1YIJ1

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yij100
1QVFY 1VQ71 1Q821 3CCL1 1VQ6Z 3I55Z 1VQP1 1W2BY 1K732 3CXCY 3G4SZ 1NJI2 3CMAZ 2QA4Z 1VQL1 3CCUZ 1KD12 3CCR1 1VQ5Z 1VQ7Z 3CPWY 3CCM1 1YJNZ 3CC71 3CPWZ 3CCS1 1YJWZ 3CCEZ 1VQ9Z 1YI21 1VQN1 3I56Z 1KC81 1VQ81 2OTJZ 1M1K2 1K8A2 1Q862 1KQSY 1YI2Z 1VQNZ 3CC21 1KQSZ 1VQMZ 3CMEZ 1Q811 1YIJ1 2OTLZ 1YHQZ 3G4S1 1W2BZ 1M1K1 1VQ41 1VQ4Z 1VQOZ 1QVGY 3CC7Z 1YJW1 3CD61 1Q822 3CCU1 1Q7Y2 1N8R2 1QVFZ 1YJ9Z 3CCQ1 1JJ2Y 1KD11 1JJ2Z 1VQLZ 1VQKZ 1YHQ1 3CCVZ 1NJI1 1VQ8Z 2OTJ1 1YJ91 1K9M2 3G71Z 3I551 1VQPZ 1K8A1 1YITZ 2QEXZ 1YIJZ 3CCLZ 1VQ61 3CCSZ 3G711 1Q861 3OW2Y 1Q7Y1 3CD6Z 3G6EZ 3G6E1 3CXCZ 3CCE1 1VQ91 2OTL1 1M901 1VQO1 1QVGZ 1S721 3CCV1 3CCJZ 3CCRZ 1VQ51 3CME1 3CMA1 1YJN1 3CCMZ 2QA41 1KC82 3CCJ1 3CC41 1K9M1 3CC4Z 2QEX1 3I561 1N8R1 1S72Z 1K731 1VQM1 1M902 3CC2Z 1VQK1 1YIT1 3OW2Z 1Q812 3CCQZ
chains in the Genus database with same CATH superfamily
4BBSI 1RNIA 3S14I 2O4HA 5T67A 2RIQA 3IF8A 1TFIA 1WJ2A 3IFUA 5FLMI 2R6MA 3G4SZ 3D9XA 2VPZA 3BG0B 3CCR1 4BBRI 3P5JB 3GTQI 3J80f 5FLXb 3CCEZ 1VQ9Z 3I56Z 1KC81 1VQ81 2OTJZ 3NH4A 4MD8A 5LL6f 1Q862 3I4MI 2DE6A 3CMEZ 1KRLA 1W2BZ 3NH5A 1WIIA 1VQ41 2LIYA 4A3CI 3CD61 1S7MA 1AA6A 3Q87A 1YUKA 2M6NA 3GTGI 3RZDI 3HOVI 1JJ2Z 1Z02A 1VQPZ 3RZOI 2VF1A 2IZ4A 3IR7A 4NBAA 1Y1VS 4RVHA 1Y1VI 4A3DI 1VQ61 4E2ZA 2JIOA 2JS4A 3GTJI 2QR1B 1QF8A 1LQLA 2QREB 2F4OA 3M4OI 4RVDA 1SFOI 3GTLI 2JR6A 2M48A 2NVXI 5T64A 2QKDA 3S2HI 2V8KA 4NBDA 2E2HI 3CCMZ 1YJN1 3CCJ1 3CC4Z 2JA5I 1Z03A 2R7ZI 2W04A 2GTIA 3J81f 4NOZA 2JA8I 1PFTA 3OW2Z 3GCFA 3GTKI 1QVFY 1VQ71 4S1TA 3CCL1 1W2BY 3ESWA 3KIFA 2O53A 1K83I 1QYPA 3GTMI 4A3KI 4A3JI 3CCM1 1YJNZ 3M3YI 1Z01A 2QRDB 3CC71 1YJWZ 1YI21 2B63I 3HOZI 2VPWA 1K8A2 4BY1I 1KQSY 2R92I 3CC21 1VQMZ 3VB9A 3KIHA 1YIJ1 1YHQZ 3G4S1 3JAMf 2LEXA 3PO3S 3H3VJ 1Q822 3GTPI 2K3RA 2OZKA 1Q7Y2 1N8R2 1QVFZ 1YJ9Z 4NBGA 1RO2A 5D1OB 1I50I 4BY7I 4E31A 1WCMI 1VQLZ 2RHBA 1VQ8Z 2OTJ1 3G71Z 3I551 3EERA 1K8A1 3S15I 3BG1B 4A3LI 1YITZ 2P28A 3CCLZ 3S1RI 1Q861 5IP7I 3CD6Z 3EEDA 2QLVB 2E7ZA 4NBHA 2BJOA 1QVGZ 4Y7NI 4A3EI 2Q4ZA 5AN9F 2DE7A 