1YIJ1

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yij100
3CCMZ 3G711 1VQPZ 1VQMZ 1Q7Y2 1VQ41 1YI21 1Q812 1KD12 1QVGY 3CME1 1JJ2Z 1VQ5Z 1Q811 1KD11 1QVFY 3CC21 1Q822 3CC41 1K8A2 3OW2Z 1M901 3CD6Z 3G4S1 2OTJZ 3I561 1K8A1 3CXCY 1VQLZ 1YHQ1 1VQ8Z 3CCQ1 2OTLZ 3I551 1Q861 1VQK1 3G6E1 1S72Z 3CC71 1M1K2 1VQO1 1VQ7Z 1Q7Y1 3CMA1 3CCM1 1VQP1 1VQM1 1S721 1VQ9Z 1Q821 1YJ9Z 3CCJZ 1YITZ 1VQ51 1QVGZ 1YJNZ 3CCUZ 3CCLZ 1NJI2 1KQSZ 3CCEZ 1K732 1VQ91 3CD61 2OTJ1 1NJI1 2QEXZ 3CCRZ 1YIJZ 1N8R2 1VQ6Z 1KC82 3CXCZ 3CPWY 1YJWZ 1VQL1 1VQ81 1W2BY 1VQNZ 3CCSZ 3CCVZ 1M1K1 2OTL1 3G71Z 2QA4Z 1VQ71 1VQ4Z 1YI2Z 1JJ2Y 3CMEZ 3CC2Z 1QVFZ 2QA41 3OW2Y 3CC4Z 1YJ91 3CCJ1 3G4SZ 1K731 3I56Z 1K9M2 1YIT1 1YJN1 3CCU1 1K9M1 3CCL1 1N8R1 1KC81 1KQSY 1YHQZ 1M902 3CCE1 3CCQZ 2QEX1 3CCR1 3I55Z 1YIJ1 1VQ61 1YJW1 1VQKZ 3G6EZ 3CPWZ 3CC7Z 1VQN1 1VQOZ 3CCS1 1W2BZ 1Q862 3CCV1 3CMAZ
chains in the Genus database with same CATH superfamily
2G2KA 3CCMZ 3I07A 3HOZI 2NVTI 4NB9A 1JJ2Z 3GTKI 1Q16A 1QVFY 4DK1A 1Z03A 3IFUA 1N2FA 1Q822 2DE6A 1K8A2 3D2LA 2GU2A 1I50I 1PFTA 3NFZA 3I561 4A3II 1K8A1 1DL6A 1NUIA 3JAMb 1YHQ1 2JIPA 1WJ2A 1RO4A 5IP9I 3I551 1Q861 1WW9A 1S7MA 2JA7I 2VF1A 3F3FC 3CMA1 2VPZA 2R6MA 2AYDA 3NH8A 3S2DI 3M3YI 3JAMf 4BXXI 1YITZ 1VQ51 3CCUZ 3LUSA 3CCLZ 3S1MI 3MZLB 1KQSZ 3BG0B 1VLAA 3FKII 1VQ6Z 4A3CI 1VQL1 5C44I 3IX0A 1W2BY 2WB1A 4MD8A 4BBSI 4HH4A 3IF8A 2QA4Z 4MRIA 2RBLA 2JMOA 3PO3S 4Y7NI 1JJ2Y 2LFUA 3CC2Z 1QVFZ 4A3BI 2F4OA 2QA41 3CC4Z 3NH5A 1P9NA 1K731 3S16I 5FLXb 2OOYB 2JUBA 1KC81 1M902 3S1RI 1K83I 3CCR1 4E2WA 3GCFA 4NBGA 4E30A 1YIJ1 3G6EZ 1QF8A 2HU9A 5LL6f 3CCS1 1RLYA 3QWUA 4E2YA 1ML8A 2VPWA 5FLXf 3G711 1VQPZ 2Y0SA 3MZKB 2M48A 3J80b 1VQMZ 4A3FI 1Q7Y2 1VQ41 2QRDB 2V8JA 5C3EI 3J81f 1Q812 1KD12 2B63I 3HKZA 1TWGI 2P3YA 1Q811 1KD11 3FQMA 2KPIA 2JA5I 5T6BA 3CD6Z 3NH4A 3G4S1 2OTJZ 1WCMI 2V45A 2HF1A 3CQZI 4NBBA 3I4NI 2F4MA 2NAPA 1VQ8Z 2QREB 3J80f 3VMIA 4E2ZA 2E9HA 4HGYA 1AA6A 2JS4A 2JIOA 1VQK1 3CC71 1M1K2 1JWHC 4RVHA 1VQ7Z 3D6WA 3CCM1 1RNIA 3VTNA 1Q821 3VB9A 4MH4A 1RO0A 3MONA 3HOVI 2E2HI 1YJNZ 4NH1C 2RPRA 4DQYB 2V3VA 2K5RA 2JA6I 