1K8A2

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k8a200
3CMAZ 3CCVZ 1Q812 3CCMZ 3CC4Z 3I551 3G6EZ 1QVFY 1YITZ 1YJ91 1M901 3G4SZ 3CCEZ 3I55Z 1YIJ1 1K731 1VQ91 1VQM1 3CPWZ 1VQ7Z 1VQ51 1VQP1 3CME1 3CCJ1 1YIJZ 1S72Z 3G71Z 1YI21 1VQOZ 1NJI2 1JJ2Z 1Q861 3CXCY 1VQ8Z 1KD11 3CD6Z 1YJNZ 3CCQZ 1YI2Z 1VQK1 2OTJZ 1VQ6Z 1K732 1Q821 1M1K1 1N8R2 1KC81 3OW2Y 1Q7Y2 1YJ9Z 3CCR1 1VQKZ 1K8A1 1YHQ1 1KQSZ 1YJW1 1VQ9Z 1W2BY 1VQMZ 1K9M2 1VQ5Z 2OTL1 1Q811 3I561 1Q862 1QVGZ 1VQPZ 1YHQZ 3CMEZ 3CCJZ 2QA41 3CCU1 1M902 3CPWY 2QEX1 1VQ41 3CCS1 1Q822 1M1K2 3CCL1 3CXCZ 2QA4Z 1QVFZ 1VQN1 3CCV1 3CCM1 3CC41 1JJ2Y 1YIT1 3CCE1 1VQL1 1NJI1 3CCRZ 1KD12 1VQ71 1W2BZ 3CC71 1VQLZ 1YJWZ 2OTLZ 3I56Z 1S721 1KC82 1N8R1 3G711 1KQSY 1VQO1 1Q7Y1 3CC7Z 3CC21 3CCUZ 2QEXZ 3CMA1 1QVGY 1VQ4Z 3CCSZ 1K8A2 3G6E1 1VQ81 3CD61 3CCLZ 1YJN1 3OW2Z 3CCQ1 3CC2Z 1VQNZ 3G4S1 1K9M1 2OTJ1 1VQ61
chains in the Genus database with same CATH superfamily
4E30A 2E2II 3PO3S 1X0TA 4NOZA 1QVFY 1YITZ 4DQYB 3JAMf 4E2WA 2JA5I 1DL6A 5LL6f 3U50C 1NUIA 3KIHA 4E2ZA 1K731 3GTLI 3CPWZ 1VQ51 3PO2I 3CME1 2BJOA 3M3YI 2YADA 1YI21 4BY1I 2QR1B 1Q861 1VQ8Z 5D1OB 1YJNZ 3CCQZ 2K5RA 2WB1A 2M48A 2OOYB 1RO4A 3HKZA 2JA8I 1NP6A 1TWFI 4A3BI 1VQKZ 4NBDA 3J7A4 1K8A1 1WZNA 1WIIA 1KQSZ 3QWUA 1YJW1 5C4XI 3GTMI 1W2BY 2F4OA 3S2HI 3H3VJ 3I561 2JNYA 2O53A 2QA41 2LEXA 3I4MI 3CPWY 1RO0A 2QEX1 1QXFA 5D1OA 1Q822 2QLVB 2NAPA 1Z01A 3NH5A 3GKQA 3GTQI 2RIQA 1QF8A 4QTTA 1Z02A 1YIT1 3RZOI 2OZKA 5CM2M 5A2Qb 2VPYA 3CCRZ 2E2HI 4RVDA 2O4HA 2JR6A 4TNUA 2IZ4A 2K3RA 3CC71 4NFRA 3MZKB 1FDIA 3CQZI 1N8R1 1KQSY 1YUKA 2R92I 5D1PA 4MONA 3CCSZ 2V8JA 5C4JI 1K8A2 1VQ81 4A3II 2GTHA 4NH1C 3CCLZ 1YJN1 2RHBA 3OW2Z 3CCQ1 1SFOI 2W03A 3CC2Z 1VQNZ 1K9M1 3CMAZ 2NVQI 4NBCA 2VPXA 2NVXI 3JAMb 3EERA 2Q4ZA 1L1OC 3G4SZ 3I55Z 2PMZA 4MH4A 1TWHI 3FQQA 3S1RI 1VQ7Z 5IP9I 2DE5A 4A3LI 3S1QI 1X3ZA 1AA6A 1YIJZ 4RVHA 2KI7B 2QRCB 1VQOZ 3KIFA 4E33A 2B63I 3NDIA 3CXCY 5IT9f 3CD6Z 2IV2X 4RV9A 4MD7A 2QREB 3VMHA 2VPWA 1Q821 2IZ3A 1N8R2 5FLMI 2HU9A 3OW2Y 1YUAA 3CCR1 1WW9A 3S14I 4NB9A 5FLXb 5C3EI 1VQ9Z 2KPIA 1VQMZ 1K9M2 1Q811 1VQPZ 1YHQZ 