4A3II

Rna polymerase ii binary complex with dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3iI02
5CM2M 2P3YA 2YU9I 1TWAI 4Y7NI 3FKII 4BBRI 2NVXI 3S1QI 4NBFA 2JA7I 4NBEA 2JA6I 3HOUI 3M3YI 1Y1VI 3GTKI 2DE7A 4XX2A 4A3II 3GTQI 3U50C 3VB9A 3H0GI 1QYPA 2R93I 4NBDA 4A3JI 3HOWI 2R92I 4NOZA 2E2II 2JNYA 3S16I 4NBHA 2NVTI 2E2JI 4BY1I 4BBSI 1TWHI 4BXXI 2K5RA 1Y1WI 4A3BI 3PO3S 3S2HI 2E2HI 3S15I 4A93I 1L1OC 2AKLA 3EERA 1WCMI 1TWFI 2DE5A 1DL6A 2JS4A 1RO4A 1TFIA 1LQLA 3LUSA 5C4XI 1I6HI 1I3QI 5FLMI 3GTLI 4NB8A 1NUIA 4MH4A 5C44I 1ML8A 1I50I 4A3DI 5IP9I 1USPA 3GTJI 3HOXI 3PO2I 2NVQI 4NB9A 3GTMI 4A3GI 3S17I 4A3FI 3S1RI 3RZDI 3HOZI 3S14I 3I4MI 1Y1VS 3S2DI 1X3ZA 3S1NI 4A3LI 2R7ZI 3GTPI 2JR6A 2KPIA 2BJOA 3ESWA 4NBCA 1TWGI 1YUAA 1USPB 2NVYI 3K7AI 4A3MI 1K83I 1N2FA 4NBBA 3GTOI 3D6WA 4Y52I 3Q87A 5C4JI 3GKQA 4QTTA 4NBGA 4BY7I 3H3VJ 3I07A 2HF1A 1VLAA 4A3EI 2J6AA 3S1MI 2JA8I 3HOYI 2RBLA 1X3WA 2VUMI 3PO3I 2B63I 4X6AI 4QTUA 3GTGI 3VMHA 5IP7I 2JA5I 1SFOI 3VMGA 2F4MA 4A3CI 3CQZI 3I4NI 1R9TI 1ZB9A 4NBAA 1TWCI 2F4OA 3HOVI 1ZB8A 1RLYA 3VMIA 4A3KI 2PK7A 3GTMS 3M4OI 3GCFA 1WW9A 1PFTA 2DE6A 3RZOI 5C3EI
chains in the Genus database with same CATH superfamily
2P3YA 2YU9I 1Z02A 1YI2Z 4BBRI 1X0TA 5IT9b 3MZLB 1N8R1 4NBFA 3CPWZ 4RVHA 4A3II 3GTQI 3U50C 1VQPZ 2RHBA 2H85A 2R93I 4RV9A 4NBDA 4A3JI 3HOWI 2R92I 3CC71 2W03A 3CCRZ 3I55Z 4RVDA 2K5RA 2IV2X 3IFUA 3CME1 3PO3S 1RNIA 3FQQA 1L1OC 1DL6A 4E2YA 2O4HA 1TFIA 1LQLA 1Q7Y2 1M1K2 5T6BA 1I3QI 2QLVB 5FLMI 1VQOZ 4MH4A 5C44I 3CCQ1 4HH4A 1I50I 2W04A 5IP9I 1Q861 2VPWA 3TDHB 1QVGZ 1VQ71 4A3GI 1AA6A 3S14I 2R6MA 1RO0A 3S2DI 3D9XA 4A3LI 2P28A 2PM9A 1Z03A 3I56Z 1VQMZ 2QREB 1YIJZ 4A3MI 2JIRA 4NBBA 3GTOI 3JAMb 2OTJZ 5D1OA 2JIQA 2JIPA 4QTTA 1FDOA 3S1MI 2RBLA 1X3WA 2B63I 2LIYA 3VMHA 2RT9A 2V8JA 2JA5I 2V3VA 3I4NI 1R9TI 3CCJ1 1ZB9A 2F4OA 5IT9f 2QA4Z 3CXCZ 3CC7Z 2M6NA 3GTMS 1WW9A 2DE6A 1W2BY 2K3RA 5C3EI 3CCM1 3CC21 1KRLA 3CMEZ 1YJ91 2KI7B 3S1QI 2JA7I 4S1TA 2JA6I 3CCL1 3HOUI 1Q811 3M3YI 2DE7A 2O53A 1QYPA 4CL1A 1QVFY 2GU2A 2JNYA 4NBHA 4E2ZA 3J80f 3CCQZ 2YADA 3NFZA 3CCU1 4RS4A 4TNUA 2E2HI 3S15I 3KIHA 2AYDA 3EERA 1VQ9Z 1WJ2A 2DE5A 2QRDB 2JS4A 1KQSZ 4E32A 1ZH1A 