3Q87A

Structure of e. cuniculi mtq2-trm112 complex responible for the methylation of erf1 translation termination factor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
122
Chain Sequence
MKPFLLGLLKCKRCSFMTKLILECEKAESNDVDVKIFNKHMFTENGGERLKSLVNSLRDFHGRELSEQDISSFVENPGDDEKIKEFLFGIDVVEGSLRCDMCGLIYPIKGSIVETVDTVESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords Putative uncharacterized protein ECU08_1170
publication title Mechanism of activation of methyltransferases involved in translation by the Trm112 'hub' protein
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 32
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3q87A00
4NBBA 3GTMI 3EERA 2E2II 4NBAA 3H3VJ 2E2HI 3HOUI 2NVYI 4NBEA 1DL6A 4QTUA 4A3EI 5C3EI 1R9TI 4A3MI 4NBCA 4A3KI 5IP7I 3FKII 3HOVI 1VLAA 3GTOI 1WCMI 1QYPA 3GCFA 1TFIA 3HOYI 1I50I 2VUMI 2R93I 1ZB9A 4BXXI 3S14I 3RZOI 5FLMI 3VB9A 2K5RA 4A3FI 4BBSI 3HOZI 2JA6I 2DE6A 3HOWI 2E2JI 3ESWA 3I4NI 2BJOA 2F4OA 1PFTA 3GTJI 3HOXI 1N2FA 4A3LI 3D6WA 3GKQA 2JA8I 1X3ZA 5C4JI 1USPB 3S1RI 3Q87A 1TWHI 1K83I 3GTQI 2PK7A 3H0GI 3GTMS 1RO4A 4BBRI 1RLYA 4NBDA 1Y1VI 4QTTA 1NUIA 3GTKI 3GTPI 3U50C 4NB9A 3VMHA 4A3BI 2NVXI 4NB8A 4NBFA 4NOZA 4BY7I 2NVTI 3S2DI 4XX2A 1LQLA 1TWFI 3S16I 1YUAA 1WW9A 2HF1A 2DE5A 3PO2I 5C44I 2JNYA 4A3JI 3S1NI 3PO3I 2JA7I 3RZDI 5IP9I 1SFOI 4A93I 2AKLA 3K7AI 3S17I 3S1QI 3S1MI 1USPA 2DE7A 2F4MA 4A3GI 2JA5I 3VMGA 2NVQI 1ZB8A 4BY1I 1I6HI 3M4OI 2RBLA 1TWGI 3PO3S 3S15I 3CQZI 3I4MI 3M3YI 2KPIA 3S2HI 4NBHA 1Y1VS 4X6AI 4Y52I 5C4XI 2JR6A 4A3DI 3GTGI 2J6AA 4MH4A 1TWAI 1I3QI 3VMIA 2R92I 1Y1WI 3LUSA 1TWCI 2YU9I 4A3II 2B63I 3GTLI 2R7ZI 5CM2M 4A3CI 1ML8A 2P3YA 3I07A 1L1OC 1X3WA 4NBGA 2JS4A 4Y7NI
chains in the Genus database with same CATH superfamily
3EERA 2H85A 3CCU1 3H3VJ 2M48A 3MONA 1DL6A 4QTUA 4DQYB 3FKII 2Q51A 3G4S1 1NP6A 1TFIA 3HOYI 1I50I 1ZB9A 5FLMI 1VQ9Z 3HOWI 3CCM1 2F4OA 1PFTA 2V8KA 4TNUA 4RVDA 1WJ2A 1VQMZ 3NH5A 1N2FA 3MZKB 2QEX1 3D6WA 1FDOA 3G71Z 2JMOA 3S1RI 3GTQI 1K83I 4RVFA 2QRCB 3HKZA 3CCE1 3GTMS 1RO4A 3CMA1 1YJW1 1Q811 1VQ81 1VQ71 1YI21 3GTKI 5FLXb 3NFZA 3GTPI 2OTL1 2QLVB 4NBFA 3J80f 4E2ZA 2M6NA 4XX2A 1LQLA 3QWUA 1YJ9Z 1TWFI 2VPXA 3S16I 1WW9A 3CC7Z 2DE5A 1VQ5Z 5C44I 2YADA 3PO3I 1YUKA 1SFOI 