5IT9f

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 1
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9f00
5A2Qf 3JAMf 5FLXf 3J80f 3J81f 5IT9f
chains in the Genus database with same CATH superfamily
2E2HI 1VQ8Z 1VQ4Z 4A3JI 2EGTA 1M902 1YI21 3CC71 4CL1A 2Q4ZA 3KIHA 3J80b 5C3EI 1WJ2A 5T67A 3S2HI 4A3BI 2VPYA 4A3DI 3HOWI 2DE5A 2H85A 1YITZ 4TNUA 1Q16A 3VMHA 5AN9F 2QRDB 1VQLZ 2K3RA 3H0GI 3G6E1 1VQNZ 1YJWZ 4DQYB 1WIIA 1USPB 4HGZA 2RIQA 4E32A 4QTTA 2Q51A 2E2II 1RLYA 3HOXI 3HOZI 3IF8A 4E2YA 3S2DI 3CCV1 3GTMS 1I50I 2G2KA 1FDOA 3S1RI 2V45A 3CCE1 3J80f 1VQ81 1VQPZ 1AA6A 2QREB 2O53A 2QA41 1WZNA 2JIOA 1W2BZ 1VLAA 4A3FI 1VQOZ 2LIYA 1Q7Y1 4X6AI 3G711 4MH4A 2R92I 4HH4A 4MRIA 1Q862 3CXCZ 2PK7A 4A3EI 2V8KA 5IT9f 1YIT1 4MD7A 1YJNZ 2JNYA 3T4NB 4HGYA 1VQ91 1VQL1 1YHQZ 1VQN1 2F4OA 4E33A 3CC21 1VQM1 3EEDA 1ML8A 1N8R1 4NH1C 4A3II 1S7MA 1L1OC 1RO0A 1SIWA 1KC82 2KI7B 2AKLA 3QWUA 1VQ5Z 3S15I 3CCUZ 2NVXI 1M901 2RBLA 3KIFA 2QEX1 2HF1A 1Y8CA 3NH4A 2IZ3A 3CMEZ 4A93I 1W2BY 2JS4A 3J7A4 3Q87A 4NBGA 5CM2M 2GU2A 2QR1B 2V8IA 1S721 4NFRA 3CXCY 4RS4A 3CCMZ 4BBRI 5LL6f 1YJN1 2OTJZ 3GCFA 4NBAA 1R9TI 3CQZI 4QTUA 1YHQ1 3LUSA 3CD61 3CC4Z 2JIMA 3FQMA 1QXFA 5C4XI 1KQSZ 2QKDA 2V8JA 1K9M2 3CCL1 1KRLA 3HOUI 3NH5A 4NBHA 1X3ZA 2NVTI 1TWGI 1VQ51 3CCU1 1NJI2 2YADA 5D1OA 2QLVB 1RO4A 1WCMI 4A3CI 2O4HA 1Y1WI 1TWCI 2HU9A 2R6MA 1Z01A 2M48A 2OOYB 5IT9b 3S1MI 4Y7NI 1VQ7Z 1TWAI 3GTPI 5IP9I 1KD11 1DL6A 2M6NA 5C44I 4XX2A 2OTLZ 1Q861 4A3GI 1WW9A 3I56Z 3MZLB 1YUKA 2E9HA 3GTGI 1X0TA 2NAPA 3D9XA 2JIRA 3I55Z 4E2WA 1VQ41 5C4JI 3CCQZ 1KC81 3CCSZ 1Q822 2VUGA 1QVFZ 3TE5B 1KQSY 2W03A 1VQKZ 3I4NI 1NP6A 2JIQA 4E2XA 1Y1VI 2JA8I 4NBEA 3CCJZ 5D1OB 3F3PC 3IX0A 2K5RA 4NBBA 1YJW1 4RVDA 1Q812 3D6WA 2RT9A 3ESWA 3S1NI 3JAMf 2OOXB 2BJOA 2OTL1 1N2FA 3CPWZ 2ZAEB 4Y52I 2P28A 4A3KI 2JMOA 1YI2Z 