA 3GTKI 2NVYI 5IP7I 3H3VJ 2B63I 1JWHC 3NH8A 4HGZA 3CCS1 1VQPZ 1QVGY 1Y1WI 3CPWY 2M48A 3MONA 2OTLZ 2P3YA 3CCQ1 1W2BZ 1FDOA 1VQL1 2LIYA 2OTJZ 3CXCY 4S1TA 3G71Z 1K83I 3J81b 1VQOZ 4X6AI 1ML8A 4CL1A 2VPWA 4DQYB 3CC2Z 2K5RA 1M1K2 1RQFA 4E30A 3M4OI 2W04A 1LQLA 1YHQZ 4EWCA 3ESWA 2P28A 2VF1A 5D1OB 1NJI1 5C3EI 1RNIA 3IR7A 4XX2A 1I6HI 4NFRA 3CCRZ 3RZDI 2PMZA 3I561 3CCL1 1N2FA 1VQKZ 4Y52I 2JUBA 3GCFA 2E2II 3EERA 2RHBA 3CCV1 3NFZA 4RVHA 3CC41 2Q4ZA 3G4S1 3TDHB 1VQ9Z 3CD6Z 4BY1I 5FLXf 4A3DI 3NH5A 1VQ61 2GTIA 1VQN1 2E9HA 5T6BA 1QYPA 2VPZA 3S1NI 2E2HI 4NBEA 2IZ4A 1NP6A 1Z02A 2IZ3A 2E2JI 4BXXI 3VMHA 1QXFA 2RT9A 2RBLA 3CME1 3S14I 3CCSZ 1M902 2JIPA 3RZOI 3D9XA 4NBBA 1K9M1 1Z01A 3CCQZ 4A3II 5C4XI 3MZLB 1VQLZ 2JIOA 1NUIA 1I3QI 4NH1C 1YJ91 2QEXZ 3T4NB 3CCU1 4E2WA 3S15I 2R6MA 2JIMA 3NDIA 3BG1B 4RVGA 4NOZA 1Q861 4NBGA 2R93I 1W2BY 3HOXI 3F3PC 2YADA 2V8JA 1USPA 1KC82 1ZB8A 4A3JI 1VQM1 1YUKA 1VQ8Z 2IV2X 3K7AI 3I56Z 3CQZI 3CCLZ 1K9M2 1JJ2Z 3VMIA 2OOXB 1WCMI 2KPIA 3JAMb 2DE5A 3CCVZ 2R7ZI 3CC4Z 3MZKB 3U50C 4DK1A 3IFUA 1N8R2 4E2ZA 2W03A 2QR1B 2OZKA 3BG0B 4A3KI 1KD12 2OOYB 5A2Qb 1Y1VI 5IT9b 4E2XA 3HOUI 1TWAI 3OW2Z 3GTLI 1TWGI 2O53A 1Q811 1VQ51 2JA7I 4A3LI 3F3FC 3VMGA 3FQQA 3J81f 1Y1VS 2F4MA 1YI21 2NVXI 2E7ZA 5A2Qf 2NVQI 2VUMI 4QTTA 4RVFA 3CCUZ 2JIQA 4A3BI 1X3ZA 2QA4Z 4HGYA 3NH4A 1YUAA 3S1QI 2HF1A 2AKLA 1USPB 2VPXA 3I4NI 4NBDA 1S721 2RPRA 1NJI2 2JR6A 3FKII 3J80b 1VQMZ 1Q821 1YJN1 1R9TI 3CMA1 1FDIA 3HKZA 1L1OC 4E33A 3CCM1 1VLAA 4NB8A 3J80f 2KI7B 2OTJ1 1TWHI 1Q7Y1 2JNYA 2JMOA 1KQSY 1K731 3Q87A 1ZH1A 2JIRA 3S1RI 1JJ2Y 1S7MA 1P9NA 2G2KA 4RV9A 3CC21 1YIT1 3LUSA 2VPYA 2JA6I 4HH4A 3CC71 3IX0A 3CCJ1 3H0GI 3P5JB 1I50I 5D1OA 4AYBA 3GTPI 1TFIA 1VQ5Z 4MD7A 2V45A 4E31A 1Z03A 3FQMA 1YI2Z 4MONA 1KRLA 4MRIA 1KQSZ 3S17I 2QREB 1TWFI 4A3CI 2JS4A 2AYDA 3OW2Y 1X3WA 3IF8A 2NAPA 2JA8I 3S2DI 1VQ91 1VQ41 4E32A 3CD61 2DE7A 2QKDA 5AN9F 3CCE1 1SIWA 1TWCI 3G4SZ 3S16I 1K8A1 1Q862 3HOZI 2H85A 1S72Z 2Q51A 3M3YI 3JAMf 4A3EI 1X0TA 1VQ6Z 1VQNZ 4BBSI 3HOYI 3HOVI 5T64A 3HOWI 3QWUA 2WB1A 4A3GI 4MD8A 1QF8A 1YJNZ