2JIOA 3CPWY 3EEDA 2F4MA 1QVGY 3J81b 2JA5I 2OOYB 4BY1I 4HGYA 1JJ2Y 3D2LA 2RBLA 2JIRA 3CQZI 3I4MI 3CXCZ 3CCL1 2LEXA 2KPIA 4NBHA 4Y52I 1QF8A 3GTLI 3G6E1 4A3CI 2WAQA 1L1OC 3CCV1 1VQM1 1Q862 3CPWZ 2RHBA 2E2HI 5A2Qb 3HOUI 3F3FC 4NBEA 1QVGZ 1VQOZ 5C3EI 3G711 1VQP1 1Q7Y2 1JJ2Z 4A3KI 5IP7I 5LL6f 1WCMI 3CCQZ 1QYPA 3JAMb 4E32A 2EGTA 3CME1 1S7MA 4AYBA 4A3FI 1RNIA 3HOZI 2QA4Z 1Z02A 2OTJ1 3IFUA 4MD7A 3I561 3P5JB 4A3LI 1RQFA 2O53A 2JA8I 1WIIA 1KRLA 1VQ51 1USPB 3H0GI 4BBRI 1RLYA 3CC41 1ZH1A 2AYDA 1Y1VI 3F3PC 3OW2Y 3U50C 2W04A 4A3BI 1WZNA 1YHQ1 2G2KA 2V8IA 2RPRA 1P9NA 4DK1A 1Q812 1YITZ 2JIMA 1RO0A 3NH8A 2Q4ZA 2VPWA 3CCRZ 2JNYA 4A3JI 1RO2A 3VTNA 1VQ6Z 4S1TA 5IP9I 2QRDB 3K7AI 1QVFY 4E31A 3S1MI 3TDHB 4A3GI 2GTHA 2VPZA 1VQ4Z 2K3RA 5IT9b 1I6HI 4CL1A 3M4OI 3PO3S 1VQO1 3M3YI 1Z01A 4MD8A 1M901 4MH4A 1TWAI 3NDIA 3CCSZ 3CC2Z 1VQL1 3I55Z 4MXUA 4DGLA 3I07A 1YIJZ 4Y7NI 3GTMI 1QVFZ 3CCUZ 2GU2A 4HGZA 4E30A 3HOVI 1VLAA 1SIWA 2Y0SA 3GCFA 1VQKZ 2VUMI 2R93I 1K9M2 4BXXI 2LFUA 3VB9A 1VQ91 1W2BY 4BBSI 2O4HA 2DE6A 2VUGA 2E2JI 3ESWA 1M1K2 3I4NI 1VQNZ 2BJOA 2JUBA 2IZ4A 1K9M1 2VF1A 1KQSY 5FLXf 1Y8CA 4NH1C 2PMZA 2GTIA 3TE5B 3KIFA 1M1K1 2QR1B 1X3ZA 5C4JI 3Q87A 1KC82 2PK7A 2I3CA 2RIQA 1VQ61 3CCEZ 1AA6A 1YJNZ 2WB1A 4E33A 3BG1B 3CMAZ 1YJWZ 3T4NB 4NBDA 1VQ8Z 4NFRA 1KC81 4NB9A 3VMHA 1QXFA 4NB8A 4HH4A 4RVGA 3J81f 2OOXB 5T64A 3S2DI 1YJ91 3IF8A 3CCJZ 1YUAA 4E2YA 3CC71 1NJI1 2HF1A 2W03A 1JWHC 3IR7A 2JA7I 3I551 4A93I 5T6BA 3S1QI 1USPA 3NH4A 3J80b 1YIJ1 1N8R1 3VMGA 4EWCA 1ZB8A 3CD6Z 2QKDA 1TWGI 3S15I 4RVHA 3MZLB 3CCLZ 4E2XA 3S2HI 4X6AI 5C4XI 4A3DI 3GTGI 2J6AA 2IZ3A 1VQK1 5A2Qf 2QREB 3VMIA 1Y1WI 4A3II 2V8JA 2R7ZI 5CM2M 4MONA 3G6EZ 3FQQA 1VQN1 1K732 3JAMf 1X3WA 3KIHA 3CCVZ 1M902 4NBBA 4E2WA 1Q822 2E2II 4NBAA 2E7ZA 2OZKA 2NVYI 3OW2Z 4A3EI 1R9TI 4A3MI 4NBCA 1K731 1VQPZ 2NAPA 3GTOI 3CCQ1 2R6MA 4RV9A 1Q821 1YJN1 3S14I 3RZOI 4MRIA 3CMEZ 1S72Z 2K5RA 2IV2X 2QA41 2JA6I 3CXCY 2OTJZ 2P28A 1Q16A 2E9HA 3GTJI 3HOXI 1Z03A 3I56Z 3GKQA 3CCJ1 2V3VA 1TWHI 5D1OB 3G4SZ 3J7A4 3CC4Z 2JIQA 4QTTA 1NUIA 5D1OA 3CD61 1K8A2 2NVXI 3D9XA 1KD12 3CCMZ 4NOZA 4BY7I 2NVTI 2PM9A 2QEXZ 2V45A 1YHQZ 5IT9f 3NDJA 1YIT1 1K8A1 3PO2I 1KD11 3CCR1 3S1NI 5D1PA 3RZDI 4MD9A 2AKLA 3IX0A 3S17I 2DE7A 1VQ41 1VQ7Z 1YI2Z 2NVQI 3FQMA 1NJI2 2OTLZ 1W2BZ 3BG0B 2KI7B 5T67A 1Y1VS 1X0TA 2JR6A 1Q861 2ZAEB 1KQSZ 3CCS1 1N8R2 1I3QI 2HU9A 2VPYA 3CC21 2R92I 3LUSA 1TWCI 2YU9I 1S721 2B63I 4RS4A 5AN9F 1VQLZ 2JIPA 1Q7Y1 2LIYA 1ML8A 2P3YA 1FDIA 4NBGA 2RT9A 2JS4A