1Y8CA 3BG1B 4NB8A 1ML8A 2QR1B 1KC82 1Q7Y1 2WB1A 1RQFA 3GTJI 3PO2I 4NB9A 2LEXA 2OOYB 2G2KA 4AYBA 4A3FI 3S1RI 3RZDI 2Q51A 1X3ZA 2R7ZI 1VQ81 1TWGI 3J81b 4MD7A 3HKZA 2GTIA 3K7AI 4HGYA 1N2FA 1YJW1 3CCJZ 3G4SZ 3MZKB 4NH1C 3CMA1 1N8R2 4Y52I 2ZAEB 2QEX1 5AN9F 5C4JI 2V8KA 4DK1A 3CCE1 1JJ2Y 4BY7I 3H3VJ 3IR7A 3CCS1 2HF1A 4DGLA 3CCMZ 3CC2Z 2JA8I 3HOYI 2LFUA 1YJ9Z 1M901 2Y0SA 1YJN1 1VQ51 3VMGA 2F4MA 4E30A 1VQN1 3OW2Y 5T67A 3NDIA 1TWCI 5D1PA 2GTHA 1RLYA 2JMOA 2PK7A 3M4OI 2VPZA 3CCUZ 1NJI2 1TWAI 4Y7NI 3QWUA 5T64A 1S721 1KD12 2V45A 3J7A4 2NVXI 4EWCA 1Y1VI 3NH4A 2OTL1 4XX2A 1VQ61 3H0GI 5A2Qf 1JWHC 3MONA 2JUBA 3S16I 3G6E1 4BY1I 4BBSI 1K732 1TWHI 2OOXB 4BXXI 1VQL1 4A3BI 3S2HI 1Q822 1K9M1 4A93I 1TWFI 2IZ4A 3KIFA 1W2BZ 1VQ8Z 2WAQA 3LUSA 1K8A2 5FLXb 1VQK1 1WZNA 3GTLI 4MD9A 4E33A 1YJWZ 4MD8A 1QXFA 3CMAZ 2QEXZ 3J81f 1YUKA 3CCEZ 1VQ7Z 3HOZI 3I4MI 3CCSZ 3T4NB 2JIOA 3NH5A 1KC81 1QVFZ 2QKDA 3GTPI 2JR6A 2JIMA 2KPIA 2BJOA 1VQ5Z 1USPB 2NVYI 2RIQA 1K83I 4MONA 4MXUA 3NDJA 1Z01A 3BG0B 3CPWY 3Q87A 2Q4ZA 4MRIA 3GKQA 4NBGA 1M1K1 3P5JB 3CCV1 2VUMI 3PO3I 1S72Z 1VQ41 4X6AI 2VPXA 4QTUA 3JAMf 1YHQ1 5IP7I 4A3CI 3CQZI 2OTLZ 1WIIA 1VQ6Z 4RVFA 2QA41 1ZB8A 3G711 1FDIA 4RVGA 4A3KI 3GCFA 3IF8A 1PFTA 2VF1A 3G6EZ 2PMZA 5CM2M 5LL6f 1VQLZ 3CC41 3FKII 1S7MA 1YIT1 1RO2A 4NBEA 3J80b 4E31A 1QF8A 3GTKI 1QVGY 3CCLZ 1NJI1 3VB9A 1KD11 3D2LA 1JJ2Z 3CD61 1VQKZ 3FQMA 4NOZA 2E2II 2HU9A 2NVTI 2E2JI 2VUGA 2VPYA 1Y1WI 2EGTA 1YI21 5FLXf 3OW2Z 1VQ91 4NFRA 3F3PC 2AKLA 1K731 1WCMI 1RO4A 1VQP1 2I3CA 4DQYB 1Q862 1Q821 5C4XI 1I6HI 3CCR1 1NUIA 3I551 2E9HA 4E2WA 1Q16A 4A3DI 3F3FC 1M902 1USPA 3HOXI 1K8A1 2NVQI 2V8IA 3GTMI 3IX0A 3S17I 1SIWA 3TE5B 2QRCB 1Y1VS 3CXCY 2OZKA 3CCVZ 3S1NI 4HGZA 1VQ4Z 3ESWA 4NBCA 1YHQZ 1YUAA 3G4S1 1VQO1 2NAPA 3D6WA 3EEDA 2E7ZA 3G71Z 3NH8A 1NP6A 3I07A 1VLAA 4A3EI 2J6AA 2IZ3A 3CC4Z 3VTNA 1VQM1 3I561 3GTGI 1YITZ 5D1OB 2RPRA 1YIJ1 1SFOI 1YJNZ 2M48A 4NBAA 1VQNZ 2OTJ1 4E2XA 3CD6Z 3HOVI 1K9M2 3VMIA 1KQSY 3RZOI 1Q812 1P9NA 5A2Qb
chains in the Genus database with same CATH topology