4A3CI 3CCJZ 3HOXI 4CL1A 2DE6A 3CCS1 3ESWA 1M1K2 3MZLB 3CCL1 1VQN1 3D2LA 5IP7I 2LIYA 3VMIA 1JWHC 4BBSI 3PO3I 4MRIA 4A3MI 3HOZI 1X3WA 3VMGA 2JIMA 3LUSA 3GTGI 3J80f 4HGYA 1VQ71 1Z03A 3J81f 1PFTA 4DGLA 1VQLZ 1TWGI 3H0GI 1WJ2A 2PK7A 2QRDB 3D6WA 2OTLZ 3RZDI 1VQO1 3EEDA 1VQ4Z 2Y0SA 4MD8A 3I07A 1P9NA 3CD61 4Y7NI 1Q812 2M6NA 3CCMZ 3CC4Z 2VUMI 3G6EZ 2V8IA 1M901 2R93I 3CCEZ 5C44I 4A3DI 2LFUA 4NBBA 1VQ91 1RNIA 2EGTA 3P5JB 1VQM1 4A3KI 1VQP1 2R7ZI 4RVGA 2RT9A 3CCJ1 4E2YA 1USPB 2E9HA 1R9TI 1JJ2Z 5IT9b 1KD11 1YI2Z 1VQK1 1FDOA 4HGZA 2PM9A 3S16I 3S2DI 3NDJA 1VQ6Z 3Q87A 4X6AI 1M1K1 1YJ9Z 4A3JI 2J6AA 2JA7I 3M4OI 2JA6I 2YU9I 2Q51A 1USPA 2WAQA 2OTL1 2RBLA 1Y8CA 1M902 2W04A 1K83I 2I3CA 1VQ41 1LQLA 1Y1WI 3S17I 2OOXB 2JIRA 4MD9A 3S15I 2H85A 4XX2A 2QA4Z 4NBFA 2AYDA 1QYPA 3CCM1 3F3PC 3IR7A 3CC41 4E32A 1JJ2Y 3I4NI 3VB9A 1TFIA 2HF1A 1Y1VI 2NVTI 3S1MI 5AN9F 3CCE1 4NBGA 3T4NB 3GTOI 2NVYI 3NH4A 1NJI1 1ZB9A 4BBRI 3J80b 1SIWA 2E7ZA 1KD12 3J81b 2JIPA 1ML8A 3GCFA 1W2BZ 3GTMS 1RLYA 4BXXI 1RO2A 1ZB8A 3IFUA 4EWCA 2ZAEB 3S1NI 2VUGA 1Q7Y1 2JIQA 3CC21 3CC7Z 3CCUZ 4E31A 3CMA1 2GTIA 3GTKI 4AYBA 2AKLA 4DK1A 3MONA 4HH4A 4NBHA 2V3VA 3G4S1 1VQ61 1N2FA 3CCVZ 2R6MA 4QTUA 3I551 1I3QI 4A3FI 3NFZA 1YJ91 4MXUA 2QKDA 1Q16A 1ZH1A 1YIJ1 3TDHB 4E2XA 3HOUI 1VLAA 4NB8A 3IX0A 4NBAA 4Y52I 3HOYI 4RVFA 1S72Z 5FLXf 3G71Z 3VTNA 1NJI2 5T64A 1KRLA 4BY7I 3FKII 2GU2A 2OTJZ 1K732 3HOWI 1KC81 3BG0B 1Q7Y2 2E2JI 2F4MA 2V8KA 1YHQ1 4A3EI 4A93I 1WCMI 1VQ5Z 4NBEA 1QVGZ 1Q862 2JIOA 1I6HI 3CMEZ 3CCU1 3GTPI 2VF1A 2P3YA 1TWCI 3CXCZ 1I50I 1QVFZ 4A3GI 3CCV1 2JMOA 1TWAI 2DE7A 5A2Qf 1RQFA 1VQL1 2P28A 5T6BA 1Y1VS 3F3FC 3GTJI 3FQMA 3NH8A 1YJWZ 2G2KA 2JUBA 3I56Z 1S721 2JS4A 1KC82 4RS4A 1S7MA 2VPZA 3G711 3K7AI 3D9XA 3TE5B 4S1TA 2QEXZ 1QVGY 2RPRA 5T67A 3G6E1 3BG1B 2V45A 3HOVI 2OTJ1 3IF8A
chains in the Genus database with same CATH topology
