1K8A2

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k8a200
1Q822 1K8A2 3CCVZ 3CC21 3CCQZ 3CCMZ 3CMA1 1QVFY 1YJW1 1Q812 1YJ9Z 1VQK1 1KD12 3CCS1 1VQ5Z 2OTLZ 3G711 1M1K1 1YITZ 1K8A1 1N8R2 1VQ61 3CCV1 1KC81 3CPWZ 2QA4Z 2QEXZ 1Q811 1VQ9Z 3G6EZ 3CCEZ 3CD6Z 2OTJ1 1K9M2 3CCJZ 3CMEZ 1VQ51 1KD11 2OTL1 1VQOZ 1YJNZ 1JJ2Z 1YIT1 1VQN1 3CXCY 1YI2Z 1KQSZ 1VQ4Z 1N8R1 3CCL1 3I561 1QVFZ 1VQLZ 2QA41 2QEX1 3CC41 3CCM1 1NJI1 1YHQZ 1VQ91 3CC7Z 1VQ7Z 1Q821 1W2BZ 3CD61 1VQ8Z 1S72Z 1K9M1 3G4SZ 1VQO1 3CCQ1 1M902 1VQPZ 1QVGY 1K732 1YJ91 3CCUZ 3CCRZ 3OW2Y 1VQL1 1YIJZ 3CC71 3G4S1 3CC2Z 1Q862 3CMAZ 1Q7Y2 3CPWY 1M901 3CXCZ 1K731 1VQKZ 3CCU1 3G6E1 3CCE1 3CCSZ 3G71Z 3I55Z 3CCJ1 3CME1 1YIJ1 1JJ2Y 1YJN1 1VQ6Z 1KQSY 1YI21 1KC82 1VQ41 1Q861 1Q7Y1 1VQMZ 1QVGZ 2OTJZ 3OW2Z 1YHQ1 1W2BY 1VQ71 1VQ81 1S721 3I551 1YJWZ 1VQNZ 3CCLZ 3I56Z 1VQP1 3CCR1 3CC4Z 1VQM1 1M1K2 1NJI2
chains in the Genus database with same CATH superfamily
3BG0B 4Y52I 3D9XA 3S17I 3GTKI 2QRCB 3CCQZ 1QVFY 2O53A 5A2Qb 1YJW1 3VB9A 1Y1WI 1KD12 3CCS1 2NVTI 2VPWA 5T6BA 3HOXI 1Y1VS 4A93I 1QYPA 2NVQI 2QREB 3CCV1 2R6MA 4QTTA 2Y0SA 3T4NB 1RO0A 4XX2A 4RVFA 3D6WA 1VQ9Z 2OTJ1 4Y7NI 1K9M2 1VQ51 2OTL1 1VQOZ 5AN9F 1RO4A 2QRDB 3CXCY 1YI2Z 5T67A 1N8R1 2IZ4A 2VPZA 1QVFZ 4EWCA 4A3BI 2QA41 2JMOA 2PM9A 3VMIA 4E31A 1NJI1 4MONA 1YHQZ 1WZNA 4RVDA 1WIIA 3HOVI 1Q821 1VQ8Z 1S72Z 4RVGA 4NBGA 1M902 1ZB8A 4E2ZA 3GTGI 1K732 1YJ91 2E2II 3OW2Y 3S15I 2AKLA 2F4MA 2IZ3A 5C44I 4NBCA 2NVXI 2LEXA 3IX0A 5D1OA 3G4S1 1Z03A 3MONA 3CPWY 3JAMf 3CXCZ 5D1PA 1X3WA 1ZH1A 3S1NI 3CCSZ 2GTIA 3KIFA 3CCJ1 1YIJ1 4A3EI 1KQSY 1VQ41 1Q861 4HGYA 3S1RI 1Q7Y1 1TWAI 1VQMZ 4NBAA 2P3YA 4MD9A 4A3II 2OTJZ 3OW2Z 1W2BY 1VQ71 2JNYA 4NBFA 3S1MI 4DGLA 2LFUA 3CCR1 3HOWI 3PO3I 2JIRA 4NOZA 1NJI2 1WJ2A 2VPYA 2RIQA 1Q822 3GTMI 1K8A2 4NBDA 1Z02A 1TWCI 3CC21 2W04A 1TWFI 1YJ9Z 5A2Qf 2KPIA 3J81f 3BG1B 3NH5A 1M1K1 4DQYB 1YUKA 3TE5B 1KC81 5C4JI 3FQQA 3PO3S 2V45A 2QEXZ 2B63I 4QTUA 2OZKA 1Q811 3GTMS 3U50C 2Q4ZA 3CD6Z 3CCJZ 2M48A 3KIHA 1FDIA 2H85A 3GCFA 1YIT1 1YUAA 1VQ4Z 4NB9A 3I561 3CCL1 4S1TA 4NBBA 1VQLZ 4HH4A 4NBHA 3IFUA 5C3EI 