2P3YA 2YU9I 1Z02A 1YI2Z 4BBRI 1X0TA 5IT9b 3MZLB 1N8R1 4NBFA 3CPWZ 4RVHA 4A3II 3GTQI 3U50C 1VQPZ 2RHBA 2H85A 2R93I 4RV9A 4NBDA 4A3JI 3HOWI 2R92I 3CC71 2W03A 3CCRZ 3I55Z 4RVDA 2K5RA 3IFUA 3CME1 3PO3S 1RNIA 3FQQA 1L1OC 1DL6A 4E2YA 2O4HA 1TFIA 1LQLA 1Q7Y2 1M1K2 5T6BA 1I3QI 2QLVB 5FLMI 1VQOZ 4MH4A 5C44I 3CCQ1 4HH4A 1I50I 2W04A 5IP9I 1Q861 3TDHB 1QVGZ 1VQ71 4A3GI 3S14I 2R6MA 1RO0A 3S2DI 3D9XA 4A3LI 2P28A 2PM9A 1Z03A 3I56Z 1VQMZ 2QREB 1YIJZ 4A3MI 4NBBA 3GTOI 3JAMb 2OTJZ 5D1OA 4QTTA 3S1MI 2RBLA 1X3WA 2B63I 2LIYA 3VMHA 2RT9A 2V8JA 2JA5I 3I4NI 1R9TI 3CCJ1 1ZB9A 2F4OA 5IT9f 2QA4Z 3CXCZ 3CC7Z 2M6NA 3GTMS 1WW9A 2DE6A 1W2BY 2K3RA 5C3EI 3CCM1 3CC21 1KRLA 3CMEZ 1YJ91 2KI7B 3S1QI 2JA7I 4S1TA 2JA6I 3CCL1 3HOUI 1Q811 3M3YI 2DE7A 2O53A 1QYPA 4CL1A 1QVFY 2GU2A 2JNYA 4NBHA 4E2ZA 3J80f 3CCQZ 2YADA 3NFZA 3CCU1 4RS4A 4TNUA 2E2HI 3S15I 3KIHA 3EERA 1VQ9Z 2DE5A 2QRDB 2JS4A 1KQSZ 4E32A 1ZH1A 3BG1B 4NB8A 1ML8A 2QR1B 1KC82 1Q7Y1 2WB1A 1RQFA 3GTJI 3PO2I 4NB9A 2OOYB 2G2KA 4AYBA 4A3FI 3S1RI 3RZDI 2Q51A 1X3ZA 2R7ZI 1VQ81 1TWGI 3J81b 4MD7A 3HKZA 2GTIA 3K7AI 4HGYA 1N2FA 1YJW1 3CCJZ 3G4SZ 3MZKB 4NH1C 3CMA1 1N8R2 4Y52I 2ZAEB 2QEX1 5AN9F 5C4JI 2V8KA 4DK1A 3CCE1 1JJ2Y 4BY7I 3H3VJ 3CCS1 2HF1A 4DGLA 3CCMZ 3CC2Z 2JA8I 3HOYI 2LFUA 1YJ9Z 1M901 2Y0SA 1YJN1 1VQ51 3VMGA 2F4MA 4E30A 1VQN1 3OW2Y 5T67A 3NDIA 1TWCI 5D1PA 2GTHA 1RLYA 2JMOA 2PK7A 3M4OI 3CCUZ 1NJI2 1TWAI 4Y7NI 3QWUA 5T64A 1S721 1KD12 3J7A4 2NVXI 4EWCA 1Y1VI 3NH4A 2OTL1 4XX2A 1VQ61 3H0GI 5A2Qf 1JWHC 3MONA 2JUBA 3S16I 3G6E1 4BY1I 4BBSI 1K732 1TWHI 2OOXB 4BXXI 1VQL1 4A3BI 3S2HI 1Q822 1K9M1 4A93I 1TWFI 2IZ4A 3KIFA 1W2BZ 1VQ8Z 2WAQA 3LUSA 1K8A2 5FLXb 1VQK1 3GTLI 4MD9A 4E33A 1YJWZ 4MD8A 3CMAZ 2QEXZ 3J81f 1YUKA 3CCEZ 1VQ7Z 3HOZI 3I4MI 3CCSZ 3T4NB 3NH5A 1KC81 1QVFZ 2QKDA 3GTPI 2JR6A 2KPIA 2BJOA 1VQ5Z 1USPB 2NVYI 2RIQA 1K83I 4MONA 4MXUA 3NDJA 1Z01A 3BG0B 3CPWY 3Q87A 2Q4ZA 4MRIA 3GKQA 4NBGA 1M1K1 3P5JB 3CCV1 2VUMI 3PO3I 1S72Z 1VQ41 4X6AI 4QTUA 3JAMf 1YHQ1 5IP7I 4A3CI 3CQZI 2OTLZ 1WIIA 1VQ6Z 4RVFA 2QA41 1ZB8A 3G711 4RVGA 4A3KI 3GCFA 3IF8A 1PFTA 2VF1A 3G6EZ 2PMZA 5CM2M 5LL6f 1VQLZ 3CC41 3FKII 1S7MA 1YIT1 1RO2A 4NBEA 3J80b 4E31A 1QF8A 3GTKI 1QVGY 3CCLZ 1NJI1 3VB9A 1KD11 1JJ2Z 3CD61 1VQKZ 3FQMA 4NOZA 2E2II 2HU9A 2NVTI 2E2JI 2VUGA 1Y1WI 2EGTA 1YI21 5FLXf 3OW2Z 1VQ91 4NFRA 3F3PC 