chains in the Genus database with same CATH topology
3EERA 2H85A 3CCU1 3H3VJ 2M48A 3MONA 1DL6A 4QTUA 4DQYB 3FKII 2Q51A 3G4S1 1NP6A 1TFIA 3HOYI 1I50I 1ZB9A 5FLMI 1VQ9Z 3HOWI 2F4OA 1PFTA 3CCM1 2V8KA 4TNUA 4RVDA 1VQMZ 3NH5A 1N2FA 3MZKB 2QEX1 3D6WA 3G71Z 2JMOA 3S1RI 3GTQI 1K83I 4RVFA 2QRCB 3HKZA 3CCE1 3GTMS 1RO4A 3CMA1 1YJW1 1Q811 1VQ81 1VQ71 1YI21 3GTKI 5FLXb 3NFZA 3GTPI 2OTL1 2QLVB 4NBFA 3J80f 4E2ZA 2M6NA 4XX2A 1LQLA 3QWUA 1YJ9Z 1TWFI 3S16I 1WW9A 3CC7Z 2DE5A 1VQ5Z 5C44I 2YADA 3PO3I 1YUKA 1SFOI 3CPWY 3EEDA 2F4MA 1QVGY 3J81b 2JA5I 2OOYB 4BY1I 4HGYA 1JJ2Y 2RBLA 3CQZI 3I4MI 3CXCZ 3CCL1 2KPIA 4NBHA 4Y52I 1QF8A 3GTLI 3G6E1 4A3CI 2WAQA 1L1OC 3CCV1 1VQM1 1Q862 3CPWZ 2RHBA 2E2HI 5A2Qb 3HOUI 3F3FC 4NBEA 1QVGZ 1VQOZ 5C3EI 3G711 1VQP1 1Q7Y2 1JJ2Z 4A3KI 5IP7I 5LL6f 1WCMI 3CCQZ 1QYPA 3JAMb 4E32A 2EGTA 3CME1 1S7MA 4AYBA 4A3FI 1RNIA 3HOZI 2QA4Z 1Z02A 2OTJ1 3IFUA 4MD7A 3I561 3P5JB 4A3LI 1RQFA 2O53A 2JA8I 1WIIA 1KRLA 1VQ51 1USPB 3H0GI 4BBRI 1RLYA 3CC41 1ZH1A 1Y1VI 3F3PC 3OW2Y 3U50C 2W04A 4A3BI 1YHQ1 2G2KA 2V8IA 2RPRA 1P9NA 4DK1A 1Q812 1YITZ 1RO0A 3NH8A 2Q4ZA 3CCRZ 2JNYA 4A3JI 1RO2A 3VTNA 1VQ6Z 4S1TA 5IP9I 2QRDB 3K7AI 1QVFY 4E31A 3S1MI 3TDHB 4A3GI 2GTHA 1VQ4Z 2K3RA 5IT9b 1I6HI 4CL1A 3M4OI 3PO3S 1VQO1 3M3YI 1Z01A 4MD8A 1M901 4MH4A 1TWAI 3NDIA 3CCSZ 3CC2Z 1VQL1 3I55Z 4MXUA 4DGLA 3I07A 1YIJZ 4Y7NI 3GTMI 1QVFZ 3CCUZ 2GU2A 4HGZA 4E30A 3HOVI 1VLAA 2Y0SA 3GCFA 1VQKZ 2VUMI 2R93I 1K9M2 4BXXI 2LFUA 3VB9A 1VQ91 1W2BY 4BBSI 2O4HA 2DE6A 2VUGA 2E2JI 3ESWA 1M1K2 3I4NI 1VQNZ 2BJOA 2JUBA 2IZ4A 1K9M1 2VF1A 1KQSY 5FLXf 4NH1C 2PMZA 2GTIA 3TE5B 3KIFA 1M1K1 2QR1B 1X3ZA 5C4JI 3Q87A 1KC82 2PK7A 2I3CA 2RIQA 1VQ61 3CCEZ 1YJNZ 2WB1A 4E33A 3BG1B 3CMAZ 1YJWZ 3T4NB 4NBDA 1VQ8Z 4NFRA 1KC81 4NB9A 3VMHA 4NB8A 4HH4A 4RVGA 3J81f 2OOXB 5T64A 3S2DI 1YJ91 3IF8A 3CCJZ 1YUAA 4E2YA 3CC71 1NJI1 2HF1A 2W03A 1JWHC 2JA7I 3I551 4A93I 5T6BA 3S1QI 1USPA 3NH4A 3J80b 1YIJ1 1N8R1 3VMGA 4EWCA 1ZB8A 3CD6Z 2QKDA 1TWGI 3S15I 4RVHA 3MZLB 3CCLZ 4E2XA 3S2HI 4X6AI 5C4XI 