1LQLA 4MD7A 1VQ7Z 3H0GI 4NB8A 3S2HI 2G2KA 2Q51A 3CCRZ 3NDIA 2DE7A 3S1QI 4TNUA 3CC71 3Q87A 3IF8A 3HOYI 3CC2Z 3ESWA 2VUMI 2KI7B 4MD8A 1X0TA 3J80f 2JIMA 2IV2X 1I50I 3MZKB 3CCU1 3G6E1 1USPA 5IP9I 2W03A 3CME1 2YU9I 1JJ2Y 3GTJI 2GTHA 2E9HA 1KC82 2QR1B 4RS4A 5FLXb 1KRLA 3EEDA 2E2JI 4MH4A 1Z01A 3I4NI 3F3PC 2JA5I 4AYBA 3I551 2BJOA 1YJWZ 4CL1A 3EERA 3CCLZ 3I56Z 4BY1I 3VMGA 4E33A 5IP7I 1ML8A 3FQMA 4E2WA 4RVHA 3GTPI 3CCVZ 1WCMI 1RQFA 1NP6A 4E30A 3CMA1 5LL6f 2QKDA 1SIWA 2VPXA 4E2XA 4A3JI 1VQ5Z 2OTLZ 3G711 5C4XI 3QWUA 1PFTA 1N8R2 1N2FA 3GKQA 5IT9f 1VQ61 3I07A 3CPWZ 2QA4Z 2JR6A 3P5JB 3G6EZ 3GTQI 4MXUA 2EGTA 1KD11 3CMEZ 1KQSZ 3MZLB 1P9NA 2K5RA 2JS4A 1K83I 2DE5A 3CC41 4HGZA 4MRIA 5T64A 3HOZI 1VQ91 1WW9A 1W2BZ 2JIQA 1K9M1 3G4SZ 2M6NA 3NDJA 1VQO1 3M3YI 1QXFA 2WB1A 2VF1A 2PMZA 1I6HI 3H3VJ 4NH1C 2YADA 1YIJZ 4A3GI 3F3FC 2LIYA 1SFOI 2JA6I 1Q862 3CMAZ 2JIPA 4RV9A 3GTOI 1Q7Y2 1M901 3GTLI 3J7A4 1K731 3CCE1 2HF1A 3G71Z 2RPRA 3NH8A 1USPB 1YJN1 1VLAA 1VQ6Z 3FKII 3LUSA 4BBSI 4BXXI 4NFRA 2V8IA 3S16I 5D1OB 1VQP1 4A3KI 5FLXf 1TWGI 2QLVB 3TDHB 3CC4Z 1VQM1 3HKZA 1M1K2 1RNIA 2R93I 2I3CA 4E2YA 2F4OA 2OOYB 4NBEA 2JA8I 2E2HI 4DK1A 2V8KA 2K3RA 4BBRI 2RBLA 2JA7I 2GU2A 1Q16A 1Q812 2VUGA 4BY7I 3IR7A 1VQK1 1L1OC 1S7MA 2NVYI 2JUBA 1YITZ 2R7ZI 1K8A1 2O4HA 3RZDI 1TWHI 3J80b 4X6AI 3CCEZ 4A3FI 2R92I 5CM2M 1Y8CA 1YJNZ 1JJ2Z 2P28A 1VQN1 2V8JA 2QEX1 3CCM1 3D2LA 3K7AI 2HU9A 2V3VA 3CC7Z 3NFZA 1R9TI 3CD61 3RZOI 3S2DI 4A3DI 2PK7A 1RO2A 1AA6A 3CCQ1 1NUIA 1VQPZ 1QVGY 1DL6A 3JAMb 2J6AA 3CCUZ 2RHBA 1VQL1 3I4MI 4A3MI 1QF8A 2OOXB 2WAQA 2NAPA 1TFIA 1FDOA 4A3CI 3HOUI 3VMHA 1VQKZ 2DE6A 1X3ZA 2RT9A 2ZAEB 3I55Z 3M4OI 5FLMI 4E32A 1YI21 3S14I 1JWHC 2JIOA 5IT9b 3NH4A 1QVGZ 1ZB9A 1RLYA 1YHQ1 3PO2I 1VQ81 1S721 1VQNZ 1I3QI 1Y1VI 3CQZI 2E7ZA 4A3LI 3VTNA 3CCMZ 3J81b 2AYDA
chains in the Genus database with same CATH topology
