3Q87A

Structure of e. cuniculi mtq2-trm112 complex responible for the methylation of erf1 translation termination factor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
122
Chain Sequence
MKPFLLGLLKCKRCSFMTKLILECEKAESNDVDVKIFNKHMFTENGGERLKSLVNSLRDFHGRELSEQDISSFVENPGDDEKIKEFLFGIDVVEGSLRCDMCGLIYPIKGSIVETVDTVESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ECU08_1170
publication title Mechanism of activation of methyltransferases involved in translation by the Trm112 'hub' protein
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase activator/transferase
total genus 32
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3q87A00
4A3KI 3GTGI 3S1QI 3LUSA 2JA7I 3PO2I 2DE7A 3S2HI 3VMIA 2NVQI 4A3DI 2R93I 3GTOI 1USPA 2NVXI 1N2FA 2VUMI 2R92I 1PFTA 3I4NI 2BJOA 4BBRI 4XX2A 1X3ZA 3PO3S 2B63I 3S1MI 3GTJI 3GTKI 2KPIA 4A3BI 4A3LI 1LQLA 2E2HI 4NOZA 2E2JI 1I50I 1YUAA 3S15I 2AKLA 3VB9A 4A3JI 3S1NI 3EERA 1L1OC 1TWAI 3RZDI 3S17I 4QTUA 5C4JI 2JA5I 2R7ZI 5C4XI 3GTLI 2JR6A 4NBEA 4NBDA 3VMHA 3GTMI 3S16I 1DL6A 3S1RI 3I07A 1RLYA 1WCMI 3ESWA 3CQZI 3H0GI 4NBAA 1TWCI 2NVTI 1QYPA 1ZB8A 2PK7A 3D6WA 4A3FI 4Y52I 1Y1VI 3GCFA 1NUIA 2JA8I 1VLAA 4NBHA 2J6AA 4NBGA 3VMGA 5C44I 5FLMI 2YU9I 3HOXI 2NVYI 1WW9A 3HOUI 2F4MA 1ML8A 4BBSI 3HOWI 3U50C 4NBBA 5C3EI 1TFIA 2F4OA 3GKQA 4BY1I 1ZB9A 1TWGI 3GTPI 4QTTA 4A3CI 4BY7I 3HOYI 2K5RA 1K83I 2E2II 2JA6I 4A3II 3S2DI 4A93I 4A3MI 3M4OI 1SFOI 3HOZI 2JNYA 3FKII 1X3WA 1Y1VS 3Q87A 3H3VJ 5CM2M 3GTQI 4X6AI 1TWHI 2P3YA 1I3QI 4NBCA 5IP7I 2RBLA 5IP9I 4NB8A 4A3EI 1I6HI 4BXXI 1TWFI 4MH4A 3HOVI 4A3GI 2JS4A 4NB9A 3S14I 2DE6A 3M3YI 1RO4A 1R9TI 2HF1A 3GTMS 3I4MI 3PO3I 1USPB 4Y7NI 2DE5A 3RZOI 4NBFA 1Y1WI 3K7AI
chains in the Genus database with same CATH superfamily
1Q821 1QVFZ 3LUSA 3F3PC 4MD9A 3J80f 1USPA 2O53A 2W04A 2R6MA 2R92I 1PFTA 2RHBA 1KQSZ 1NP6A 4HH4A 2BJOA 1M901 5D1PA 1X3ZA 2G2KA 1YIT1 2JUBA 2B63I 1YJW1 3GTKI 1LQLA 3CCR1 2W03A 2WAQA 5A2Qb 4NOZA 4RVGA 1X0TA 3CMEZ 4A3JI 5FLXb 3EERA 1L1OC 4HGZA 5C4JI 3MZKB 4MD7A 2JA5I 1SIWA 2JR6A 4NBEA 3TE5B 2OTLZ 3GTMI 3CCJZ 1RLYA 3ESWA 3CC21 4NBAA 1KQSY 1QYPA 2ZAEB 1YIJ1 2PK7A 1M1K2 2QREB 1YJN1 1NUIA 2JA8I 3G4SZ 2QA41 1VQNZ 4HGYA 3U50C 1N8R2 5C3EI 1TFIA 2GU2A 4E2ZA 3J7A4 2E7ZA 