3H3VJ 2QEXZ 4NBAA 3CXCZ 1NP6A 1YJWZ 1VQNZ 3H0GI 3CCVZ 2LIYA 2OOXB 3RZOI 1TWCI 5IT9b 1YI2Z 2JR6A 2IV2X 3GTQI 3CMEZ 1TWFI 2O4HA 3GTLI 4RV9A 3NDIA 2K3RA 3S2HI 1YIT1 3S17I 4A3MI 3Q87A 3P5JB 3CCU1 3CCL1 5D1PA 1X0TA 3CCQZ 4XX2A 3D9XA 5D1OB 1VQ61 1SIWA 1X3ZA 1KRLA 2PMZA 3CPWZ 4E32A 1FDIA 1VQOZ 4NBCA 4A3JI 2QLVB 1YUKA 4EWCA 2R92I 2BJOA 1Z02A 2W04A 4DGLA 3CC21 1FDOA 3K7AI 3CC41 2IZ3A 1M901 1I6HI 2RT9A 3CXCY 2JIMA 3HOYI 3GTPI 5A2Qb 4NBHA 1TWHI 5C4XI 2OTLZ 1TWAI 2IZ4A 4NOZA 1Y1VS 2P28A 3M4OI 3G6E1 2PK7A 2NVYI 5D1OA 1Y1VI 3S15I 4BY1I 1Q7Y1 1QYPA 3GTJI 3VMGA 1VQP1 4HGZA 2E2II 1VQM1 1VQ9Z 1YJ9Z 4E33A 3CCJZ 4NB8A 5A2Qf 3GTMS 1QVGZ 2RIQA 1R9TI 2RHBA 2PM9A 1Z01A 4RVFA 3GTMI 2QKDA 3CCEZ 1L1OC 1VQ91 3HOWI 3CD61 2OTJ1 2V8KA 3HOUI 3S1NI 1N8R2 2ZAEB 3CPWY 2YADA 2QR1B 1VQ81 4RVDA 1M1K1 2VPYA 4A3KI 2YU9I 4E2XA 4NBDA 3GKQA 1VQ71 4CL1A 2AKLA 2KI7B 2GTHA 3TE5B 1USPB 3I56Z 1Y8CA 1YJN1 1YHQZ 3VMHA 4A3EI 3KIHA 5T64A 2QEX1 3I55Z 3FQQA 1RO2A 1YJW1 3U50C 1LQLA 1ZH1A 2O53A 2LEXA 4QTUA 4E31A 1VQN1 1Q862 3CCV1 5IP7I 4NFRA 3CMAZ 5AN9F 2OZKA 3HOXI 4A93I 2NVXI 3KIFA 1YI21 2M6NA 4NBEA 1QVGY 3CME1 3S14I 1VQ5Z 1ZB9A 2JIRA 4NBFA 2VPXA 1TFIA 3OW2Z 3BG1B 5IT9f 3TDHB 2V8IA 1VQLZ 2VUMI 3CCQ1 1ZB8A 1X3WA 2Q51A 3S1QI 1WZNA 1USPA 3RZDI 2VUGA 3ESWA 3I4MI 1S72Z 4TNUA 2J6AA 1VQO1 3F3PC 4X6AI 2H85A 4RS4A 4MD7A 2I3CA 1S721 4MXUA 4Y52I 2QRCB 4MONA 1SFOI 3PO3I 2E2JI 1NJI2 3J7A4 1K732 4AYBA 1NJI1 3CCRZ 2R93I 1QXFA 1YIJZ 4BBRI 1KC82 1WIIA 4BY7I 3J81b 1RQFA 3CCSZ 2OTL1 4A3DI 2JNYA 2DE5A 5FLMI 2R7ZI 3IR7A 1YUAA 3G71Z 4A3GI 2NVQI 1VQ4Z 4S1TA 2GTIA 2WAQA 1Y1WI 4A3LI 5C4JI 5T67A 3OW2Y 2E7ZA 1YJ91 1I3QI 3CCJ1 3GTOI 3G4SZ 2DE7A 1K9M2 2W03A 1K9M1 1N8R1 3GTGI 2Q4ZA 1KQSY 3CCE1 3EEDA 4RVGA 1VQKZ 3NDJA 3EERA 4MD9A 3PO2I 2EGTA 2JIQA 3CC7Z 4QTTA 5CM2M 1W2BZ 3T4NB 2JA8I
chains in the Genus database with same CATH topology