4A3DI 3GTGI 2J6AA 2IZ3A 1VQK1 5A2Qf 2QREB 3VMIA 1Y1WI 4A3II 2V8JA 2R7ZI 5CM2M 4MONA 3G6EZ 3FQQA 1VQN1 1K732 3JAMf 1X3WA 3KIHA 3CCVZ 1M902 4NBBA 4E2WA 1Q822 2E2II 4NBAA 2OZKA 2NVYI 3OW2Z 4A3EI 1R9TI 4A3MI 4NBCA 1K731 1VQPZ 3GTOI 3CCQ1 2R6MA 4RV9A 1Q821 1YJN1 3S14I 3RZOI 4MRIA 3CMEZ 1S72Z 2K5RA 2QA41 2JA6I 3CXCY 2OTJZ 2P28A 2E9HA 3GTJI 3HOXI 1Z03A 3I56Z 3GKQA 3CCJ1 1TWHI 5D1OB 3G4SZ 3J7A4 3CC4Z 4QTTA 1NUIA 5D1OA 3CD61 1K8A2 2NVXI 3D9XA 1KD12 3CCMZ 4NOZA 4BY7I 2NVTI 2PM9A 1YHQZ 2QEXZ 5IT9f 3NDJA 1YIT1 1K8A1 3PO2I 1KD11 3CCR1 3S1NI 5D1PA 3RZDI 4MD9A 2AKLA 3IX0A 3S17I 2DE7A 1VQ41 1VQ7Z 1YI2Z 2NVQI 3FQMA 1NJI2 2OTLZ 1W2BZ 3BG0B 2KI7B 5T67A 1Y1VS 1X0TA 2JR6A 1Q861 2ZAEB 1KQSZ 3CCS1 1N8R2 1I3QI 2HU9A 3CC21 2R92I 3LUSA 1TWCI 2YU9I 1S721 2B63I 4RS4A 5AN9F 1VQLZ 1Q7Y1 2LIYA 1ML8A 2P3YA 4NBGA 2RT9A 2JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBB A;  3GTM I;  3EER A;  2E2I I;  4NBA A;  3H3V J;  2E2H I;  3HOU I;  2NVY I;  4NBE A;  1DL6 A;  4QTU A;  4A3E I;  5C3E I;  1R9T I;  4A3M I;  4NBC A;  4A3K I;  5IP7 I;  3FKI I;  3HOV I;  1VLA A;  3GTO I;  1WCM I;  1QYP A;  3GCF A;  1TFI A;  3HOY I;  1I50 I;  2VUM I;  2R93 I;  1ZB9 A;  4BXX I;  3S14 I;  3RZO I;  5FLM I;  3VB9 A;  2K5R A;  4A3F I;  4BBS I;  3HOZ I;  2JA6 I;  2DE6 A;  3HOW I;  2E2J I;  3ESW A;  3I4N I;  2BJO A;  2F4O A;  1PFT A;  3GTJ I;  3HOX I;  1N2F A;  4A3L I;  3D6W A;  3GKQ A;  2JA8 I;  1X3Z A;  5C4J I;  1USP B;  3S1R I;  3Q87 A;  1TWH I;  1K83 I;  3GTQ I;  2PK7 A;  3H0G I;  3GTM S;  1RO4 A;  4BBR I;  1RLY A;  4NBD A;  1Y1V I;  4QTT A;  1NUI A;  3GTK I;  3GTP I;  3U50 C;  4NB9 A;  3VMH A;  4A3B I;  2NVX I;  4NB8 A;  4NBF A;  4NOZ A;  4BY7 I;  2NVT I;  3S2D I;  4XX2 A;  1LQL A;  1TWF I;  3S16 I;  1YUA A;  1WW9 A;  2HF1 A;  2DE5 A;  3PO2 I;  5C44 I;  2JNY A;  4A3J I;  3S1N I;  3PO3 I;  2JA7 I;  3RZD I;  5IP9 I;  1SFO I;  4A93 I;  2AKL A;  3K7A I;  3S17 I;  3S1Q I;  3S1M I;  1USP A;  2DE7 A;  2F4M A;  4A3G I;  2JA5 I;  3VMG A;  2NVQ I;  1ZB8 A;  4BY1 I;  1I6H I;  3M4O I;  2RBL A;  1TWG I;  3PO3 S;  3S15 I;  3CQZ I;  3I4M I;  3M3Y I;  2KPI A;  3S2H I;  4NBH A;  1Y1V S;  4X6A I;  4Y52 I;  5C4X I;  2JR6 A;  4A3D I;  3GTG I;  2J6A A;  4MH4 A;  1TWA I;  1I3Q I;  3VMI A;  2R92 I;  1Y1W I;  3LUS A;  1TWC I;  2YU9 I;  4A3I I;  2B63 I;  3GTL I;  2R7Z I;  5CM2 M;  4A3C I;  1ML8 A;  2P3Y A;  3I07 A;  1L1O C;  1X3W A;  4NBG A;  2JS4 A;  4Y7N I; 