chains in the Genus database with same CATH topology
3NDJA 3CMAZ 3CMEZ 3CCMZ 3KIHA 1SFOI 2QLVB 3EEDA 4Y7NI 2QEX1 5IP9I 4A3FI 1YJW1 2GTHA 1YIJ1 5IT9f 1K8A2 3G6E1 5C44I 3KIFA 3I551 1YITZ 3GTQI 3I07A 1YJ9Z 2VUGA 4A3MI 2QRDB 1RO4A 3CC7Z 3VTNA 2M6NA 3CCJZ 4QTUA 1QVGZ 2EGTA 2F4OA 4NBCA 1VQ71 2Y0SA 1VQ81 3CPWZ 1Q812 4BY7I 5T67A 2BJOA 2DE6A 2K3RA 5FLXb 4MH4A 3CXCZ 2R92I 2V8KA 3J7A4 1QVFY 5LL6f 1DL6A 1VQP1 1M901 4MXUA 1VQ4Z 2OTL1 2LFUA 5C4JI 3CCEZ 2HU9A 2QRCB 3G711 1ZB9A 3GTMI 3PO2I 1VQO1 3S2HI 3GKQA 1RLYA 1RO2A 3TE5B 2NVTI 4NBHA 2JA5I 3GTMS 1YHQ1 2WAQA 1PFTA 4A93I 1Q822 1QVFZ 1WIIA 2V8IA 2O4HA 3CCR1 1KC81 1WW9A 5FLMI 1VQK1 1Q7Y2 2ZAEB 4NB9A 1K732 3PO3I 1YJWZ 4BBRI 3GTGI 2GU2A 1YIJZ 3D6WA 2QA41 3G6EZ 3S1MI 5CM2M 3I55Z 1RO0A 2I3CA 5D1PA 3PO3S 4E2YA 3VB9A 4RVDA 2RIQA 1N8R1 4TNUA 2PK7A 4MD9A 3I4MI 2PM9A 4NBFA 1KD11 3GTOI 3GTJI 1VQ7Z 4RS4A 4DGLA 4NBAA 2YU9I 1M1K1 2J6AA 3GTKI 2NVYI 5IP7I 3H3VJ 2B63I 1JWHC 3NH8A 4HGZA 3CCS1 1VQPZ 1QVGY 1Y1WI 3CPWY 2M48A 3MONA 2OTLZ 2P3YA 3CCQ1 1W2BZ 1VQL1 2LIYA 2OTJZ 3CXCY 4S1TA 3G71Z 1K83I 3J81b 1VQOZ 4X6AI 1ML8A 4CL1A 4DQYB 3CC2Z 2K5RA 1M1K2 1RQFA 4E30A 3M4OI 2W04A 1LQLA 1YHQZ 4EWCA 3ESWA 2P28A 2VF1A 5D1OB 1NJI1 5C3EI 1RNIA 4XX2A 1I6HI 4NFRA 3CCRZ 3RZDI 2PMZA 3I561 3CCL1 1N2FA 1VQKZ 4Y52I 2JUBA 3GCFA 2E2II 3EERA 2RHBA 3CCV1 3NFZA 4RVHA 3CC41 2Q4ZA 3G4S1 3TDHB 1VQ9Z 3CD6Z 4BY1I 5FLXf 4A3DI 3NH5A 1VQ61 2GTIA 1VQN1 2E9HA 5T6BA 1QYPA 3S1NI 2E2HI 4NBEA 2IZ4A 1NP6A 1Z02A 2IZ3A 2E2JI 4BXXI 3VMHA 2RT9A 2RBLA 3CME1 3S14I 3CCSZ 1M902 3RZOI 3D9XA 4NBBA 1K9M1 1Z01A 3CCQZ 4A3II 5C4XI 3MZLB 1VQLZ 1NUIA 1I3QI 4NH1C 1YJ91 2QEXZ 3T4NB 3CCU1 4E2WA 3S15I 2R6MA 3NDIA 3BG1B 4RVGA 4NOZA 1Q861 4NBGA 2R93I 1W2BY 3HOXI 3F3PC 2YADA 2V8JA 1USPA 1KC82 1ZB8A 4A3JI 1VQM1 