2G2KA 3CCMZ 3I07A 3HOZI 2NVTI 4NB9A 1JJ2Z 3GTKI 1QVFY 4DK1A 1Z03A 3IFUA 1N2FA 1Q822 2DE6A 1K8A2 2GU2A 1I50I 1PFTA 3NFZA 3I561 4A3II 1K8A1 1DL6A 1NUIA 3JAMb 1YHQ1 1RO4A 5IP9I 3I551 1Q861 1WW9A 1S7MA 2JA7I 2VF1A 3F3FC 3CMA1 2R6MA 3NH8A 3S2DI 3M3YI 3JAMf 4BXXI 1YITZ 1VQ51 3CCUZ 3LUSA 3CCLZ 3S1MI 3MZLB 1KQSZ 3BG0B 1VLAA 3FKII 1VQ6Z 4A3CI 1VQL1 5C44I 3IX0A 1W2BY 2WB1A 4MD8A 4BBSI 4HH4A 3IF8A 2QA4Z 4MRIA 2RBLA 2JMOA 3PO3S 4Y7NI 1JJ2Y 2LFUA 3CC2Z 1QVFZ 4A3BI 2F4OA 2QA41 3CC4Z 3NH5A 1P9NA 1K731 3S16I 5FLXb 2OOYB 2JUBA 1KC81 1M902 3S1RI 1K83I 3CCR1 4E2WA 3GCFA 4NBGA 4E30A 1YIJ1 3G6EZ 1QF8A 2HU9A 5LL6f 3CCS1 1RLYA 3QWUA 4E2YA 1ML8A 5FLXf 3G711 1VQPZ 2Y0SA 3MZKB 2M48A 3J80b 1VQMZ 4A3FI 1Q7Y2 1VQ41 2QRDB 2V8JA 5C3EI 3J81f 1Q812 1KD12 2B63I 3HKZA 1TWGI 2P3YA 1Q811 1KD11 3FQMA 2KPIA 2JA5I 5T6BA 3CD6Z 3NH4A 3G4S1 2OTJZ 1WCMI 2HF1A 3CQZI 4NBBA 3I4NI 2F4MA 1VQ8Z 2QREB 3J80f 3VMIA 4E2ZA 2E9HA 4HGYA 2JS4A 1VQK1 3CC71 1M1K2 1JWHC 4RVHA 1VQ7Z 3D6WA 3CCM1 1RNIA 3VTNA 1Q821 3VB9A 4MH4A 1RO0A 3MONA 3HOVI 2E2HI 1YJNZ 4NH1C 2RPRA 4DQYB 2K5RA 2JA6I 3H3VJ 2QEXZ 4NBAA 3CXCZ 1NP6A 1YJWZ 1VQNZ 3H0GI 3CCVZ 2LIYA 2OOXB 3RZOI 1TWCI 5IT9b 1YI2Z 2JR6A 3GTQI 3CMEZ 1TWFI 2O4HA 3GTLI 4RV9A 3NDIA 2K3RA 3S2HI 1YIT1 3S17I 4A3MI 3Q87A 3P5JB 3CCU1 3CCL1 5D1PA 1X0TA 3CCQZ 4XX2A 3D9XA 5D1OB 1VQ61 1X3ZA 1KRLA 2PMZA 3CPWZ 4E32A 1VQOZ 4NBCA 4A3JI 2QLVB 1YUKA 4EWCA 2R92I 2BJOA 1Z02A 2W04A 4DGLA 3CC21 3K7AI 3CC41 2IZ3A 1M901 1I6HI 2RT9A 3CXCY 3HOYI 3GTPI 5A2Qb 4NBHA 1TWHI 5C4XI 2OTLZ 1TWAI 2IZ4A 4NOZA 1Y1VS 2P28A 3M4OI 3G6E1 2PK7A 2NVYI 5D1OA 1Y1VI 3S15I 4BY1I 1Q7Y1 1QYPA 3GTJI 3VMGA 1VQP1 4HGZA 2E2II 1VQM1 1VQ9Z 1YJ9Z 4E33A 3CCJZ 4NB8A 5A2Qf 3GTMS 1QVGZ 2RIQA 1R9TI 2RHBA 2PM9A 1Z01A 4RVFA 3GTMI 2QKDA 3CCEZ 1L1OC 1VQ91 3HOWI 3CD61 2OTJ1 2V8KA 3HOUI 3S1NI 1N8R2 2ZAEB 3CPWY 2YADA 2QR1B 1VQ81 4RVDA 1M1K1 4A3KI 2YU9I 4E2XA 4NBDA 3GKQA 1VQ71 4CL1A 2AKLA 2KI7B 2GTHA 3TE5B 1USPB 3I56Z 1YJN1 1YHQZ 3VMHA 4A3EI 3KIHA 5T64A 2QEX1 3I55Z 3FQQA 1RO2A 1YJW1 3U50C 1LQLA 1ZH1A 2O53A 4QTUA 4E31A 1VQN1 1Q862 3CCV1 5IP7I 4NFRA 3CMAZ 5AN9F 2OZKA 3HOXI 4A93I 2NVXI 3KIFA 1YI21 2M6NA 4NBEA 1QVGY 3CME1 3S14I 1VQ5Z 1ZB9A 4NBFA 1TFIA 3OW2Z 3BG1B 5IT9f 3TDHB 2V8IA 1VQLZ 2VUMI 3CCQ1 1ZB8A 1X3WA 2Q51A 3S1QI 1USPA 3RZDI 2VUGA 3ESWA 3I4MI 1S72Z 4TNUA 2J6AA 1VQO1 3F3PC 4X6AI 2H85A 4RS4A 4MD7A 