1VQ71 4BY1I 1QXFA 3QWUA 3G6EZ 4QTTA 3HOYI 2K5RA 2OZKA 2RPRA 1VQP1 4CL1A 4A3MI 2OTJZ 2JNYA 2OOYB 1X3WA 3CC4Z 3Q87A 3H3VJ 3VTNA 4E2XA 2P3YA 2V8IA 1NJI1 4E32A 2RBLA 4BXXI 3G71Z 3CMAZ 4MH4A 3HOVI 4A3GI 1Q7Y1 4NB9A 3TDHB 3CCMZ 1VQ9Z 2KI7B 1KC82 4Y7NI 1QF8A 3RZOI 3CPWZ 1FDIA 1VQL1 1KD11 3GTGI 2JA7I 2NVQI 1YI2Z 5D1OA 5T64A 2NVXI 2VUMI 3I4NI 3CD6Z 5AN9F 2QEXZ 3T4NB 4RVHA 1S721 1ZH1A 5LL6f 3S1MI 3GTJI 2KPIA 3CXCZ 3CCL1 2PMZA 3CPWY 1VQMZ 3S1NI 3CCU1 1TWAI 2VF1A 2V8KA 1Z02A 3CCLZ 2R7ZI 2IZ4A 5IT9b 3GTLI 1Q16A 1WCMI 2QRDB 1K732 1JJ2Z 2NVTI 1TWCI 3I551 1ZB8A 4DGLA 4A3FI 5IT9f 3GCFA 1YJ91 3OW2Z 3HOXI 2NVYI 3IF8A 3CCQ1 1VQO1 1YITZ 1Q812 4DQYB 1YJWZ 4NBBA 1QVFY 3CCRZ 3CXCY 3GKQA 5A2Qf 2QKDA 3NFZA 1Q862 2JA6I 3CCS1 4A3II 5FLXf 4A93I 2GTHA 3M4OI 1SFOI 3HOZI 3FKII 2QLVB 2JIQA 2HU9A 3BG1B 3CC2Z 3IX0A 2RIQA 1VQ41 1VQ81 1YIJZ 4NBCA 5IP7I 5IP9I 2WB1A 1YJNZ 4A3EI 2JS4A 2QA4Z 5T6BA 3S14I 3CCV1 1R9TI 2HF1A 1WZNA 2RT9A 3GTMS 2IV2X 1USPB 3NH5A 1K8A1 1AA6A 1KC81 1VQ7Z 4E2YA 4DK1A 4RVDA 3K7AI 1Z03A 1YHQ1 1K9M2 3CC71 2O4HA 3JAMb 1VQPZ 3PO2I 2VPXA 3FQMA 3VMIA 2R93I 3GTOI 2LEXA 1N2FA 4RV9A 1W2BZ 4E31A 3JAMf 2QRCB 1VQK1 2H85A 4XX2A 1VQ51 3IFUA 3NDJA 3CCE1 1RNIA 4A3LI 1WJ2A 3NH4A 4NH1C 1VQ61 2V45A 4RVFA 2E2JI 2VPYA 4MD8A 4MXUA 1VQLZ 3RZDI 2VUGA 2Y0SA 2LIYA 2JIOA 3S1RI 2OOXB 4Y52I 1Y1VI 1NJI2 1K731 1VLAA 4NBHA 5C44I 2VPWA 4NBGA 5FLMI 1S72Z 2F4MA 1JWHC 1Q7Y2 4BBSI 3NDIA 2F4OA 4E30A 1Q811 3I561 1TWGI 4AYBA 4A3CI 3CCUZ 1K83I 1WIIA 3S2DI 3J80b 1Y1VS 2IZ3A 3GTQI 4X6AI 1TWHI 1I3QI 3IR7A 1M1K1 3I55Z 1S7MA 1Y8CA 2I3CA 4NB8A 2YADA 4TNUA 1I6HI 1TWFI 3EEDA 1YJ9Z 3NH8A 3CCQZ 4E2WA 1VQOZ 1RO2A 3KIHA 1RO4A 1N8R1 2NAPA 3F3FC 5D1OB 1P9NA 1Q822 3PO3I 3CME1 1Y1WI 4A3KI 3S1QI 3J81b 3CCSZ 4E33A 2DE7A 2LFUA 1JJ2Y 1K9M1 3S2HI 2OTL1 3CCJ1 4A3DI 3D9XA 1M902 2GTIA 3J81f 1KRLA 3OW2Y 2V8JA 4BBRI 1VQ8Z 1VQ4Z 3G4S1 4EWCA 3PO3S 2Q4ZA 1VQN1 3D2LA 1YUKA 2JIPA 4RS4A 4A3BI 3CCVZ 2E2HI 1I50I 1YUAA 3S15I 3G6E1 2AKLA 3VB9A 3S17I 2K3RA 4MONA 4QTUA 2M48A 1YHQZ 3MONA 5C4XI 3CC7Z 2VPZA 5T67A 2OTJ1 3MZLB 3CC41 3HKZA 4NBDA 3VMHA 3S16I 1DL6A 3I07A 3CQZI 3H0GI 3FQQA 3D6WA 2AYDA 2QR1B 2JIMA 1VQKZ 2J6AA 3VMGA 3G711 2YU9I 3CMA1 1WW9A 1VQ5Z 4NFRA 4S1TA 3CCM1 4MRIA 1VQ91 3HOUI 1ML8A 3CCEZ 3HOWI 1VQ6Z 1K8A2 1QVGZ 1ZB9A 1RQFA 3GTPI 4BY7I 1Z01A 2E2II 3KIFA 2P28A 1W2BY 1YI21 2M6NA 5CM2M 2E9HA 3BG0B 3P5JB 3CD61 2JIRA 2EGTA 2QEX1 2Q51A 1FDOA 2V3VA 2DE6A 3M3YI 2JMOA 3I4MI 1KD12 2DE5A 4NBFA 1RO0A 1VQM1 1QVGY 1Q861 2PM9A 3I56Z