#chains in the Genus database with same CATH topology
 3EER A;  2H85 A;  3CCU 1;  3H3V J;  2M48 A;  3MON A;  1DL6 A;  4QTU A;  4DQY B;  3FKI I;  2Q51 A;  3G4S 1;  1NP6 A;  1TFI A;  3HOY I;  1I50 I;  1ZB9 A;  5FLM I;  1VQ9 Z;  3HOW I;  3CCM 1;  2F4O A;  1PFT A;  2V8K A;  4TNU A;  4RVD A;  1WJ2 A;  1VQM Z;  3NH5 A;  1N2F A;  3MZK B;  2QEX 1;  3D6W A;  1FDO A;  3G71 Z;  2JMO A;  3S1R I;  3GTQ I;  1K83 I;  4RVF A;  2QRC B;  3HKZ A;  3CCE 1;  3GTM S;  1RO4 A;  3CMA 1;  1YJW 1;  1Q81 1;  1VQ8 1;  1VQ7 1;  1YI2 1;  3GTK I;  5FLX b;  3NFZ A;  3GTP I;  2OTL 1;  2QLV B;  4NBF A;  3J80 f;  4E2Z A;  2M6N A;  4XX2 A;  1LQL A;  3QWU A;  1YJ9 Z;  1TWF I;  2VPX A;  3S16 I;  1WW9 A;  3CC7 Z;  2DE5 A;  1VQ5 Z;  5C44 I;  2YAD A;  3PO3 I;  1YUK A;  1SFO I;  2JIO A;  3CPW Y;  3EED A;  2F4M A;  1QVG Y;  3J81 b;  2JA5 I;  2OOY B;  4BY1 I;  4HGY A;  1JJ2 Y;  3D2L A;  2RBL A;  2JIR A;  3CQZ I;  3I4M I;  3CXC Z;  3CCL 1;  2LEX A;  2KPI A;  4NBH A;  4Y52 I;  1QF8 A;  3GTL I;  3G6E 1;  4A3C I;  2WAQ A;  1L1O C;  3CCV 1;  1VQM 1;  1Q86 2;  3CPW Z;  2RHB A;  2E2H I;  5A2Q b;  3HOU I;  3F3F C;  4NBE A;  1QVG Z;  1VQO Z;  5C3E I;  3G71 1;  1VQP 1;  1Q7Y 2;  1JJ2 Z;  4A3K I;  5IP7 I;  5LL6 f;  1WCM I;  3CCQ Z;  1QYP A;  3JAM b;  4E32 A;  2EGT A;  3CME 1;  1S7M A;  4AYB A;  4A3F I;  1RNI A;  3HOZ I;  2QA4 Z;  1Z02 A;  2OTJ 1;  3IFU A;  4MD7 A;  3I56 1;  3P5J B;  4A3L I;  1RQF A;  2O53 A;  2JA8 I;  1WII A;  1KRL A;  1VQ5 1;  1USP B;  3H0G I;  4BBR I;  1RLY A;  3CC4 1;  1ZH1 A;  2AYD A;  1Y1V I;  3F3P C;  3OW2 Y;  3U50 C;  2W04 A;  4A3B I;  1WZN A;  1YHQ 1;  2G2K A;  2V8I A;  2RPR A;  1P9N A;  4DK1 A;  1Q81 2;  1YIT Z;  2JIM A;  1RO0 A;  3NH8 A;  2Q4Z A;  2VPW A;  3CCR Z;  2JNY A;  4A3J I;  1RO2 A;  3VTN A;  1VQ6 Z;  4S1T A;  5IP9 I;  2QRD B;  3K7A I;  1QVF Y;  4E31 A;  3S1M I;  3TDH B;  4A3G I;  2GTH A;  2VPZ A;  1VQ4 Z;  2K3R A;  5IT9 b;  1I6H I;  4CL1 A;  3M4O I;  3PO3 S;  1VQO 1;  3M3Y I;  1Z01 A;  4MD8 A;  1M90 1;  4MH4 A;  1TWA I;  3NDI A;  3CCS Z;  3CC2 Z;  1VQL 1;  3I55 