3Q87A

Structure of e. cuniculi mtq2-trm112 complex responible for the methylation of erf1 translation termination factor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
122
Chain Sequence
b'MKPFLLGLLKCKRCSFMTKLILECEKAESNDVDVKIFNKHMFTENGGERLKSLVNSLRDFHGRELSEQDISSFVENPGDDEKIKEFLFGIDVVEGSLRCDMCGLIYPIKGSIVETVDTVESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ECU08_1170
publication title Mechanism of activation of methyltransferases involved in translation by the Trm112 'hub' protein
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase activator/transferase
total genus 32
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3q87A00
3GTLI 3GTMS 1N2FA 3S1QI 1ZB8A 4NBHA 3VMGA 3I07A 2JA5I 2F4OA 2JA6I 2E2HI 5C3EI 3S2HI 2R92I 3S1RI 2B63I 2DE7A 2F4MA 2J6AA 3S14I 4NB8A 4NBBA 1DL6A 4QTTA 1USPA 3HOVI 2E2II 3S16I 4NBEA 4QTUA 3S15I 2HF1A 1WCMI 3H3VJ 2R93I 3GTPI 1TWAI 3VMIA 2YU9I 1X3WA 2BJOA 3GTQI 4Y7NI 1TWCI 3U50C 3HOYI 2VUMI 4XX2A 3VMHA 4BY7I 3PO3S 3HOWI 2K5RA 1I6HI 1NUIA 3M4OI 4BXXI 1I50I 1Y1VI 5FLMI 2JA7I 5IP7I 5C4JI 1USPB 2E2JI 1YUAA 2JR6A 3I4NI 2R7ZI 4MH4A 4A3KI 4Y52I 4A3II 2JNYA 3GTKI 1QYPA 5IP9I 3LUSA 3GTMI 4NBDA 3EERA 3HOXI 1K83I 5CM2M 1TFIA 3K7AI 4A93I 1Y1WI 3RZOI 1TWHI 3RZDI 3ESWA 1Y1VS 4NBGA 3HOZI 1I3QI 4A3BI 1TWGI 2JA8I 1VLAA 3H0GI 3GTOI 1TWFI 4NBFA 4X6AI 4A3JI 2NVTI 3S17I 4A3LI 4BY1I 4A3CI 2RBLA 3S1MI 4NB9A 3S1NI 3S2DI 3GKQA 1R9TI 3PO2I 4NBCA 2PK7A 2DE6A 1ZB9A 3HOUI 2AKLA 2NVYI 4A3EI 3GCFA 1X3ZA 4A3DI 2JS4A 1PFTA 4A3GI 2P3YA 4NOZA 3PO3I 5C44I 4A3FI 4A3MI 4BBSI 4NBAA 1LQLA 1SFOI 3Q87A 1WW9A 2NVQI 4BBRI 2NVXI 3VB9A 3GTJI 2DE5A 5C4XI 2KPIA 3CQZI 3M3YI 3D6WA 3GTGI 1RO4A 3I4MI 1RLYA 3FKII 1L1OC 1ML8A
chains in the Genus database with same CATH superfamily
1KC81 2V8KA 2V45A 3NH8A 1VQKZ 1VQO1 4E2ZA 4NH1C 2JA6I 5C3EI 2R92I 1YUKA 2DE7A 2F4MA 2QEXZ 3D2LA 1DL6A 3J81f 3CCL1 1ZH1A 2OTLZ 2WAQA 3CCSZ 1TWAI 3VMIA 1VQP1 2BJOA 3OW2Y 3GTQI 4Y7NI 1TWCI 2K3RA 3F3PC 4NFRA 3TE5B 3U50C 4MXUA 1FDOA 3HOYI 2W03A 3PO3S 1N8R1 3CC2Z 3M4OI 3CC7Z 1WIIA 5FLMI 2JIQA 3BG1B 2JA7I 1QVGZ 1P9NA 1QF8A 1YJ91 3I56Z 3CPWZ 3CCEZ 3P5JB 4TNUA 1QYPA 2IZ4A 3NH4A 3NFZA 3GTMI 4NBDA 1JJ2Z 2VUGA 3EERA 1K83I 1VQLZ 1YJNZ 5CM2M 1TFIA 1Y1WI 1TWHI 2WB1A 3ESWA 