3Q87A

Structure of e. cuniculi mtq2-trm112 complex responible for the methylation of erf1 translation termination factor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
122
Chain Sequence
MKPFLLGLLKCKRCSFMTKLILECEKAESNDVDVKIFNKHMFTENGGERLKSLVNSLRDFHGRELSEQDISSFVENPGDDEKIKEFLFGIDVVEGSLRCDMCGLIYPIKGSIVETVDTVESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ECU08_1170
publication title Mechanism of activation of methyltransferases involved in translation by the Trm112 'hub' protein
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase activator/transferase
total genus 32
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3q87A00
1VLAA 1TWFI 2J6AA 4NBGA 3S1QI 1Y1WI 3M4OI 3S1NI 1I3QI 4X6AI 1QYPA 3CQZI 1K83I 2B63I 4NB8A 1X3WA 3GCFA 3S16I 3Q87A 4BY7I 1Y1VS 3GTQI 1I6HI 3I4NI 3S14I 4A93I 2HF1A 2JA7I 1TFIA 3HOZI 1USPA 3GTOI 3H3VJ 2E2HI 5C4XI 4NBDA 4A3CI 4A3JI 2JA6I 3EERA 3I4MI 1ZB8A 3D6WA 4NBEA 1PFTA 2NVQI 4NB9A 3U50C 4A3KI 2DE7A 4NBAA 3ESWA 2E2II 1DL6A 2JA5I 1NUIA 1TWAI 1YUAA 3GTKI 1Y1VI 4BXXI 3M3YI 2NVXI 2K5RA 1R9TI 5FLMI 4Y52I 3GTPI 4Y7NI 2RBLA 3K7AI 4NBBA 4XX2A 3HOUI 4QTTA 3I07A 3GTGI 3HOYI 3VMHA 3S1RI 1RLYA 2JS4A 2R7ZI 4A3FI 4NBCA 4A3BI 2DE6A 2JA8I 1SFOI 2VUMI 3S15I 3PO3S 3S2HI 4BY1I 5C3EI 2JR6A 4MH4A 5CM2M 3HOWI 3VMIA 3FKII 4A3II 3PO2I 3H0GI 4A3LI 4NBFA 4NOZA 3RZOI 3GTLI 1RO4A 3GTMS 2P3YA 3RZDI 4A3EI 3S17I 1TWCI 1ML8A 1TWGI 3VB9A 2YU9I 2BJOA 1X3ZA 1N2FA 3S1MI 4A3DI 2R92I 3PO3I 5C4JI 3GTJI 3GKQA 4NBHA 2PK7A 5IP7I 1WCMI 4BBRI 5C44I 2R93I 4QTUA 2AKLA 2NVTI 2E2JI 2JNYA 4A3GI 3GTMI 2F4OA 1LQLA 1L1OC 1TWHI 1WW9A 2F4MA 3S2DI 1USPB 5IP9I 3VMGA 2DE5A 4A3MI 2KPIA 1I50I 2NVYI 3LUSA 4BBSI 3HOXI 1ZB9A 3HOVI
chains in the Genus database with same CATH superfamily
1VQ61 2J6AA 4NBGA 4DK1A 2RPRA 1QYPA 2JUBA 4RS4A 4NB8A 4EWCA 1Z03A 2QA4Z 2JIRA 2JIOA 3S16I 2Q51A 4BY7I 3J80f 4DQYB 1Y8CA 3CC4Z 2JA7I 3HOZI 1USPA 2M48A 1K9M1 2E2HI 1K731 4A3CI 3CC7Z 2QEX1 2OZKA 1ZB8A 2Y0SA 3I56Z 1RQFA 2OTLZ 3CCJZ 5D1OA 1TWAI 1YUAA 3GTKI 1VQN1 3CCMZ 1N8R2 2K5RA 3CXCZ 4Y52I 3NH5A 1VQ8Z 1ZH1A 1VQ6Z 2RBLA 2QREB 2HU9A 3CMA1 4HH4A 3CCQZ 5T67A 4A3FI 1KD12 3EEDA 1YJWZ 4NFRA 2VF1A 3OW2Z 1SFOI 3BG1B 2OOYB 4MD8A 5C3EI 2JR6A 2QEXZ 4NBFA 3KIFA 1RO4A 2JMOA 