1YUKA 1VQ8Z 3K7AI 3I56Z 3CQZI 3CCLZ 1K9M2 1JJ2Z 3VMIA 2OOXB 1WCMI 2KPIA 3JAMb 2DE5A 3CCVZ 2R7ZI 3CC4Z 3MZKB 3U50C 4DK1A 3IFUA 1N8R2 4E2ZA 2W03A 2QR1B 2OZKA 3BG0B 4A3KI 1KD12 2OOYB 5A2Qb 1Y1VI 5IT9b 4E2XA 3HOUI 1TWAI 3OW2Z 3GTLI 1TWGI 2O53A 1Q811 1VQ51 2JA7I 4A3LI 3F3FC 3VMGA 3FQQA 3J81f 1Y1VS 2F4MA 1YI21 2NVXI 5A2Qf 2NVQI 2VUMI 4QTTA 4RVFA 3CCUZ 4A3BI 1X3ZA 2QA4Z 4HGYA 3NH4A 1YUAA 3S1QI 2HF1A 2AKLA 1USPB 3I4NI 4NBDA 1S721 2RPRA 1NJI2 2JR6A 3FKII 3J80b 1VQMZ 1Q821 1YJN1 1R9TI 3CMA1 3HKZA 1L1OC 4E33A 3CCM1 1VLAA 4NB8A 3J80f 2KI7B 2OTJ1 1TWHI 1Q7Y1 2JNYA 2JMOA 1KQSY 1K731 3Q87A 1ZH1A 3S1RI 1JJ2Y 1S7MA 1P9NA 2G2KA 4RV9A 3CC21 1YIT1 3LUSA 2JA6I 4HH4A 3CC71 3IX0A 3CCJ1 3H0GI 3P5JB 1I50I 5D1OA 4AYBA 3GTPI 1TFIA 1VQ5Z 4MD7A 4E31A 1Z03A 3FQMA 1YI2Z 4MONA 1KRLA 4MRIA 1KQSZ 3S17I 2QREB 1TWFI 4A3CI 2JS4A 3OW2Y 1X3WA 3IF8A 2JA8I 3S2DI 1VQ91 1VQ41 4E32A 3CD61 2DE7A 2QKDA 5AN9F 3CCE1 1TWCI 3G4SZ 3S16I 1K8A1 1Q862 3HOZI 2H85A 1S72Z 2Q51A 3M3YI 3JAMf 4A3EI 1X0TA 1VQ6Z 1VQNZ 4BBSI 3HOYI 3HOVI 5T64A 3HOWI 3QWUA 2WB1A 4A3GI 4MD8A 1QF8A 1YJNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 I;  1YUA A;  3VB9 A;  3S1Q I;  2HF1 A;  2PK7 A;  3RZO I;  2AKL A;  4NBB A;  1SFO I;  1USP B;  3I4M I;  3I4N I;  4NBD A;  4Y7N I;  4NBF A;  3GTO I;  3GTJ I;  5IP9 I;  4A3I I;  5C4X I;  4A3F I;  2JR6 A;  1NUI A;  3FKI I;  1I3Q I;  5C44 I;  4NBA A;  2YU9 I;  2J6A A;  3GTK I;  2NVY I;  3S15 I;  3GTQ I;  3I07 A;  5IP7 I;  3H3V J;  1R9T I;  2B63 I;  4A3M I;  1RO4 A;  1L1O C;  4NOZ A;  1Y1W I;  1VLA A;  4NBG A;  4NB8 A;  2R93 I;  3HOX I;  4QTU A;  1TWH I;  1USP A;  2F4O A;  2JNY A;  4NBC A;  2P3Y A;  4BY7 I;  3Q87 A;  3S1R I;  1ZB8 A;  4A3J I;  2BJO A;  2DE6 A;  3K7A I;  1K83 I;  3CQZ I;  4MH4 A;  4X6A I;  1ML8 A;  3LUS A;  2R92 I;  3VMI A;  2JA6 I;  1WCM I;  2KPI A;  1DL6 A;  2K5R A;  3M4O I;  2DE5 A;  1LQL A;  3H0G I;  1I50 I;  2R7Z I;  