5CM2M 1VQ51 3GKQA 3CME1 3GTMS 3CMA1 1FDIA 4NBFA 2QA41 1SIWA 2V3VA 2RBLA 5IT9b 3CC41 1K9M1 2AKLA 2QEX1 3I561 2DE5A 3QWUA 3D2LA 1VQM1 1M902 3CC2Z 3NH8A 1L1OC 2E2II 4QTTA 1Q812 3HOYI 3CCQZ 3S1NI 3FQQA 1RLYA 4HH4A 2JA7I 1Y8CA 1ZB9A 1Q821 1VQ6Z 2OOXB 3TE5B 2YU9I 2IV2X 3I55Z 1K732 3CXCY 3S2DI 1NJI2 2V8IA 2Y0SA 3CMAZ 1Q16A 2QA4Z 1VQL1 3CCUZ 3F3PC 4AYBA 4BXXI 1TWHI 1VQ5Z 2RPRA 2PK7A 4TNUA 5C44I 4CL1A 1USPB 3CPWZ 3CCS1 1VQN1 3J7A4 2F4MA 3PO3I 1WZNA 4NBCA 3GTOI 4RVFA 1TWCI 1VQNZ 1KQSZ 1ML8A 2OTLZ 1VLAA 1M1K1 1DL6A 4RVGA 1VQ4Z 4NB8A 1VQOZ 3CC7Z 2K5RA 1YJW1 3S17I 1ZB8A 3CCU1 3MZKB 3TDHB 3J80b 5D1PA 4QTUA 1KD11 4X6AI 5FLXf 1VQKZ 2J6AA 5A2Qf 1X0TA 4RV9A 4E30A 1YJ91 1K9M2 1X3ZA 4EWCA 2OOYB 3HOUI 5C4XI 4A93I 2H85A 4DQYB 1YIJZ 4MONA 3CCSZ 2PM9A 1WW9A 3OW2Y 1Q7Y1 4A3GI 2HU9A 2ZAEB 3HOXI 3MONA 2WAQA 1M901 2V8JA 1S721 3CCJZ 2JUBA 3HKZA 1FDOA 3U50C 1QXFA 3S1MI 2RT9A 2NAPA 3I4NI 3NDJA 3T4NB 1P9NA 2R93I 1RQFA 3NFZA 4XX2A 3S1QI 3VMHA 1N2FA 1K731 1I3QI 3FKII 5IP9I 1Y1WI 1VQK1 1YIT1 3PO2I 3K7AI 3I07A 4HGYA 1NUIA 4A3BI 1TWFI 4NBEA 2E9HA 3CQZI 3NDIA 1VQP1 1RO4A 2WB1A 3JAMb 2JIPA 4MD9A 1KD12 4MXUA 2AYDA 3FQMA 5C4JI 1YUAA 1RO0A 3J81b 4HGZA 4MRIA 4MD7A 4RS4A 4NH1C 1VQ7Z 3CPWY 5D1OA 2I3CA 2JIMA 3VTNA 2KPIA 5C3EI 1M1K2 1ZH1A 2KI7B 2VUGA 4Y52I 4E2YA 1YI2Z 2IZ3A 1Q811 2W03A 2EGTA 1QVGY 2VPXA 1TWGI 2LFUA 1X3WA 3CCQ1 4NB9A 1JJ2Y 2NVYI 2Q51A 1NP6A 3S16I 1YHQ1 3CCVZ 2JIRA 2HF1A 2G2KA 1NJI1 2JIQA 2VPYA 3HOWI 4A3II 2V45A 2QEXZ 3H0GI 1JWHC 4NFRA 3G711 4E32A 3VMGA 2VUMI 2NVTI 3MZLB 2QRCB 2YADA 3G6EZ 3VMIA 3G6E1 4DGLA 3CXCZ 3CCE1 1VQ91 2PMZA 2OTL1 1USPA 3F3FC 4NBBA 1VQO1 2GU2A 3CCV1 3CCRZ 3IX0A 3D6WA 2E2JI 5A2Qb 5IT9f 1R9TI 4A3FI 4E33A 2JNYA 2JA6I 1KC82 2GTHA 1I6HI 3LUSA 2P3YA 4A3MI 1N8R1 1S72Z 2JMOA 1TWAI 4DK1A 4MH4A 4E2WA 5T6BA 2NVQI 4E2XA
chains in the Genus database with same CATH topology