3CCVZ 1RO2A 3CCRZ 3HOZI 3G4SZ 1I3QI 4EWCA 3CXCZ 2JA8I 3J80f 1VQ51 1M901 1TWFI 3F3FC 1Q812 2KI7B 3S17I 4A3CI 1VQ81 3CCJZ 1YIT1 2E9HA 4NBCA 3CMEZ 3T4NB 2OOYB 2QRCB 3HOUI 1X3ZA 1VQ71 5C44I 4A3FI 4NBAA 1LQLA 2E7ZA 2QA4Z 2KPIA 3GTGI 2Q51A 3I4MI 4RVHA 1QXFA 1K9M2 2VPYA 1Q7Y1 2QLVB 3GTLI 3IF8A 2G2KA 1N2FA 3I07A 4AYBA 2JMOA 2OTJZ 2J6AA 1W2BZ 4NB8A 4NBBA 1VQ9Z 1Q811 4QTTA 1USPA 3CCU1 1QVGY 2RIQA 2JIOA 3CCQZ 1KD12 3S15I 2HF1A 1WCMI 3IR7A 3CPWY 4MONA 3GTPI 5IT9f 2JIPA 1JJ2Y 2RT9A 1YI21 3MONA 1JWHC 1RNIA 4XX2A 3J80b 1VQOZ 3MZLB 4E33A 2W04A 3CXCY 3G711 5D1PA 1K9M1 5FLXb 1Z02A 3NDJA 1NUIA 2LFUA 1YHQZ 3CMA1 1NP6A 1VQM1 1Y8CA 4DK1A 1YJW1 5IP7I 4RVFA 1YUAA 2JR6A 2GTHA 1AA6A 1VQPZ 1S72Z 2EGTA 3CD6Z 4A3KI 2JNYA 5IP9I 3LUSA 2VF1A 1VQ61 1KD11 1WJ2A 1SIWA 3K7AI 2QEX1 3RZOI 4E2YA 2OZKA 2VPZA 1K8A2 1VLAA 3H0GI 3I551 2JUBA 4NBFA 4X6AI 1Q822 4MD9A 1YJ9Z 4A3LI 3J7A4 3IFUA 3S2DI 3GKQA 3G6E1 1W2BY 2OOXB 2AKLA 3GCFA 3CC41 5IT9b 1VQNZ 2JS4A 4A3GI 4BBSI 2R6MA 4BBRI 4RVGA 2IV2X 3VB9A 2DE5A 3CQZI 1VQ5Z 1Q862 1RLYA 4HGZA 3NDIA 4A3II 5FLXf 2I3CA 3GTMS 1ZB8A 4HH4A 1VQ8Z 4E32A 1YITZ 4MD8A 1YJN1 1K8A1 2JA5I 2RHBA 2E2HI 2B63I 3BG0B 1Q821 3G4S1 2QRDB 1VQ7Z 1S7MA 2QKDA 2E2II 3S16I 2V8IA 2PM9A 1WZNA 2LIYA 2R93I 5D1OA 4RV9A 1QVFZ 2YU9I 1X3WA 3NH5A 3CME1 1RQFA 3VMHA 4BY7I 3HOWI 1KQSZ 5T6BA 3KIFA 2QA41 4BXXI 1Y1VI 1NJI2 5C4JI 1USPB 3CCM1 2IZ3A 2NAPA 3I4NI 4MH4A 1YI2Z 2QREB 2V8JA 4Y52I 3GTKI 1YIJ1 3EEDA 5T67A 4RVDA 1Y1VS 4NBGA 4DGLA 3CCQ1 1VQ41 3QWUA 4A3BI 2P28A 3FQQA 1TWGI 3CCLZ 1Z03A 3GTOI 3CMAZ 1VQMZ 2GTIA 1YJWZ 2PMZA 5AN9F 2RBLA 4CL1A 1VQK1 1R9TI 3PO2I 3FQMA 2PK7A 1NJI1 1Z01A 1VQ6Z 1ZB9A 2ZAEB 4A3EI 1PFTA 1YHQ1 4NOZA 3PO3I 4A3MI 1QVFY 1SFOI 2OTL1 4HGYA 1WW9A 3CCS1 2NVXI 3GTJI 1K732 3I55Z 3FKII 1L1OC 1S721 1Q16A 3CD61 1ML8A 2RPRA 2YADA 2Y0SA 3S1QI 4MD7A 2VPXA 4NBHA 3VMGA 5A2Qf 1M902 2F4OA 3G6EZ 1KQSY 3S2HI 3S1RI 2O53A 3CC4Z 2H85A 3S14I 2O4HA 3CC21 3HOVI 3CC71 4NBEA 4QTUA 3H3VJ 2GU2A 4E2WA 3I561 4E2XA 3CCE1 4E31A 4E30A 1VQL1 2VUMI 1X0TA 1K731 2AYDA 1VQN1 5T64A 1Q7Y2 3JAMf 3CCV1 2K5RA 1I6HI 3CCR1 1RO0A 1I50I 2JIRA 3MZKB 2E2JI 1KRLA 2Q4ZA 3J81b 3CCJ1 2R7ZI 5D1OB 2JIMA 2VPWA 1M1K2 3HOXI 3OW2Z 1FDIA 4A93I 1Q861 3RZDI 1KC82 3IX0A 3VTNA 3CCUZ 5A2Qb 4S1TA 4DQYB 3CCMZ 4A3JI 2NVTI 4BY1I 2HU9A 2M6NA 3HKZA 3S1MI 4NB9A 3S1NI 2QR1B 1YIJZ 2DE6A 2NVYI 4RS4A 3D9XA 2OTJ1 4MRIA 3G71Z 1VQ91 4A3DI 2P3YA 1VQ4Z 3Q87A 2NVQI 2M48A 1M1K1 3M3YI 3TDHB 5C4XI 5LL6f 3D6WA 3KIHA 1RO4A 2LEXA 2V3VA 1N8R2 3JAMb