3BG0B 4Y52I 3D9XA 3S17I 3GTKI 2QRCB 3CCQZ 1QVFY 2O53A 5A2Qb 1YJW1 3VB9A 1Y1WI 1KD12 3CCS1 2NVTI 5T6BA 3HOXI 1Y1VS 4A93I 1QYPA 2NVQI 2QREB 3CCV1 2R6MA 4QTTA 2Y0SA 3T4NB 1RO0A 4XX2A 4RVFA 3D6WA 1VQ9Z 2OTJ1 4Y7NI 1K9M2 1VQ51 2OTL1 1VQOZ 5AN9F 1RO4A 2QRDB 3CXCY 1YI2Z 5T67A 1N8R1 2IZ4A 1QVFZ 4EWCA 4A3BI 2QA41 2JMOA 2PM9A 3VMIA 4E31A 1NJI1 4MONA 1YHQZ 3HOVI 4RVDA 1WIIA 1Q821 1VQ8Z 1S72Z 4RVGA 4NBGA 1M902 1ZB8A 4E2ZA 3GTGI 1K732 1YJ91 2E2II 3OW2Y 3S15I 2AKLA 2F4MA 2IZ3A 5C44I 4NBCA 2NVXI 3IX0A 5D1OA 3G4S1 1Z03A 3MONA 3CPWY 3JAMf 3CXCZ 5D1PA 1X3WA 1ZH1A 3S1NI 3CCSZ 2GTIA 3KIFA 3CCJ1 1YIJ1 4A3EI 1KQSY 1VQ41 1Q861 4HGYA 3S1RI 1Q7Y1 1VQMZ 1TWAI 4NBAA 2P3YA 4MD9A 4A3II 2OTJZ 3OW2Z 1W2BY 1VQ71 2JNYA 4NBFA 3S1MI 4DGLA 2LFUA 3CCR1 3HOWI 3PO3I 4NOZA 1NJI2 2RIQA 1Q822 3GTMI 1K8A2 4NBDA 1Z02A 1TWCI 3CC21 2W04A 1TWFI 1YJ9Z 5A2Qf 2KPIA 3J81f 3BG1B 3NH5A 1M1K1 4DQYB 1YUKA 3TE5B 1KC81 5C4JI 3FQQA 3PO3S 2QEXZ 2B63I 4QTUA 2OZKA 1Q811 3GTMS 3U50C 2Q4ZA 3CD6Z 3CCJZ 2M48A 3KIHA 2H85A 3GCFA 1YIT1 1YUAA 1VQ4Z 4NB9A 3I561 3CCL1 4S1TA 4NBBA 1VQLZ 4HH4A 4NBHA 3IFUA 5C3EI 1LQLA 4MD7A 1VQ7Z 3H0GI 4NB8A 3S2HI 2G2KA 2Q51A 3CCRZ 3NDIA 2DE7A 3S1QI 4TNUA 3CC71 3Q87A 3IF8A 3HOYI 3CC2Z 3ESWA 2VUMI 2KI7B 4MD8A 1X0TA 3J80f 1I50I 3MZKB 3CCU1 3G6E1 1USPA 5IP9I 2W03A 3CME1 2YU9I 1JJ2Y 3GTJI 2GTHA 2E9HA 1KC82 2QR1B 4RS4A 5FLXb 1KRLA 3EEDA 2E2JI 4MH4A 1Z01A 3I4NI 3F3PC 2JA5I 4AYBA 3I551 2BJOA 1YJWZ 4CL1A 3EERA 3CCLZ 3I56Z 4BY1I 3VMGA 4E33A 5IP7I 1ML8A 3FQMA 4E2WA 4RVHA 3GTPI 3CCVZ 1WCMI 1RQFA 1NP6A 4E30A 3CMA1 5LL6f 2QKDA 4E2XA 4A3JI 1VQ5Z 2OTLZ 3G711 5C4XI 3QWUA 1PFTA 1N8R2 1N2FA 3GKQA 5IT9f 1VQ61 3I07A 3CPWZ 2QA4Z 2JR6A 3P5JB 3G6EZ 3GTQI 4MXUA 2EGTA 1KD11 3CMEZ 1KQSZ 3MZLB 1P9NA 2K5RA 2JS4A 1K83I 2DE5A 3CC41 4HGZA 4MRIA 5T64A 3HOZI 1VQ91 1WW9A 1W2BZ 1K9M1 3G4SZ 2M6NA 3NDJA 1VQO1 3M3YI 2WB1A 2VF1A 2PMZA 1I6HI 3H3VJ 4NH1C 2YADA 1YIJZ 4A3GI 3F3FC 2LIYA 1SFOI 2JA6I 1Q862 3CMAZ 4RV9A 3GTOI 1Q7Y2 1M901 3GTLI 3J7A4 1K731 3CCE1 2HF1A 3G71Z 2RPRA 3NH8A 1USPB 1YJN1 1VLAA 1VQ6Z 3FKII 3LUSA 4BBSI 4BXXI 4NFRA 2V8IA 3S16I 5D1OB 1VQP1 4A3KI 5FLXf 1TWGI 2QLVB 3TDHB 3CC4Z 1VQM1 3HKZA 1M1K2 1RNIA 2R93I 2I3CA 4E2YA 2F4OA 2OOYB 4NBEA 2JA8I 2E2HI 4DK1A 2V8KA 2K3RA 4BBRI 2RBLA 2JA7I 2GU2A 1Q812 2VUGA 4BY7I 1VQK1 1L1OC 1S7MA 2NVYI 2JUBA 1YITZ 2R7ZI 1K8A1 2O4HA 3RZDI 1TWHI 3J80b 