chains in the Genus database with same CATH topology
1Q821 1QVFZ 3LUSA 3F3PC 4MD9A 3J80f 1USPA 2O53A 2W04A 2R6MA 2R92I 1PFTA 2RHBA 1KQSZ 1NP6A 4HH4A 2BJOA 1M901 5D1PA 1X3ZA 2G2KA 1YIT1 2JUBA 2B63I 1YJW1 3GTKI 1LQLA 2W03A 2WAQA 5A2Qb 3CCR1 4NOZA 4RVGA 1X0TA 3CMEZ 4A3JI 5FLXb 3EERA 1L1OC 4HGZA 5C4JI 3MZKB 4MD7A 2JA5I 2JR6A 4NBEA 3TE5B 2OTLZ 3GTMI 3CCJZ 1RLYA 3ESWA 3CC21 4NBAA 1KQSY 1QYPA 2ZAEB 1YIJ1 2PK7A 1M1K2 2QREB 1YJN1 1NUIA 2JA8I 3G4SZ 2QA41 1VQNZ 4HGYA 3U50C 1N8R2 5C3EI 1TFIA 2GU2A 4E2ZA 3J7A4 1VQ71 4BY1I 3QWUA 3G6EZ 4QTTA 3HOYI 2K5RA 2OZKA 2RPRA 1VQP1 4CL1A 4A3MI 2OTJZ 2JNYA 2OOYB 1X3WA 3CC4Z 3Q87A 3H3VJ 3VTNA 4E2XA 2P3YA 2V8IA 1NJI1 4E32A 2RBLA 4BXXI 3G71Z 3CMAZ 4MH4A 3HOVI 4A3GI 1Q7Y1 4NB9A 3TDHB 3CCMZ 1VQ9Z 2KI7B 1KC82 4Y7NI 1QF8A 3RZOI 3CPWZ 1VQL1 1KD11 3GTGI 2JA7I 2NVQI 1YI2Z 5D1OA 5T64A 2NVXI 2VUMI 3I4NI 3CD6Z 5AN9F 2QEXZ 3T4NB 4RVHA 1S721 1ZH1A 5LL6f 3S1MI 3GTJI 2KPIA 3CXCZ 3CCL1 2PMZA 3CPWY 1VQMZ 3S1NI 3CCU1 1TWAI 2VF1A 2V8KA 1Z02A 3CCLZ 2R7ZI 2IZ4A 5IT9b 3GTLI 1WCMI 2QRDB 1K732 1JJ2Z 2NVTI 1TWCI 3I551 1ZB8A 4DGLA 4A3FI 5IT9f 3GCFA 1YJ91 3OW2Z 3HOXI 2NVYI 3IF8A 3CCQ1 1VQO1 1YITZ 1Q812 4DQYB 1YJWZ 4NBBA 1QVFY 3CCRZ 3CXCY 3GKQA 5A2Qf 2QKDA 3NFZA 1Q862 2JA6I 3CCS1 4A3II 5FLXf 4A93I 2GTHA 3M4OI 1SFOI 3HOZI 3FKII 2QLVB 2HU9A 3BG1B 3CC2Z 3IX0A 2RIQA 1VQ41 1VQ81 1YIJZ 4NBCA 5IP7I 5IP9I 2WB1A 1YJNZ 4A3EI 2JS4A 2QA4Z 5T6BA 3S14I 3CCV1 1R9TI 2HF1A 2RT9A 3GTMS 1USPB 3NH5A 1K8A1 1KC81 1VQ7Z 4E2YA 4DK1A 4RVDA 3K7AI 1Z03A 1YHQ1 1K9M2 3CC71 2O4HA 3JAMb 1VQPZ 3PO2I 3FQMA 3VMIA 2R93I 3GTOI 1N2FA 4RV9A 1W2BZ 4E31A 3JAMf 2QRCB 1VQK1 2H85A 4XX2A 1VQ51 3IFUA 3NDJA 3CCE1 1RNIA 4A3LI 3NH4A 4NH1C 1VQ61 4RVFA 2E2JI 4MD8A 4MXUA 1VQLZ 3RZDI 2VUGA 2Y0SA 2LIYA 3S1RI 2OOXB 4Y52I 1Y1VI 1NJI2 1K731 1VLAA 4NBHA 5C44I 4NBGA 5FLMI 1S72Z 2F4MA 1JWHC 1Q7Y2 4BBSI 3NDIA 2F4OA 4E30A 1Q811 3I561 1TWGI 4AYBA 4A3CI 3CCUZ 1K83I 1WIIA 3S2DI 3J80b 1Y1VS 2IZ3A 3GTQI 4X6AI 1TWHI 1I3QI 1M1K1 3I55Z 1S7MA 2I3CA 4NB8A 2YADA 4TNUA 