chains in the Genus database with same CATH topology
1KC81 2V8KA 3NH8A 1VQKZ 1VQO1 4E2ZA 4NH1C 2JA6I 5C3EI 2R92I 1YUKA 2DE7A 2F4MA 2QEXZ 1DL6A 3J81f 3CCL1 1ZH1A 2OTLZ 2WAQA 3CCSZ 1TWAI 3VMIA 1VQP1 2BJOA 3OW2Y 3GTQI 4Y7NI 1TWCI 2K3RA 3F3PC 4NFRA 3TE5B 3U50C 4MXUA 3HOYI 2W03A 3PO3S 1N8R1 3CC2Z 3M4OI 3CC7Z 1WIIA 5FLMI 3BG1B 2JA7I 1QVGZ 1P9NA 1QF8A 1YJ91 3I56Z 3CPWZ 3CCEZ 3P5JB 4TNUA 1QYPA 2IZ4A 3NH4A 3NFZA 3GTMI 4NBDA 1JJ2Z 2VUGA 3EERA 1K83I 1VQLZ 1YJNZ 5CM2M 1TFIA 1Y1WI 1TWHI 2WB1A 3ESWA 3CCVZ 1RO2A 3CCRZ 3HOZI 3G4SZ 1I3QI 4EWCA 3CXCZ 2JA8I 3J80f 1VQ51 1M901 1TWFI 3F3FC 1Q812 2KI7B 3S17I 4A3CI 1VQ81 3CCJZ 1YIT1 2E9HA 4NBCA 3CMEZ 3T4NB 2OOYB 2QRCB 3HOUI 1X3ZA 1VQ71 5C44I 4A3FI 4NBAA 1LQLA 2QA4Z 2KPIA 3GTGI 2Q51A 3I4MI 4RVHA 1K9M2 1Q7Y1 2QLVB 3GTLI 3IF8A 2G2KA 1N2FA 3I07A 4AYBA 2JMOA 2OTJZ 2J6AA 1W2BZ 4NB8A 4NBBA 1VQ9Z 1Q811 4QTTA 1USPA 3CCU1 1QVGY 2RIQA 3CCQZ 1KD12 3S15I 2HF1A 1WCMI 3CPWY 4MONA 3GTPI 5IT9f 1JJ2Y 2RT9A 1YI21 3MONA 1JWHC 1RNIA 4XX2A 3J80b 1VQOZ 3MZLB 4E33A 2W04A 3CXCY 3G711 5D1PA 1K9M1 5FLXb 1Z02A 3NDJA 1NUIA 2LFUA 1YHQZ 3CMA1 1NP6A 1VQM1 4DK1A 1YJW1 5IP7I 4RVFA 1YUAA 2JR6A 2GTHA 1VQPZ 1S72Z 2EGTA 3CD6Z 4A3KI 2JNYA 5IP9I 3LUSA 2VF1A 1VQ61 1KD11 3K7AI 2QEX1 3RZOI 4E2YA 2OZKA 1K8A2 1VLAA 3H0GI 3I551 2JUBA 4NBFA 4X6AI 1Q822 4MD9A 1YJ9Z 4A3LI 3J7A4 3IFUA 3S2DI 3GKQA 3G6E1 1W2BY 2OOXB 2AKLA 3GCFA 3CC41 5IT9b 1VQNZ 2JS4A 4A3GI 4BBSI 2R6MA 4BBRI 4RVGA 3VB9A 2DE5A 3CQZI 1VQ5Z 1Q862 1RLYA 4HGZA 3NDIA 4A3II 5FLXf 2I3CA 3GTMS 1ZB8A 4HH4A 1VQ8Z 4E32A 1YITZ 4MD8A 1YJN1 1K8A1 2JA5I 2RHBA 2E2HI 2B63I 3BG0B 1Q821 3G4S1 2QRDB 1VQ7Z 1S7MA 2QKDA 2E2II 3S16I 2V8IA 2PM9A 2LIYA 2R93I 5D1OA 4RV9A 1QVFZ 2YU9I 1X3WA 3NH5A 3CME1 1RQFA 3VMHA 4BY7I 3HOWI 1KQSZ 5T6BA 3KIFA 2QA41 4BXXI 1Y1VI 1NJI2 5C4JI 1USPB 3CCM1 2IZ3A 3I4NI 4MH4A 1YI2Z 2QREB 2V8JA 4Y52I 3GTKI 1YIJ1 3EEDA 5T67A 4RVDA 1Y1VS 4NBGA 4DGLA 3CCQ1 1VQ41 3QWUA 4A3BI 2P28A 3FQQA 1TWGI 3CCLZ 1Z03A 3GTOI 3CMAZ 1VQMZ 2GTIA 1YJWZ 2PMZA 5AN9F 2RBLA 4CL1A 