3ESW A;  3GTP I;  1TFI A;  3U50 C;  5C3E I;  5C4J I;  4XX2 A;  1I6H I;  1ZB9 A;  3RZD I;  3GTM I;  3PO2 I;  1N2F A;  3S2H I;  3GKQ A;  1RLY A;  4Y52 I;  3S17 I;  3GCF A;  2E2I I;  1TWF I;  4A3K I;  2NVT I;  4A3C I;  4NBH A;  2JS4 A;  3EER A;  2JA5 I;  3GTM S;  1X3W A;  2JA8 I;  3S2D I;  1Y1V I;  3HOU I;  1TWA I;  1PFT A;  4A93 I;  3GTL I;  1TWG I;  2DE7 A;  2JA7 I;  4A3L I;  3VMG A;  4BY1 I;  1TWC I;  1WW9 A;  1Y1V S;  3S16 I;  4A3D I;  2F4M A;  5FLM I;  3HOZ I;  2NVX I;  1QYP A;  3S1N I;  2E2H I;  4NBE A;  3M3Y I;  4NB9 A;  4A3E I;  2NVQ I;  4BBS I;  3PO3 I;  4BBR I;  3GTG I;  2VUM I;  3HOY I;  3HOV I;  4QTT A;  3D6W A;  3HOW I;  2E2J I;  4BXX I;  3S1M I;  5CM2 M;  3VMH A;  4A3G I;  4A3B I;  1X3Z A;  2RBL A;  3PO3 S; 
#chains in the Genus database with same CATH topology
 3NDJ A;  3CMA Z;  1AA6 A;  3CME Z;  3CCM Z;  3KIH A;  1SFO I;  2QLV B;  3EED A;  4Y7N I;  2QEX 1;  5IP9 I;  4A3F I;  1YJW 1;  2GTH A;  1YIJ 1;  5IT9 f;  1K8A 2;  3G6E 1;  5C44 I;  3KIF A;  3I55 1;  1YIT Z;  1WJ2 A;  3GTQ I;  3I07 A;  1YJ9 Z;  2VUG A;  4A3M I;  2QRD B;  1RO4 A;  3CC7 Z;  3VTN A;  2M6N A;  3CCJ Z;  4QTU A;  1QVG Z;  2F4O A;  2EGT A;  4NBC A;  1VQ7 1;  2Y0S A;  1VQ8 1;  3CPW Z;  1Q81 2;  4BY7 I;  5T67 A;  2BJO A;  2DE6 A;  2K3R A;  5FLX b;  4MH4 A;  3CXC Z;  2R92 I;  2V8K A;  3J7A 4;  1QVF Y;  5LL6 f;  1DL6 A;  1VQP 1;  1M90 1;  4MXU A;  1VQ4 Z;  2OTL 1;  2LFU A;  5C4J I;  1WZN A;  3CCE Z;  2HU9 A;  2QRC B;  3G71 1;  1ZB9 A;  3GTM I;  3PO2 I;  1VQO 1;  3S2H I;  3GKQ A;  1RLY A;  1RO2 A;  3TE5 B;  2NVT I;  4NBH A;  1Q16 A;  2JA5 I;  3GTM S;  1YHQ 1;  2WAQ A;  2V3V A;  1PFT A;  4A93 I;  1Q82 2;  1QVF Z;  1WII A;  2V8I A;  2O4H A;  3CCR 1;  1KC8 1;  1WW9 A;  3D2L A;  5FLM I;  1VQK 1;  1Q7Y 2;  2ZAE B;  4NB9 A;  1Y8C A;  1K73 2;  3PO3 I;  1YJW Z;  4BBR I;  3GTG I;  2GU2 A;  1YIJ Z;  3D6W A;  2QA4 1;  3G6E Z;  3S1M I;  5CM2 