2AKLA 1K731 1WCMI 1RO4A 1VQP1 2I3CA 4DQYB 1Q862 1Q821 5C4XI 1I6HI 3CCR1 1NUIA 3I551 2E9HA 4E2WA 4A3DI 3F3FC 1M902 1USPA 3HOXI 1K8A1 2NVQI 2V8IA 3GTMI 3IX0A 3S17I 3TE5B 2QRCB 1Y1VS 3CXCY 2OZKA 3CCVZ 3S1NI 4HGZA 1VQ4Z 3ESWA 4NBCA 1YHQZ 1YUAA 3G4S1 1VQO1 3D6WA 3EEDA 3G71Z 3NH8A 1NP6A 3I07A 1VLAA 4A3EI 2J6AA 2IZ3A 3CC4Z 3VTNA 1VQM1 3I561 3GTGI 1YITZ 5D1OB 2RPRA 1YIJ1 1SFOI 1YJNZ 2M48A 4NBAA 1VQNZ 2OTJ1 4E2XA 3CD6Z 3HOVI 1K9M2 3VMIA 1KQSY 3RZOI 1Q812 1P9NA 5A2Qb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM2 M;  2P3Y A;  2YU9 I;  1TWA I;  4Y7N I;  3FKI I;  4BBR I;  2NVX I;  3S1Q I;  4NBF A;  2JA7 I;  4NBE A;  2JA6 I;  3HOU I;  3M3Y I;  1Y1V I;  3GTK I;  2DE7 A;  4XX2 A;  4A3I I;  3GTQ I;  3U50 C;  3VB9 A;  3H0G I;  1QYP A;  2R93 I;  4NBD A;  4A3J I;  3HOW I;  2R92 I;  4NOZ A;  2E2I I;  2JNY A;  3S16 I;  4NBH A;  2NVT I;  2E2J I;  4BY1 I;  4BBS I;  1TWH I;  4BXX I;  2K5R A;  1Y1W I;  4A3B I;  3PO3 S;  3S2H I;  2E2H I;  3S15 I;  4A93 I;  1L1O C;  2AKL A;  3EER A;  1WCM I;  1TWF I;  2DE5 A;  1DL6 A;  2JS4 A;  1RO4 A;  1TFI A;  1LQL A;  3LUS A;  5C4X I;  1I6H I;  1I3Q I;  5FLM I;  3GTL I;  4NB8 A;  1NUI A;  4MH4 A;  5C44 I;  1ML8 A;  1I50 I;  4A3D I;  5IP9 I;  1USP A;  3GTJ I;  3HOX I;  3PO2 I;  2NVQ I;  4NB9 A;  3GTM I;  4A3G I;  3S17 I;  4A3F I;  3S1R I;  3RZD I;  3HOZ I;  3S14 I;  3I4M I;  1Y1V S;  3S2D I;  1X3Z A;  3S1N I;  4A3L I;  2R7Z I;  3GTP I;  2JR6 A;  2KPI A;  2BJO A;  3ESW A;  4NBC A;  1TWG I;  1YUA A;  1USP B;  2NVY I;  3K7A I;  4A3M I;  1K83 I;  1N2F A;  4NBB A;  3GTO I;  3D6W A;  4Y52 I;  3Q87 A;  5C4J I;  3GKQ A;  4QTT A;  4NBG A;  4BY7 I;  3H3V J;  3I07 A;  2HF1 A;  1VLA A;  4A3E I;  2J6A A;  3S1M I;  2JA8 I;  3HOY I;  2RBL A;  1X3W A;  2VUM I;  3PO3 I;  2B63 I;  4X6A I;  4QTU A;  3GTG I;  3VMH A;  5IP7 I;  2JA5 I;  1SFO I;  3VMG A;  2F4M A;  4A3C I;  3CQZ I;  3I4N I;  1R9T I;  1ZB9 A;  4NBA A;  1TWC I;  2F4O A;  3HOV I;  1ZB8 A;  1RLY A;  3VMI A;  4A3K I;  2PK7 A;  3GTM S;  3M4O I;  3GCF A;  1WW9 A;  1PFT A;  2DE6 A;  3RZO I;  5C3E I; 
#chains in the Genus database with same CATH topology