1VQK1 1R9TI 3PO2I 3FQMA 2PK7A 1NJI1 1Z01A 1VQ6Z 1ZB9A 2ZAEB 4A3EI 1PFTA 1YHQ1 4NOZA 3PO3I 4A3MI 1QVFY 1SFOI 2OTL1 4HGYA 1WW9A 3CCS1 2NVXI 3GTJI 1K732 3I55Z 3FKII 1L1OC 1S721 3CD61 1ML8A 2RPRA 2YADA 2Y0SA 3S1QI 4MD7A 4NBHA 3VMGA 5A2Qf 1M902 2F4OA 3G6EZ 1KQSY 3S2HI 3S1RI 2O53A 3CC4Z 2H85A 3S14I 2O4HA 3CC21 3HOVI 3CC71 4NBEA 4QTUA 3H3VJ 2GU2A 4E2WA 3I561 4E2XA 3CCE1 4E31A 4E30A 1VQL1 2VUMI 1X0TA 1K731 1VQN1 5T64A 1Q7Y2 3JAMf 3CCV1 2K5RA 1I6HI 3CCR1 1RO0A 1I50I 3MZKB 2E2JI 1KRLA 2Q4ZA 3J81b 3CCJ1 2R7ZI 5D1OB 1M1K2 3HOXI 3OW2Z 4A93I 1Q861 3RZDI 1KC82 3IX0A 3VTNA 3CCUZ 5A2Qb 4S1TA 4DQYB 3CCMZ 4A3JI 2NVTI 4BY1I 2HU9A 2M6NA 3HKZA 3S1MI 4NB9A 3S1NI 2QR1B 1YIJZ 2DE6A 2NVYI 4RS4A 3D9XA 2OTJ1 4MRIA 3G71Z 1VQ91 4A3DI 2P3YA 1VQ4Z 3Q87A 2NVQI 2M48A 1M1K1 3M3YI 3TDHB 5C4XI 5LL6f 3D6WA 3KIHA 1RO4A 1N8R2 3JAMb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL I;  3GTM S;  1N2F A;  3S1Q I;  1ZB8 A;  4NBH A;  3VMG A;  3I07 A;  2JA5 I;  2F4O A;  2JA6 I;  2E2H I;  5C3E I;  3S2H I;  2R92 I;  3S1R I;  2B63 I;  2DE7 A;  2F4M A;  2J6A A;  3S14 I;  4NB8 A;  4NBB A;  1DL6 A;  4QTT A;  1USP A;  3HOV I;  2E2I I;  3S16 I;  4NBE A;  4QTU A;  3S15 I;  2HF1 A;  1WCM I;  3H3V J;  2R93 I;  3GTP I;  1TWA I;  3VMI A;  2YU9 I;  1X3W A;  2BJO A;  3GTQ I;  4Y7N I;  1TWC I;  3U50 C;  3HOY I;  2VUM I;  4XX2 A;  3VMH A;  4BY7 I;  3PO3 S;  3HOW I;  2K5R A;  1I6H I;  1NUI A;  3M4O I;  4BXX I;  1I50 I;  1Y1V I;  5FLM I;  2JA7 I;  5IP7 I;  5C4J I;  1USP B;  2E2J I;  1YUA A;  2JR6 A;  3I4N I;  2R7Z I;  4MH4 A;  4A3K I;  4Y52 I;  4A3I I;  2JNY A;  3GTK I;  1QYP A;  5IP9 I;  3LUS A;  3GTM I;  4NBD A;  3EER A;  3HOX I;  1K83 I;  5CM2 M;  1TFI A;  3K7A I;  4A93 I;  1Y1W I;  3RZO I;  1TWH I;  3RZD I;  3ESW A;  1Y1V S;  4NBG A;  3HOZ I;  1I3Q I;  4A3B I;  1TWG I;  2JA8 I;  1VLA A;  3H0G I;  3GTO I;  1TWF I;  4NBF A;  4X6A I;  4A3J I;  2NVT I;  3S17 I;  4A3L I;  4BY1 I;  4A3C I;  2RBL A;  3S1M I;  4NB9 A;  3S1N I;  3S2D I;  3GKQ A;  1R9T I;  3PO2 I;  4NBC A;  2PK7 A;  2DE6 A;  1ZB9 A;  3HOU I;  2AKL A;  2NVY I;  4A3E I;  3GCF A;  1X3Z A;  4A3D I;  2JS4 A;  1PFT A;  4A3G I;  2P3Y A;  4NOZ A;  3PO3 I;  5C44 I;  4A3F I;  4A3M I;  4BBS I;  4NBA A;  1LQL A;  1SFO I;  3Q87 A;  1WW9 A;  2NVQ I;  4BBR I;  2NVX I;  3VB9 A;  3GTJ I;  2DE5 A;  5C4X I;  2KPI A;  3CQZ I;  3M3Y I;  3D6W A;  3GTG I;  1RO4 A;  3I4M I;  1RLY A;  3FKI I;  1L1O C;  1ML8 A; 