4BBSI 1RNIA 3S14I 2O4HA 5T67A 2RIQA 3IF8A 1TFIA 3IFUA 5FLMI 2R6MA 3G4SZ 3D9XA 3BG0B 3CCR1 4BBRI 3P5JB 3GTQI 3J80f 5FLXb 3CCEZ 1VQ9Z 3I56Z 1KC81 1VQ81 2OTJZ 3NH4A 4MD8A 5LL6f 1Q862 3I4MI 2DE6A 3CMEZ 1KRLA 1W2BZ 3NH5A 1WIIA 1VQ41 2LIYA 4A3CI 3CD61 1S7MA 3Q87A 1YUKA 2M6NA 3GTGI 3RZDI 3HOVI 1JJ2Z 1Z02A 1VQPZ 3RZOI 2VF1A 2IZ4A 4NBAA 1Y1VS 4RVHA 1Y1VI 4A3DI 1VQ61 4E2ZA 2JS4A 3GTJI 2QR1B 1QF8A 1LQLA 2QREB 2F4OA 3M4OI 4RVDA 1SFOI 3GTLI 2JR6A 2M48A 2NVXI 5T64A 2QKDA 3S2HI 2V8KA 4NBDA 2E2HI 3CCMZ 1YJN1 3CCJ1 3CC4Z 2JA5I 1Z03A 2R7ZI 2W04A 2GTIA 3J81f 4NOZA 2JA8I 1PFTA 3OW2Z 3GCFA 3GTKI 1QVFY 1VQ71 4S1TA 3CCL1 1W2BY 3ESWA 3KIFA 2O53A 1K83I 1QYPA 3GTMI 4A3KI 4A3JI 3CCM1 1YJNZ 3M3YI 1Z01A 2QRDB 3CC71 1YI21 1YJWZ 2B63I 3HOZI 1K8A2 4BY1I 1KQSY 2R92I 3CC21 1VQMZ 3VB9A 3KIHA 1YIJ1 1YHQZ 3G4S1 3JAMf 3PO3S 3H3VJ 1Q822 3GTPI 2K3RA 2OZKA 1Q7Y2 1N8R2 1QVFZ 1YJ9Z 4NBGA 1RO2A 5D1OB 1I50I 4BY7I 4E31A 1WCMI 1VQLZ 2RHBA 1VQ8Z 2OTJ1 3G71Z 3I551 3EERA 1K8A1 3S15I 3BG1B 4A3LI 1YITZ 2P28A 3CCLZ 3S1RI 1Q861 5IP7I 3CD6Z 3EEDA 2QLVB 4NBHA 2BJOA 1QVGZ 4Y7NI 4A3EI 2Q4ZA 5AN9F 2DE7A 5CM2M 1VQ51 3GKQA 3CME1 3GTMS 3CMA1 4NBFA 2QA41 2RBLA 5IT9b 3CC41 1K9M1 2AKLA 2QEX1 3I561 2DE5A 3QWUA 1VQM1 1M902 3CC2Z 3NH8A 1L1OC 2E2II 4QTTA 1Q812 3HOYI 3CCQZ 3S1NI 3FQQA 1RLYA 4HH4A 2JA7I 1ZB9A 1Q821 1VQ6Z 2OOXB 3TE5B 2YU9I 3I55Z 1K732 3CXCY 3S2DI 1NJI2 2V8IA 2Y0SA 3CMAZ 2QA4Z 1VQL1 3CCUZ 3F3PC 4AYBA 4BXXI 1TWHI 1VQ5Z 2RPRA 2PK7A 4TNUA 5C44I 4CL1A 1USPB 3CPWZ 3CCS1 1VQN1 3J7A4 2F4MA 3PO3I 4NBCA 3GTOI 4RVFA 1TWCI 1VQNZ 1KQSZ 1ML8A 2OTLZ 1VLAA 1M1K1 1DL6A 4RVGA 1VQ4Z 4NB8A 1VQOZ 3CC7Z 2K5RA 1YJW1 3S17I 1ZB8A 3CCU1 3MZKB 3TDHB 3J80b 5D1PA 4QTUA 1KD11 4X6AI 5FLXf 1VQKZ 2J6AA 5A2Qf 1X0TA 4RV9A 4E30A 1YJ91 1K9M2 1X3ZA 4EWCA 2OOYB 3HOUI 5C4XI 4A93I 2H85A 4DQYB 1YIJZ 4MONA 3CCSZ 2PM9A 1WW9A 3OW2Y 1Q7Y1 4A3GI 2HU9A 2ZAEB 3HOXI 3MONA 2WAQA 1M901 2V8JA 1S721 3CCJZ 2JUBA 3HKZA 3U50C 3S1MI 2RT9A 3I4NI 3NDJA 3T4NB 1P9NA 2R93I 1RQFA 3NFZA 4XX2A 3S1QI 3VMHA 1N2FA 1K731 1I3QI 3FKII 5IP9I 1Y1WI 1VQK1 1YIT1 3PO2I 3K7AI 3I07A 4HGYA 1NUIA 4A3BI 1TWFI 4NBEA 2E9HA 3CQZI 3NDIA 1VQP1 1RO4A 2WB1A 3JAMb 4MD9A 1KD12 4MXUA 3FQMA 5C4JI 1YUAA 1RO0A 3J81b 4HGZA 4MRIA 4MD7A 4RS4A 4NH1C 1VQ7Z 3CPWY 5D1OA 2I3CA 3VTNA 2KPIA 5C3EI 1M1K2 1ZH1A 2KI7B 2VUGA 4Y52I 4E2YA 1YI2Z 2IZ3A 1Q811 2W03A 2EGTA 1QVGY 