4E30A 2E2II 3PO3S 1X0TA 4NOZA 1QVFY 1YITZ 4DQYB 3JAMf 4E2WA 2JA5I 1DL6A 5LL6f 3U50C 1NUIA 3KIHA 4E2ZA 1K731 3GTLI 3CPWZ 1VQ51 3PO2I 3CME1 2BJOA 3M3YI 2YADA 1YI21 4BY1I 2QR1B 1Q861 1VQ8Z 5D1OB 1YJNZ 3CCQZ 2K5RA 2WB1A 2M48A 2OOYB 1RO4A 3HKZA 2JA8I 1NP6A 1TWFI 4A3BI 1VQKZ 4NBDA 3J7A4 1K8A1 1WIIA 1KQSZ 3QWUA 1YJW1 5C4XI 3GTMI 1W2BY 2F4OA 3S2HI 3H3VJ 3I561 2JNYA 2O53A 2QA41 3I4MI 3CPWY 1RO0A 2QEX1 5D1OA 1Q822 2QLVB 1Z01A 3NH5A 3GKQA 3GTQI 2RIQA 1QF8A 4QTTA 1Z02A 1YIT1 3RZOI 2OZKA 5CM2M 5A2Qb 3CCRZ 2E2HI 4RVDA 2O4HA 2JR6A 4TNUA 2IZ4A 2K3RA 3CC71 4NFRA 3MZKB 3CQZI 1N8R1 1KQSY 1YUKA 2R92I 5D1PA 4MONA 3CCSZ 2V8JA 5C4JI 1K8A2 1VQ81 4A3II 2GTHA 4NH1C 3CCLZ 1YJN1 2RHBA 3OW2Z 3CCQ1 1SFOI 2W03A 3CC2Z 1VQNZ 1K9M1 3CMAZ 2NVQI 4NBCA 2NVXI 3JAMb 3EERA 2Q4ZA 1L1OC 3G4SZ 3I55Z 2PMZA 4MH4A 1TWHI 3FQQA 3S1RI 1VQ7Z 5IP9I 2DE5A 4A3LI 3S1QI 1X3ZA 1YIJZ 4RVHA 2KI7B 2QRCB 1VQOZ 3KIFA 4E33A 2B63I 3NDIA 3CXCY 5IT9f 3CD6Z 4RV9A 4MD7A 2QREB 3VMHA 1Q821 2IZ3A 1N8R2 5FLMI 2HU9A 3OW2Y 1YUAA 3CCR1 1WW9A 3S14I 4NB9A 5FLXb 5C3EI 1VQ9Z 2KPIA 1VQMZ 1K9M2 1Q811 1VQPZ 1YHQZ 4A3CI 3CCJZ 3HOXI 4CL1A 2DE6A 3CCS1 3ESWA 1M1K2 3MZLB 3CCL1 1VQN1 5IP7I 2LIYA 3VMIA 1JWHC 4BBSI 3PO3I 4MRIA 4A3MI 3HOZI 1X3WA 3VMGA 3LUSA 3GTGI 3J80f 4HGYA 1VQ71 1Z03A 3J81f 1PFTA 4DGLA 1VQLZ 1TWGI 3H0GI 2PK7A 2QRDB 3D6WA 2OTLZ 3RZDI 1VQO1 3EEDA 1VQ4Z 2Y0SA 4MD8A 3I07A 1P9NA 3CD61 4Y7NI 1Q812 2M6NA 3CCMZ 3CC4Z 2VUMI 3G6EZ 2V8IA 1M901 2R93I 3CCEZ 5C44I 4A3DI 2LFUA 4NBBA 1VQ91 1RNIA 2EGTA 3P5JB 1VQM1 4A3KI 1VQP1 2R7ZI 4RVGA 2RT9A 3CCJ1 4E2YA 1USPB 2E9HA 1R9TI 1JJ2Z 5IT9b 1KD11 1YI2Z 1VQK1 4HGZA 2PM9A 3S16I 3S2DI 3NDJA 1VQ6Z 3Q87A 4X6AI 1M1K1 1YJ9Z 4A3JI 2J6AA 2JA7I 3M4OI 2JA6I 2YU9I 2Q51A 1USPA 2WAQA 2OTL1 2RBLA 1M902 2W04A 1K83I 2I3CA 1VQ41 1LQLA 1Y1WI 3S17I 2OOXB 4MD9A 3S15I 2H85A 4XX2A 2QA4Z 4NBFA 1QYPA 3CCM1 3F3PC 3CC41 4E32A 1JJ2Y 3I4NI 3VB9A 1TFIA 2HF1A 1Y1VI 2NVTI 3S1MI 5AN9F 3CCE1 4NBGA 3T4NB 3GTOI 2NVYI 3NH4A 1NJI1 1ZB9A 4BBRI 3J80b 1KD12 3J81b 3GTMS 1ML8A 3GCFA 1W2BZ 1RLYA 4BXXI 1RO2A 1ZB8A 3IFUA 4EWCA 2ZAEB 3S1NI 2VUGA 1Q7Y1 3CC7Z 3CC21 3CCUZ 4E31A 3CMA1 2GTIA 3GTKI 4AYBA 2AKLA 4DK1A 3MONA 4HH4A 4NBHA 3G4S1 1VQ61 1N2FA 3CCVZ 2R6MA 4QTUA 3I551 1I3QI 4A3FI 3NFZA 1YJ91 4MXUA 2QKDA 1ZH1A 1YIJ1 3TDHB 4E2XA 3HOUI 1VLAA 4NB8A 3IX0A 4NBAA 4Y52I 3HOYI 4RVFA 1S72Z 5FLXf 3G71Z 3VTNA 