2QLVB 3CPWY 2PMZA 4E33A 4A3EI 4E31A 3CCU1 1N8R1 1VQNZ 4A3DI 2R92I 1YIJ1 3CD6Z 2QR1B 5C4JI 3I551 4NBHA 2PK7A 1WCMI 3KIHA 2NVTI 4A3GI 2IZ3A 3GTMI 1NP6A 3D9XA 1WW9A 2F4MA 2P28A 1JJ2Z 1USPB 3CMAZ 1VQ51 3CC21 2KPIA 1I50I 4BBSI 3HOXI 3G6E1 1YUKA 3CC41 3HOVI 2V3VA 3M4OI 3S1NI 5D1OB 2O53A 1YIT1 2B63I 2GU2A 3QWUA 1X3WA 3GCFA 3Q87A 3T4NB 1S721 1Y1VS 1I6HI 3CCUZ 1M901 3I4NI 2HF1A 3S14I 4A93I 2YADA 5C4XI 1YIJZ 2V8IA 1YHQZ 1P9NA 3I55Z 3I4MI 2KI7B 3D6WA 3JAMf 1PFTA 2IV2X 2E2II 2O4HA 1QVFZ 2V45A 1WIIA 4E30A 4RVDA 3CXCY 3CCQ1 2E7ZA 1Z01A 1VQ5Z 3CC2Z 1Q822 1YJW1 3GTPI 3G6EZ 4Y7NI 4MRIA 4NBBA 1Q811 1JWHC 5T64A 4QTTA 5LL6f 4E32A 3VMHA 1YITZ 4RVGA 3G4S1 2R7ZI 3OW2Y 4MD9A 4RVFA 1S72Z 3MZKB 4NH1C 3J81f 2VUMI 1FDOA 3CCL1 4MH4A 4HGZA 2IZ4A 3CD61 3HOWI 3NDJA 3VMIA 4A3II 3PO2I 3GTLI 5FLXb 2P3YA 1TWCI 1ML8A 3VB9A 4E2WA 2YU9I 1VQL1 3S1MI 1KC82 2OTJZ 2LIYA 3GTJI 1KRLA 1QVGZ 1SIWA 3GKQA 3IF8A 1JJ2Y 1Q862 3TE5B 1VQK1 1W2BZ 1VQO1 4MD7A 5T6BA 5IT9f 5A2Qb 5IP9I 3FQMA 3G4SZ 4A3MI 3BG0B 3LUSA 2JIMA 1TWFI 3CCLZ 1YI21 3S1QI 1KQSZ 4X6AI 1YHQ1 2VPZA 1Q7Y2 2VPWA 1K83I 3CQZI 4HGYA 2H85A 1QF8A 2JIPA 4MONA 3GTQI 4E2XA 1KC81 2QRCB 1VQLZ 3GTOI 1KD11 4NBDA 2JA6I 3J80b 1QVFY 3NFZA 1YJ91 1Q861 2NVQI 2Q4ZA 1RO2A 3D2LA 3P5JB 2JA5I 1VQKZ 1VQOZ 2K3RA 2QRDB 1Y1VI 3TDHB 4BXXI 3M3YI 2NVXI 5FLMI 3CME1 2V8JA 1VQ41 3HOUI 3MONA 4XX2A 1YI2Z 1K8A2 1Q7Y1 3IR7A 3I07A 2VPXA 2WB1A 1RLYA 1NJI2 2JS4A 4DGLA 2RIQA 4A3BI 1X0TA 3PO3S 1S7MA 5CM2M 2OTJ1 3CCVZ 3FKII 3IFUA 1VQMZ 4NOZA 3RZOI 4A3LI 1YJ9Z 4E2YA 3RZDI 2E9HA 3S17I 1QVGY 5IT9b 2BJOA 3FQQA 2LEXA 1W2BY 3CCR1 4BBRI 1M1K2 1QXFA 2AKLA 3CMEZ 1K8A1 2JNYA 2E2JI 2GTHA 1VQ4Z 2I3CA 1VQ91 1NJI1 1VQPZ 3IX0A 4TNUA 3VMGA 2DE5A 1KQSY 1VLAA 4AYBA 1Y1WI 1I3QI 1VQ71 1Q821 2JIQA 2EGTA 3G71Z 1RO0A 3CCE1 3F3PC 1Q16A 1TFIA 3H3VJ 4A3JI 1M1K1 3EERA 3CCRZ 4NBEA 4NB9A 3U50C 4A3KI 2DE7A 4NBAA 3ESWA 1DL6A 2VUGA 1NUIA 2V8KA 1VQ9Z 3JAMb 5D1PA 1FDIA 4S1TA 3J7A4 1R9TI 4CL1A 3CCS1 1YJN1 2LFUA 2RT9A 4RV9A 2WAQA 2NAPA 3K7AI 3CCV1 1VQ7Z 2M6NA 3GTGI 3NH4A 3HOYI 1VQM1 3S1RI 1M902 4NBCA 2DE6A 2R6MA 2JA8I 5FLXf 3S15I 3S2HI 4E2ZA 4BY1I 3CCEZ 3HKZA 2ZAEB 5AN9F 3H0GI 3J81b 4MXUA 3GTMS 2GTIA 2QA41 3VTNA 1TWGI 3CPWZ 2G2KA 2PM9A 2QKDA 1X3ZA 1VQP1 1N2FA 3NDIA 3PO3I 3CC71 2W03A 1Q812 2AYDA 1K9M2 1K732 3CCSZ 1YJNZ 5IP7I 5C44I 2R93I 2OOXB 4QTUA 5A2Qf 3I561 1WJ2A 1AA6A 2OTL1 3CCJ1 1WZNA 2F4OA 1LQLA 4RVHA 1L1OC 3NH8A 1TWHI 3S2DI 1Z02A 3CCM1 3MZLB 2RHBA 2NVYI 1VQ81 2VPYA 3F3FC 1RNIA 1ZB9A 3G711 2W04A