1TWGI 2LFUA 1X3WA 3CCQ1 4NB9A 1JJ2Y 2NVYI 2Q51A 1NP6A 3S16I 1YHQ1 3CCVZ 1NJI1 2HF1A 2G2KA 3HOWI 4A3II 2QEXZ 3H0GI 1JWHC 4NFRA 3G711 4E32A 3VMGA 2VUMI 2NVTI 3MZLB 2QRCB 2YADA 3G6EZ 3VMIA 3G6E1 4DGLA 3CXCZ 3CCE1 1VQ91 2PMZA 2OTL1 1USPA 3F3FC 4NBBA 1VQO1 2GU2A 3CCV1 3CCRZ 3IX0A 3D6WA 2E2JI 5A2Qb 5IT9f 1R9TI 4A3FI 4E33A 2JNYA 2JA6I 1KC82 2GTHA 1I6HI 3LUSA 2P3YA 4A3MI 1N8R1 1S72Z 2JMOA 1TWAI 4DK1A 4MH4A 4E2WA 5T6BA 2NVQI 4E2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF Y;  1VQ7 1;  1Q82 1;  3CCL 1;  1VQ6 Z;  3I55 Z;  1VQP 1;  1W2B Y;  1K73 2;  3CXC Y;  3G4S Z;  1NJI 2;  3CMA Z;  2QA4 Z;  1VQL 1;  3CCU Z;  1KD1 2;  3CCR 1;  1VQ5 Z;  1VQ7 Z;  3CPW Y;  3CCM 1;  1YJN Z;  3CC7 1;  3CPW Z;  3CCS 1;  1YJW Z;  3CCE Z;  1VQ9 Z;  1YI2 1;  1VQN 1;  3I56 Z;  1KC8 1;  1VQ8 1;  2OTJ Z;  1M1K 2;  1K8A 2;  1Q86 2;  1KQS Y;  1YI2 Z;  1VQN Z;  3CC2 1;  1KQS Z;  1VQM Z;  3CME Z;  1Q81 1;  1YIJ 1;  2OTL Z;  1YHQ Z;  3G4S 1;  1W2B Z;  1M1K 1;  1VQ4 1;  1VQ4 Z;  1VQO Z;  1QVG Y;  3CC7 Z;  1YJW 1;  3CD6 1;  1Q82 2;  3CCU 1;  1Q7Y 2;  1N8R 2;  1QVF Z;  1YJ9 Z;  3CCQ 1;  1JJ2 Y;  1KD1 1;  1JJ2 Z;  1VQL Z;  1VQK Z;  1YHQ 1;  3CCV Z;  1NJI 1;  1VQ8 Z;  2OTJ 1;  1YJ9 1;  1K9M 2;  3G71 Z;  3I55 1;  1VQP Z;  1K8A 1;  1YIT Z;  2QEX Z;  1YIJ Z;  3CCL Z;  1VQ6 1;  3CCS Z;  3G71 1;  1Q86 1;  3OW2 Y;  1Q7Y 1;  3CD6 Z;  3G6E Z;  3G6E 1;  3CXC Z;  3CCE 1;  1VQ9 1;  2OTL 1;  1M90 1;  1VQO 1;  1QVG Z;  1S72 1;  3CCV 1;  3CCJ Z;  3CCR Z;  1VQ5 1;  3CME 1;  3CMA 1;  1YJN 1;  3CCM Z;  2QA4 1;  1KC8 2;  3CCJ 1;  3CC4 1;  1K9M 1;  3CC4 Z;  2QEX 1;  3I56 1;  1N8R 1;  1S72 Z;  1K73 1;  1VQM 1;  1M90 2;  3CC2 Z;  1VQK 1;  1YIT 1;  3OW2 Z;  1Q81 2;  3CCQ Z; 
#chains in the Genus database with same CATH topology
 4BBS I;  1RNI A;  3S14 I;  2O4H A;  5T67 A;  2RIQ A;  3IF8 A;  1TFI A;  1WJ2 A;  3IFU A;  5FLM I;  2R6M A;  3G4S Z;  3D9X A;  2VPZ A;  3BG0 B;  3CCR 1;  4BBR I;  3P5J B;  3GTQ I;  3J80 f;  5FLX b;  3CCE Z;  1VQ9 Z;  3I56 Z;  1KC8 1;  1VQ8 1;  2OTJ Z;  3NH4 A;  4MD8 A;  5LL6 f;  1Q86 2;  3I4M I;  2DE6 A;  3CME Z;  