#chains in the Genus database with same CATH topology
 1KC8 1;  2V8K A;  2V45 A;  3NH8 A;  1VQK Z;  1VQO 1;  4E2Z A;  4NH1 C;  2JA6 I;  5C3E I;  2R92 I;  1YUK A;  2DE7 A;  2F4M A;  2QEX Z;  3D2L A;  1DL6 A;  3J81 f;  3CCL 1;  1ZH1 A;  2OTL Z;  2WAQ A;  3CCS Z;  1TWA I;  3VMI A;  1VQP 1;  2BJO A;  3OW2 Y;  3GTQ I;  4Y7N I;  1TWC I;  2K3R A;  3F3P C;  4NFR A;  3TE5 B;  3U50 C;  4MXU A;  1FDO A;  3HOY I;  2W03 A;  3PO3 S;  1N8R 1;  3CC2 Z;  3M4O I;  3CC7 Z;  1WII A;  5FLM I;  2JIQ A;  3BG1 B;  2JA7 I;  1QVG Z;  1P9N A;  1QF8 A;  1YJ9 1;  3I56 Z;  3CPW Z;  3CCE Z;  3P5J B;  4TNU A;  1QYP A;  2IZ4 A;  3NH4 A;  3NFZ A;  3GTM I;  4NBD A;  1JJ2 Z;  2VUG A;  3EER A;  1K83 I;  1VQL Z;  1YJN Z;  5CM2 M;  1TFI A;  1Y1W I;  1TWH I;  2WB1 A;  3ESW A;  3CCV Z;  1RO2 A;  3CCR Z;  3HOZ I;  3G4S Z;  1I3Q I;  4EWC A;  3CXC Z;  2JA8 I;  3J80 f;  1VQ5 1;  1M90 1;  1TWF I;  3F3F C;  1Q81 2;  2KI7 B;  3S17 I;  4A3C I;  1VQ8 1;  3CCJ Z;  1YIT 1;  2E9H A;  4NBC A;  3CME Z;  3T4N B;  2OOY B;  2QRC B;  3HOU I;  1X3Z A;  1VQ7 1;  5C44 I;  4A3F I;  4NBA A;  1LQL A;  2E7Z A;  2QA4 Z;  2KPI A;  3GTG I;  2Q51 A;  3I4M I;  4RVH A;  1QXF A;  1K9M 2;  2VPY A;  1Q7Y 1;  2QLV B;  3GTL I;  3IF8 A;  2G2K A;  1N2F A;  3I07 A;  4AYB A;  2JMO A;  2OTJ Z;  2J6A A;  1W2B Z;  4NB8 A;  4NBB A;  1VQ9 Z;  1Q81 1;  4QTT A;  1USP A;  3CCU 1;  1QVG Y;  2RIQ A;  2JIO A;  3CCQ Z;  1KD1 2;  3S15 I;  2HF1 A;  1WCM I;  3IR7 A;  3CPW Y;  4MON A;  3GTP I;  5IT9 f;  2JIP A;  1JJ2 Y;  2RT9 A;  1YI2 1;  3MON A;  1JWH C;  1RNI A;  4XX2 A;  3J80 b;  1VQO Z;  3MZL B;  4E33 A;  2W04 A;  3CXC Y;  3G71 1;  5D1P A;  1K9M 1;  5FLX b;  1Z02 A;  3NDJ A;  1NUI A;  2LFU A;  1YHQ Z;  3CMA 1;  1NP6 A;  1VQM 1;  1Y8C A;  4DK1 A;  1YJW 1;  5IP7 I;  4RVF A;  1YUA A;  2JR6 A;  2GTH A;  1AA6 A;  1VQP Z;  1S72 Z;  2EGT A;  3CD6 Z;  4A3K I;  2JNY A;  5IP9 I;  3LUS A;  2VF1 A;  1VQ6 1;  1KD1 1;  1WJ2 A;  1SIW A;  3K7A I;  2QEX 1;  3RZO I;  4E2Y A;  2OZK A;  2VPZ A;  1K8A 2;  1VLA A;  3H0G I;  3I55 1;  2JUB A;  4NBF A;  4X6A