chains in the Genus database with same CATH topology
1VQ61 2J6AA 4NBGA 4DK1A 2RPRA 1QYPA 2JUBA 4RS4A 4NB8A 4EWCA 1Z03A 2QA4Z 3S16I 2Q51A 4BY7I 3J80f 4DQYB 3CC4Z 2JA7I 3HOZI 1USPA 2M48A 1K9M1 2E2HI 1K731 4A3CI 3CC7Z 2QEX1 2OZKA 1ZB8A 2Y0SA 3I56Z 1RQFA 2OTLZ 3CCJZ 5D1OA 1TWAI 1YUAA 3GTKI 1VQN1 3CCMZ 1N8R2 2K5RA 3CXCZ 4Y52I 3NH5A 1VQ8Z 1ZH1A 1VQ6Z 2RBLA 2QREB 2HU9A 3CMA1 4HH4A 3CCQZ 5T67A 4A3FI 1KD12 3EEDA 1YJWZ 4NFRA 2VF1A 3OW2Z 1SFOI 3BG1B 2OOYB 4MD8A 5C3EI 2JR6A 2QEXZ 4NBFA 3KIFA 1RO4A 2JMOA 2QLVB 3CPWY 2PMZA 4E33A 4A3EI 4E31A 3CCU1 1N8R1 1VQNZ 4A3DI 2R92I 1YIJ1 3CD6Z 2QR1B 5C4JI 3I551 4NBHA 2PK7A 1WCMI 3KIHA 2NVTI 4A3GI 2IZ3A 3GTMI 1NP6A 3D9XA 1WW9A 2F4MA 2P28A 1JJ2Z 1USPB 3CMAZ 1VQ51 3CC21 2KPIA 1I50I 4BBSI 3HOXI 3G6E1 1YUKA 3CC41 3HOVI 3M4OI 3S1NI 5D1OB 2O53A 1YIT1 2B63I 2GU2A 3QWUA 1X3WA 3GCFA 3Q87A 3T4NB 1S721 1Y1VS 1I6HI 3CCUZ 1M901 3I4NI 2HF1A 3S14I 4A93I 2YADA 5C4XI 1YIJZ 2V8IA 1YHQZ 1P9NA 3I55Z 3I4MI 2KI7B 3D6WA 3JAMf 1PFTA 2E2II 2O4HA 1QVFZ 1WIIA 4E30A 4RVDA 3CXCY 3CCQ1 1Z01A 1VQ5Z 3CC2Z 1Q822 1YJW1 3GTPI 3G6EZ 4Y7NI 4MRIA 4NBBA 1Q811 1JWHC 5T64A 4QTTA 5LL6f 4E32A 3VMHA 1YITZ 4RVGA 3G4S1 2R7ZI 3OW2Y 4MD9A 4RVFA 1S72Z 3MZKB 4NH1C 3J81f 2VUMI 3CCL1 4MH4A 4HGZA 2IZ4A 3CD61 3HOWI 3NDJA 3VMIA 4A3II 3PO2I 3GTLI 5FLXb 2P3YA 1TWCI 1ML8A 3VB9A 4E2WA 2YU9I 1VQL1 3S1MI 1KC82 2OTJZ 2LIYA 3GTJI 1KRLA 1QVGZ 3GKQA 3IF8A 1JJ2Y 1Q862 3TE5B 1VQK1 1W2BZ 1VQO1 4MD7A 5T6BA 5IT9f 5A2Qb 5IP9I 3FQMA 3G4SZ 4A3MI 3BG0B 3LUSA 1TWFI 3CCLZ 1YI21 3S1QI 1KQSZ 4X6AI 1YHQ1 1Q7Y2 3CQZI 1K83I 4HGYA 2H85A 1QF8A 4MONA 3GTQI 4E2XA 1KC81 2QRCB 1VQLZ 3GTOI 1KD11 4NBDA 2JA6I 3J80b 1QVFY 3NFZA 1YJ91 1Q861 2NVQI 2Q4ZA 1RO2A 3P5JB 2JA5I 1VQKZ 1VQOZ 2K3RA 2QRDB 1Y1VI 3TDHB 4BXXI 3M3YI 2NVXI 5FLMI 3CME1 2V8JA 1VQ41 3HOUI 3MONA 4XX2A 1YI2Z 1K8A2 1Q7Y1 3I07A 2WB1A 1RLYA 1NJI2 2JS4A 4DGLA 2RIQA 4A3BI 1X0TA 3PO3S 1S7MA 5CM2M 2OTJ1 3CCVZ 3FKII 3IFUA 1VQMZ 4NOZA 3RZOI 4A3LI 1YJ9Z 4E2YA 3RZDI 2E9HA 3S17I 1QVGY 5IT9b 2BJOA 3FQQA 