Z;  4MXU A;  4DGL A;  3I07 A;  1YIJ Z;  4Y7N I;  3GTM I;  1QVF Z;  3CCU Z;  2GU2 A;  4HGZ A;  4E30 A;  3HOV I;  1VLA A;  1SIW A;  2Y0S A;  3GCF A;  1VQK Z;  2VUM I;  2R93 I;  1K9M 2;  4BXX I;  2LFU A;  3VB9 A;  1VQ9 1;  1W2B Y;  4BBS I;  2O4H A;  2DE6 A;  2VUG A;  2E2J I;  3ESW A;  1M1K 2;  3I4N I;  1VQN Z;  2BJO A;  2JUB A;  2IZ4 A;  1K9M 1;  2VF1 A;  1KQS Y;  5FLX f;  1Y8C A;  4NH1 C;  2PMZ A;  2GTI A;  3TE5 B;  3KIF A;  1M1K 1;  2QR1 B;  1X3Z A;  5C4J I;  3Q87 A;  1KC8 2;  2PK7 A;  2I3C A;  2RIQ A;  1VQ6 1;  3CCE Z;  1AA6 A;  1YJN Z;  2WB1 A;  4E33 A;  3BG1 B;  3CMA Z;  1YJW Z;  3T4N B;  4NBD A;  1VQ8 Z;  4NFR A;  1KC8 1;  4NB9 A;  3VMH A;  1QXF A;  4NB8 A;  4HH4 A;  4RVG A;  3J81 f;  2OOX B;  5T64 A;  3S2D I;  1YJ9 1;  3IF8 A;  3CCJ Z;  1YUA A;  4E2Y A;  3CC7 1;  1NJI 1;  2HF1 A;  2W03 A;  1JWH C;  3IR7 A;  2JA7 I;  3I55 1;  4A93 I;  5T6B A;  3S1Q I;  1USP A;  3NH4 A;  3J80 b;  1YIJ 1;  1N8R 1;  3VMG A;  4EWC A;  1ZB8 A;  3CD6 Z;  2QKD A;  1TWG I;  3S15 I;  4RVH A;  3MZL B;  3CCL Z;  4E2X A;  3S2H I;  4X6A I;  5C4X I;  4A3D I;  3GTG I;  2J6A A;  2IZ3 A;  1VQK 1;  5A2Q f;  2QRE B;  3VMI A;  1Y1W I;  4A3I I;  2V8J A;  2R7Z I;  5CM2 M;  4MON A;  3G6E Z;  3FQQ A;  1VQN 1;  1K73 2;  3JAM f;  1X3W A;  3KIH A;  3CCV Z;  1M90 2;  4NBB A;  4E2W A;  1Q82 2;  2E2I I;  4NBA A;  2E7Z A;  2OZK A;  2NVY I;  3OW2 Z;  4A3E I;  1R9T I;  4A3M I;  4NBC A;  1K73 1;  1VQP Z;  2NAP A;  3GTO I;  3CCQ 1;  2R6M A;  4RV9 A;  1Q82 1;  1YJN 1;  3S14 I;  3RZO I;  4MRI A;  3CME Z;  1S72 Z;  2K5R A;  2IV2 X;  2QA4 1;  2JA6 I;  3CXC Y;  2OTJ Z;  2P28 A;  1Q16 A;  2E9H A;  3GTJ I;  3HOX I;  1Z03 A;  3I56 Z;  3GKQ A;  3CCJ 1;  2V3V A;  1TWH I;  5D1O B;  3G4S Z;  3J7A 4;  3CC4 Z;  2JIQ A;  4QTT A;  1NUI A;  5D1O A;  3CD6 1;  1K8A 2;  2NVX I;  3D9X A;  1KD1 2;  3CCM Z;  4NOZ A;  4BY7 I;  2NVT I;  2PM9 A;  2QEX Z;  2V45 A;  1YHQ Z;  5IT9 f;  3NDJ A;  1YIT 1;  1K8A 1;  3PO2 I;  1KD1 1;  3CCR 1;  3S1N I;  5D1P A;  3RZD I;  4MD9 A;  2AKL A;  3IX0 A;  3S17 I;  2DE7 A;  1VQ4 1;  1VQ7 Z;  1YI2 Z;  2NVQ I;  3FQM A;  1NJI 2;  2OTL Z;  1W2B Z;  3BG0 B;  2KI7 B;  5T67 A;  1Y1V S;  1X0T A;  2JR6 A;  1Q86 1;  2ZAE B;  1KQS Z;  3CCS 1;  1N8R 2;  1I3Q I;  2HU9 A;  2VPY A;  3CC2 1;  2R92 I;  3LUS A;  1TWC I;  2YU9 I;  1S72 1;  2B63 I;  4RS4 A;  5AN9 F;  1VQL Z;  2JIP A;  1Q7Y 1;  2LIY A;  1ML8 A;  2P3Y A;  1FDI A;  4NBG A;  2RT9 A;  2JS4 A; 