I;  1Q82 2;  4MD9 A;  1YJ9 Z;  4A3L I;  3J7A 4;  3IFU A;  3S2D I;  3GKQ A;  3G6E 1;  1W2B Y;  2OOX B;  2AKL A;  3GCF A;  3CC4 1;  5IT9 b;  1VQN Z;  2JS4 A;  4A3G I;  4BBS I;  2R6M A;  4BBR I;  4RVG A;  2IV2 X;  3VB9 A;  2DE5 A;  3CQZ I;  1VQ5 Z;  1Q86 2;  1RLY A;  4HGZ A;  3NDI A;  4A3I I;  5FLX f;  2I3C A;  3GTM S;  1ZB8 A;  4HH4 A;  1VQ8 Z;  4E32 A;  1YIT Z;  4MD8 A;  1YJN 1;  1K8A 1;  2JA5 I;  2RHB A;  2E2H I;  2B63 I;  3BG0 B;  1Q82 1;  3G4S 1;  2QRD B;  1VQ7 Z;  1S7M A;  2QKD A;  2E2I I;  3S16 I;  2V8I A;  2PM9 A;  1WZN A;  2LIY A;  2R93 I;  5D1O A;  4RV9 A;  1QVF Z;  2YU9 I;  1X3W A;  3NH5 A;  3CME 1;  1RQF A;  3VMH A;  4BY7 I;  3HOW I;  1KQS Z;  5T6B A;  3KIF A;  2QA4 1;  4BXX I;  1Y1V I;  1NJI 2;  5C4J I;  1USP B;  3CCM 1;  2IZ3 A;  2NAP A;  3I4N I;  4MH4 A;  1YI2 Z;  2QRE B;  2V8J A;  4Y52 I;  3GTK I;  1YIJ 1;  3EED A;  5T67 A;  4RVD A;  1Y1V S;  4NBG A;  4DGL A;  3CCQ 1;  1VQ4 1;  3QWU A;  4A3B I;  2P28 A;  3FQQ A;  1TWG I;  3CCL Z;  1Z03 A;  3GTO I;  3CMA Z;  1VQM Z;  2GTI A;  1YJW Z;  2PMZ A;  5AN9 F;  2RBL A;  4CL1 A;  1VQK 1;  1R9T I;  3PO2 I;  3FQM A;  2PK7 A;  1NJI 1;  1Z01 A;  1VQ6 Z;  1ZB9 A;  2ZAE B;  4A3E I;  1PFT A;  1YHQ 1;  4NOZ A;  3PO3 I;  4A3M I;  1QVF Y;  1SFO I;  2OTL 1;  4HGY A;  1WW9 A;  3CCS 1;  2NVX I;  3GTJ I;  1K73 2;  3I55 Z;  3FKI I;  1L1O C;  1S72 1;  1Q16 A;  3CD6 1;  1ML8 A;  2RPR A;  2YAD A;  2Y0S A;  3S1Q I;  4MD7 A;  2VPX A;  4NBH A;  3VMG A;  5A2Q f;  1M90 2;  2F4O A;  3G6E Z;  1KQS Y;  3S2H I;  3S1R I;  2O53 A;  3CC4 Z;  2H85 A;  3S14 I;  2O4H A;  3CC2 1;  3HOV I;  3CC7 1;  4NBE A;  4QTU A;  3H3V J;  2GU2 A;  4E2W A;  3I56 1;  4E2X A;  3CCE 1;  4E31 A;  4E30 A;  1VQL 1;  2VUM I;  1X0T A;  1K73 1;  2AYD A;  1VQN 1;  5T64 A;  1Q7Y 2;  3JAM f;  3CCV 1;  2K5R A;  1I6H I;  3CCR 1;  1RO0 A;  1I50 I;  2JIR A;  3MZK B;  2E2J I;  1KRL A;  2Q4Z A;  3J81 b;  3CCJ 1;  2R7Z I;  5D1O B;  2JIM A;  2VPW A;  1M1K 2;  3HOX I;  3OW2 Z;  1FDI A;  4A93 I;  1Q86 1;  3RZD I;  1KC8 2;  3IX0 A;  3VTN A;  3CCU Z;  5A2Q b;  4S1T A;  4DQY B;  3CCM Z;  4A3J I;  2NVT I;  4BY1 I;  2HU9 A;  2M6N A;  3HKZ A;  3S1M I;  4NB9 A;  3S1N I;  2QR1 B;  1YIJ Z;  2DE6 A;  2NVY I;  4RS4 A;  3D9X A;  2OTJ 1;  4MRI A;  3G71 Z;  1VQ9 1;  4A3D I;  2P3Y A;  1VQ4 Z;  3Q87 A;  2NVQ I;  2M48 A;  1M1K 1;  3M3Y I;  3TDH B;  5C4X I;  5LL6 f;  3D6W A;  3KIH A;  1RO4 A;  2LEX A;  2V3V A;  1N8R 2;  3JAM b; 