1W2BY 3CCR1 4BBRI 1M1K2 2AKLA 3CMEZ 1K8A1 2JNYA 2E2JI 2GTHA 1VQ4Z 2I3CA 1VQ91 1NJI1 1VQPZ 3IX0A 4TNUA 3VMGA 2DE5A 1KQSY 1VLAA 4AYBA 1Y1WI 1I3QI 1VQ71 1Q821 2EGTA 3G71Z 1RO0A 3CCE1 3F3PC 1TFIA 3H3VJ 4A3JI 1M1K1 3EERA 3CCRZ 4NBEA 4NB9A 3U50C 4A3KI 2DE7A 4NBAA 3ESWA 1DL6A 2VUGA 1NUIA 2V8KA 1VQ9Z 3JAMb 5D1PA 4S1TA 3J7A4 1R9TI 4CL1A 3CCS1 1YJN1 2LFUA 2RT9A 4RV9A 2WAQA 3K7AI 3CCV1 1VQ7Z 2M6NA 3GTGI 3NH4A 3HOYI 1VQM1 3S1RI 1M902 4NBCA 2DE6A 2R6MA 2JA8I 5FLXf 3S15I 3S2HI 4E2ZA 4BY1I 3CCEZ 3HKZA 2ZAEB 5AN9F 3H0GI 3J81b 4MXUA 3GTMS 2GTIA 2QA41 3VTNA 1TWGI 3CPWZ 2G2KA 2PM9A 2QKDA 1X3ZA 1VQP1 1N2FA 3NDIA 3PO3I 3CC71 2W03A 1Q812 1K9M2 1K732 3CCSZ 1YJNZ 5IP7I 5C44I 2R93I 2OOXB 4QTUA 5A2Qf 3I561 2OTL1 3CCJ1 2F4OA 1LQLA 4RVHA 1L1OC 3NH8A 1TWHI 3S2DI 1Z02A 3CCM1 3MZLB 2RHBA 2NVYI 1VQ81 3F3FC 1RNIA 1ZB9A 3G711 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  1TWF I;  2J6A A;  4NBG A;  3S1Q I;  1Y1W I;  3M4O I;  3S1N I;  1I3Q I;  4X6A I;  1QYP A;  3CQZ I;  1K83 I;  2B63 I;  4NB8 A;  1X3W A;  3GCF A;  3S16 I;  3Q87 A;  4BY7 I;  1Y1V S;  3GTQ I;  1I6H I;  3I4N I;  3S14 I;  4A93 I;  2HF1 A;  2JA7 I;  1TFI A;  3HOZ I;  1USP A;  3GTO I;  3H3V J;  2E2H I;  5C4X I;  4NBD A;  4A3C I;  4A3J I;  2JA6 I;  3EER A;  3I4M I;  1ZB8 A;  3D6W A;  4NBE A;  1PFT A;  2NVQ I;  4NB9 A;  3U50 C;  4A3K I;  2DE7 A;  4NBA A;  3ESW A;  2E2I I;  1DL6 A;  2JA5 I;  1NUI A;  1TWA I;  1YUA A;  3GTK I;  1Y1V I;  4BXX I;  3M3Y I;  2NVX I;  2K5R A;  1R9T I;  5FLM I;  4Y52 I;  3GTP I;  4Y7N I;  2RBL A;  3K7A I;  4NBB A;  4XX2 A;  3HOU I;  4QTT A;  3I07 A;  3GTG I;  3HOY I;  3VMH A;  3S1R I;  1RLY A;  2JS4 A;  2R7Z I;  4A3F I;  4NBC A;  4A3B I;  2DE6 A;  2JA8 I;  1SFO I;  2VUM I;  3S15 I;  3PO3 S;  3S2H I;  4BY1 I;  5C3E I;  2JR6 A;  4MH4 A;  5CM2 M;  3HOW I;  3VMI A;  3FKI I;  4A3I I;  3PO2 I;  3H0G I;  4A3L I;  4NBF A;  4NOZ A;  3RZO I;  3GTL I;  1RO4 A;  3GTM S;  2P3Y A;  3RZD I;  4A3E I;  3S17 I;  1TWC I;  1ML8 A;  1TWG I;  3VB9 A;  2YU9 I;  2BJO A;  1X3Z A;  1N2F A;  3S1M I;  4A3D I;  2R92 I;  3PO3 I;  5C4J I;  3GTJ I;  3GKQ A;  4NBH A;  2PK7 A;  5IP7 I;  1WCM I;  4BBR I;  5C44 I;  2R93 I;  4QTU A;  2AKL A;  2NVT I;  2E2J I;  2JNY A;  4A3G I;  3GTM I;  2F4O A;  1LQL A;  1L1O C;  1TWH I;  1WW9 A;  2F4M A;  3S2D I;  1USP B;  5IP9 I;  3VMG A;  2DE5 A;  4A3M I;  2KPI A;  1I50 I;  2NVY I;  3LUS A;  4BBS I;  3HOX I;  1ZB9 A;  3HOV I; 