#chains in the Genus database with same CATH homology
 3EER A;  2H85 A;  3CCU 1;  3H3V J;  2M48 A;  3MON A;  1DL6 A;  4QTU A;  4DQY B;  3FKI I;  2Q51 A;  3G4S 1;  1NP6 A;  1TFI A;  3HOY I;  1I50 I;  1ZB9 A;  5FLM I;  1VQ9 Z;  3HOW I;  2F4O A;  1PFT A;  3CCM 1;  2V8K A;  4TNU A;  4RVD A;  1VQM Z;  3NH5 A;  1N2F A;  3MZK B;  2QEX 1;  3D6W A;  3G71 Z;  2JMO A;  3S1R I;  3GTQ I;  1K83 I;  4RVF A;  2QRC B;  3HKZ A;  3CCE 1;  3GTM S;  1RO4 A;  3CMA 1;  1YJW 1;  1Q81 1;  1VQ8 1;  1VQ7 1;  1YI2 1;  3GTK I;  5FLX b;  3NFZ A;  3GTP I;  2OTL 1;  2QLV B;  4NBF A;  3J80 f;  4E2Z A;  2M6N A;  4XX2 A;  1LQL A;  3QWU A;  1YJ9 Z;  1TWF I;  3S16 I;  1WW9 A;  3CC7 Z;  2DE5 A;  1VQ5 Z;  5C44 I;  2YAD A;  3PO3 I;  1YUK A;  1SFO I;  3CPW Y;  3EED A;  2F4M A;  1QVG Y;  3J81 b;  2JA5 I;  2OOY B;  4BY1 I;  4HGY A;  1JJ2 Y;  2RBL A;  3CQZ I;  3I4M I;  3CXC Z;  3CCL 1;  2KPI A;  4NBH A;  4Y52 I;  1QF8 A;  3GTL I;  3G6E 1;  4A3C I;  2WAQ A;  1L1O C;  3CCV 1;  1VQM 1;  1Q86 2;  3CPW Z;  2RHB A;  2E2H I;  5A2Q b;  3HOU I;  3F3F C;  4NBE A;  1QVG Z;  1VQO Z;  5C3E I;  3G71 1;  1VQP 1;  1Q7Y 2;  1JJ2 Z;  4A3K I;  5IP7 I;  5LL6 f;  1WCM I;  3CCQ Z;  1QYP A;  3JAM b;  4E32 A;  2EGT A;  3CME 1;  1S7M A;  4AYB A;  4A3F I;  1RNI A;  3HOZ I;  2QA4 Z;  1Z02 A;  2OTJ 1;  3IFU A;  4MD7 A;  3I56 1;  3P5J B;  4A3L I;  1RQF A;  2O53 A;  2JA8 I;  1WII A;  1KRL A;  1VQ5 1;  1USP B;  3H0G I;  4BBR I;  1RLY A;  3CC4 1;  1ZH1 A;  1Y1V I;  3F3P C;  3OW2 Y;  3U50 C;  2W04 A;  4A3B I;  1YHQ 1;  2G2K A;  2V8I A;  2RPR A;  1P9N A;  4DK1 A;  1Q81 2;  1YIT Z;  1RO0 A;  3NH8 A;  2Q4Z A;  3CCR Z;  2JNY A;  4A3J I;  1RO2 A;  3VTN A;  1VQ6 Z;  4S1T A;  5IP9 I;  2QRD B;  3K7A I;  1QVF Y;  4E31 A;  3S1M I;  3TDH B;  4A3G I;  2GTH A;  1VQ4 Z;  2K3R A;  5IT9 b;  1I6H I;  4CL1 A;  3M4O I;  3PO3 S;  1VQO 1;  3M3Y I;  1Z01 A;  4MD8 A;  1M90 1;  4MH4 A;  1TWA I;  3NDI A;  3CCS Z;  3CC2 Z;  1VQL 1;  3I55 Z;  4MXU A;  4DGL A;  3I07 A;  1YIJ Z;  4Y7N I;  3GTM I;  1QVF Z;  3CCU Z;  2GU2 A;  4HGZ A;  4E30 