4X6AI 3CCEZ 4A3FI 2R92I 5CM2M 1YJNZ 1JJ2Z 2P28A 1VQN1 2V8JA 2QEX1 3CCM1 1R9TI 3K7AI 2HU9A 3CC7Z 3RZOI 3NFZA 3CD61 3S2DI 4A3DI 2PK7A 1RO2A 3CCQ1 1NUIA 1VQPZ 1QVGY 1DL6A 3JAMb 2J6AA 3CCUZ 2RHBA 1VQL1 3I4MI 4A3MI 1QF8A 2OOXB 2WAQA 1TFIA 4A3CI 3HOUI 3VMHA 1VQKZ 2DE6A 1X3ZA 2RT9A 2ZAEB 3I55Z 3M4OI 5FLMI 4E32A 1YI21 3S14I 1JWHC 5IT9b 3NH4A 1QVGZ 1ZB9A 1RLYA 1YHQ1 3PO2I 1VQ81 1S721 1VQNZ 1I3QI 1Y1VI 3CQZI 4A3LI 3VTNA 3CCMZ 3J81b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 2;  1K8A 2;  3CCV Z;  3CC2 1;  3CCQ Z;  3CCM Z;  3CMA 1;  1QVF Y;  1YJW 1;  1Q81 2;  1YJ9 Z;  1VQK 1;  1KD1 2;  3CCS 1;  1VQ5 Z;  2OTL Z;  3G71 1;  1M1K 1;  1YIT Z;  1K8A 1;  1N8R 2;  1VQ6 1;  3CCV 1;  1KC8 1;  3CPW Z;  2QA4 Z;  2QEX Z;  1Q81 1;  1VQ9 Z;  3G6E Z;  3CCE Z;  3CD6 Z;  2OTJ 1;  1K9M 2;  3CCJ Z;  3CME Z;  1VQ5 1;  1KD1 1;  2OTL 1;  1VQO Z;  1YJN Z;  1JJ2 Z;  1YIT 1;  1VQN 1;  3CXC Y;  1YI2 Z;  1KQS Z;  1VQ4 Z;  1N8R 1;  3CCL 1;  3I56 1;  1QVF Z;  1VQL Z;  2QA4 1;  2QEX 1;  3CC4 1;  3CCM 1;  1NJI 1;  1YHQ Z;  1VQ9 1;  3CC7 Z;  1VQ7 Z;  1Q82 1;  1W2B Z;  3CD6 1;  1VQ8 Z;  1S72 Z;  1K9M 1;  3G4S Z;  1VQO 1;  3CCQ 1;  1M90 2;  1VQP Z;  1QVG Y;  1K73 2;  1YJ9 1;  3CCU Z;  3CCR Z;  3OW2 Y;  1VQL 1;  1YIJ Z;  3CC7 1;  3G4S 1;  3CC2 Z;  1Q86 2;  3CMA Z;  1Q7Y 2;  3CPW Y;  1M90 1;  3CXC Z;  1K73 1;  1VQK Z;  3CCU 1;  3G6E 1;  3CCE 1;  3CCS Z;  3G71 Z;  3I55 Z;  3CCJ 1;  3CME 1;  1YIJ 1;  1JJ2 Y;  1YJN 1;  1VQ6 Z;  1KQS Y;  1YI2 1;  1KC8 2;  1VQ4 1;  1Q86 1;  1Q7Y 1;  1VQM Z;  1QVG Z;  2OTJ Z;  3OW2 Z;  1YHQ 1;  1W2B Y;  1VQ7 1;  1VQ8 1;  1S72 1;  3I55 1;  1YJW Z;  1VQN Z;  3CCL Z;  3I56 Z;  1VQP 1;  3CCR 1;  3CC4 Z;  1VQM 1;  1M1K 2;  1NJI 2; 
#chains in the Genus database with same CATH topology
 3BG0 B;  4Y52 I;  3D9X A;  3S17 I;  3GTK I;  2QRC B;  3CCQ Z;  1QVF Y;  2O53 A;  5A2Q b;  1YJW 1;  3VB9 A;  1Y1W I;  1KD1 2;  3CCS 1;  2NVT I;  2VPW A;  5T6B A;  3HOX I;  1Y1V S;  4A93 I;  1QYP A;  2NVQ I;  2QRE B;  3CCV 1;  2R6M A;  4QTT A;  2Y0S A;  3T4N B;  1RO0 A;  4XX2 A;  4RVF A;  3D6W A;  1VQ9 Z;  2OTJ 1;  