1NJI2 5T64A 1KRLA 4BY7I 3FKII 2GU2A 2OTJZ 1K732 3HOWI 1KC81 3BG0B 1Q7Y2 2E2JI 2F4MA 2V8KA 1YHQ1 4A3EI 4A93I 1WCMI 1VQ5Z 4NBEA 1QVGZ 1Q862 1I6HI 3CMEZ 3CCU1 3GTPI 2VF1A 2P3YA 1TWCI 3CXCZ 1I50I 1QVFZ 4A3GI 3CCV1 2JMOA 1TWAI 2DE7A 5A2Qf 1RQFA 1VQL1 2P28A 5T6BA 1Y1VS 3F3FC 3GTJI 3FQMA 3NH8A 1YJWZ 2G2KA 2JUBA 3I56Z 1S721 2JS4A 1KC82 4RS4A 1S7MA 3G711 3K7AI 3D9XA 3TE5B 4S1TA 2QEXZ 1QVGY 2RPRA 5T67A 3G6E1 3BG1B 3HOVI 2OTJ1 3IF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Z;  3CCV Z;  1Q81 2;  3CCM Z;  3CC4 Z;  3I55 1;  3G6E Z;  1QVF Y;  1YIT Z;  1YJ9 1;  1M90 1;  3G4S Z;  3CCE Z;  3I55 Z;  1YIJ 1;  1K73 1;  1VQ9 1;  1VQM 1;  3CPW Z;  1VQ7 Z;  1VQ5 1;  1VQP 1;  3CME 1;  3CCJ 1;  1YIJ Z;  1S72 Z;  3G71 Z;  1YI2 1;  1VQO Z;  1NJI 2;  1JJ2 Z;  1Q86 1;  3CXC Y;  1VQ8 Z;  1KD1 1;  3CD6 Z;  1YJN Z;  3CCQ Z;  1YI2 Z;  1VQK 1;  2OTJ Z;  1VQ6 Z;  1K73 2;  1Q82 1;  1M1K 1;  1N8R 2;  1KC8 1;  3OW2 Y;  1Q7Y 2;  1YJ9 Z;  3CCR 1;  1VQK Z;  1K8A 1;  1YHQ 1;  1KQS Z;  1YJW 1;  1VQ9 Z;  1W2B Y;  1VQM Z;  1K9M 2;  1VQ5 Z;  2OTL 1;  1Q81 1;  3I56 1;  1Q86 2;  1QVG Z;  1VQP Z;  1YHQ Z;  3CME Z;  3CCJ Z;  2QA4 1;  3CCU 1;  1M90 2;  3CPW Y;  2QEX 1;  1VQ4 1;  3CCS 1;  1Q82 2;  1M1K 2;  3CCL 1;  3CXC Z;  2QA4 Z;  1QVF Z;  1VQN 1;  3CCV 1;  3CCM 1;  3CC4 1;  1JJ2 Y;  1YIT 1;  3CCE 1;  1VQL 1;  1NJI 1;  3CCR Z;  1KD1 2;  1VQ7 1;  1W2B Z;  3CC7 1;  1VQL Z;  1YJW Z;  2OTL Z;  3I56 Z;  1S72 1;  1KC8 2;  1N8R 1;  3G71 1;  1KQS Y;  1VQO 1;  1Q7Y 1;  3CC7 Z;  3CC2 1;  3CCU Z;  2QEX Z;  3CMA 1;  1QVG Y;  1VQ4 Z;  3CCS Z;  1K8A 2;  3G6E 1;  1VQ8 1;  3CD6 1;  3CCL Z;  1YJN 1;  3OW2 Z;  3CCQ 1;  3CC2 Z;  1VQN Z;  3G4S 1;  1K9M 1;  2OTJ 1;  1VQ6 1; 
#chains in the Genus database with same CATH topology
 4E30 A;  2E2I I;  3PO3 S;  1X0T A;  4NOZ A;  1QVF Y;  1YIT Z;  4DQY B;  3JAM f;  4E2W A;  2JA5 I;  1DL6 A;  5LL6 f;  3U50 C;  1NUI A;  3KIH A;  4E2Z A;  1K73 1;  3GTL I;  3CPW Z;  1VQ5 1;  3PO2 I;  3CME 1;  2BJO A;  3M3Y I;  2YAD A;  1YI2 1;  4BY1 I;  2QR1 B;  1Q86 1;  1VQ8 Z;  5D1O B;  1YJN Z;  3CCQ Z;  2K5R A;  2WB1 