#chains in the Genus database with same CATH topology
 1VQ6 1;  2J6A A;  4NBG A;  4DK1 A;  2RPR A;  1QYP A;  2JUB A;  4RS4 A;  4NB8 A;  4EWC A;  1Z03 A;  2QA4 Z;  2JIR A;  2JIO A;  3S16 I;  2Q51 A;  4BY7 I;  3J80 f;  4DQY B;  1Y8C A;  3CC4 Z;  2JA7 I;  3HOZ I;  1USP A;  2M48 A;  1K9M 1;  2E2H I;  1K73 1;  4A3C I;  3CC7 Z;  2QEX 1;  2OZK A;  1ZB8 A;  2Y0S A;  3I56 Z;  1RQF A;  2OTL Z;  3CCJ Z;  5D1O A;  1TWA I;  1YUA A;  3GTK I;  1VQN 1;  3CCM Z;  1N8R 2;  2K5R A;  3CXC Z;  4Y52 I;  3NH5 A;  1VQ8 Z;  1ZH1 A;  1VQ6 Z;  2RBL A;  2QRE B;  2HU9 A;  3CMA 1;  4HH4 A;  3CCQ Z;  5T67 A;  4A3F I;  1KD1 2;  3EED A;  1YJW Z;  4NFR A;  2VF1 A;  3OW2 Z;  1SFO I;  3BG1 B;  2OOY B;  4MD8 A;  5C3E I;  2JR6 A;  2QEX Z;  4NBF A;  3KIF A;  1RO4 A;  2JMO A;  2QLV B;  3CPW Y;  2PMZ A;  4E33 A;  4A3E I;  4E31 A;  3CCU 1;  1N8R 1;  1VQN Z;  4A3D I;  2R92 I;  1YIJ 1;  3CD6 Z;  2QR1 B;  5C4J I;  3I55 1;  4NBH A;  2PK7 A;  1WCM I;  3KIH A;  2NVT I;  4A3G I;  2IZ3 A;  3GTM I;  1NP6 A;  3D9X A;  1WW9 A;  2F4M A;  2P28 A;  1JJ2 Z;  1USP B;  3CMA Z;  1VQ5 1;  3CC2 1;  2KPI A;  1I50 I;  4BBS I;  3HOX I;  3G6E 1;  1YUK A;  3CC4 1;  3HOV I;  2V3V A;  3M4O I;  3S1N I;  5D1O B;  2O53 A;  1YIT 1;  2B63 I;  2GU2 A;  3QWU A;  1X3W A;  3GCF A;  3Q87 A;  3T4N B;  1S72 1;  1Y1V S;  1I6H I;  3CCU Z;  1M90 1;  3I4N I;  2HF1 A;  3S14 I;  4A93 I;  2YAD A;  5C4X I;  1YIJ Z;  2V8I A;  1YHQ Z;  1P9N A;  3I55 Z;  3I4M I;  2KI7 B;  3D6W A;  3JAM f;  1PFT A;  2IV2 X;  2E2I I;  2O4H A;  1QVF Z;  2V45 A;  1WII A;  4E30 A;  4RVD A;  3CXC Y;  3CCQ 1;  2E7Z A;  1Z01 A;  1VQ5 Z;  3CC2 Z;  1Q82 2;  1YJW 1;  3GTP I;  3G6E Z;  4Y7N I;  4MRI A;  4NBB A;  1Q81 1;  1JWH C;  5T64 A;  4QTT A;  5LL6 f;  4E32 A;  3VMH A;  1YIT Z;  4RVG A;  3G4S 1;  2R7Z I;  3OW2 Y;  4MD9 A;  4RVF A;  1S72 Z;  3MZK B;  4NH1 C;  3J81 f;  2VUM I;  1FDO A;  3CCL 1;  4MH4 A;  4HGZ A;  2IZ4 A;  3CD6 1;  3HOW I;  3NDJ A;  3VMI A;  4A3I I;  3PO2 I;  3GTL I;  5FLX b;  2P3Y A;  1TWC I;  1ML8 A;  3VB9 A;  4E2W A;  2YU9 I;  1VQL 1;  3S1M