4Y7N I;  1K9M 2;  1VQ5 1;  2OTL 1;  1VQO Z;  5AN9 F;  1RO4 A;  2QRD B;  3CXC Y;  1YI2 Z;  5T67 A;  1N8R 1;  2IZ4 A;  2VPZ A;  1QVF Z;  4EWC A;  4A3B I;  2QA4 1;  2JMO A;  2PM9 A;  3VMI A;  4E31 A;  1NJI 1;  4MON A;  1YHQ Z;  1WZN A;  4RVD A;  1WII A;  3HOV I;  1Q82 1;  1VQ8 Z;  1S72 Z;  4RVG A;  4NBG A;  1M90 2;  1ZB8 A;  4E2Z A;  3GTG I;  1K73 2;  1YJ9 1;  2E2I I;  3OW2 Y;  3S15 I;  2AKL A;  2F4M A;  2IZ3 A;  5C44 I;  4NBC A;  2NVX I;  2LEX A;  3IX0 A;  5D1O A;  3G4S 1;  1Z03 A;  3MON A;  3CPW Y;  3JAM f;  3CXC Z;  5D1P A;  1X3W A;  1ZH1 A;  3S1N I;  3CCS Z;  2GTI A;  3KIF A;  3CCJ 1;  1YIJ 1;  4A3E I;  1KQS Y;  1VQ4 1;  1Q86 1;  4HGY A;  3S1R I;  1Q7Y 1;  1TWA I;  1VQM Z;  4NBA A;  2P3Y A;  4MD9 A;  4A3I I;  2OTJ Z;  3OW2 Z;  1W2B Y;  1VQ7 1;  2JNY A;  4NBF A;  3S1M I;  4DGL A;  2LFU A;  3CCR 1;  3HOW I;  3PO3 I;  2JIR A;  4NOZ A;  1NJI 2;  1WJ2 A;  2VPY A;  2RIQ A;  1Q82 2;  3GTM I;  1K8A 2;  4NBD A;  1Z02 A;  1TWC I;  3CC2 1;  2W04 A;  1TWF I;  1YJ9 Z;  5A2Q f;  2KPI A;  3J81 f;  3BG1 B;  3NH5 A;  1M1K 1;  4DQY B;  1YUK A;  3TE5 B;  1KC8 1;  5C4J I;  3FQQ A;  3PO3 S;  2V45 A;  2QEX Z;  2B63 I;  4QTU A;  2OZK A;  1Q81 1;  3GTM S;  3U50 C;  2Q4Z A;  3CD6 Z;  3CCJ Z;  2M48 A;  3KIH A;  1FDI A;  2H85 A;  3GCF A;  1YIT 1;  1YUA A;  1VQ4 Z;  4NB9 A;  3I56 1;  3CCL 1;  4S1T A;  4NBB A;  1VQL Z;  4HH4 A;  4NBH A;  3IFU A;  5C3E I;  1LQL A;  4MD7 A;  1VQ7 Z;  3H0G I;  4NB8 A;  3S2H I;  2G2K A;  2Q51 A;  3CCR Z;  3NDI A;  2DE7 A;  3S1Q I;  4TNU A;  3CC7 1;  3Q87 A;  3IF8 A;  3HOY I;  3CC2 Z;  3ESW A;  2VUM I;  2KI7 B;  4MD8 A;  1X0T A;  3J80 f;  2JIM A;  2IV2 X;  1I50 I;  3MZK B;  3CCU 1;  3G6E 1;  1USP A;  5IP9 I;  2W03 A;  3CME 1;  2YU9 I;  1JJ2 Y;  3GTJ I;  2GTH A;  2E9H A;  1KC8 2;  2QR1 B;  4RS4 A;  5FLX b;  1KRL A;  3EED A;  2E2J I;  4MH4 A;  1Z01 A;  3I4N I;  3F3P C;  2JA5 I;  4AYB A;  3I55 1;  2BJO A;  1YJW Z;  4CL1 A;  3EER A;  3CCL Z;  3I56 Z;  4BY1 I;  3VMG A;  4E33 A;  5IP7 I;  1ML8 A;  3FQM A;  4E2W A;  4RVH A;  3GTP I;  3CCV Z;  1WCM I;  1RQF A;  1NP6 A;  4E30 A;  3CMA 1;  