M;  3I55 Z;  2LEX A;  1RO0 A;  2I3C A;  5D1P A;  3PO3 S;  4E2Y A;  3VB9 A;  4RVD A;  2RIQ A;  1N8R 1;  4TNU A;  2PK7 A;  4MD9 A;  3I4M I;  2PM9 A;  4NBF A;  1KD1 1;  3GTO I;  3GTJ I;  1VQ7 Z;  4RS4 A;  4DGL A;  4NBA A;  2YU9 I;  1M1K 1;  2J6A A;  3GTK I;  2NVY I;  5IP7 I;  3H3V J;  2B63 I;  1JWH C;  3NH8 A;  4HGZ A;  3CCS 1;  1VQP Z;  1QVG Y;  1Y1W I;  3CPW Y;  2M48 A;  3MON A;  2OTL Z;  2P3Y A;  3CCQ 1;  1W2B Z;  1FDO A;  1VQL 1;  2LIY A;  2OTJ Z;  3CXC Y;  4S1T A;  3G71 Z;  1K83 I;  3J81 b;  1VQO Z;  4X6A I;  1ML8 A;  4CL1 A;  2VPW A;  4DQY B;  3CC2 Z;  2K5R A;  1M1K 2;  1RQF A;  4E30 A;  3M4O I;  2W04 A;  1LQL A;  1YHQ Z;  4EWC A;  3ESW A;  2P28 A;  2VF1 A;  5D1O B;  1NJI 1;  5C3E I;  1RNI A;  3IR7 A;  4XX2 A;  1I6H I;  4NFR A;  3CCR Z;  3RZD I;  2PMZ A;  3I56 1;  3CCL 1;  1N2F A;  1VQK Z;  4Y52 I;  2JUB A;  3GCF A;  2E2I I;  3EER A;  2RHB A;  3CCV 1;  3NFZ A;  4RVH A;  3CC4 1;  2Q4Z A;  3G4S 1;  3TDH B;  1VQ9 Z;  3CD6 Z;  4BY1 I;  5FLX f;  4A3D I;  3NH5 A;  1VQ6 1;  2GTI A;  1VQN 1;  2E9H A;  5T6B A;  1QYP A;  2VPZ A;  3S1N I;  2E2H I;  4NBE A;  2IZ4 A;  1NP6 A;  1Z02 A;  2IZ3 A;  2E2J I;  4BXX I;  3VMH A;  1QXF A;  2RT9 A;  2RBL A;  3CME 1;  3S14 I;  3CCS Z;  1M90 2;  2JIP A;  3RZO I;  3D9X A;  4NBB A;  1K9M 1;  1Z01 A;  3CCQ Z;  4A3I I;  5C4X I;  3MZL B;  1VQL Z;  2JIO A;  1NUI A;  1I3Q I;  4NH1 C;  1YJ9 1;  2QEX Z;  3T4N B;  3CCU 1;  4E2W A;  3S15 I;  2R6M A;  2JIM A;  3NDI A;  3BG1 B;  4RVG A;  4NOZ A;  1Q86 1;  4NBG A;  2R93 I;  1W2B Y;  3HOX I;  3F3P C;  2YAD A;  2V8J A;  1USP A;  1KC8 2;  1ZB8 A;  4A3J I;  1VQM 1;  1YUK A;  1VQ8 Z;  2IV2 X;  3K7A I;  3I56 Z;  3CQZ I;  3CCL Z;  1K9M 2;  1JJ2 Z;  3VMI A;  2OOX B;  1WCM I;  2KPI A;  3JAM b;  2DE5 A;  3CCV Z;  2R7Z I;  3CC4 Z;  3MZK B;  3U50 C;  4DK1 A;  3IFU A;  1N8R 2;  4E2Z A;  2W03 A;  2QR1 B;  2OZK A;  3BG0 B;  4A3K I;  1KD1 2;  2OOY B;  