3CC7Z 4MD8A 3PO2I 2VUMI 1K83I 1VQP1 2WAQA 3K7AI 1K9M1 3GTQI 1VQ6Z 1QVFY 4E31A 1QVGZ 2KPIA 2RPRA 1VQO1 2JA7I 1NJI1 1QYPA 3NFZA 3BG0B 5IP7I 1I6HI 2GTIA 4MD9A 1VQK1 4NBDA 1ZB8A 1Z03A 1TFIA 3M4OI 1Y1VS 4DK1A 3VMIA 4EWCA 1M1K2 1LQLA 4BY7I 2VPXA 3P5JB 3G4SZ 5FLMI 4BY1I 2NVYI 3I07A 1YJ9Z 3CPWY 4S1TA 2YU9I 1K8A2 3RZDI 3U50C 3IFUA 2IZ4A 2QA4Z 3EERA 1Q821 2R93I 3CME1 3GTJI 2NVQI 3GKQA 1YIJZ 1ZB9A 3PO3I 3FKII 2JR6A 3CMAZ 3HKZA 3G71Z 1QVGY 1VQ61 2E7ZA 4NB9A 2DE6A 2GTHA 2IV2X 3JAMb 1X3WA 2JIPA 4MONA 1VQ9Z 2OZKA 3CCM1 4NBCA 3OW2Z 1K732 3CC2Z 1VQMZ 1I3QI 1Q811 1TWFI 4NBFA 2I3CA 2WB1A 1TWHI 3VMGA 2QRCB 2E2JI 2OTJ1 3GTOI 1YUAA 1JJ2Z 3CC41 2LFUA 3G4S1 2QEXZ 3VTNA 5FLXb 1FDIA 3BG1B 3TDHB 3CCRZ 1YJ91 2Y0SA 4A3LI 3F3FC 2JA5I 3MONA 5T6BA 4BBSI 5A2Qb 3S16I 2VF1A 3J81b 4RVFA 3I4MI 4NOZA 3S17I 4RVGA 3GTLI 1SFOI 1VQ71 1RO2A 1YIJ1 2F4MA 2VPZA 3GTKI 3CMA1 1P9NA 1S72Z 4DGLA 1PFTA 1KD12 2DE7A 3MZKB 2J6AA 2W04A 2B63I 3PO3S 3I561 2P3YA 2JUBA 4RV9A 4E30A 1RQFA 3OW2Y 4BXXI 3CD6Z 3HOYI 3D2LA 1M1K1 3I551 2V3VA 2PMZA 3H3VJ 4E2ZA 1JJ2Y 3S1QI 3S14I 2AYDA 3NH8A 3VB9A 5FLXf 3CCQ1 3CCLZ 3NDIA 3CCS1 2LEXA 1K8A1 2R7ZI 4MXUA 1ZH1A 4NB8A 4RVHA 5A2Qf 1Q7Y2 1NUIA 1RNIA 3FQQA 2VPWA 1Z02A 3RZOI 3J81f 3CCR1 3G6EZ 4A3MI 1USPA 3IR7A 2JA6I 3HOVI 1QF8A 3M3YI 3CCJ1 3GTMI 5D1PA 3CCVZ 1N8R2 4AYBA 5T64A 2PM9A 2RHBA 1K731 3CCEZ 3NDJA 1JWHC
chains in the Genus database with same CATH topology
2E2HI 1VQ8Z 1VQ4Z 4A3JI 2EGTA 1M902 1YI21 3CC71 4CL1A 2Q4ZA 3KIHA 3J80b 5C3EI 5T67A 3S2HI 4A3BI 4A3DI 3HOWI 2DE5A 2H85A 1YITZ 4TNUA 3VMHA 5AN9F 2QRDB 1VQLZ 2K3RA 3H0GI 3G6E1 1VQNZ 1YJWZ 4DQYB 1WIIA 1USPB 4HGZA 2RIQA 4E32A 4QTTA 2Q51A 2E2II 1RLYA 3HOXI 3HOZI 3IF8A 4E2YA 3S2DI 3CCV1 3GTMS 1I50I 2G2KA 3S1RI 3CCE1 3J80f 1VQ81 1VQPZ 2QREB 2O53A 2QA41 1W2BZ 1VLAA 4A3FI 1VQOZ 2LIYA 1Q7Y1 4X6AI 