 2P3Y A;  2YU9 I;  1Z02 A;  1YI2 Z;  4BBR I;  1X0T A;  5IT9 b;  3MZL B;  1N8R 1;  4NBF A;  3CPW Z;  4RVH A;  4A3I I;  3GTQ I;  3U50 C;  1VQP Z;  2RHB A;  2H85 A;  2R93 I;  4RV9 A;  4NBD A;  4A3J I;  3HOW I;  2R92 I;  3CC7 1;  2W03 A;  3CCR Z;  3I55 Z;  4RVD A;  2K5R A;  2IV2 X;  3IFU A;  3CME 1;  3PO3 S;  1RNI A;  3FQQ A;  1L1O C;  1DL6 A;  4E2Y A;  2O4H A;  1TFI A;  1LQL A;  1Q7Y 2;  1M1K 2;  5T6B A;  1I3Q I;  2QLV B;  5FLM I;  1VQO Z;  4MH4 A;  5C44 I;  3CCQ 1;  4HH4 A;  1I50 I;  2W04 A;  5IP9 I;  1Q86 1;  2VPW A;  3TDH B;  1QVG Z;  1VQ7 1;  4A3G I;  1AA6 A;  3S14 I;  2R6M A;  1RO0 A;  3S2D I;  3D9X A;  4A3L I;  2P28 A;  2PM9 A;  1Z03 A;  3I56 Z;  1VQM Z;  2QRE B;  1YIJ Z;  4A3M I;  2JIR A;  4NBB A;  3GTO I;  3JAM b;  2OTJ Z;  5D1O A;  2JIQ A;  2JIP A;  4QTT A;  1FDO A;  3S1M I;  2RBL A;  1X3W A;  2B63 I;  2LIY A;  3VMH A;  2RT9 A;  2V8J A;  2JA5 I;  2V3V A;  3I4N I;  1R9T I;  3CCJ 1;  1ZB9 A;  2F4O A;  5IT9 f;  2QA4 Z;  3CXC Z;  3CC7 Z;  2M6N A;  3GTM S;  1WW9 A;  2DE6 A;  1W2B Y;  2K3R A;  5C3E I;  3CCM 1;  3CC2 1;  1KRL A;  3CME Z;  1YJ9 1;  2KI7 B;  3S1Q I;  2JA7 I;  4S1T A;  2JA6 I;  3CCL 1;  3HOU I;  1Q81 1;  3M3Y I;  2DE7 A;  2O53 A;  1QYP A;  4CL1 A;  1QVF Y;  2GU2 A;  2JNY A;  4NBH A;  4E2Z A;  3J80 f;  3CCQ Z;  2YAD A;  3NFZ A;  3CCU 1;  4RS4 A;  4TNU A;  2E2H I;  3S15 I;  3KIH A;  2AYD A;  3EER A;  1VQ9 Z;  1WJ2 A;  2DE5 A;  2QRD B;  2JS4 A;  1KQS Z;  4E32 A;  1ZH1 A;  1Y8C A;  3BG1 B;  4NB8 A;  1ML8 A;  2QR1 B;  1KC8 2;  1Q7Y 1;  2WB1 A;  1RQF A;  3GTJ I;  3PO2 I;  4NB9 A;  2LEX A;  2OOY B;  2G2K A;  4AYB A;  4A3F I;  3S1R I;  3RZD I;  2Q51 A;  1X3Z A;  2R7Z I;  1VQ8 1;  1TWG I;  3J81 b;  4MD7 A;  3HKZ A;  2GTI A;  3K7A I;  4HGY A;  1N2F A;  1YJW 1;  3CCJ Z;  3G4S Z;  3MZK B;  4NH1 C;  3CMA 1;  1N8R 2;  4Y52 I;  2ZAE B;  2QEX 1;  5AN9 F;  5C4J I;  2V8K A;  4DK1 A;  3CCE 1;  1JJ2 Y;  4BY7 I;  3H3V J;  3IR7 A;  3CCS 1;  2HF1 A;  4DGL A;  3CCM Z;  3CC2 Z;  2JA8 I;  3HOY I;  2LFU A;  1YJ9 Z;  1M90 1;  2Y0S A;  1YJN 1;  1VQ5 1;  3VMG A;  2F4M A;  4E30 A;  1VQN 1;  3OW2 Y;  5T67 A;  3NDI A;  1TWC I;  5D1P A;  2GTH A;  1RLY A;  2JMO A;  2PK7 A;  3M4O I;  2VPZ A;  3CCU Z;  1NJI 2;  1TWA