1KRL A;  1W2B Z;  3NH5 A;  1WII A;  1VQ4 1;  2LIY A;  4A3C I;  3CD6 1;  1S7M A;  1AA6 A;  3Q87 A;  1YUK A;  2M6N A;  3GTG I;  3RZD I;  3HOV I;  1JJ2 Z;  1Z02 A;  1VQP Z;  3RZO I;  2VF1 A;  2IZ4 A;  3IR7 A;  4NBA A;  1Y1V S;  4RVH A;  1Y1V I;  4A3D I;  1VQ6 1;  4E2Z A;  2JIO A;  2JS4 A;  3GTJ I;  2QR1 B;  1QF8 A;  1LQL A;  2QRE B;  2F4O A;  3M4O I;  4RVD A;  1SFO I;  3GTL I;  2JR6 A;  2M48 A;  2NVX I;  5T64 A;  2QKD A;  3S2H I;  2V8K A;  4NBD A;  2E2H I;  3CCM Z;  1YJN 1;  3CCJ 1;  3CC4 Z;  2JA5 I;  1Z03 A;  2R7Z I;  2W04 A;  2GTI A;  3J81 f;  4NOZ A;  2JA8 I;  1PFT A;  3OW2 Z;  3GCF A;  3GTK I;  1QVF Y;  1VQ7 1;  4S1T A;  3CCL 1;  1W2B Y;  3ESW A;  3KIF A;  2O53 A;  1K83 I;  1QYP A;  3GTM I;  4A3K I;  4A3J I;  3CCM 1;  1YJN Z;  3M3Y I;  1Z01 A;  2QRD B;  3CC7 1;  1YJW Z;  1YI2 1;  2B63 I;  3HOZ I;  2VPW A;  1K8A 2;  4BY1 I;  1KQS Y;  2R92 I;  3CC2 1;  1VQM Z;  3VB9 A;  3KIH A;  1YIJ 1;  1YHQ Z;  3G4S 1;  3JAM f;  2LEX A;  3PO3 S;  3H3V J;  1Q82 2;  3GTP I;  2K3R A;  2OZK A;  1Q7Y 2;  1N8R 2;  1QVF Z;  1YJ9 Z;  4NBG A;  1RO2 A;  5D1O B;  1I50 I;  4BY7 I;  4E31 A;  1WCM I;  1VQL Z;  2RHB A;  1VQ8 Z;  2OTJ 1;  3G71 Z;  3I55 1;  3EER A;  1K8A 1;  3S15 I;  3BG1 B;  4A3L I;  1YIT Z;  2P28 A;  3CCL Z;  3S1R I;  1Q86 1;  5IP7 I;  3CD6 Z;  3EED A;  2QLV B;  2E7Z A;  4NBH A;  2BJO A;  1QVG Z;  4Y7N I;  4A3E I;  2Q4Z A;  5AN9 F;  2DE7 A;  5CM2 M;  1VQ5 1;  3GKQ A;  3CME 1;  3GTM S;  3CMA 1;  1FDI A;  4NBF A;  2QA4 1;  1SIW A;  2V3V A;  2RBL A;  5IT9 b;  3CC4 1;  1K9M 1;  2AKL A;  2QEX 1;  3I56 1;  2DE5 A;  3QWU A;  3D2L A;  1VQM 1;  1M90 2;  3CC2 Z;  3NH8 A;  1L1O C;  2E2I I;  4QTT A;  1Q81 2;  3HOY I;  3CCQ Z;  3S1N I;  3FQQ A;  1RLY A;  4HH4 A;  2JA7 I;  1Y8C A;  1ZB9 A;  1Q82 1;  1VQ6 Z;  2OOX B;  3TE5 B;  2YU9 I;  2IV2 X;  3I55 Z;  1K73 2;  3CXC Y;  3S2D I;  1NJI 2;  2V8I A;  2Y0S A;  3CMA Z;  1Q16 A;  2QA4 Z;  1VQL 1;  3CCU Z;  3F3P C;  4AYB A;  4BXX I;  1TWH I;  1VQ5 Z;  2RPR A;  2PK7 A;  4TNU A;  5C44 I;  4CL1 A;  1USP B;  3CPW Z;  3CCS 1;  1VQN 1;  3J7A 4;  2F4M A;  3PO3 I;  1WZN A;  