3G711 4MH4A 2R92I 4HH4A 4MRIA 1Q862 3CXCZ 2PK7A 4A3EI 2V8KA 5IT9f 1YIT1 4MD7A 1YJNZ 2JNYA 3T4NB 4HGYA 1VQ91 1VQL1 1YHQZ 1VQN1 2F4OA 4E33A 3CC21 1VQM1 3EEDA 1ML8A 1N8R1 4NH1C 4A3II 1S7MA 1L1OC 1RO0A 1KC82 2KI7B 2AKLA 3QWUA 1VQ5Z 3S15I 3CCUZ 2NVXI 1M901 2RBLA 3KIFA 2QEX1 2HF1A 3NH4A 2IZ3A 3CMEZ 4A93I 1W2BY 2JS4A 3J7A4 3Q87A 4NBGA 5CM2M 2GU2A 2QR1B 2V8IA 1S721 4NFRA 3CXCY 4RS4A 3CCMZ 4BBRI 5LL6f 1YJN1 2OTJZ 3GCFA 4NBAA 1R9TI 3CQZI 4QTUA 1YHQ1 3LUSA 3CD61 3CC4Z 3FQMA 5C4XI 1KQSZ 2QKDA 2V8JA 1K9M2 3CCL1 1KRLA 3HOUI 3NH5A 4NBHA 1X3ZA 2NVTI 1TWGI 1VQ51 3CCU1 1NJI2 2YADA 5D1OA 2QLVB 1RO4A 1WCMI 4A3CI 2O4HA 1Y1WI 1TWCI 2HU9A 2R6MA 1Z01A 2M48A 2OOYB 5IT9b 3S1MI 4Y7NI 1VQ7Z 1TWAI 3GTPI 5IP9I 1KD11 1DL6A 2M6NA 5C44I 4XX2A 2OTLZ 1Q861 4A3GI 1WW9A 3I56Z 3MZLB 1YUKA 2E9HA 3GTGI 1X0TA 3D9XA 3I55Z 4E2WA 1VQ41 5C4JI 3CCQZ 1KC81 3CCSZ 1Q822 2VUGA 1QVFZ 3TE5B 1KQSY 2W03A 1VQKZ 3I4NI 1NP6A 4E2XA 1Y1VI 2JA8I 4NBEA 3CCJZ 5D1OB 3F3PC 3IX0A 2K5RA 4NBBA 1YJW1 4RVDA 1Q812 3D6WA 2RT9A 3ESWA 3S1NI 3JAMf 2OOXB 2BJOA 2OTL1 1N2FA 3CPWZ 2ZAEB 4Y52I 2P28A 4A3KI 2JMOA 1YI2Z 3CC7Z 4MD8A 3PO2I 2VUMI 1K83I 1VQP1 2WAQA 3K7AI 1K9M1 3GTQI 1VQ6Z 1QVFY 4E31A 1QVGZ 2KPIA 2RPRA 1VQO1 2JA7I 1NJI1 1QYPA 3NFZA 3BG0B 5IP7I 1I6HI 2GTIA 4MD9A 1VQK1 4NBDA 1ZB8A 1Z03A 1TFIA 3M4OI 1Y1VS 4DK1A 3VMIA 4EWCA 1M1K2 1LQLA 4BY7I 3P5JB 3G4SZ 5FLMI 4BY1I 2NVYI 3I07A 1YJ9Z 3CPWY 4S1TA 2YU9I 1K8A2 3RZDI 3U50C 3IFUA 2IZ4A 2QA4Z 3EERA 1Q821 2R93I 3CME1 3GTJI 2NVQI 3GKQA 1YIJZ 1ZB9A 3PO3I 3FKII 2JR6A 3CMAZ 3HKZA 3G71Z 1QVGY 1VQ61 4NB9A 2DE6A 2GTHA 3JAMb 1X3WA 4MONA 1VQ9Z 2OZKA 3CCM1 4NBCA 3OW2Z 1K732 3CC2Z 1VQMZ 1I3QI 1Q811 1TWFI 4NBFA 2I3CA 2WB1A 1TWHI 3VMGA 2QRCB 2E2JI 2OTJ1 3GTOI 1YUAA 1JJ2Z 3CC41 2LFUA 3G4S1 2QEXZ 3VTNA 5FLXb 3BG1B 3TDHB 3CCRZ 1YJ91 2Y0SA 4A3LI 3F3FC 2JA5I 3MONA 5T6BA 