2I3CA 1S721 4MXUA 4Y52I 2QRCB 4MONA 1SFOI 3PO3I 2E2JI 1NJI2 3J7A4 1K732 4AYBA 1NJI1 3CCRZ 2R93I 1YIJZ 4BBRI 1KC82 1WIIA 4BY7I 3J81b 1RQFA 3CCSZ 2OTL1 4A3DI 2JNYA 2DE5A 5FLMI 2R7ZI 1YUAA 3G71Z 4A3GI 2NVQI 1VQ4Z 4S1TA 2GTIA 2WAQA 1Y1WI 4A3LI 5C4JI 5T67A 3OW2Y 1YJ91 1I3QI 3CCJ1 3GTOI 3G4SZ 2DE7A 1K9M2 2W03A 1K9M1 1N8R1 3GTGI 2Q4ZA 1KQSY 3CCE1 3EEDA 4RVGA 1VQKZ 3NDJA 3EERA 4MD9A 3PO2I 3CC7Z 2EGTA 4QTTA 5CM2M 1W2BZ 3T4NB 2JA8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM Z;  3G71 1;  1VQP Z;  1VQM Z;  1Q7Y 2;  1VQ4 1;  1YI2 1;  1Q81 2;  1KD1 2;  1QVG Y;  3CME 1;  1JJ2 Z;  1VQ5 Z;  1Q81 1;  1KD1 1;  1QVF Y;  3CC2 1;  1Q82 2;  3CC4 1;  1K8A 2;  3OW2 Z;  1M90 1;  3CD6 Z;  3G4S 1;  2OTJ Z;  3I56 1;  1K8A 1;  3CXC Y;  1VQL Z;  1YHQ 1;  1VQ8 Z;  3CCQ 1;  2OTL Z;  3I55 1;  1Q86 1;  1VQK 1;  3G6E 1;  1S72 Z;  3CC7 1;  1M1K 2;  1VQO 1;  1VQ7 Z;  1Q7Y 1;  3CMA 1;  3CCM 1;  1VQP 1;  1VQM 1;  1S72 1;  1VQ9 Z;  1Q82 1;  1YJ9 Z;  3CCJ Z;  1YIT Z;  1VQ5 1;  1QVG Z;  1YJN Z;  3CCU Z;  3CCL Z;  1NJI 2;  1KQS Z;  3CCE Z;  1K73 2;  1VQ9 1;  3CD6 1;  2OTJ 1;  1NJI 1;  2QEX Z;  3CCR Z;  1YIJ Z;  1N8R 2;  1VQ6 Z;  1KC8 2;  3CXC Z;  3CPW Y;  1YJW Z;  1VQL 1;  1VQ8 1;  1W2B Y;  1VQN Z;  3CCS Z;  3CCV Z;  1M1K 1;  2OTL 1;  3G71 Z;  2QA4 Z;  1VQ7 1;  1VQ4 Z;  1YI2 Z;  1JJ2 Y;  3CME Z;  3CC2 Z;  1QVF Z;  2QA4 1;  3OW2 Y;  3CC4 Z;  1YJ9 1;  3CCJ 1;  3G4S Z;  1K73 1;  3I56 Z;  1K9M 2;  1YIT 1;  1YJN 1;  3CCU 1;  1K9M 1;  3CCL 1;  1N8R 1;  1KC8 1;  1KQS Y;  1YHQ Z;  1M90 2;  3CCE 1;  3CCQ Z;  2QEX 1;  3CCR 1;  3I55 Z;  1YIJ 1;  1VQ6 1;  1YJW 1;  1VQK Z;  3G6E Z;  3CPW Z;  3CC7 Z;  1VQN 1;  1VQO Z;  3CCS 1;  1W2B Z;  1Q86 2;  3CCV 1;  3CMA Z; 
#chains in the Genus database with same CATH topology
 2G2K A;  3CCM Z;  3I07 A;  3HOZ I;  2NVT I;  4NB9 A;  1JJ2 Z;  3GTK I;  1Q16 A;  1QVF Y;  4DK1 A;  1Z03 A;  3IFU A;  1N2F A;  1Q82 2;  2DE6 A;  1K8A 2;  3D2L A;  2GU2 A;  1I50 I;  1PFT A;  3NFZ A;  3I56 1;  4A3I I;  1K8A 1;  1DL6 A;  1NUI A;  3JAM b;  1YHQ 1;  2JIP A;  1WJ2 A;  1RO4 A;  5IP9 I;  3I55 1;  1Q86 1;  