A;  2M48 A;  2OOY B;  1RO4 A;  3HKZ A;  2JA8 I;  1NP6 A;  1TWF I;  4A3B I;  1VQK Z;  4NBD A;  3J7A 4;  1K8A 1;  1WZN A;  1WII A;  1KQS Z;  3QWU A;  1YJW 1;  5C4X I;  3GTM I;  1W2B Y;  2F4O A;  3S2H I;  3H3V J;  3I56 1;  2JNY A;  2O53 A;  2QA4 1;  2LEX A;  3I4M I;  3CPW Y;  1RO0 A;  2QEX 1;  1QXF A;  5D1O A;  1Q82 2;  2QLV B;  2NAP A;  1Z01 A;  3NH5 A;  3GKQ A;  3GTQ I;  2RIQ A;  1QF8 A;  4QTT A;  1Z02 A;  1YIT 1;  3RZO I;  2OZK A;  5CM2 M;  5A2Q b;  2VPY A;  3CCR Z;  2E2H I;  4RVD A;  2O4H A;  2JR6 A;  4TNU A;  2IZ4 A;  2K3R A;  3CC7 1;  4NFR A;  3MZK B;  1FDI A;  3CQZ I;  1N8R 1;  1KQS Y;  1YUK A;  2R92 I;  5D1P A;  4MON A;  3CCS Z;  2V8J A;  5C4J I;  1K8A 2;  1VQ8 1;  4A3I I;  2GTH A;  4NH1 C;  3CCL Z;  1YJN 1;  2RHB A;  3OW2 Z;  3CCQ 1;  1SFO I;  2W03 A;  3CC2 Z;  1VQN Z;  1K9M 1;  3CMA Z;  2NVQ I;  4NBC A;  2VPX A;  2NVX I;  3JAM b;  3EER A;  2Q4Z A;  1L1O C;  3G4S Z;  3I55 Z;  2PMZ A;  4MH4 A;  1TWH I;  3FQQ A;  3S1R I;  1VQ7 Z;  5IP9 I;  2DE5 A;  4A3L I;  3S1Q I;  1X3Z A;  1AA6 A;  1YIJ Z;  4RVH A;  2KI7 B;  2QRC B;  1VQO Z;  3KIF A;  4E33 A;  2B63 I;  3NDI A;  3CXC Y;  5IT9 f;  3CD6 Z;  2IV2 X;  4RV9 A;  4MD7 A;  2QRE B;  3VMH A;  2VPW A;  1Q82 1;  2IZ3 A;  1N8R 2;  5FLM I;  2HU9 A;  3OW2 Y;  1YUA A;  3CCR 1;  1WW9 A;  3S14 I;  4NB9 A;  5FLX b;  5C3E I;  1VQ9 Z;  2KPI A;  1VQM Z;  1K9M 2;  1Q81 1;  1VQP Z;  1YHQ Z;  4A3C I;  3CCJ Z;  3HOX I;  4CL1 A;  2DE6 A;  3CCS 1;  3ESW A;  1M1K 2;  3MZL B;  3CCL 1;  1VQN 1;  3D2L A;  5IP7 I;  2LIY A;  3VMI A;  1JWH C;  4BBS I;  3PO3 I;  4MRI A;  4A3M I;  3HOZ I;  1X3W A;  3VMG A;  2JIM A;  3LUS A;  3GTG I;  3J80 f;  4HGY A;  1VQ7 1;  1Z03 A;  3J81 f;  1PFT A;  4DGL A;  1VQL Z;  1TWG I;  3H0G I;  1WJ2 A;  2PK7 A;  2QRD B;  3D6W A;  2OTL Z;  3RZD I;  1VQO 1;  3EED A;  1VQ4 Z;  2Y0S A;  4MD8 A;  3I07 A;  1P9N A;  3CD6 1;  4Y7N I;  1Q81 2;  2M6N A;  3CCM Z;  3CC4 Z;  2VUM I;  3G6E Z;  2V8I A;  1M90 1;  2R93 I;  3CCE Z;  5C44 I;  4A3D I;  2LFU A;  4NBB A;  1VQ9 1;  1RNI A;  2EGT A;  3P5J B;  1VQM 1;  4A3K I;  1VQP 1;  2R7Z I;  4RVG A;  