4NBC A;  3GTO I;  4RVF A;  1TWC I;  1VQN Z;  1KQS Z;  1ML8 A;  2OTL Z;  1VLA A;  1M1K 1;  1DL6 A;  4RVG A;  1VQ4 Z;  4NB8 A;  1VQO Z;  3CC7 Z;  2K5R A;  1YJW 1;  3S17 I;  1ZB8 A;  3CCU 1;  3MZK B;  3TDH B;  3J80 b;  5D1P A;  4QTU A;  1KD1 1;  4X6A I;  5FLX f;  1VQK Z;  2J6A A;  5A2Q f;  1X0T A;  4RV9 A;  4E30 A;  1YJ9 1;  1K9M 2;  1X3Z A;  4EWC A;  2OOY B;  3HOU I;  5C4X I;  4A93 I;  2H85 A;  4DQY B;  1YIJ Z;  4MON A;  3CCS Z;  2PM9 A;  1WW9 A;  3OW2 Y;  1Q7Y 1;  4A3G I;  2HU9 A;  2ZAE B;  3HOX I;  3MON A;  2WAQ A;  1M90 1;  2V8J A;  1S72 1;  3CCJ Z;  2JUB A;  3HKZ A;  1FDO A;  3U50 C;  1QXF A;  3S1M I;  2RT9 A;  2NAP A;  3I4N I;  3NDJ A;  3T4N B;  1P9N A;  2R93 I;  1RQF A;  3NFZ A;  4XX2 A;  3S1Q I;  3VMH A;  1N2F A;  1K73 1;  1I3Q I;  3FKI I;  5IP9 I;  1Y1W I;  1VQK 1;  1YIT 1;  3PO2 I;  3K7A I;  3I07 A;  4HGY A;  1NUI A;  4A3B I;  1TWF I;  4NBE A;  2E9H A;  3CQZ I;  3NDI A;  1VQP 1;  1RO4 A;  2WB1 A;  3JAM b;  2JIP A;  4MD9 A;  1KD1 2;  4MXU A;  2AYD A;  3FQM A;  5C4J I;  1YUA A;  1RO0 A;  3J81 b;  4HGZ A;  4MRI A;  4MD7 A;  4RS4 A;  4NH1 C;  1VQ7 Z;  3CPW Y;  5D1O A;  2I3C A;  2JIM A;  3VTN A;  2KPI A;  5C3E I;  1M1K 2;  1ZH1 A;  2KI7 B;  2VUG A;  4Y52 I;  4E2Y A;  1YI2 Z;  2IZ3 A;  1Q81 1;  2W03 A;  2EGT A;  1QVG Y;  2VPX A;  1TWG I;  2LFU A;  1X3W A;  3CCQ 1;  4NB9 A;  1JJ2 Y;  2NVY I;  2Q51 A;  1NP6 A;  3S16 I;  1YHQ 1;  3CCV Z;  2JIR A;  2HF1 A;  2G2K A;  1NJI 1;  2JIQ A;  2VPY A;  3HOW I;  4A3I I;  2V45 A;  2QEX Z;  3H0G I;  1JWH C;  4NFR A;  3G71 1;  4E32 A;  3VMG A;  2VUM I;  2NVT I;  3MZL B;  2QRC B;  2YAD A;  3G6E Z;  3VMI A;  3G6E 1;  4DGL A;  3CXC Z;  3CCE 1;  1VQ9 1;  2PMZ A;  2OTL 1;  1USP A;  3F3F C;  4NBB A;  1VQO 1;  2GU2 A;  3CCV 1;  3CCR Z;  3IX0 A;  3D6W A;  2E2J I;  5A2Q b;  5IT9 f;  1R9T I;  4A3F I;  4E33 A;  2JNY A;  2JA6 I;  1KC8 2;  2GTH A;  1I6H I;  3LUS A;  2P3Y A;  4A3M I;  1N8R 1;  1S72 Z;  2JMO A;  1TWA I;  4DK1 A;  4MH4 A;  4E2W A;  5T6B A;  2NVQ I;  4E2X A; 
#chains in the Genus database with same CATH homology