1WW9 A;  1S7M A;  2JA7 I;  2VF1 A;  3F3F C;  3CMA 1;  2VPZ A;  2R6M A;  2AYD A;  3NH8 A;  3S2D I;  3M3Y I;  3JAM f;  4BXX I;  1YIT Z;  1VQ5 1;  3CCU Z;  3LUS A;  3CCL Z;  3S1M I;  3MZL B;  1KQS Z;  3BG0 B;  1VLA A;  3FKI I;  1VQ6 Z;  4A3C I;  1VQL 1;  5C44 I;  3IX0 A;  1W2B Y;  2WB1 A;  4MD8 A;  4BBS I;  4HH4 A;  3IF8 A;  2QA4 Z;  4MRI A;  2RBL A;  2JMO A;  3PO3 S;  4Y7N I;  1JJ2 Y;  2LFU A;  3CC2 Z;  1QVF Z;  4A3B I;  2F4O A;  2QA4 1;  3CC4 Z;  3NH5 A;  1P9N A;  1K73 1;  3S16 I;  5FLX b;  2OOY B;  2JUB A;  1KC8 1;  1M90 2;  3S1R I;  1K83 I;  3CCR 1;  4E2W A;  3GCF A;  4NBG A;  4E30 A;  1YIJ 1;  3G6E Z;  1QF8 A;  2HU9 A;  5LL6 f;  3CCS 1;  1RLY A;  3QWU A;  4E2Y A;  1ML8 A;  2VPW A;  5FLX f;  3G71 1;  1VQP Z;  2Y0S A;  3MZK B;  2M48 A;  3J80 b;  1VQM Z;  4A3F I;  1Q7Y 2;  1VQ4 1;  2QRD B;  2V8J A;  5C3E I;  3J81 f;  1Q81 2;  1KD1 2;  2B63 I;  3HKZ A;  1TWG I;  2P3Y A;  1Q81 1;  1KD1 1;  3FQM A;  2KPI A;  2JA5 I;  5T6B A;  3CD6 Z;  3NH4 A;  3G4S 1;  2OTJ Z;  1WCM I;  2V45 A;  2HF1 A;  3CQZ I;  4NBB A;  3I4N I;  2F4M A;  2NAP A;  1VQ8 Z;  2QRE B;  3J80 f;  3VMI A;  4E2Z A;  2E9H A;  4HGY A;  1AA6 A;  2JS4 A;  2JIO A;  1VQK 1;  3CC7 1;  1M1K 2;  1JWH C;  4RVH A;  1VQ7 Z;  3D6W A;  3CCM 1;  1RNI A;  3VTN A;  1Q82 1;  3VB9 A;  4MH4 A;  1RO0 A;  3MON A;  3HOV I;  2E2H I;  1YJN Z;  4NH1 C;  2RPR A;  4DQY B;  2V3V A;  2K5R A;  2JA6 I;  3H3V J;  2QEX Z;  4NBA A;  3CXC Z;  1NP6 A;  1YJW Z;  1VQN Z;  3H0G I;  3CCV Z;  2LIY A;  2OOX B;  3RZO I;  1TWC I;  5IT9 b;  1YI2 Z;  2JR6 A;  2IV2 X;  3GTQ I;  3CME Z;  1TWF I;  2O4H A;  3GTL I;  4RV9 A;  3NDI A;  2K3R A;  3S2H I;  1YIT 1;  3S17 I;  4A3M I;  3Q87 A;  3P5J B;  3CCU 1;  3CCL 1;  5D1P A;  1X0T A;  3CCQ Z;  4XX2 A;  3D9X A;  5D1O B;  1VQ6 1;  1SIW A;  1X3Z A;  1KRL A;  2PMZ A;  3CPW Z;  4E32 A;  1FDI A;  1VQO Z;  4NBC A;  4A3J I;  2QLV B;  1YUK A;  4EWC A;  2R92 I;  2BJO A;  1Z02 A;  2W04 A;  4DGL A;  3CC2 1;  1FDO A;  3K7A I;  3CC4 1;  2IZ3 A;  1M90 1;  1I6H I;  2RT9 A;  3CXC Y;  2JIM A;  3HOY I;  3GTP I;  5A2Q b;  4NBH A;  1TWH I;  5C4X I;  