I;  1KC8 2;  2OTJ Z;  2LIY A;  3GTJ I;  1KRL A;  1QVG Z;  1SIW A;  3GKQ A;  3IF8 A;  1JJ2 Y;  1Q86 2;  3TE5 B;  1VQK 1;  1W2B Z;  1VQO 1;  4MD7 A;  5T6B A;  5IT9 f;  5A2Q b;  5IP9 I;  3FQM A;  3G4S Z;  4A3M I;  3BG0 B;  3LUS A;  2JIM A;  1TWF I;  3CCL Z;  1YI2 1;  3S1Q I;  1KQS Z;  4X6A I;  1YHQ 1;  2VPZ A;  1Q7Y 2;  2VPW A;  1K83 I;  3CQZ I;  4HGY A;  2H85 A;  1QF8 A;  2JIP A;  4MON A;  3GTQ I;  4E2X A;  1KC8 1;  2QRC B;  1VQL Z;  3GTO I;  1KD1 1;  4NBD A;  2JA6 I;  3J80 b;  1QVF Y;  3NFZ A;  1YJ9 1;  1Q86 1;  2NVQ I;  2Q4Z A;  1RO2 A;  3D2L A;  3P5J B;  2JA5 I;  1VQK Z;  1VQO Z;  2K3R A;  2QRD B;  1Y1V I;  3TDH B;  4BXX I;  3M3Y I;  2NVX I;  5FLM I;  3CME 1;  2V8J A;  1VQ4 1;  3HOU I;  3MON A;  4XX2 A;  1YI2 Z;  1K8A 2;  1Q7Y 1;  3IR7 A;  3I07 A;  2VPX A;  2WB1 A;  1RLY A;  1NJI 2;  2JS4 A;  4DGL A;  2RIQ A;  4A3B I;  1X0T A;  3PO3 S;  1S7M A;  5CM2 M;  2OTJ 1;  3CCV Z;  3FKI I;  3IFU A;  1VQM Z;  4NOZ A;  3RZO I;  4A3L I;  1YJ9 Z;  4E2Y A;  3RZD I;  2E9H A;  3S17 I;  1QVG Y;  5IT9 b;  2BJO A;  3FQQ A;  2LEX A;  1W2B Y;  3CCR 1;  4BBR I;  1M1K 2;  1QXF A;  2AKL A;  3CME Z;  1K8A 1;  2JNY A;  2E2J I;  2GTH A;  1VQ4 Z;  2I3C A;  1VQ9 1;  1NJI 1;  1VQP Z;  3IX0 A;  4TNU A;  3VMG A;  2DE5 A;  1KQS Y;  1VLA A;  4AYB A;  1Y1W I;  1I3Q I;  1VQ7 1;  1Q82 1;  2JIQ A;  2EGT A;  3G71 Z;  1RO0 A;  3CCE 1;  3F3P C;  1Q16 A;  1TFI A;  3H3V J;  4A3J I;  1M1K 1;  3EER A;  3CCR Z;  4NBE A;  4NB9 A;  3U50 C;  4A3K I;  2DE7 A;  4NBA A;  3ESW A;  1DL6 A;  2VUG A;  1NUI A;  2V8K A;  1VQ9 Z;  3JAM b;  5D1P A;  1FDI A;  4S1T A;  3J7A 4;  1R9T I;  4CL1 A;  3CCS 1;  1YJN 1;  2LFU A;  2RT9 A;  4RV9 A;  2WAQ A;  2NAP A;  3K7A I;  3CCV 1;  1VQ7 Z;  2M6N A;  3GTG I;  3NH4 A;  3HOY I;  1VQM 1;  3S1R I;  1M90 2;  4NBC A;  2DE6 A;  2R6M A;  2JA8 I;  5FLX f;  3S15 I;  3S2H I;  4E2Z A;  4BY1 I;  3CCE Z;  3HKZ A;  2ZAE B;  5AN9 F;  3H0G I;  3J81 b;  4MXU A;  3GTM S;  2GTI A;  2QA4 1;  3VTN A;  1TWG I;  3CPW Z;  2G2K A;  2PM9 A;  2QKD A;  1X3Z A;  1VQP 1;  1N2F A;  3NDI A;  3PO3 I;  3CC7 1;  2W03 A;  1Q81 2;  2AYD A;  1K9M 2;  1K73 2;  3CCS Z;  1YJN Z;  5IP7 I;  5C44 I;  2R93 I;  2OOX B;  4QTU A;  5A2Q f;  3I56 1;  1WJ2 A;  1AA6 A;  2OTL 1;  3CCJ 1;  1WZN A;  2F4O A;  1LQL A;  4RVH A;  1L1O C;  3NH8 A;  1TWH I;  3S2D I;  1Z02 A;  3CCM 1;  3MZL B;  2RHB A;  2NVY I;  1VQ8 1;  2VPY A;  3F3F C;  1RNI A;  1ZB9 A;  3G71 1;  2W04 A; 