 4BBS I;  1RNI A;  3S14 I;  2O4H A;  5T67 A;  2RIQ A;  3IF8 A;  1TFI A;  3IFU A;  5FLM I;  2R6M A;  3G4S Z;  3D9X A;  3BG0 B;  3CCR 1;  4BBR I;  3P5J B;  3GTQ I;  3J80 f;  5FLX b;  3CCE Z;  1VQ9 Z;  3I56 Z;  1KC8 1;  1VQ8 1;  2OTJ Z;  3NH4 A;  4MD8 A;  5LL6 f;  1Q86 2;  3I4M I;  2DE6 A;  3CME Z;  1KRL A;  1W2B Z;  3NH5 A;  1WII A;  1VQ4 1;  2LIY A;  4A3C I;  3CD6 1;  1S7M A;  3Q87 A;  1YUK A;  2M6N A;  3GTG I;  3RZD I;  3HOV I;  1JJ2 Z;  1Z02 A;  1VQP Z;  3RZO I;  2VF1 A;  2IZ4 A;  4NBA A;  1Y1V S;  4RVH A;  1Y1V I;  4A3D I;  1VQ6 1;  4E2Z A;  2JS4 A;  3GTJ I;  2QR1 B;  1QF8 A;  1LQL A;  2QRE B;  2F4O A;  3M4O I;  4RVD A;  1SFO I;  3GTL I;  2JR6 A;  2M48 A;  2NVX I;  5T64 A;  2QKD A;  3S2H I;  2V8K A;  4NBD A;  2E2H I;  3CCM Z;  1YJN 1;  3CCJ 1;  3CC4 Z;  2JA5 I;  1Z03 A;  2R7Z I;  2W04 A;  2GTI A;  3J81 f;  4NOZ A;  2JA8 I;  1PFT A;  3OW2 Z;  3GCF A;  3GTK I;  1QVF Y;  1VQ7 1;  4S1T A;  3CCL 1;  1W2B Y;  3ESW A;  3KIF A;  2O53 A;  1K83 I;  1QYP A;  3GTM I;  4A3K I;  4A3J I;  3CCM 1;  1YJN Z;  3M3Y I;  1Z01 A;  2QRD B;  3CC7 1;  1YI2 1;  1YJW Z;  2B63 I;  3HOZ I;  1K8A 2;  4BY1 I;  1KQS Y;  2R92 I;  3CC2 1;  1VQM Z;  3VB9 A;  3KIH A;  1YIJ 1;  1YHQ Z;  3G4S 1;  3JAM f;  3PO3 S;  3H3V J;  1Q82 2;  3GTP I;  2K3R A;  2OZK A;  1Q7Y 2;  1N8R 2;  1QVF Z;  1YJ9 Z;  4NBG A;  1RO2 A;  5D1O B;  1I50 I;  4BY7 I;  4E31 A;  1WCM I;  1VQL Z;  2RHB A;  1VQ8 Z;  2OTJ 1;  3G71 Z;  3I55 1;  3EER A;  1K8A 1;  3S15 I;  3BG1 B;  4A3L I;  1YIT Z;  2P28 A;  3CCL Z;  3S1R I;  1Q86 1;  5IP7 I;  3CD6 Z;  3EED A;  2QLV B;  4NBH A;  2BJO A;  1QVG Z;  4Y7N I;  4A3E I;  2Q4Z A;  5AN9 F;  2DE7 A;  5CM2 M;  1VQ5 1;  3GKQ A;  3CME 1;  3GTM S;  3CMA 1;  4NBF A;  2QA4 1;  2RBL A;  5IT9 b;  3CC4 1;  1K9M 1;  2AKL A;  2QEX 1;  3I56 1;  2DE5 A;  3QWU A;  1VQM 1;  1M90 2;  3CC2 Z;  3NH8 A;  1L1O C;  2E2I I;  4QTT A;  1Q81 2;  3HOY I;  3CCQ Z;  3S1N I;  3FQQ A;  1RLY A;  4HH4 A;  2JA7 I;  1ZB9 A;  1Q82 1;  1VQ6 Z;  2OOX B;  3TE5 B;  2YU9 I;  3I55 Z;  1K73 2;  3CXC Y;  3S2D I;  1NJI 2;  2V8I A;  2Y0S A;  3CMA Z;  2QA4 Z;  1VQL 1;  3CCU Z;  3F3P C;  4AYB