5A2Q b;  1Y1V I;  5IT9 b;  4E2X A;  3HOU I;  1TWA I;  3OW2 Z;  3GTL I;  1TWG I;  2O53 A;  1Q81 1;  1VQ5 1;  2JA7 I;  4A3L I;  3F3F C;  3VMG A;  3FQQ A;  3J81 f;  1Y1V S;  2F4M A;  1YI2 1;  2NVX I;  2E7Z A;  5A2Q f;  2NVQ I;  2VUM I;  4QTT A;  4RVF A;  3CCU Z;  2JIQ A;  4A3B I;  1X3Z A;  2QA4 Z;  4HGY A;  3NH4 A;  1YUA A;  3S1Q I;  2HF1 A;  2AKL A;  1USP B;  2VPX A;  3I4N I;  4NBD A;  1S72 1;  2RPR A;  1NJI 2;  2JR6 A;  3FKI I;  3J80 b;  1VQM Z;  1Q82 1;  1YJN 1;  1R9T I;  3CMA 1;  1FDI A;  3HKZ A;  1L1O C;  4E33 A;  3CCM 1;  1VLA A;  4NB8 A;  3J80 f;  2KI7 B;  2OTJ 1;  1TWH I;  1Q7Y 1;  2JNY A;  2JMO A;  1KQS Y;  1K73 1;  3Q87 A;  1ZH1 A;  2JIR A;  3S1R I;  1JJ2 Y;  1S7M A;  1P9N A;  2G2K A;  4RV9 A;  3CC2 1;  1YIT 1;  3LUS A;  2VPY A;  2JA6 I;  4HH4 A;  3CC7 1;  3IX0 A;  3CCJ 1;  3H0G I;  3P5J B;  1I50 I;  5D1O A;  4AYB A;  3GTP I;  1TFI A;  1VQ5 Z;  4MD7 A;  2V45 A;  4E31 A;  1Z03 A;  3FQM A;  1YI2 Z;  4MON A;  1KRL A;  4MRI A;  1KQS Z;  3S17 I;  2QRE B;  1TWF I;  4A3C I;  2JS4 A;  2AYD A;  3OW2 Y;  1X3W A;  3IF8 A;  2NAP A;  2JA8 I;  3S2D I;  1VQ9 1;  1VQ4 1;  4E32 A;  3CD6 1;  2DE7 A;  2QKD A;  5AN9 F;  3CCE 1;  1SIW A;  1TWC I;  3G4S Z;  3S16 I;  1K8A 1;  1Q86 2;  3HOZ I;  2H85 A;  1S72 Z;  2Q51 A;  3M3Y I;  3JAM f;  4A3E I;  1X0T A;  1VQ6 Z;  1VQN Z;  4BBS I;  3HOY I;  3HOV I;  5T64 A;  3HOW I;  3QWU A;  2WB1 A;  4A3G I;  4MD8 A;  1QF8 A;  1YJN Z; 
#chains in the Genus database with same CATH homology
 3NDJ A;  3CMA Z;  3CME Z;  3CCM Z;  3KIH A;  1SFO I;  2QLV B;  3EED A;  4Y7N I;  2QEX 1;  5IP9 I;  4A3F I;  1YJW 1;  2GTH A;  1YIJ 1;  5IT9 f;  1K8A 2;  3G6E 1;  5C44 I;  3KIF A;  3I55 1;  1YIT Z;  3GTQ I;  3I07 A;  1YJ9 Z;  2VUG A;  4A3M I;  2QRD B;  1RO4 A;  3CC7 Z;  3VTN A;  2M6N A;  3CCJ Z;  4QTU A;  1QVG Z;  2EGT A;  2F4O A;  4NBC A;  1VQ7 1;  2Y0S A;  1VQ8 1;  3CPW Z;  1Q81 2;  4BY7 I;  5T67 