1I6HI 1TWFI 3EEDA 1YJ9Z 3NH8A 3CCQZ 4E2WA 1VQOZ 1RO2A 3KIHA 1RO4A 1N8R1 3F3FC 5D1OB 1P9NA 1Q822 3PO3I 3CME1 1Y1WI 4A3KI 3S1QI 3J81b 3CCSZ 4E33A 2DE7A 2LFUA 1JJ2Y 1K9M1 3S2HI 2OTL1 3CCJ1 4A3DI 3D9XA 1M902 2GTIA 3J81f 1KRLA 3OW2Y 2V8JA 4BBRI 1VQ8Z 1VQ4Z 3G4S1 4EWCA 3PO3S 2Q4ZA 1VQN1 1YUKA 4RS4A 4A3BI 3CCVZ 2E2HI 1I50I 1YUAA 3S15I 3G6E1 2AKLA 3VB9A 3S17I 2K3RA 4MONA 4QTUA 2M48A 1YHQZ 3MONA 5C4XI 3CC7Z 2OTJ1 5T67A 3MZLB 3CC41 3HKZA 4NBDA 3VMHA 3S16I 1DL6A 3I07A 3CQZI 3H0GI 3FQQA 3D6WA 2QR1B 1VQKZ 2J6AA 3VMGA 3G711 2YU9I 3CMA1 1WW9A 1VQ5Z 4NFRA 4S1TA 3CCM1 4MRIA 1VQ91 3HOUI 1ML8A 3CCEZ 3HOWI 1VQ6Z 1K8A2 1QVGZ 1ZB9A 1RQFA 3GTPI 4BY7I 1Z01A 2E2II 3KIFA 2P28A 1W2BY 1YI21 2M6NA 5CM2M 2E9HA 3BG0B 3P5JB 3CD61 2EGTA 2QEX1 2Q51A 2DE6A 3M3YI 2JMOA 3I4MI 1KD12 2DE5A 4NBFA 1RO0A 1VQM1 1QVGY 1Q861 2PM9A 3I56Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K I;  3GTG I;  3S1Q I;  3LUS A;  2JA7 I;  3PO2 I;  2DE7 A;  3S2H I;  3VMI A;  2NVQ I;  4A3D I;  2R93 I;  3GTO I;  1USP A;  2NVX I;  1N2F A;  2VUM I;  2R92 I;  1PFT A;  3I4N I;  2BJO A;  4BBR I;  4XX2 A;  1X3Z A;  3PO3 S;  2B63 I;  3S1M I;  3GTJ I;  3GTK I;  2KPI A;  4A3B I;  4A3L I;  1LQL A;  2E2H I;  4NOZ A;  2E2J I;  1I50 I;  1YUA A;  3S15 I;  2AKL A;  3VB9 A;  4A3J I;  3S1N I;  3EER A;  1L1O C;  1TWA I;  3RZD I;  3S17 I;  4QTU A;  5C4J I;  2JA5 I;  2R7Z I;  5C4X I;  3GTL I;  2JR6 A;  4NBE A;  4NBD A;  3VMH A;  3GTM I;  3S16 I;  1DL6 A;  3S1R I;  3I07 A;  1RLY A;  1WCM I;  3ESW A;  3CQZ I;  3H0G I;  4NBA A;  1TWC I;  2NVT I;  1QYP A;  1ZB8 A;  2PK7 A;  3D6W A;  4A3F I;  4Y52 I;  1Y1V I;  3GCF A;  1NUI A;  2JA8 I;  1VLA A;  4NBH A;  2J6A A;  4NBG A;  3VMG A;  5C44 I;  5FLM I;  2YU9 I;  3HOX I;  2NVY I;  1WW9 A;  3HOU I;  2F4M A;  1ML8 A;  4BBS I;  3HOW I;  3U50 C;  4NBB A;  5C3E I;  1TFI A;  2F4O A;  3GKQ A;  4BY1 I;  1ZB9 A;  1TWG I;  3GTP I;  4QTT A;  4A3C I;  4BY7 I;  3HOY I;  2K5R A;  1K83 I;  2E2I I;  2JA6 I;  4A3I I;  3S2D I;  4A93 I;  4A3M I;  3M4O I;  1SFO I;  3HOZ I;  2JNY A;  3FKI I;  1X3W A;  1Y1V S;  3Q87 A;  3H3V J;  5CM2 M;  3GTQ I;  4X6A I;  1TWH I;  2P3Y A;  1I3Q I;  4NBC A;  5IP7 I;  2RBL A;  5IP9 I;  4NB8 A;  4A3E I;  1I6H I;  4BXX I;  1TWF I;  4MH4 A;  3HOV I;  4A3G I;  2JS4 A;  4NB9 A;  3S14 I;  2DE6 A;  3M3Y I;  1RO4 A;  1R9T I;  2HF1 A;  3GTM S;  3I4M I;  3PO3 I;  1USP B;  4Y7N I;  2DE5 A;  3RZO I;  4NBF A;  1Y1W I;  3K7A I; 