5LL6 f;  2QKD A;  1SIW A;  2VPX A;  4E2X A;  4A3J I;  1VQ5 Z;  2OTL Z;  3G71 1;  5C4X I;  3QWU A;  1PFT A;  1N8R 2;  1N2F A;  3GKQ A;  5IT9 f;  1VQ6 1;  3I07 A;  3CPW Z;  2QA4 Z;  2JR6 A;  3P5J B;  3G6E Z;  3GTQ I;  4MXU A;  2EGT A;  1KD1 1;  3CME Z;  1KQS Z;  3MZL B;  1P9N A;  2K5R A;  2JS4 A;  1K83 I;  2DE5 A;  3CC4 1;  4HGZ A;  4MRI A;  5T64 A;  3HOZ I;  1VQ9 1;  1WW9 A;  1W2B Z;  2JIQ A;  1K9M 1;  3G4S Z;  2M6N A;  3NDJ A;  1VQO 1;  3M3Y I;  1QXF A;  2WB1 A;  2VF1 A;  2PMZ A;  1I6H I;  3H3V J;  4NH1 C;  2YAD A;  1YIJ Z;  4A3G I;  3F3F C;  2LIY A;  1SFO I;  2JA6 I;  1Q86 2;  3CMA Z;  2JIP A;  4RV9 A;  3GTO I;  1Q7Y 2;  1M90 1;  3GTL I;  3J7A 4;  1K73 1;  3CCE 1;  2HF1 A;  3G71 Z;  2RPR A;  3NH8 A;  1USP B;  1YJN 1;  1VLA A;  1VQ6 Z;  3FKI I;  3LUS A;  4BBS I;  4BXX I;  4NFR A;  2V8I A;  3S16 I;  5D1O B;  1VQP 1;  4A3K I;  5FLX f;  1TWG I;  2QLV B;  3TDH B;  3CC4 Z;  1VQM 1;  3HKZ A;  1M1K 2;  1RNI A;  2R93 I;  2I3C A;  4E2Y A;  2F4O A;  2OOY B;  4NBE A;  2JA8 I;  2E2H I;  4DK1 A;  2V8K A;  2K3R A;  4BBR I;  2RBL A;  2JA7 I;  2GU2 A;  1Q16 A;  1Q81 2;  2VUG A;  4BY7 I;  3IR7 A;  1VQK 1;  1L1O C;  1S7M A;  2NVY I;  2JUB A;  1YIT Z;  2R7Z I;  1K8A 1;  2O4H A;  3RZD I;  1TWH I;  3J80 b;  4X6A I;  3CCE Z;  4A3F I;  2R92 I;  5CM2 M;  1Y8C A;  1YJN Z;  1JJ2 Z;  2P28 A;  1VQN 1;  2V8J A;  2QEX 1;  3CCM 1;  3D2L A;  3K7A I;  2HU9 A;  2V3V A;  3CC7 Z;  3NFZ A;  1R9T I;  3CD6 1;  3RZO I;  3S2D I;  4A3D I;  2PK7 A;  1RO2 A;  1AA6 A;  3CCQ 1;  1NUI A;  1VQP Z;  1QVG Y;  1DL6 A;  3JAM b;  2J6A A;  3CCU Z;  2RHB A;  1VQL 1;  3I4M I;  4A3M I;  1QF8 A;  2OOX B;  2WAQ A;  2NAP A;  1TFI A;  1FDO A;  4A3C I;  3HOU I;  3VMH A;  1VQK Z;  2DE6 A;  1X3Z A;  2RT9 A;  2ZAE B;  3I55 Z;  3M4O I;  5FLM I;  4E32 A;  1YI2 1;  3S14 I;  1JWH C;  2JIO A;  5IT9 b;  3NH4 A;  1QVG Z;  1ZB9 A;  1RLY A;  1YHQ 1;  3PO2 I;  1VQ8 1;  1S72 1;  1VQN Z;  1I3Q I;  1Y1V I;  3CQZ I;  2E7Z A;  4A3L I;  3VTN A;  3CCM Z;  3J81 b;  2AYD A; 
#chains in the Genus database with same CATH homology