I;  4Y7N I;  3QWU A;  5T64 A;  1S72 1;  1KD1 2;  2V45 A;  3J7A 4;  2NVX I;  4EWC A;  1Y1V I;  3NH4 A;  2OTL 1;  4XX2 A;  1VQ6 1;  3H0G I;  5A2Q f;  1JWH C;  3MON A;  2JUB A;  3S16 I;  3G6E 1;  4BY1 I;  4BBS I;  1K73 2;  1TWH I;  2OOX B;  4BXX I;  1VQL 1;  4A3B I;  3S2H I;  1Q82 2;  1K9M 1;  4A93 I;  1TWF I;  2IZ4 A;  3KIF A;  1W2B Z;  1VQ8 Z;  2WAQ A;  3LUS A;  1K8A 2;  5FLX b;  1VQK 1;  1WZN A;  3GTL I;  4MD9 A;  4E33 A;  1YJW Z;  4MD8 A;  1QXF A;  3CMA Z;  2QEX Z;  3J81 f;  1YUK A;  3CCE Z;  1VQ7 Z;  3HOZ I;  3I4M I;  3CCS Z;  3T4N B;  2JIO A;  3NH5 A;  1KC8 1;  1QVF Z;  2QKD A;  3GTP I;  2JR6 A;  2JIM A;  2KPI A;  2BJO A;  1VQ5 Z;  1USP B;  2NVY I;  2RIQ A;  1K83 I;  4MON A;  4MXU A;  3NDJ A;  1Z01 A;  3BG0 B;  3CPW Y;  3Q87 A;  2Q4Z A;  4MRI A;  3GKQ A;  4NBG A;  1M1K 1;  3P5J B;  3CCV 1;  2VUM I;  3PO3 I;  1S72 Z;  1VQ4 1;  4X6A I;  2VPX A;  4QTU A;  3JAM f;  1YHQ 1;  5IP7 I;  4A3C I;  3CQZ I;  2OTL Z;  1WII A;  1VQ6 Z;  4RVF A;  2QA4 1;  1ZB8 A;  3G71 1;  1FDI A;  4RVG A;  4A3K I;  3GCF A;  3IF8 A;  1PFT A;  2VF1 A;  3G6E Z;  2PMZ A;  5CM2 M;  5LL6 f;  1VQL Z;  3CC4 1;  3FKI I;  1S7M A;  1YIT 1;  1RO2 A;  4NBE A;  3J80 b;  4E31 A;  1QF8 A;  3GTK I;  1QVG Y;  3CCL Z;  1NJI 1;  3VB9 A;  1KD1 1;  3D2L A;  1JJ2 Z;  3CD6 1;  1VQK Z;  3FQM A;  4NOZ A;  2E2I I;  2HU9 A;  2NVT I;  2E2J I;  2VUG A;  2VPY A;  1Y1W I;  2EGT A;  1YI2 1;  5FLX f;  3OW2 Z;  1VQ9 1;  4NFR A;  3F3P C;  2AKL A;  1K73 1;  1WCM I;  1RO4 A;  1VQP 1;  2I3C A;  4DQY B;  1Q86 2;  1Q82 1;  5C4X I;  1I6H I;  3CCR 1;  1NUI A;  3I55 1;  2E9H A;  4E2W A;  1Q16 A;  4A3D I;  3F3F C;  1M90 2;  1USP A;  3HOX I;  1K8A 1;  2NVQ I;  2V8I A;  3GTM I;  3IX0 A;  3S17 I;  1SIW A;  3TE5 B;  2QRC B;  1Y1V S;  3CXC Y;  2OZK A;  3CCV Z;  3S1N I;  4HGZ A;  1VQ4 Z;  3ESW A;  4NBC A;  1YHQ Z;  1YUA A;  3G4S 1;  1VQO 1;  2NAP A;  3D6W A;  3EED A;  2E7Z A;  3G71 Z;  3NH8 A;  1NP6 A;  3I07 A;  1VLA A;  4A3E I;  2J6A A;  2IZ3 A;  3CC4 Z;  3VTN A;  1VQM 1;  3I56 1;  3GTG I;  1YIT Z;  5D1O B;  2RPR A;  1YIJ 1;  1SFO I;  1YJN Z;  2M48 A;  4NBA A;  1VQN Z;  2OTJ 1;  4E2X A;  3CD6 Z;  3HOV I;  1K9M 2;  3VMI A;  1KQS Y;  3RZO I;  1Q81 2;  1P9N A;  5A2Q b; 