A;  3HOV I;  1VLA A;  2Y0S A;  3GCF A;  1VQK Z;  2VUM I;  2R93 I;  1K9M 2;  4BXX I;  2LFU A;  3VB9 A;  1VQ9 1;  1W2B Y;  4BBS I;  2O4H A;  2DE6 A;  2VUG A;  2E2J I;  3ESW A;  1M1K 2;  3I4N I;  1VQN Z;  2BJO A;  2JUB A;  2IZ4 A;  1K9M 1;  2VF1 A;  1KQS Y;  5FLX f;  4NH1 C;  2PMZ A;  2GTI A;  3TE5 B;  3KIF A;  1M1K 1;  2QR1 B;  1X3Z A;  5C4J I;  3Q87 A;  1KC8 2;  2PK7 A;  2I3C A;  2RIQ A;  1VQ6 1;  3CCE Z;  1YJN Z;  2WB1 A;  4E33 A;  3BG1 B;  3CMA Z;  1YJW Z;  3T4N B;  4NBD A;  1VQ8 Z;  4NFR A;  1KC8 1;  4NB9 A;  3VMH A;  4NB8 A;  4HH4 A;  4RVG A;  3J81 f;  2OOX B;  5T64 A;  3S2D I;  1YJ9 1;  3IF8 A;  3CCJ Z;  1YUA A;  4E2Y A;  3CC7 1;  1NJI 1;  2HF1 A;  2W03 A;  1JWH C;  2JA7 I;  3I55 1;  4A93 I;  5T6B A;  3S1Q I;  1USP A;  3NH4 A;  3J80 b;  1YIJ 1;  1N8R 1;  3VMG A;  4EWC A;  1ZB8 A;  3CD6 Z;  2QKD A;  1TWG I;  3S15 I;  4RVH A;  3MZL B;  3CCL Z;  4E2X A;  3S2H I;  4X6A I;  5C4X I;  4A3D I;  3GTG I;  2J6A A;  2IZ3 A;  1VQK 1;  5A2Q f;  2QRE B;  3VMI A;  1Y1W I;  4A3I I;  2V8J A;  2R7Z I;  5CM2 M;  4MON A;  3G6E Z;  3FQQ A;  1VQN 1;  1K73 2;  3JAM f;  1X3W A;  3KIH A;  3CCV Z;  1M90 2;  4NBB A;  4E2W A;  1Q82 2;  2E2I I;  4NBA A;  2OZK A;  2NVY I;  3OW2 Z;  4A3E I;  1R9T I;  4A3M I;  4NBC A;  1K73 1;  1VQP Z;  3GTO I;  3CCQ 1;  2R6M A;  4RV9 A;  1Q82 1;  1YJN 1;  3S14 I;  3RZO I;  4MRI A;  3CME Z;  1S72 Z;  2K5R A;  2QA4 1;  2JA6 I;  3CXC Y;  2OTJ Z;  2P28 A;  2E9H A;  3GTJ I;  3HOX I;  1Z03 A;  3I56 Z;  3GKQ A;  3CCJ 1;  1TWH I;  5D1O B;  3G4S Z;  3J7A 4;  3CC4 Z;  4QTT A;  1NUI A;  5D1O A;  3CD6 1;  1K8A 2;  2NVX I;  3D9X A;  1KD1 2;  3CCM Z;  4NOZ A;  4BY7 I;  2NVT I;  2PM9 A;  1YHQ Z;  2QEX Z;  5IT9 f;  3NDJ A;  1YIT 1;  1K8A 1;  3PO2 I;  1KD1 1;  3CCR 1;  3S1N I;  5D1P A;  3RZD I;  4MD9 A;  2AKL A;  3IX0 A;  3S17 I;  2DE7 A;  1VQ4 1;  1VQ7 Z;  1YI2 Z;  2NVQ I;  3FQM A;  1NJI 2;  2OTL Z;  1W2B Z;  3BG0 B;  2KI7 B;  5T67 A;  1Y1V S;  1X0T A;  2JR6 A;  1Q86 1;  2ZAE B;  1KQS Z;  3CCS 1;  1N8R 2;  1I3Q I;  2HU9 A;  3CC2 1;  2R92 I;  3LUS A;  1TWC I;  2YU9 I;  1S72 1;  2B63 I;  4RS4 A;  5AN9 F;  1VQL Z;  1Q7Y 1;  2LIY A;  1ML8 A;  2P3Y A;  4NBG A;  2RT9 A;  2JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...