2RT9 A;  3CCJ 1;  4E2Y A;  1USP B;  2E9H A;  1R9T I;  1JJ2 Z;  5IT9 b;  1KD1 1;  1YI2 Z;  1VQK 1;  1FDO A;  4HGZ A;  2PM9 A;  3S16 I;  3S2D I;  3NDJ A;  1VQ6 Z;  3Q87 A;  4X6A I;  1M1K 1;  1YJ9 Z;  4A3J I;  2J6A A;  2JA7 I;  3M4O I;  2JA6 I;  2YU9 I;  2Q51 A;  1USP A;  2WAQ A;  2OTL 1;  2RBL A;  1Y8C A;  1M90 2;  2W04 A;  1K83 I;  2I3C A;  1VQ4 1;  1LQL A;  1Y1W I;  3S17 I;  2OOX B;  2JIR A;  4MD9 A;  3S15 I;  2H85 A;  4XX2 A;  2QA4 Z;  4NBF A;  2AYD A;  1QYP A;  3CCM 1;  3F3P C;  3IR7 A;  3CC4 1;  4E32 A;  1JJ2 Y;  3I4N I;  3VB9 A;  1TFI A;  2HF1 A;  1Y1V I;  2NVT I;  3S1M I;  5AN9 F;  3CCE 1;  4NBG A;  3T4N B;  3GTO I;  2NVY I;  3NH4 A;  1NJI 1;  1ZB9 A;  4BBR I;  3J80 b;  1SIW A;  2E7Z A;  1KD1 2;  3J81 b;  2JIP A;  1ML8 A;  3GCF A;  1W2B Z;  3GTM S;  1RLY A;  4BXX I;  1RO2 A;  1ZB8 A;  3IFU A;  4EWC A;  2ZAE B;  3S1N I;  2VUG A;  1Q7Y 1;  2JIQ A;  3CC2 1;  3CC7 Z;  3CCU Z;  4E31 A;  3CMA 1;  2GTI A;  3GTK I;  4AYB A;  2AKL A;  4DK1 A;  3MON A;  4HH4 A;  4NBH A;  2V3V A;  3G4S 1;  1VQ6 1;  1N2F A;  3CCV Z;  2R6M A;  4QTU A;  3I55 1;  1I3Q I;  4A3F I;  3NFZ A;  1YJ9 1;  4MXU A;  2QKD A;  1Q16 A;  1ZH1 A;  1YIJ 1;  3TDH B;  4E2X A;  3HOU I;  1VLA A;  4NB8 A;  3IX0 A;  4NBA A;  4Y52 I;  3HOY I;  4RVF A;  1S72 Z;  5FLX f;  3G71 Z;  3VTN A;  1NJI 2;  5T64 A;  1KRL A;  4BY7 I;  3FKI I;  2GU2 A;  2OTJ Z;  1K73 2;  3HOW I;  1KC8 1;  3BG0 B;  1Q7Y 2;  2E2J I;  2F4M A;  2V8K A;  1YHQ 1;  4A3E I;  4A93 I;  1WCM I;  1VQ5 Z;  4NBE A;  1QVG Z;  1Q86 2;  2JIO A;  1I6H I;  3CME Z;  3CCU 1;  3GTP I;  2VF1 A;  2P3Y A;  1TWC I;  3CXC Z;  1I50 I;  1QVF Z;  4A3G I;  3CCV 1;  2JMO A;  1TWA I;  2DE7 A;  5A2Q f;  1RQF A;  1VQL 1;  2P28 A;  5T6B A;  1Y1V S;  3F3F C;  3GTJ I;  3FQM A;  3NH8 A;  1YJW Z;  2G2K A;  2JUB A;  3I56 Z;  1S72 1;  2JS4 A;  1KC8 2;  4RS4 A;  1S7M A;  2VPZ A;  3G71 1;  3K7A I;  3D9X A;  3TE5 B;  4S1T A;  2QEX Z;  1QVG Y;  2RPR A;  5T67 A;  3G6E 1;  3BG1 B;  2V45 A;  3HOV I;  2OTJ 1;  3IF8 A; 
#chains in the Genus database with same CATH homology