#chains in the Genus database with same CATH topology
 1Q82 1;  1QVF Z;  3LUS A;  3F3P C;  4MD9 A;  3J80 f;  1USP A;  2O53 A;  2W04 A;  2R6M A;  2R92 I;  1PFT A;  2RHB A;  1KQS Z;  1NP6 A;  4HH4 A;  2BJO A;  1M90 1;  5D1P A;  1X3Z A;  2G2K A;  1YIT 1;  2JUB A;  2B63 I;  1YJW 1;  3GTK I;  1LQL A;  3CCR 1;  2W03 A;  2WAQ A;  5A2Q b;  4NOZ A;  4RVG A;  1X0T A;  3CME Z;  4A3J I;  5FLX b;  3EER A;  1L1O C;  4HGZ A;  5C4J I;  3MZK B;  4MD7 A;  2JA5 I;  1SIW A;  2JR6 A;  4NBE A;  3TE5 B;  2OTL Z;  3GTM I;  3CCJ Z;  1RLY A;  3ESW A;  3CC2 1;  4NBA A;  1KQS Y;  1QYP A;  2ZAE B;  1YIJ 1;  2PK7 A;  1M1K 2;  2QRE B;  1YJN 1;  1NUI A;  2JA8 I;  3G4S Z;  2QA4 1;  1VQN Z;  4HGY A;  3U50 C;  1N8R 2;  5C3E I;  1TFI A;  2GU2 A;  4E2Z A;  3J7A 4;  2E7Z A;  1VQ7 1;  4BY1 I;  1QXF A;  3QWU A;  3G6E Z;  4QTT A;  3HOY I;  2K5R A;  2OZK A;  2RPR A;  1VQP 1;  4CL1 A;  4A3M I;  2OTJ Z;  2JNY A;  2OOY B;  1X3W A;  3CC4 Z;  3Q87 A;  3H3V J;  3VTN A;  4E2X A;  2P3Y A;  2V8I A;  1NJI 1;  4E32 A;  2RBL A;  4BXX I;  3G71 Z;  3CMA Z;  4MH4 A;  3HOV I;  4A3G I;  1Q7Y 1;  4NB9 A;  3TDH B;  3CCM Z;  1VQ9 Z;  2KI7 B;  1KC8 2;  4Y7N I;  1QF8 A;  3RZO I;  3CPW Z;  1FDI A;  1VQL 1;  1KD1 1;  3GTG I;  2JA7 I;  2NVQ I;  1YI2 Z;  5D1O A;  5T64 A;  2NVX I;  2VUM I;  3I4N I;  3CD6 Z;  5AN9 F;  2QEX Z;  3T4N B;  4RVH A;  1S72 1;  1ZH1 A;  5LL6 f;  3S1M I;  3GTJ I;  2KPI A;  3CXC Z;  3CCL 1;  2PMZ A;  3CPW Y;  1VQM Z;  3S1N I;  3CCU 1;  1TWA I;  2VF1 A;  2V8K A;  1Z02 A;  3CCL Z;  2R7Z I;  2IZ4 A;  5IT9 b;  3GTL I;  1Q16 A;  1WCM I;  2QRD B;  1K73 2;  1JJ2 Z;  2NVT I;  1TWC I;  3I55 1;  1ZB8 A;  4DGL A;  4A3F I;  5IT9 f;  3GCF A;  1YJ9 1;  3OW2 Z;  3HOX I;  2NVY I;  3IF8 A;  3CCQ 1;  1VQO 1;  1YIT Z;  1Q81 2;  4DQY B;  1YJW Z;  4NBB A;  1QVF Y;  3CCR Z;  3CXC Y;  3GKQ A;  5A2Q f;  2QKD A;  3NFZ A;  1Q86 2;  2JA6 I;  3CCS 1;  4A3I I;  5FLX f;  4A93 I;  2GTH A;  3M4O I;  1SFO I;  3HOZ I;  3FKI I;  2QLV B;  2JIQ A;  2HU9 A;  3BG1 B;  3CC2 Z;  3IX0 A;  2RIQ A;  1VQ4 1;  1VQ8 1;  1YIJ Z;  4NBC