2OTL Z;  1TWA I;  2IZ4 A;  4NOZ A;  1Y1V S;  2P28 A;  3M4O I;  3G6E 1;  2PK7 A;  2NVY I;  5D1O A;  1Y1V I;  3S15 I;  4BY1 I;  1Q7Y 1;  1QYP A;  3GTJ I;  3VMG A;  1VQP 1;  4HGZ A;  2E2I I;  1VQM 1;  1VQ9 Z;  1YJ9 Z;  4E33 A;  3CCJ Z;  4NB8 A;  5A2Q f;  3GTM S;  1QVG Z;  2RIQ A;  1R9T I;  2RHB A;  2PM9 A;  1Z01 A;  4RVF A;  3GTM I;  2QKD A;  3CCE Z;  1L1O C;  1VQ9 1;  3HOW I;  3CD6 1;  2OTJ 1;  2V8K A;  3HOU I;  3S1N I;  1N8R 2;  2ZAE B;  3CPW Y;  2YAD A;  2QR1 B;  1VQ8 1;  4RVD A;  1M1K 1;  2VPY A;  4A3K I;  2YU9 I;  4E2X A;  4NBD A;  3GKQ A;  1VQ7 1;  4CL1 A;  2AKL A;  2KI7 B;  2GTH A;  3TE5 B;  1USP B;  3I56 Z;  1Y8C A;  1YJN 1;  1YHQ Z;  3VMH A;  4A3E I;  3KIH A;  5T64 A;  2QEX 1;  3I55 Z;  3FQQ A;  1RO2 A;  1YJW 1;  3U50 C;  1LQL A;  1ZH1 A;  2O53 A;  2LEX A;  4QTU A;  4E31 A;  1VQN 1;  1Q86 2;  3CCV 1;  5IP7 I;  4NFR A;  3CMA Z;  5AN9 F;  2OZK A;  3HOX I;  4A93 I;  2NVX I;  3KIF A;  1YI2 1;  2M6N A;  4NBE A;  1QVG Y;  3CME 1;  3S14 I;  1VQ5 Z;  1ZB9 A;  2JIR A;  4NBF A;  2VPX A;  1TFI A;  3OW2 Z;  3BG1 B;  5IT9 f;  3TDH B;  2V8I A;  1VQL Z;  2VUM I;  3CCQ 1;  1ZB8 A;  1X3W A;  2Q51 A;  3S1Q I;  1WZN A;  1USP A;  3RZD I;  2VUG A;  3ESW A;  3I4M I;  1S72 Z;  4TNU A;  2J6A A;  1VQO 1;  3F3P C;  4X6A I;  2H85 A;  4RS4 A;  4MD7 A;  2I3C A;  1S72 1;  4MXU A;  4Y52 I;  2QRC B;  4MON A;  1SFO I;  3PO3 I;  2E2J I;  1NJI 2;  3J7A 4;  1K73 2;  4AYB A;  1NJI 1;  3CCR Z;  2R93 I;  1QXF A;  1YIJ Z;  4BBR I;  1KC8 2;  1WII A;  4BY7 I;  3J81 b;  1RQF A;  3CCS Z;  2OTL 1;  4A3D I;  2JNY A;  2DE5 A;  5FLM I;  2R7Z I;  3IR7 A;  1YUA A;  3G71 Z;  4A3G I;  2NVQ I;  1VQ4 Z;  4S1T A;  2GTI A;  2WAQ A;  1Y1W I;  4A3L I;  5C4J I;  5T67 A;  3OW2 Y;  2E7Z A;  1YJ9 1;  1I3Q I;  3CCJ 1;  3GTO I;  3G4S Z;  2DE7 A;  1K9M 2;  2W03 A;  1K9M 1;  1N8R 1;  3GTG I;  2Q4Z A;  1KQS Y;  3CCE 1;  3EED A;  4RVG A;  1VQK Z;  3NDJ A;  3EER A;  4MD9 A;  3PO2 I;  2EGT A;  2JIQ A;  3CC7 Z;  4QTT A;  5CM2 M;  1W2B Z;  3T4N B;  2JA8 I; 
#chains in the Genus database with same CATH homology