#chains in the Genus database with same CATH homology
 2P3Y A;  2YU9 I;  1Z02 A;  1YI2 Z;  4BBR I;  1X0T A;  5IT9 b;  3MZL B;  1N8R 1;  4NBF A;  3CPW Z;  4RVH A;  4A3I I;  3GTQ I;  3U50 C;  1VQP Z;  2RHB A;  2H85 A;  2R93 I;  4RV9 A;  4NBD A;  4A3J I;  3HOW I;  2R92 I;  3CC7 1;  2W03 A;  3CCR Z;  3I55 Z;  4RVD A;  2K5R A;  3IFU A;  3CME 1;  3PO3 S;  1RNI A;  3FQQ A;  1L1O C;  1DL6 A;  4E2Y A;  2O4H A;  1TFI A;  1LQL A;  1Q7Y 2;  1M1K 2;  5T6B A;  1I3Q I;  2QLV B;  5FLM I;  1VQO Z;  4MH4 A;  5C44 I;  3CCQ 1;  4HH4 A;  1I50 I;  2W04 A;  5IP9 I;  1Q86 1;  3TDH B;  1QVG Z;  1VQ7 1;  4A3G I;  3S14 I;  2R6M A;  1RO0 A;  3S2D I;  3D9X A;  4A3L I;  2P28 A;  2PM9 A;  1Z03 A;  3I56 Z;  1VQM Z;  2QRE B;  1YIJ Z;  4A3M I;  4NBB A;  3GTO I;  3JAM b;  2OTJ Z;  5D1O A;  4QTT A;  3S1M I;  2RBL A;  1X3W A;  2B63 I;  2LIY A;  3VMH A;  2RT9 A;  2V8J A;  2JA5 I;  3I4N I;  1R9T I;  3CCJ 1;  1ZB9 A;  2F4O A;  5IT9 f;  2QA4 Z;  3CXC Z;  3CC7 Z;  2M6N A;  3GTM S;  1WW9 A;  2DE6 A;  1W2B Y;  2K3R A;  5C3E I;  3CCM 1;  3CC2 1;  1KRL A;  3CME Z;  1YJ9 1;  2KI7 B;  3S1Q I;  2JA7 I;  4S1T A;  2JA6 I;  3CCL 1;  3HOU I;  1Q81 1;  3M3Y I;  2DE7 A;  2O53 A;  1QYP A;  4CL1 A;  1QVF Y;  2GU2 A;  2JNY A;  4NBH A;  4E2Z A;  3J80 f;  3CCQ Z;  2YAD A;  3NFZ A;  3CCU 1;  4RS4 A;  4TNU A;  2E2H I;  3S15 I;  3KIH A;  3EER A;  1VQ9 Z;  2DE5 A;  2QRD B;  2JS4 A;  1KQS Z;  4E32 A;  1ZH1 A;  3BG1 B;  4NB8 A;  1ML8 A;  2QR1 B;  1KC8 2;  1Q7Y 1;  2WB1 A;  1RQF A;  3GTJ I;  3PO2 I;  4NB9 A;  2OOY B;  2G2K A;  4AYB A;  4A3F I;  3S1R I;  3RZD I;  2Q51 A;  1X3Z A;  2R7Z I;  1VQ8 1;  1TWG I;  3J81 b;  4MD7 A;  3HKZ A;  2GTI A;  3K7A I;  4HGY A;  1N2F A;  1YJW 1;  3CCJ Z;  3G4S Z;  3MZK B;  4NH1 C;  3CMA 1;  1N8R 2;  4Y52 I;  2ZAE B;  2QEX 1;  5AN9 F;  5C4J I;  2V8K A;  4DK1 A;  3CCE 1;  1JJ2 Y;  4BY7 I;  3H3V J;  3CCS 1;  2HF1 A;  4DGL A;  3CCM Z;  3CC2 Z;  2JA8 I;  3HOY I;  2LFU A;  1YJ9 Z;  1M90 1;  2Y0S A;  1YJN 1;  1VQ5 1;  3VMG A;  2F4M A;  4E30 A;  1VQN 1;  3OW2 Y;  5T67 A;  3NDI A;  1TWC I;  5D1P A;  2GTH A;  1RLY A;  2JMO A;  2PK7 A;  3M4O I;  3CCU