A;  5IP7 I;  5IP9 I;  2WB1 A;  1YJN Z;  4A3E I;  2JS4 A;  2QA4 Z;  5T6B A;  3S14 I;  3CCV 1;  1R9T I;  2HF1 A;  1WZN A;  2RT9 A;  3GTM S;  2IV2 X;  1USP B;  3NH5 A;  1K8A 1;  1AA6 A;  1KC8 1;  1VQ7 Z;  4E2Y A;  4DK1 A;  4RVD A;  3K7A I;  1Z03 A;  1YHQ 1;  1K9M 2;  3CC7 1;  2O4H A;  3JAM b;  1VQP Z;  3PO2 I;  2VPX A;  3FQM A;  3VMI A;  2R93 I;  3GTO I;  2LEX A;  1N2F A;  4RV9 A;  1W2B Z;  4E31 A;  3JAM f;  2QRC B;  1VQK 1;  2H85 A;  4XX2 A;  1VQ5 1;  3IFU A;  3NDJ A;  3CCE 1;  1RNI A;  4A3L I;  1WJ2 A;  3NH4 A;  4NH1 C;  1VQ6 1;  2V45 A;  4RVF A;  2E2J I;  2VPY A;  4MD8 A;  4MXU A;  1VQL Z;  3RZD I;  2VUG A;  2Y0S A;  2LIY A;  2JIO A;  3S1R I;  2OOX B;  4Y52 I;  1Y1V I;  1NJI 2;  1K73 1;  1VLA A;  4NBH A;  5C44 I;  2VPW A;  4NBG A;  5FLM I;  1S72 Z;  2F4M A;  1JWH C;  1Q7Y 2;  4BBS I;  3NDI A;  2F4O A;  4E30 A;  1Q81 1;  3I56 1;  1TWG I;  4AYB A;  4A3C I;  3CCU Z;  1K83 I;  1WII A;  3S2D I;  3J80 b;  1Y1V S;  2IZ3 A;  3GTQ I;  4X6A I;  1TWH I;  1I3Q I;  3IR7 A;  1M1K 1;  3I55 Z;  1S7M A;  1Y8C A;  2I3C A;  4NB8 A;  2YAD A;  4TNU A;  1I6H I;  1TWF I;  3EED A;  1YJ9 Z;  3NH8 A;  3CCQ Z;  4E2W A;  1VQO Z;  1RO2 A;  3KIH A;  1RO4 A;  1N8R 1;  2NAP A;  3F3F C;  5D1O B;  1P9N A;  1Q82 2;  3PO3 I;  3CME 1;  1Y1W I;  4A3K I;  3S1Q I;  3J81 b;  3CCS Z;  4E33 A;  2DE7 A;  2LFU A;  1JJ2 Y;  1K9M 1;  3S2H I;  2OTL 1;  3CCJ 1;  4A3D I;  3D9X A;  1M90 2;  2GTI A;  3J81 f;  1KRL A;  3OW2 Y;  2V8J A;  4BBR I;  1VQ8 Z;  1VQ4 Z;  3G4S 1;  4EWC A;  3PO3 S;  2Q4Z A;  1VQN 1;  3D2L A;  1YUK A;  2JIP A;  4RS4 A;  4A3B I;  3CCV Z;  2E2H I;  1I50 I;  1YUA A;  3S15 I;  3G6E 1;  2AKL A;  3VB9 A;  3S17 I;  2K3R A;  4MON A;  4QTU A;  2M48 A;  1YHQ Z;  3MON A;  5C4X I;  3CC7 Z;  2VPZ A;  5T67 A;  2OTJ 1;  3MZL B;  3CC4 1;  3HKZ A;  4NBD A;  3VMH A;  3S16 I;  1DL6 A;  3I07 A;  3CQZ I;  3H0G I;  3FQQ A;  3D6W A;  2AYD A;  2QR1 B;  2JIM A;  1VQK Z;  2J6A A;  3VMG A;  3G71 1;  2YU9 I;  3CMA 1;  1WW9 A;  1VQ5 Z;  4NFR A;  4S1T A;  3CCM 1;  4MRI A;  1VQ9 1;  3HOU I;  1ML8 A;  3CCE Z;  3HOW I;  1VQ6 Z;  1K8A 2;  1QVG Z;  1ZB9 A;  1RQF A;  3GTP I;  4BY7 I;  1Z01 A;  2E2I I;  3KIF A;  2P28 A;  1W2B Y;  1YI2 1;  2M6N A;  5CM2 M;  2E9H A;  3BG0 B;  3P5J B;  3CD6 1;  2JIR A;  2EGT A;  2QEX 1;  2Q51 A;  1FDO A;  2V3V A;  2DE6 A;  3M3Y I;  2JMO A;  3I4M I;  1KD1 2;  2DE5 A;  4NBF A;  1RO0 A;  1VQM 1;  1QVG Y;  1Q86 1;  2PM9 A;  3I56 Z; 