#chains in the Genus database with same CATH homology
 1KC8 1;  2V8K A;  3NH8 A;  1VQK Z;  1VQO 1;  4E2Z A;  4NH1 C;  2JA6 I;  5C3E I;  2R92 I;  1YUK A;  2DE7 A;  2F4M A;  2QEX Z;  1DL6 A;  3J81 f;  3CCL 1;  1ZH1 A;  2OTL Z;  2WAQ A;  3CCS Z;  1TWA I;  3VMI A;  1VQP 1;  2BJO A;  3OW2 Y;  3GTQ I;  4Y7N I;  1TWC I;  2K3R A;  3F3P C;  4NFR A;  3TE5 B;  3U50 C;  4MXU A;  3HOY I;  2W03 A;  3PO3 S;  1N8R 1;  3CC2 Z;  3M4O I;  3CC7 Z;  1WII A;  5FLM I;  3BG1 B;  2JA7 I;  1QVG Z;  1P9N A;  1QF8 A;  1YJ9 1;  3I56 Z;  3CPW Z;  3CCE Z;  3P5J B;  4TNU A;  1QYP A;  2IZ4 A;  3NH4 A;  3NFZ A;  3GTM I;  4NBD A;  1JJ2 Z;  2VUG A;  3EER A;  1K83 I;  1VQL Z;  1YJN Z;  5CM2 M;  1TFI A;  1Y1W I;  1TWH I;  2WB1 A;  3ESW A;  3CCV Z;  1RO2 A;  3CCR Z;  3HOZ I;  3G4S Z;  1I3Q I;  4EWC A;  3CXC Z;  2JA8 I;  3J80 f;  1VQ5 1;  1M90 1;  1TWF I;  3F3F C;  1Q81 2;  2KI7 B;  3S17 I;  4A3C I;  1VQ8 1;  3CCJ Z;  1YIT 1;  2E9H A;  4NBC A;  3CME Z;  3T4N B;  2OOY B;  2QRC B;  3HOU I;  1X3Z A;  1VQ7 1;  5C44 I;  4A3F I;  4NBA A;  1LQL A;  2QA4 Z;  2KPI A;  3GTG I;  2Q51 A;  3I4M I;  4RVH A;  1K9M 2;  1Q7Y 1;  2QLV B;  3GTL I;  3IF8 A;  2G2K A;  1N2F A;  3I07 A;  4AYB A;  2JMO A;  2OTJ Z;  2J6A A;  1W2B Z;  4NB8 A;  4NBB A;  1VQ9 Z;  1Q81 1;  4QTT A;  1USP A;  3CCU 1;  1QVG Y;  2RIQ A;  3CCQ Z;  1KD1 2;  3S15 I;  2HF1 A;  1WCM I;  3CPW Y;  4MON A;  3GTP I;  5IT9 f;  1JJ2 Y;  2RT9 A;  1YI2 1;  3MON A;  1JWH C;  1RNI A;  4XX2 A;  3J80 b;  1VQO Z;  3MZL B;  4E33 A;  2W04 A;  3CXC Y;  3G71 1;  5D1P A;  1K9M 1;  5FLX b;  1Z02 A;  3NDJ A;  1NUI A;  2LFU A;  1YHQ Z;  3CMA 1;  1NP6 A;  1VQM 1;  4DK1 A;  1YJW 1;  5IP7 I;  4RVF A;  1YUA A;  2JR6 A;  2GTH A;  1VQP Z;  1S72 Z;  2EGT A;  3CD6 Z;  4A3K I;  2JNY A;  5IP9 I;  3LUS A;  2VF1 A;  1VQ6 1;  1KD1 1;  3K7A I;  2QEX 1;  3RZO I;  4E2Y A;  2OZK A;  1K8A 2;  1VLA A;  3H0G I;  3I55 1;  2JUB A;  4NBF A;  4X6A I;  1Q82 2;  4MD9 A;  1YJ9 Z;  4A3L I;  3J7A 4;  3IFU A;  3S2D I;  3GKQ A;  3G6E 1;  1W2B Y;  2OOX B;  2AKL A;  3GCF A;  3CC4 