A;  2BJO A;  2DE6 A;  2K3R A;  5FLX b;  4MH4 A;  3CXC Z;  2R92 I;  2V8K A;  3J7A 4;  1QVF Y;  5LL6 f;  1DL6 A;  1VQP 1;  1M90 1;  4MXU A;  1VQ4 Z;  2OTL 1;  2LFU A;  5C4J I;  3CCE Z;  2HU9 A;  2QRC B;  3G71 1;  1ZB9 A;  3GTM I;  3PO2 I;  1VQO 1;  3S2H I;  3GKQ A;  1RLY A;  1RO2 A;  3TE5 B;  2NVT I;  4NBH A;  2JA5 I;  3GTM S;  1YHQ 1;  2WAQ A;  1PFT A;  4A93 I;  1Q82 2;  1QVF Z;  1WII A;  2V8I A;  2O4H A;  3CCR 1;  1KC8 1;  1WW9 A;  5FLM I;  1VQK 1;  1Q7Y 2;  2ZAE B;  4NB9 A;  1K73 2;  3PO3 I;  1YJW Z;  4BBR I;  3GTG I;  2GU2 A;  1YIJ Z;  3D6W A;  2QA4 1;  3G6E Z;  3S1M I;  5CM2 M;  3I55 Z;  1RO0 A;  2I3C A;  5D1P A;  3PO3 S;  4E2Y A;  3VB9 A;  4RVD A;  2RIQ A;  1N8R 1;  4TNU A;  2PK7 A;  4MD9 A;  3I4M I;  2PM9 A;  4NBF A;  1KD1 1;  3GTO I;  3GTJ I;  1VQ7 Z;  4RS4 A;  4DGL A;  4NBA A;  2YU9 I;  1M1K 1;  2J6A A;  3GTK I;  2NVY I;  5IP7 I;  3H3V J;  2B63 I;  1JWH C;  3NH8 A;  4HGZ A;  3CCS 1;  1VQP Z;  1QVG Y;  1Y1W I;  3CPW Y;  2M48 A;  3MON A;  2OTL Z;  2P3Y A;  3CCQ 1;  1W2B Z;  1VQL 1;  2LIY A;  2OTJ Z;  3CXC Y;  4S1T A;  3G71 Z;  1K83 I;  3J81 b;  1VQO Z;  4X6A I;  1ML8 A;  4CL1 A;  4DQY B;  3CC2 Z;  2K5R A;  1M1K 2;  1RQF A;  4E30 A;  3M4O I;  2W04 A;  1LQL A;  1YHQ Z;  4EWC A;  3ESW A;  2P28 A;  2VF1 A;  5D1O B;  1NJI 1;  5C3E I;  1RNI A;  4XX2 A;  1I6H I;  4NFR A;  3CCR Z;  3RZD I;  2PMZ A;  3I56 1;  3CCL 1;  1N2F A;  1VQK Z;  4Y52 I;  2JUB A;  3GCF A;  2E2I I;  3EER A;  2RHB A;  3CCV 1;  3NFZ A;  4RVH A;  3CC4 1;  2Q4Z A;  3G4S 1;  3TDH B;  1VQ9 Z;  3CD6 Z;  4BY1 I;  5FLX f;  4A3D I;  3NH5 A;  1VQ6 1;  2GTI A;  1VQN 1;  2E9H A;  5T6B A;  1QYP A;  3S1N I;  2E2H I;  4NBE A;  2IZ4 A;  1NP6 A;  1Z02 A;  2IZ3 A;  2E2J I;  4BXX I;  3VMH A;  2RT9 A;  2RBL A;  3CME 1;  3S14 I;  3CCS Z;  1M90 2;  3RZO I;  3D9X A;  4NBB A;  1K9M 1;  1Z01 A;  3CCQ Z;  4A3I I;  5C4X I;  3MZL B;  1VQL Z;  1NUI A;  1I3Q I;  