#chains in the Genus database with same CATH homology
 1Q82 1;  1QVF Z;  3LUS A;  3F3P C;  4MD9 A;  3J80 f;  1USP A;  2O53 A;  2W04 A;  2R6M A;  2R92 I;  1PFT A;  2RHB A;  1KQS Z;  1NP6 A;  4HH4 A;  2BJO A;  1M90 1;  5D1P A;  1X3Z A;  2G2K A;  1YIT 1;  2JUB A;  2B63 I;  1YJW 1;  3GTK I;  1LQL A;  2W03 A;  2WAQ A;  5A2Q b;  3CCR 1;  4NOZ A;  4RVG A;  1X0T A;  3CME Z;  4A3J I;  5FLX b;  3EER A;  1L1O C;  4HGZ A;  5C4J I;  3MZK B;  4MD7 A;  2JA5 I;  2JR6 A;  4NBE A;  3TE5 B;  2OTL Z;  3GTM I;  3CCJ Z;  1RLY A;  3ESW A;  3CC2 1;  4NBA A;  1KQS Y;  1QYP A;  2ZAE B;  1YIJ 1;  2PK7 A;  1M1K 2;  2QRE B;  1YJN 1;  1NUI A;  2JA8 I;  3G4S Z;  2QA4 1;  1VQN Z;  4HGY A;  3U50 C;  1N8R 2;  5C3E I;  1TFI A;  2GU2 A;  4E2Z A;  3J7A 4;  1VQ7 1;  4BY1 I;  3QWU A;  3G6E Z;  4QTT A;  3HOY I;  2K5R A;  2OZK A;  2RPR A;  1VQP 1;  4CL1 A;  4A3M I;  2OTJ Z;  2JNY A;  2OOY B;  1X3W A;  3CC4 Z;  3Q87 A;  3H3V J;  3VTN A;  4E2X A;  2P3Y A;  2V8I A;  1NJI 1;  4E32 A;  2RBL A;  4BXX I;  3G71 Z;  3CMA Z;  4MH4 A;  3HOV I;  4A3G I;  1Q7Y 1;  4NB9 A;  3TDH B;  3CCM Z;  1VQ9 Z;  2KI7 B;  1KC8 2;  4Y7N I;  1QF8 A;  3RZO I;  3CPW Z;  1VQL 1;  1KD1 1;  3GTG I;  2JA7 I;  2NVQ I;  1YI2 Z;  5D1O A;  5T64 A;  2NVX I;  2VUM I;  3I4N I;  3CD6 Z;  5AN9 F;  2QEX Z;  3T4N B;  4RVH A;  1S72 1;  1ZH1 A;  5LL6 f;  3S1M I;  3GTJ I;  2KPI A;  3CXC Z;  3CCL 1;  2PMZ A;  3CPW Y;  1VQM Z;  3S1N I;  3CCU 1;  1TWA I;  2VF1 A;  2V8K A;  1Z02 A;  3CCL Z;  2R7Z I;  2IZ4 A;  5IT9 b;  3GTL I;  1WCM I;  2QRD B;  1K73 2;  1JJ2 Z;  2NVT I;  1TWC I;  3I55 1;  1ZB8 A;  4DGL A;  4A3F I;  5IT9 f;  3GCF A;  1YJ9 1;  3OW2 Z;  3HOX I;  2NVY I;  3IF8 A;  3CCQ 1;  1VQO 1;  1YIT Z;  1Q81 2;  4DQY B;  1YJW Z;  4NBB A;  1QVF Y;  3CCR Z;  3CXC Y;  3GKQ A;  5A2Q f;  2QKD A;  3NFZ A;  1Q86 2;  2JA6 I;  3CCS 1;  4A3I I;  5FLX f;  4A93 I;  2GTH A;  3M4O I;  1SFO I;  3HOZ I;  3FKI I;  2QLV B;  2HU9 A;  3BG1 B;  3CC2 Z;  3IX0 A;  2RIQ A;  1VQ4 1;  1VQ8 1;  1YIJ Z;  4NBC A;  5IP7 I;  5IP9 I;  2WB1 A;  1YJN Z;  4A3E