 4E30 A;  2E2I I;  3PO3 S;  1X0T A;  4NOZ A;  1QVF Y;  1YIT Z;  4DQY B;  3JAM f;  4E2W A;  2JA5 I;  1DL6 A;  5LL6 f;  3U50 C;  1NUI A;  3KIH A;  4E2Z A;  1K73 1;  3GTL I;  3CPW Z;  1VQ5 1;  3PO2 I;  3CME 1;  2BJO A;  3M3Y I;  2YAD A;  1YI2 1;  4BY1 I;  2QR1 B;  1Q86 1;  1VQ8 Z;  5D1O B;  1YJN Z;  3CCQ Z;  2K5R A;  2WB1 A;  2M48 A;  2OOY B;  1RO4 A;  3HKZ A;  2JA8 I;  1NP6 A;  1TWF I;  4A3B I;  1VQK Z;  4NBD A;  3J7A 4;  1K8A 1;  1WII A;  1KQS Z;  3QWU A;  1YJW 1;  5C4X I;  3GTM I;  1W2B Y;  2F4O A;  3S2H I;  3H3V J;  3I56 1;  2JNY A;  2O53 A;  2QA4 1;  3I4M I;  3CPW Y;  1RO0 A;  2QEX 1;  5D1O A;  1Q82 2;  2QLV B;  1Z01 A;  3NH5 A;  3GKQ A;  3GTQ I;  2RIQ A;  1QF8 A;  4QTT A;  1Z02 A;  1YIT 1;  3RZO I;  2OZK A;  5CM2 M;  5A2Q b;  3CCR Z;  2E2H I;  4RVD A;  2O4H A;  2JR6 A;  4TNU A;  2IZ4 A;  2K3R A;  3CC7 1;  4NFR A;  3MZK B;  3CQZ I;  1N8R 1;  1KQS Y;  1YUK A;  2R92 I;  5D1P A;  4MON A;  3CCS Z;  2V8J A;  5C4J I;  1K8A 2;  1VQ8 1;  4A3I I;  2GTH A;  4NH1 C;  3CCL Z;  1YJN 1;  2RHB A;  3OW2 Z;  3CCQ 1;  1SFO I;  2W03 A;  3CC2 Z;  1VQN Z;  1K9M 1;  3CMA Z;  2NVQ I;  4NBC A;  2NVX I;  3JAM b;  3EER A;  2Q4Z A;  1L1O C;  3G4S Z;  3I55 Z;  2PMZ A;  4MH4 A;  1TWH I;  3FQQ A;  3S1R I;  1VQ7 Z;  5IP9 I;  2DE5 A;  4A3L I;  3S1Q I;  1X3Z A;  1YIJ Z;  4RVH A;  2KI7 B;  2QRC B;  1VQO Z;  3KIF A;  4E33 A;  2B63 I;  3NDI A;  3CXC Y;  5IT9 f;  3CD6 Z;  4RV9 A;  4MD7 A;  2QRE B;  3VMH A;  1Q82 1;  2IZ3 A;  1N8R 2;  5FLM I;  2HU9 A;  3OW2 Y;  1YUA A;  3CCR 1;  1WW9 A;  3S14 I;  4NB9 A;  5FLX b;  5C3E I;  1VQ9 Z;  2KPI A;  1VQM Z;  1K9M 2;  1Q81 1;  1VQP Z;  1YHQ Z;  4A3C I;  3CCJ Z;  3HOX I;  4CL1 A;  2DE6 A;  3CCS 1;  3ESW A;  1M1K 2;  3MZL B;  3CCL 1;  1VQN 1;  5IP7 I;  2LIY A;  3VMI A;  1JWH C;  4BBS I;  3PO3 I;  4MRI A;  4A3M I;  3HOZ I;  1X3W A;  3VMG A;  3LUS A;  3GTG I;  3J80 f;  4HGY A;  1VQ7 1;  1Z03 A;  3J81 f;  1PFT A;  4DGL A;  1VQL Z;  1TWG I;  3H0G I;  2PK7 A;  2QRD B;  3D6W A;  2OTL Z;  3RZD I;  1VQO 1;  3EED A;  1VQ4 Z;  2Y0S A;  4MD8 A;  3I07 A;  1P9N A;  3CD6 1;  4Y7N I;  1Q81 2;  2M6N A;  3CCM Z;  3CC4 Z;  2VUM