A;  4BXX I;  1TWH I;  1VQ5 Z;  2RPR A;  2PK7 A;  4TNU A;  5C44 I;  4CL1 A;  1USP B;  3CPW Z;  3CCS 1;  1VQN 1;  3J7A 4;  2F4M A;  3PO3 I;  4NBC A;  3GTO I;  4RVF A;  1TWC I;  1VQN Z;  1KQS Z;  1ML8 A;  2OTL Z;  1VLA A;  1M1K 1;  1DL6 A;  4RVG A;  1VQ4 Z;  4NB8 A;  1VQO Z;  3CC7 Z;  2K5R A;  1YJW 1;  3S17 I;  1ZB8 A;  3CCU 1;  3MZK B;  3TDH B;  3J80 b;  5D1P A;  4QTU A;  1KD1 1;  4X6A I;  5FLX f;  1VQK Z;  2J6A A;  5A2Q f;  1X0T A;  4RV9 A;  4E30 A;  1YJ9 1;  1K9M 2;  1X3Z A;  4EWC A;  2OOY B;  3HOU I;  5C4X I;  4A93 I;  2H85 A;  4DQY B;  1YIJ Z;  4MON A;  3CCS Z;  2PM9 A;  1WW9 A;  3OW2 Y;  1Q7Y 1;  4A3G I;  2HU9 A;  2ZAE B;  3HOX I;  3MON A;  2WAQ A;  1M90 1;  2V8J A;  1S72 1;  3CCJ Z;  2JUB A;  3HKZ A;  3U50 C;  3S1M I;  2RT9 A;  3I4N I;  3NDJ A;  3T4N B;  1P9N A;  2R93 I;  1RQF A;  3NFZ A;  4XX2 A;  3S1Q I;  3VMH A;  1N2F A;  1K73 1;  1I3Q I;  3FKI I;  5IP9 I;  1Y1W I;  1VQK 1;  1YIT 1;  3PO2 I;  3K7A I;  3I07 A;  4HGY A;  1NUI A;  4A3B I;  1TWF I;  4NBE A;  2E9H A;  3CQZ I;  3NDI A;  1VQP 1;  1RO4 A;  2WB1 A;  3JAM b;  4MD9 A;  1KD1 2;  4MXU A;  3FQM A;  5C4J I;  1YUA A;  1RO0 A;  3J81 b;  4HGZ A;  4MRI A;  4MD7 A;  4RS4 A;  4NH1 C;  1VQ7 Z;  3CPW Y;  5D1O A;  2I3C A;  3VTN A;  2KPI A;  5C3E I;  1M1K 2;  1ZH1 A;  2KI7 B;  2VUG A;  4Y52 I;  4E2Y A;  1YI2 Z;  2IZ3 A;  1Q81 1;  2W03 A;  2EGT A;  1QVG Y;  1TWG I;  2LFU A;  1X3W A;  3CCQ 1;  4NB9 A;  1JJ2 Y;  2NVY I;  2Q51 A;  1NP6 A;  3S16 I;  1YHQ 1;  3CCV Z;  1NJI 1;  2HF1 A;  2G2K A;  3HOW I;  4A3I I;  2QEX Z;  3H0G I;  1JWH C;  4NFR A;  3G71 1;  4E32 A;  3VMG A;  2VUM I;  2NVT I;  3MZL B;  2QRC B;  2YAD A;  3G6E Z;  3VMI A;  3G6E 1;  4DGL A;  3CXC Z;  3CCE 1;  1VQ9 1;  2PMZ A;  2OTL 1;  1USP A;  3F3F C;  4NBB A;  1VQO 1;  2GU2 A;  3CCV 1;  3CCR Z;  3IX0 A;  3D6W A;  2E2J I;  5A2Q b;  5IT9 f;  1R9T I;  4A3F I;  4E33 A;  2JNY A;  2JA6 I;  1KC8 2;  2GTH A;  1I6H I;  3LUS A;  2P3Y A;  4A3M I;  1N8R 1;  1S72 Z;  2JMO A;  1TWA I;  4DK1 A;  4MH4 A;  4E2W A;  5T6B A;  2NVQ I;  4E2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...