 2G2K A;  3CCM Z;  3I07 A;  3HOZ I;  2NVT I;  4NB9 A;  1JJ2 Z;  3GTK I;  1QVF Y;  4DK1 A;  1Z03 A;  3IFU A;  1N2F A;  1Q82 2;  2DE6 A;  1K8A 2;  2GU2 A;  1I50 I;  1PFT A;  3NFZ A;  3I56 1;  4A3I I;  1K8A 1;  1DL6 A;  1NUI A;  3JAM b;  1YHQ 1;  1RO4 A;  5IP9 I;  3I55 1;  1Q86 1;  1WW9 A;  1S7M A;  2JA7 I;  2VF1 A;  3F3F C;  3CMA 1;  2R6M A;  3NH8 A;  3S2D I;  3M3Y I;  3JAM f;  4BXX I;  1YIT Z;  1VQ5 1;  3CCU Z;  3LUS A;  3CCL Z;  3S1M I;  3MZL B;  1KQS Z;  3BG0 B;  1VLA A;  3FKI I;  1VQ6 Z;  4A3C I;  1VQL 1;  5C44 I;  3IX0 A;  1W2B Y;  2WB1 A;  4MD8 A;  4BBS I;  4HH4 A;  3IF8 A;  2QA4 Z;  4MRI A;  2RBL A;  2JMO A;  3PO3 S;  4Y7N I;  1JJ2 Y;  2LFU A;  3CC2 Z;  1QVF Z;  4A3B I;  2F4O A;  2QA4 1;  3CC4 Z;  3NH5 A;  1P9N A;  1K73 1;  3S16 I;  5FLX b;  2OOY B;  2JUB A;  1KC8 1;  1M90 2;  3S1R I;  1K83 I;  3CCR 1;  4E2W A;  3GCF A;  4NBG A;  4E30 A;  1YIJ 1;  3G6E Z;  1QF8 A;  2HU9 A;  5LL6 f;  3CCS 1;  1RLY A;  3QWU A;  4E2Y A;  1ML8 A;  5FLX f;  3G71 1;  1VQP Z;  2Y0S A;  3MZK B;  2M48 A;  3J80 b;  1VQM Z;  4A3F I;  1Q7Y 2;  1VQ4 1;  2QRD B;  2V8J A;  5C3E I;  3J81 f;  1Q81 2;  1KD1 2;  2B63 I;  3HKZ A;  1TWG I;  2P3Y A;  1Q81 1;  1KD1 1;  3FQM A;  2KPI A;  2JA5 I;  5T6B A;  3CD6 Z;  3NH4 A;  3G4S 1;  2OTJ Z;  1WCM I;  2HF1 A;  3CQZ I;  4NBB A;  3I4N I;  2F4M A;  1VQ8 Z;  2QRE B;  3J80 f;  3VMI A;  4E2Z A;  2E9H A;  4HGY A;  2JS4 A;  1VQK 1;  3CC7 1;  1M1K 2;  1JWH C;  4RVH A;  1VQ7 Z;  3D6W A;  3CCM 1;  1RNI A;  3VTN A;  1Q82 1;  3VB9 A;  4MH4 A;  1RO0 A;  3MON A;  3HOV I;  2E2H I;  1YJN Z;  4NH1 C;  2RPR A;  4DQY B;  2K5R A;  2JA6 I;  3H3V J;  2QEX Z;  4NBA A;  3CXC Z;  1NP6 A;  1YJW Z;  1VQN Z;  3H0G I;  3CCV Z;  2LIY A;  2OOX B;  3RZO I;  1TWC I;  5IT9 b;  1YI2 Z;  2JR6 A;  3GTQ I;  3CME Z;  1TWF I;  2O4H A;  3GTL I;  4RV9 A;  3NDI A;  2K3R A;  3S2H I;  1YIT 1;  3S17 I;  4A3M I;  3Q87 A;  3P5J B;  3CCU 1;  3CCL 1;  5D1P A;  1X0T A;  3CCQ Z;  4XX2 A;  3D9X A;  5D1O B;  1VQ6 1;  1X3Z A;  1KRL A;  2PMZ A;  3CPW Z;  4E32 A;  1VQO Z;  4NBC A;  4A3J I;  2QLV B;  1YUK A;  4EWC A;  2R92 I;  2BJO A;  1Z02 A;  2W04 A;  4DGL