 3BG0 B;  4Y52 I;  3D9X A;  3S17 I;  3GTK I;  2QRC B;  3CCQ Z;  1QVF Y;  2O53 A;  5A2Q b;  1YJW 1;  3VB9 A;  1Y1W I;  1KD1 2;  3CCS 1;  2NVT I;  5T6B A;  3HOX I;  1Y1V S;  4A93 I;  1QYP A;  2NVQ I;  2QRE B;  3CCV 1;  2R6M A;  4QTT A;  2Y0S A;  3T4N B;  1RO0 A;  4XX2 A;  4RVF A;  3D6W A;  1VQ9 Z;  2OTJ 1;  4Y7N I;  1K9M 2;  1VQ5 1;  2OTL 1;  1VQO Z;  5AN9 F;  1RO4 A;  2QRD B;  3CXC Y;  1YI2 Z;  5T67 A;  1N8R 1;  2IZ4 A;  1QVF Z;  4EWC A;  4A3B I;  2QA4 1;  2JMO A;  2PM9 A;  3VMI A;  4E31 A;  1NJI 1;  4MON A;  1YHQ Z;  3HOV I;  4RVD A;  1WII A;  1Q82 1;  1VQ8 Z;  1S72 Z;  4RVG A;  4NBG A;  1M90 2;  1ZB8 A;  4E2Z A;  3GTG I;  1K73 2;  1YJ9 1;  2E2I I;  3OW2 Y;  3S15 I;  2AKL A;  2F4M A;  2IZ3 A;  5C44 I;  4NBC A;  2NVX I;  3IX0 A;  5D1O A;  3G4S 1;  1Z03 A;  3MON A;  3CPW Y;  3JAM f;  3CXC Z;  5D1P A;  1X3W A;  1ZH1 A;  3S1N I;  3CCS Z;  2GTI A;  3KIF A;  3CCJ 1;  1YIJ 1;  4A3E I;  1KQS Y;  1VQ4 1;  1Q86 1;  4HGY A;  3S1R I;  1Q7Y 1;  1VQM Z;  1TWA I;  4NBA A;  2P3Y A;  4MD9 A;  4A3I I;  2OTJ Z;  3OW2 Z;  1W2B Y;  1VQ7 1;  2JNY A;  4NBF A;  3S1M I;  4DGL A;  2LFU A;  3CCR 1;  3HOW I;  3PO3 I;  4NOZ A;  1NJI 2;  2RIQ A;  1Q82 2;  3GTM I;  1K8A 2;  4NBD A;  1Z02 A;  1TWC I;  3CC2 1;  2W04 A;  1TWF I;  1YJ9 Z;  5A2Q f;  2KPI A;  3J81 f;  3BG1 B;  3NH5 A;  1M1K 1;  4DQY B;  1YUK A;  3TE5 B;  1KC8 1;  5C4J I;  3FQQ A;  3PO3 S;  2QEX Z;  2B63 I;  4QTU A;  2OZK A;  1Q81 1;  3GTM S;  3U50 C;  2Q4Z A;  3CD6 Z;  3CCJ Z;  2M48 A;  3KIH A;  2H85 A;  3GCF A;  1YIT 1;  1YUA A;  1VQ4 Z;  4NB9 A;  3I56 1;  3CCL 1;  4S1T A;  4NBB A;  1VQL Z;  4HH4 A;  4NBH A;  3IFU A;  5C3E I;  1LQL A;  4MD7 A;  1VQ7 Z;  3H0G I;  4NB8 A;  3S2H I;  2G2K A;  2Q51 A;  3CCR Z;  3NDI A;  2DE7 A;  3S1Q I;  4TNU A;  3CC7 1;  3Q87 A;  3IF8 A;  3HOY I;  3CC2 Z;  3ESW A;  2VUM I;  2KI7 B;  4MD8 A;  1X0T A;  3J80 f;  1I50 I;  3MZK B;  3CCU 1;  3G6E 1;  1USP A;  5IP9 I;  2W03 A;  3CME 1;  2YU9 I;  1JJ2 Y;  3GTJ I;  2GTH A;  2E9H A;  1KC8 2;  2QR1 B;  4RS4 A;  5FLX b;  1KRL A;  3EED A;  2E2J I;  4MH4 A;  1Z01 A;  3I4N I;  3F3P C;  2JA5 I;  4AYB A;  3I55 1;  2BJO A;  