I;  2JS4 A;  2QA4 Z;  5T6B A;  3S14 I;  3CCV 1;  1R9T I;  2HF1 A;  2RT9 A;  3GTM S;  1USP B;  3NH5 A;  1K8A 1;  1KC8 1;  1VQ7 Z;  4E2Y A;  4DK1 A;  4RVD A;  3K7A I;  1Z03 A;  1YHQ 1;  1K9M 2;  3CC7 1;  2O4H A;  3JAM b;  1VQP Z;  3PO2 I;  3FQM A;  3VMI A;  2R93 I;  3GTO I;  1N2F A;  4RV9 A;  1W2B Z;  4E31 A;  3JAM f;  2QRC B;  1VQK 1;  2H85 A;  4XX2 A;  1VQ5 1;  3IFU A;  3NDJ A;  3CCE 1;  1RNI A;  4A3L I;  3NH4 A;  4NH1 C;  1VQ6 1;  4RVF A;  2E2J I;  4MD8 A;  4MXU A;  1VQL Z;  3RZD I;  2VUG A;  2Y0S A;  2LIY A;  3S1R I;  2OOX B;  4Y52 I;  1Y1V I;  1NJI 2;  1K73 1;  1VLA A;  4NBH A;  5C44 I;  4NBG A;  5FLM I;  1S72 Z;  2F4M A;  1JWH C;  1Q7Y 2;  4BBS I;  3NDI A;  2F4O A;  4E30 A;  1Q81 1;  3I56 1;  1TWG I;  4AYB A;  4A3C I;  3CCU Z;  1K83 I;  1WII A;  3S2D I;  3J80 b;  1Y1V S;  2IZ3 A;  3GTQ I;  4X6A I;  1TWH I;  1I3Q I;  1M1K 1;  3I55 Z;  1S7M A;  2I3C A;  4NB8 A;  2YAD A;  4TNU A;  1I6H I;  1TWF I;  3EED A;  1YJ9 Z;  3NH8 A;  3CCQ Z;  4E2W A;  1VQO Z;  1RO2 A;  3KIH A;  1RO4 A;  1N8R 1;  3F3F C;  5D1O B;  1P9N A;  1Q82 2;  3PO3 I;  3CME 1;  1Y1W I;  4A3K I;  3S1Q I;  3J81 b;  3CCS Z;  4E33 A;  2DE7 A;  2LFU A;  1JJ2 Y;  1K9M 1;  3S2H I;  2OTL 1;  3CCJ 1;  4A3D I;  3D9X A;  1M90 2;  2GTI A;  3J81 f;  1KRL A;  3OW2 Y;  2V8J A;  4BBR I;  1VQ8 Z;  1VQ4 Z;  3G4S 1;  4EWC A;  3PO3 S;  2Q4Z A;  1VQN 1;  1YUK A;  4RS4 A;  4A3B I;  3CCV Z;  2E2H I;  1I50 I;  1YUA A;  3S15 I;  3G6E 1;  2AKL A;  3VB9 A;  3S17 I;  2K3R A;  4MON A;  4QTU A;  2M48 A;  1YHQ Z;  3MON A;  5C4X I;  3CC7 Z;  2OTJ 1;  5T67 A;  3MZL B;  3CC4 1;  3HKZ A;  4NBD A;  3VMH A;  3S16 I;  1DL6 A;  3I07 A;  3CQZ I;  3H0G I;  3FQQ A;  3D6W A;  2QR1 B;  1VQK Z;  2J6A A;  3VMG A;  3G71 1;  2YU9 I;  3CMA 1;  1WW9 A;  1VQ5 Z;  4NFR A;  4S1T A;  3CCM 1;  4MRI A;  1VQ9 1;  3HOU I;  1ML8 A;  3CCE Z;  3HOW I;  1VQ6 Z;  1K8A 2;  1QVG Z;  1ZB9 A;  1RQF A;  3GTP I;  4BY7 I;  1Z01 A;  2E2I I;  3KIF A;  2P28 A;  1W2B Y;  1YI2 1;  2M6N A;  5CM2 M;  2E9H A;  3BG0 B;  3P5J B;  3CD6 1;  2EGT A;  2QEX 1;  2Q51 A;  2DE6 A;  3M3Y I;  2JMO A;  3I4M I;  1KD1 2;  2DE5 A;  4NBF A;  1RO0 A;  1VQM 1;  1QVG Y;  1Q86 1;  2PM9 A;  3I56 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...