I;  3G6E Z;  2V8I A;  1M90 1;  2R93 I;  3CCE Z;  5C44 I;  4A3D I;  2LFU A;  4NBB A;  1VQ9 1;  1RNI A;  2EGT A;  3P5J B;  1VQM 1;  4A3K I;  1VQP 1;  2R7Z I;  4RVG A;  2RT9 A;  3CCJ 1;  4E2Y A;  1USP B;  2E9H A;  1R9T I;  1JJ2 Z;  5IT9 b;  1KD1 1;  1YI2 Z;  1VQK 1;  4HGZ A;  2PM9 A;  3S16 I;  3S2D I;  3NDJ A;  1VQ6 Z;  3Q87 A;  4X6A I;  1M1K 1;  1YJ9 Z;  4A3J I;  2J6A A;  2JA7 I;  3M4O I;  2JA6 I;  2YU9 I;  2Q51 A;  1USP A;  2WAQ A;  2OTL 1;  2RBL A;  1M90 2;  2W04 A;  1K83 I;  2I3C A;  1VQ4 1;  1LQL A;  1Y1W I;  3S17 I;  2OOX B;  4MD9 A;  3S15 I;  2H85 A;  4XX2 A;  2QA4 Z;  4NBF A;  1QYP A;  3CCM 1;  3F3P C;  3CC4 1;  4E32 A;  1JJ2 Y;  3I4N I;  3VB9 A;  1TFI A;  2HF1 A;  1Y1V I;  2NVT I;  3S1M I;  5AN9 F;  3CCE 1;  4NBG A;  3T4N B;  3GTO I;  2NVY I;  3NH4 A;  1NJI 1;  1ZB9 A;  4BBR I;  3J80 b;  1KD1 2;  3J81 b;  3GTM S;  1ML8 A;  3GCF A;  1W2B Z;  1RLY A;  4BXX I;  1RO2 A;  1ZB8 A;  3IFU A;  4EWC A;  2ZAE B;  3S1N I;  2VUG A;  1Q7Y 1;  3CC7 Z;  3CC2 1;  3CCU Z;  4E31 A;  3CMA 1;  2GTI A;  3GTK I;  4AYB A;  2AKL A;  4DK1 A;  3MON A;  4HH4 A;  4NBH A;  3G4S 1;  1VQ6 1;  1N2F A;  3CCV Z;  2R6M A;  4QTU A;  3I55 1;  1I3Q I;  4A3F I;  3NFZ A;  1YJ9 1;  4MXU A;  2QKD A;  1ZH1 A;  1YIJ 1;  3TDH B;  4E2X A;  3HOU I;  1VLA A;  4NB8 A;  3IX0 A;  4NBA A;  4Y52 I;  3HOY I;  4RVF A;  1S72 Z;  5FLX f;  3G71 Z;  3VTN A;  1NJI 2;  5T64 A;  1KRL A;  4BY7 I;  3FKI I;  2GU2 A;  2OTJ Z;  1K73 2;  3HOW I;  1KC8 1;  3BG0 B;  1Q7Y 2;  2E2J I;  2F4M A;  2V8K A;  1YHQ 1;  4A3E I;  4A93 I;  1WCM I;  1VQ5 Z;  4NBE A;  1QVG Z;  1Q86 2;  1I6H I;  3CME Z;  3CCU 1;  3GTP I;  2VF1 A;  2P3Y A;  1TWC I;  3CXC Z;  1I50 I;  1QVF Z;  4A3G I;  3CCV 1;  2JMO A;  1TWA I;  2DE7 A;  5A2Q f;  1RQF A;  1VQL 1;  2P28 A;  5T6B A;  1Y1V S;  3F3F C;  3GTJ I;  3FQM A;  3NH8 A;  1YJW Z;  2G2K A;  2JUB A;  3I56 Z;  1S72 1;  2JS4 A;  1KC8 2;  4RS4 A;  1S7M A;  3G71 1;  3K7A I;  3D9X A;  3TE5 B;  4S1T A;  2QEX Z;  1QVG Y;  2RPR A;  5T67 A;  3G6E 1;  3BG1 B;  3HOV I;  2OTJ 1;  3IF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...