1YJW Z;  4CL1 A;  3EER A;  3CCL Z;  3I56 Z;  4BY1 I;  3VMG A;  4E33 A;  5IP7 I;  1ML8 A;  3FQM A;  4E2W A;  4RVH A;  3GTP I;  3CCV Z;  1WCM I;  1RQF A;  1NP6 A;  4E30 A;  3CMA 1;  5LL6 f;  2QKD A;  4E2X A;  4A3J I;  1VQ5 Z;  2OTL Z;  3G71 1;  5C4X I;  3QWU A;  1PFT A;  1N8R 2;  1N2F A;  3GKQ A;  5IT9 f;  1VQ6 1;  3I07 A;  3CPW Z;  2QA4 Z;  2JR6 A;  3P5J B;  3G6E Z;  3GTQ I;  4MXU A;  2EGT A;  1KD1 1;  3CME Z;  1KQS Z;  3MZL B;  1P9N A;  2K5R A;  2JS4 A;  1K83 I;  2DE5 A;  3CC4 1;  4HGZ A;  4MRI A;  5T64 A;  3HOZ I;  1VQ9 1;  1WW9 A;  1W2B Z;  1K9M 1;  3G4S Z;  2M6N A;  3NDJ A;  1VQO 1;  3M3Y I;  2WB1 A;  2VF1 A;  2PMZ A;  1I6H I;  3H3V J;  4NH1 C;  2YAD A;  1YIJ Z;  4A3G I;  3F3F C;  2LIY A;  1SFO I;  2JA6 I;  1Q86 2;  3CMA Z;  4RV9 A;  3GTO I;  1Q7Y 2;  1M90 1;  3GTL I;  3J7A 4;  1K73 1;  3CCE 1;  2HF1 A;  3G71 Z;  2RPR A;  3NH8 A;  1USP B;  1YJN 1;  1VLA A;  1VQ6 Z;  3FKI I;  3LUS A;  4BBS I;  4BXX I;  4NFR A;  2V8I A;  3S16 I;  5D1O B;  1VQP 1;  4A3K I;  5FLX f;  1TWG I;  2QLV B;  3TDH B;  3CC4 Z;  1VQM 1;  3HKZ A;  1M1K 2;  1RNI A;  2R93 I;  2I3C A;  4E2Y A;  2F4O A;  2OOY B;  4NBE A;  2JA8 I;  2E2H I;  4DK1 A;  2V8K A;  2K3R A;  4BBR I;  2RBL A;  2JA7 I;  2GU2 A;  1Q81 2;  2VUG A;  4BY7 I;  1VQK 1;  1L1O C;  1S7M A;  2NVY I;  2JUB A;  1YIT Z;  2R7Z I;  1K8A 1;  2O4H A;  3RZD I;  1TWH I;  3J80 b;  4X6A I;  3CCE Z;  4A3F I;  2R92 I;  5CM2 M;  1YJN Z;  1JJ2 Z;  2P28 A;  1VQN 1;  2V8J A;  2QEX 1;  3CCM 1;  1R9T I;  3K7A I;  2HU9 A;  3CC7 Z;  3RZO I;  3NFZ A;  3CD6 1;  3S2D I;  4A3D I;  2PK7 A;  1RO2 A;  3CCQ 1;  1NUI A;  1VQP Z;  1QVG Y;  1DL6 A;  3JAM b;  2J6A A;  3CCU Z;  2RHB A;  1VQL 1;  3I4M I;  4A3M I;  1QF8 A;  2OOX B;  2WAQ A;  1TFI A;  4A3C I;  3HOU I;  3VMH A;  1VQK Z;  2DE6 A;  1X3Z A;  2RT9 A;  2ZAE B;  3I55 Z;  3M4O I;  5FLM I;  4E32 A;  1YI2 1;  3S14 I;  1JWH C;  5IT9 b;  3NH4 A;  1QVG Z;  1ZB9 A;  1RLY A;  1YHQ 1;  3PO2 I;  1VQ8 1;  1S72 1;  1VQN Z;  1I3Q I;  1Y1V I;  3CQZ I;  4A3L I;  3VTN A;  3CCM Z;  3J81 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...