1;  5IT9 b;  1VQN Z;  2JS4 A;  4A3G I;  4BBS I;  2R6M A;  4BBR I;  4RVG A;  3VB9 A;  2DE5 A;  3CQZ I;  1VQ5 Z;  1Q86 2;  1RLY A;  4HGZ A;  3NDI A;  4A3I I;  5FLX f;  2I3C A;  3GTM S;  1ZB8 A;  4HH4 A;  1VQ8 Z;  4E32 A;  1YIT Z;  4MD8 A;  1YJN 1;  1K8A 1;  2JA5 I;  2RHB A;  2E2H I;  2B63 I;  3BG0 B;  1Q82 1;  3G4S 1;  2QRD B;  1VQ7 Z;  1S7M A;  2QKD A;  2E2I I;  3S16 I;  2V8I A;  2PM9 A;  2LIY A;  2R93 I;  5D1O A;  4RV9 A;  1QVF Z;  2YU9 I;  1X3W A;  3NH5 A;  3CME 1;  1RQF A;  3VMH A;  4BY7 I;  3HOW I;  1KQS Z;  5T6B A;  3KIF A;  2QA4 1;  4BXX I;  1Y1V I;  1NJI 2;  5C4J I;  1USP B;  3CCM 1;  2IZ3 A;  3I4N I;  4MH4 A;  1YI2 Z;  2QRE B;  2V8J A;  4Y52 I;  3GTK I;  1YIJ 1;  3EED A;  5T67 A;  4RVD A;  1Y1V S;  4NBG A;  4DGL A;  3CCQ 1;  1VQ4 1;  3QWU A;  4A3B I;  2P28 A;  3FQQ A;  1TWG I;  3CCL Z;  1Z03 A;  3GTO I;  3CMA Z;  1VQM Z;  2GTI A;  1YJW Z;  2PMZ A;  5AN9 F;  2RBL A;  4CL1 A;  1VQK 1;  1R9T I;  3PO2 I;  3FQM A;  2PK7 A;  1NJI 1;  1Z01 A;  1VQ6 Z;  1ZB9 A;  2ZAE B;  4A3E I;  1PFT A;  1YHQ 1;  4NOZ A;  3PO3 I;  4A3M I;  1QVF Y;  1SFO I;  2OTL 1;  4HGY A;  1WW9 A;  3CCS 1;  2NVX I;  3GTJ I;  1K73 2;  3I55 Z;  3FKI I;  1L1O C;  1S72 1;  3CD6 1;  1ML8 A;  2RPR A;  2YAD A;  2Y0S A;  3S1Q I;  4MD7 A;  4NBH A;  3VMG A;  5A2Q f;  1M90 2;  2F4O A;  3G6E Z;  1KQS Y;  3S2H I;  3S1R I;  2O53 A;  3CC4 Z;  2H85 A;  3S14 I;  2O4H A;  3CC2 1;  3HOV I;  3CC7 1;  4NBE A;  4QTU A;  3H3V J;  2GU2 A;  4E2W A;  3I56 1;  4E2X A;  3CCE 1;  4E31 A;  4E30 A;  1VQL 1;  2VUM I;  1X0T A;  1K73 1;  1VQN 1;  5T64 A;  1Q7Y 2;  3JAM f;  3CCV 1;  2K5R A;  1I6H I;  3CCR 1;  1RO0 A;  1I50 I;  3MZK B;  2E2J I;  1KRL A;  2Q4Z A;  3J81 b;  3CCJ 1;  2R7Z I;  5D1O B;  1M1K 2;  3HOX I;  3OW2 Z;  4A93 I;  1Q86 1;  3RZD I;  1KC8 2;  3IX0 A;  3VTN A;  3CCU Z;  5A2Q b;  4S1T A;  4DQY B;  3CCM Z;  4A3J I;  2NVT I;  4BY1 I;  2HU9 A;  2M6N A;  3HKZ A;  3S1M I;  4NB9 A;  3S1N I;  2QR1 B;  1YIJ Z;  2DE6 A;  2NVY I;  4RS4 A;  3D9X A;  2OTJ 1;  4MRI A;  3G71 Z;  1VQ9 1;  4A3D I;  2P3Y A;  1VQ4 Z;  3Q87 A;  2NVQ I;  2M48 A;  1M1K 1;  3M3Y I;  3TDH B;  5C4X I;  5LL6 f;  3D6W A;  3KIH A;  1RO4 A;  1N8R 2;  3JAM b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...