Z;  1NJI 2;  1TWA I;  4Y7N I;  3QWU A;  5T64 A;  1S72 1;  1KD1 2;  3J7A 4;  2NVX I;  4EWC A;  1Y1V I;  3NH4 A;  2OTL 1;  4XX2 A;  1VQ6 1;  3H0G I;  5A2Q f;  1JWH C;  3MON A;  2JUB A;  3S16 I;  3G6E 1;  4BY1 I;  4BBS I;  1K73 2;  1TWH I;  2OOX B;  4BXX I;  1VQL 1;  4A3B I;  3S2H I;  1Q82 2;  1K9M 1;  4A93 I;  1TWF I;  2IZ4 A;  3KIF A;  1W2B Z;  1VQ8 Z;  2WAQ A;  3LUS A;  1K8A 2;  5FLX b;  1VQK 1;  3GTL I;  4MD9 A;  4E33 A;  1YJW Z;  4MD8 A;  3CMA Z;  2QEX Z;  3J81 f;  1YUK A;  3CCE Z;  1VQ7 Z;  3HOZ I;  3I4M I;  3CCS Z;  3T4N B;  3NH5 A;  1KC8 1;  1QVF Z;  2QKD A;  3GTP I;  2JR6 A;  2KPI A;  2BJO A;  1VQ5 Z;  1USP B;  2NVY I;  2RIQ A;  1K83 I;  4MON A;  4MXU A;  3NDJ A;  1Z01 A;  3BG0 B;  3CPW Y;  3Q87 A;  2Q4Z A;  4MRI A;  3GKQ A;  4NBG A;  1M1K 1;  3P5J B;  3CCV 1;  2VUM I;  3PO3 I;  1S72 Z;  1VQ4 1;  4X6A I;  4QTU A;  3JAM f;  1YHQ 1;  5IP7 I;  4A3C I;  3CQZ I;  2OTL Z;  1WII A;  1VQ6 Z;  4RVF A;  2QA4 1;  1ZB8 A;  3G71 1;  4RVG A;  4A3K I;  3GCF A;  3IF8 A;  1PFT A;  2VF1 A;  3G6E Z;  2PMZ A;  5CM2 M;  5LL6 f;  1VQL Z;  3CC4 1;  3FKI I;  1S7M A;  1YIT 1;  1RO2 A;  4NBE A;  3J80 b;  4E31 A;  1QF8 A;  3GTK I;  1QVG Y;  3CCL Z;  1NJI 1;  3VB9 A;  1KD1 1;  1JJ2 Z;  3CD6 1;  1VQK Z;  3FQM A;  4NOZ A;  2E2I I;  2HU9 A;  2NVT I;  2E2J I;  2VUG A;  1Y1W I;  2EGT A;  1YI2 1;  5FLX f;  3OW2 Z;  1VQ9 1;  4NFR A;  3F3P C;  2AKL A;  1K73 1;  1WCM I;  1RO4 A;  1VQP 1;  2I3C A;  4DQY B;  1Q86 2;  1Q82 1;  5C4X I;  1I6H I;  3CCR 1;  1NUI A;  3I55 1;  2E9H A;  4E2W A;  4A3D I;  3F3F C;  1M90 2;  1USP A;  3HOX I;  1K8A 1;  2NVQ I;  2V8I A;  3GTM I;  3IX0 A;  3S17 I;  3TE5 B;  2QRC B;  1Y1V S;  3CXC Y;  2OZK A;  3CCV Z;  3S1N I;  4HGZ A;  1VQ4 Z;  3ESW A;  4NBC A;  1YHQ Z;  1YUA A;  3G4S 1;  1VQO 1;  3D6W A;  3EED A;  3G71 Z;  3NH8 A;  1NP6 A;  3I07 A;  1VLA A;  4A3E I;  2J6A A;  2IZ3 A;  3CC4 Z;  3VTN A;  1VQM 1;  3I56 1;  3GTG I;  1YIT Z;  5D1O B;  2RPR A;  1YIJ 1;  1SFO I;  1YJN Z;  2M48 A;  4NBA A;  1VQN Z;  2OTJ 1;  4E2X A;  3CD6 Z;  3HOV I;  1K9M 2;  3VMI A;  1KQS Y;  3RZO I;  1Q81 2;  1P9N A;  5A2Q b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...