A;  3CC2 1;  3K7A I;  3CC4 1;  2IZ3 A;  1M90 1;  1I6H I;  2RT9 A;  3CXC Y;  3HOY I;  3GTP I;  5A2Q b;  4NBH A;  1TWH I;  5C4X I;  2OTL Z;  1TWA I;  2IZ4 A;  4NOZ A;  1Y1V S;  2P28 A;  3M4O I;  3G6E 1;  2PK7 A;  2NVY I;  5D1O A;  1Y1V I;  3S15 I;  4BY1 I;  1Q7Y 1;  1QYP A;  3GTJ I;  3VMG A;  1VQP 1;  4HGZ A;  2E2I I;  1VQM 1;  1VQ9 Z;  1YJ9 Z;  4E33 A;  3CCJ Z;  4NB8 A;  5A2Q f;  3GTM S;  1QVG Z;  2RIQ A;  1R9T I;  2RHB A;  2PM9 A;  1Z01 A;  4RVF A;  3GTM I;  2QKD A;  3CCE Z;  1L1O C;  1VQ9 1;  3HOW I;  3CD6 1;  2OTJ 1;  2V8K A;  3HOU I;  3S1N I;  1N8R 2;  2ZAE B;  3CPW Y;  2YAD A;  2QR1 B;  1VQ8 1;  4RVD A;  1M1K 1;  4A3K I;  2YU9 I;  4E2X A;  4NBD A;  3GKQ A;  1VQ7 1;  4CL1 A;  2AKL A;  2KI7 B;  2GTH A;  3TE5 B;  1USP B;  3I56 Z;  1YJN 1;  1YHQ Z;  3VMH A;  4A3E I;  3KIH A;  5T64 A;  2QEX 1;  3I55 Z;  3FQQ A;  1RO2 A;  1YJW 1;  3U50 C;  1LQL A;  1ZH1 A;  2O53 A;  4QTU A;  4E31 A;  1VQN 1;  1Q86 2;  3CCV 1;  5IP7 I;  4NFR A;  3CMA Z;  5AN9 F;  2OZK A;  3HOX I;  4A93 I;  2NVX I;  3KIF A;  1YI2 1;  2M6N A;  4NBE A;  1QVG Y;  3CME 1;  3S14 I;  1VQ5 Z;  1ZB9 A;  4NBF A;  1TFI A;  3OW2 Z;  3BG1 B;  5IT9 f;  3TDH B;  2V8I A;  1VQL Z;  2VUM I;  3CCQ 1;  1ZB8 A;  1X3W A;  2Q51 A;  3S1Q I;  1USP A;  3RZD I;  2VUG A;  3ESW A;  3I4M I;  1S72 Z;  4TNU A;  2J6A A;  1VQO 1;  3F3P C;  4X6A I;  2H85 A;  4RS4 A;  4MD7 A;  2I3C A;  1S72 1;  4MXU A;  4Y52 I;  2QRC B;  4MON A;  1SFO I;  3PO3 I;  2E2J I;  1NJI 2;  3J7A 4;  1K73 2;  4AYB A;  1NJI 1;  3CCR Z;  2R93 I;  1YIJ Z;  4BBR I;  1KC8 2;  1WII A;  4BY7 I;  3J81 b;  1RQF A;  3CCS Z;  2OTL 1;  4A3D I;  2JNY A;  2DE5 A;  5FLM I;  2R7Z I;  1YUA A;  3G71 Z;  4A3G I;  2NVQ I;  1VQ4 Z;  4S1T A;  2GTI A;  2WAQ A;  1Y1W I;  4A3L I;  5C4J I;  5T67 A;  3OW2 Y;  1YJ9 1;  1I3Q I;  3CCJ 1;  3GTO I;  3G4S Z;  2DE7 A;  1K9M 2;  2W03 A;  1K9M 1;  1N8R 1;  3GTG I;  2Q4Z A;  1KQS Y;  3CCE 1;  3EED A;  4RVG A;  1VQK Z;  3NDJ A;  3EER A;  4MD9 A;  3PO2 I;  3CC7 Z;  2EGT A;  4QTT A;  5CM2 M;  1W2B Z;  3T4N B;  2JA8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...