#chains in the Genus database with same CATH homology
 1VQ6 1;  2J6A A;  4NBG A;  4DK1 A;  2RPR A;  1QYP A;  2JUB A;  4RS4 A;  4NB8 A;  4EWC A;  1Z03 A;  2QA4 Z;  3S16 I;  2Q51 A;  4BY7 I;  3J80 f;  4DQY B;  3CC4 Z;  2JA7 I;  3HOZ I;  1USP A;  2M48 A;  1K9M 1;  2E2H I;  1K73 1;  4A3C I;  3CC7 Z;  2QEX 1;  2OZK A;  1ZB8 A;  2Y0S A;  3I56 Z;  1RQF A;  2OTL Z;  3CCJ Z;  5D1O A;  1TWA I;  1YUA A;  3GTK I;  1VQN 1;  3CCM Z;  1N8R 2;  2K5R A;  3CXC Z;  4Y52 I;  3NH5 A;  1VQ8 Z;  1ZH1 A;  1VQ6 Z;  2RBL A;  2QRE B;  2HU9 A;  3CMA 1;  4HH4 A;  3CCQ Z;  5T67 A;  4A3F I;  1KD1 2;  3EED A;  1YJW Z;  4NFR A;  2VF1 A;  3OW2 Z;  1SFO I;  3BG1 B;  2OOY B;  4MD8 A;  5C3E I;  2JR6 A;  2QEX Z;  4NBF A;  3KIF A;  1RO4 A;  2JMO A;  2QLV B;  3CPW Y;  2PMZ A;  4E33 A;  4A3E I;  4E31 A;  3CCU 1;  1N8R 1;  1VQN Z;  4A3D I;  2R92 I;  1YIJ 1;  3CD6 Z;  2QR1 B;  5C4J I;  3I55 1;  4NBH A;  2PK7 A;  1WCM I;  3KIH A;  2NVT I;  4A3G I;  2IZ3 A;  3GTM I;  1NP6 A;  3D9X A;  1WW9 A;  2F4M A;  2P28 A;  1JJ2 Z;  1USP B;  3CMA Z;  1VQ5 1;  3CC2 1;  2KPI A;  1I50 I;  4BBS I;  3HOX I;  3G6E 1;  1YUK A;  3CC4 1;  3HOV I;  3M4O I;  3S1N I;  5D1O B;  2O53 A;  1YIT 1;  2B63 I;  2GU2 A;  3QWU A;  1X3W A;  3GCF A;  3Q87 A;  3T4N B;  1S72 1;  1Y1V S;  1I6H I;  3CCU Z;  1M90 1;  3I4N I;  2HF1 A;  3S14 I;  4A93 I;  2YAD A;  5C4X I;  1YIJ Z;  2V8I A;  1YHQ Z;  1P9N A;  3I55 Z;  3I4M I;  2KI7 B;  3D6W A;  3JAM f;  1PFT A;  2E2I I;  2O4H A;  1QVF Z;  1WII A;  4E30 A;  4RVD A;  3CXC Y;  3CCQ 1;  1Z01 A;  1VQ5 Z;  3CC2 Z;  1Q82 2;  1YJW 1;  3GTP I;  3G6E Z;  4Y7N I;  4MRI A;  4NBB A;  1Q81 1;  1JWH C;  5T64 A;  4QTT A;  5LL6 f;  4E32 A;  3VMH A;  1YIT Z;  4RVG A;  3G4S 1;  2R7Z I;  3OW2 Y;  4MD9 A;  4RVF A;  1S72 Z;  3MZK B;  4NH1 C;  3J81 f;  2VUM I;  3CCL 1;  4MH4 A;  4HGZ A;  2IZ4 A;  3CD6 1;  3HOW I;  3NDJ A;  3VMI A;  4A3I I;  3PO2 I;  3GTL I;  5FLX b;  2P3Y A;  1TWC I;  1ML8 A;  3VB9 A;  4E2W A;  2YU9 I;  1VQL 1;  3S1M I;  1KC8 2;  2OTJ Z;  2LIY A;  3GTJ I;  1KRL A;  1QVG Z;  