4NH1 C;  1YJ9 1;  2QEX Z;  3T4N B;  3CCU 1;  4E2W A;  3S15 I;  2R6M A;  3NDI A;  3BG1 B;  4RVG A;  4NOZ A;  1Q86 1;  4NBG A;  2R93 I;  1W2B Y;  3HOX I;  3F3P C;  2YAD A;  2V8J A;  1USP A;  1KC8 2;  1ZB8 A;  4A3J I;  1VQM 1;  1YUK A;  1VQ8 Z;  3K7A I;  3I56 Z;  3CQZ I;  3CCL Z;  1K9M 2;  1JJ2 Z;  3VMI A;  2OOX B;  1WCM I;  2KPI A;  3JAM b;  2DE5 A;  3CCV Z;  2R7Z I;  3CC4 Z;  3MZK B;  3U50 C;  4DK1 A;  3IFU A;  1N8R 2;  4E2Z A;  2W03 A;  2QR1 B;  2OZK A;  3BG0 B;  4A3K I;  1KD1 2;  2OOY B;  5A2Q b;  1Y1V I;  5IT9 b;  4E2X A;  3HOU I;  1TWA I;  3OW2 Z;  3GTL I;  1TWG I;  2O53 A;  1Q81 1;  1VQ5 1;  2JA7 I;  4A3L I;  3F3F C;  3VMG A;  3FQQ A;  3J81 f;  1Y1V S;  2F4M A;  1YI2 1;  2NVX I;  5A2Q f;  2NVQ I;  2VUM I;  4QTT A;  4RVF A;  3CCU Z;  4A3B I;  1X3Z A;  2QA4 Z;  4HGY A;  3NH4 A;  1YUA A;  3S1Q I;  2HF1 A;  2AKL A;  1USP B;  3I4N I;  4NBD A;  1S72 1;  2RPR A;  1NJI 2;  2JR6 A;  3FKI I;  3J80 b;  1VQM Z;  1Q82 1;  1YJN 1;  1R9T I;  3CMA 1;  3HKZ A;  1L1O C;  4E33 A;  3CCM 1;  1VLA A;  4NB8 A;  3J80 f;  2KI7 B;  2OTJ 1;  1TWH I;  1Q7Y 1;  2JNY A;  2JMO A;  1KQS Y;  1K73 1;  3Q87 A;  1ZH1 A;  3S1R I;  1JJ2 Y;  1S7M A;  1P9N A;  2G2K A;  4RV9 A;  3CC2 1;  1YIT 1;  3LUS A;  2JA6 I;  4HH4 A;  3CC7 1;  3IX0 A;  3CCJ 1;  3H0G I;  3P5J B;  1I50 I;  5D1O A;  4AYB A;  3GTP I;  1TFI A;  1VQ5 Z;  4MD7 A;  4E31 A;  1Z03 A;  3FQM A;  1YI2 Z;  4MON A;  1KRL A;  4MRI A;  1KQS Z;  3S17 I;  2QRE B;  1TWF I;  4A3C I;  2JS4 A;  3OW2 Y;  1X3W A;  3IF8 A;  2JA8 I;  3S2D I;  1VQ9 1;  1VQ4 1;  4E32 A;  3CD6 1;  2DE7 A;  2QKD A;  5AN9 F;  3CCE 1;  1TWC I;  3G4S Z;  3S16 I;  1K8A 1;  1Q86 2;  3HOZ I;  2H85 A;  1S72 Z;  2Q51 A;  3M3Y I;  3JAM f;  4A3E I;  1X0T A;  1VQ6 Z;  1VQN Z;  4BBS I;  3HOY I;  3HOV I;  5T64 A;  3HOW I;  3QWU A;  2WB1 A;  4A3G I;  4MD8 A;  1QF8 A;  1YJN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...