3GKQ A;  3IF8 A;  1JJ2 Y;  1Q86 2;  3TE5 B;  1VQK 1;  1W2B Z;  1VQO 1;  4MD7 A;  5T6B A;  5IT9 f;  5A2Q b;  5IP9 I;  3FQM A;  3G4S Z;  4A3M I;  3BG0 B;  3LUS A;  1TWF I;  3CCL Z;  1YI2 1;  3S1Q I;  1KQS Z;  4X6A I;  1YHQ 1;  1Q7Y 2;  3CQZ I;  1K83 I;  4HGY A;  2H85 A;  1QF8 A;  4MON A;  3GTQ I;  4E2X A;  1KC8 1;  2QRC B;  1VQL Z;  3GTO I;  1KD1 1;  4NBD A;  2JA6 I;  3J80 b;  1QVF Y;  3NFZ A;  1YJ9 1;  1Q86 1;  2NVQ I;  2Q4Z A;  1RO2 A;  3P5J B;  2JA5 I;  1VQK Z;  1VQO Z;  2K3R A;  2QRD B;  1Y1V I;  3TDH B;  4BXX I;  3M3Y I;  2NVX I;  5FLM I;  3CME 1;  2V8J A;  1VQ4 1;  3HOU I;  3MON A;  4XX2 A;  1YI2 Z;  1K8A 2;  1Q7Y 1;  3I07 A;  2WB1 A;  1RLY A;  1NJI 2;  2JS4 A;  4DGL A;  2RIQ A;  4A3B I;  1X0T A;  3PO3 S;  1S7M A;  5CM2 M;  2OTJ 1;  3CCV Z;  3FKI I;  3IFU A;  1VQM Z;  4NOZ A;  3RZO I;  4A3L I;  1YJ9 Z;  4E2Y A;  3RZD I;  2E9H A;  3S17 I;  1QVG Y;  5IT9 b;  2BJO A;  3FQQ A;  1W2B Y;  3CCR 1;  4BBR I;  1M1K 2;  2AKL A;  3CME Z;  1K8A 1;  2JNY A;  2E2J I;  2GTH A;  1VQ4 Z;  2I3C A;  1VQ9 1;  1NJI 1;  1VQP Z;  3IX0 A;  4TNU A;  3VMG A;  2DE5 A;  1KQS Y;  1VLA A;  4AYB A;  1Y1W I;  1I3Q I;  1VQ7 1;  1Q82 1;  2EGT A;  3G71 Z;  1RO0 A;  3CCE 1;  3F3P C;  1TFI A;  3H3V J;  4A3J I;  1M1K 1;  3EER A;  3CCR Z;  4NBE A;  4NB9 A;  3U50 C;  4A3K I;  2DE7 A;  4NBA A;  3ESW A;  1DL6 A;  2VUG A;  1NUI A;  2V8K A;  1VQ9 Z;  3JAM b;  5D1P A;  4S1T A;  3J7A 4;  1R9T I;  4CL1 A;  3CCS 1;  1YJN 1;  2LFU A;  2RT9 A;  4RV9 A;  2WAQ A;  3K7A I;  3CCV 1;  1VQ7 Z;  2M6N A;  3GTG I;  3NH4 A;  3HOY I;  1VQM 1;  3S1R I;  1M90 2;  4NBC A;  2DE6 A;  2R6M A;  2JA8 I;  5FLX f;  3S15 I;  3S2H I;  4E2Z A;  4BY1 I;  3CCE Z;  3HKZ A;  2ZAE B;  5AN9 F;  3H0G I;  3J81 b;  4MXU A;  3GTM S;  2GTI A;  2QA4 1;  3VTN A;  1TWG I;  3CPW Z;  2G2K A;  2PM9 A;  2QKD A;  1X3Z A;  1VQP 1;  1N2F A;  3NDI A;  3PO3 I;  3CC7 1;  2W03 A;  1Q81 2;  1K9M 2;  1K73 2;  3CCS Z;  1YJN Z;  5IP7 I;  5C44 I;  2R93 I;  2OOX B;  4QTU A;  5A2Q f;  3I56 1;  2OTL 1;  3CCJ 1;  2F4O A;  1LQL A;  4RVH A;  1L1O C;  3NH8 A;  1TWH I;  3S2D I;  1Z02 A;  3CCM 1;  3MZL B;  2RHB A;  2NVY I;  1VQ8 1;  3F3F C;  1RNI A;  1ZB9 A;  3G71 1;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...