4BBSI 5A2Qb 3S16I 2VF1A 3J81b 4RVFA 3I4MI 4NOZA 3S17I 4RVGA 3GTLI 1SFOI 1VQ71 1RO2A 1YIJ1 2F4MA 3GTKI 3CMA1 1P9NA 1S72Z 4DGLA 1PFTA 1KD12 2DE7A 3MZKB 2J6AA 2W04A 2B63I 3PO3S 3I561 2P3YA 2JUBA 4RV9A 4E30A 1RQFA 3OW2Y 4BXXI 3CD6Z 3HOYI 1M1K1 3I551 2PMZA 3H3VJ 4E2ZA 1JJ2Y 3S1QI 3S14I 3NH8A 3VB9A 5FLXf 3CCQ1 3CCLZ 3NDIA 3CCS1 1K8A1 2R7ZI 4MXUA 1ZH1A 4NB8A 4RVHA 5A2Qf 1Q7Y2 1NUIA 1RNIA 3FQQA 1Z02A 3RZOI 3J81f 3CCR1 3G6EZ 4A3MI 1USPA 2JA6I 3HOVI 1QF8A 3M3YI 3CCJ1 3GTMI 5D1PA 3CCVZ 1N8R2 4AYBA 5T64A 2PM9A 2RHBA 1K731 3CCEZ 3NDJA 1JWHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q f;  3JAM f;  5FLX f;  3J80 f;  3J81 f;  5IT9 f; 
#chains in the Genus database with same CATH topology
 2E2H I;  1VQ8 Z;  1VQ4 Z;  4A3J I;  2EGT A;  1M90 2;  1YI2 1;  3CC7 1;  4CL1 A;  2Q4Z A;  3KIH A;  3J80 b;  5C3E I;  1WJ2 A;  5T67 A;  3S2H I;  4A3B I;  2VPY A;  4A3D I;  3HOW I;  2DE5 A;  2H85 A;  1YIT Z;  4TNU A;  1Q16 A;  3VMH A;  5AN9 F;  2QRD B;  1VQL Z;  2K3R A;  3H0G I;  3G6E 1;  1VQN Z;  1YJW Z;  4DQY B;  1WII A;  1USP B;  4HGZ A;  2RIQ A;  4E32 A;  4QTT A;  2Q51 A;  2E2I I;  1RLY A;  3HOX I;  3HOZ I;  3IF8 A;  4E2Y A;  3S2D I;  3CCV 1;  3GTM S;  1I50 I;  2G2K A;  1FDO A;  3S1R I;  2V45 A;  3CCE 1;  3J80 f;  1VQ8 1;  1VQP Z;  1AA6 A;  2QRE B;  2O53 A;  2QA4 1;  1WZN A;  2JIO A;  1W2B Z;  1VLA A;  4A3F I;  1VQO Z;  2LIY A;  1Q7Y 1;  4X6A I;  3G71 1;  4MH4 A;  2R92 I;  4HH4 A;  4MRI A;  1Q86 2;  3CXC Z;  2PK7 A;  4A3E I;  2V8K A;  5IT9 f;  1YIT 1;  4MD7 A;  1YJN Z;  2JNY A;  3T4N B;  4HGY A;  1VQ9 1;  1VQL 1;  1YHQ Z;  1VQN 1;  2F4O A;  4E33 A;  3CC2 1;  1VQM 1;  3EED A;  1ML8 A;  1N8R 1;  4NH1 C;  4A3I I;  1S7M A;  1L1O C;  1RO0 A;  1SIW A;  1KC8 2;  2KI7 B;  2AKL A;  3QWU A;  1VQ5 Z;  3S15 I;  3CCU Z;  2NVX I;  1M90 1;  2RBL A;  3KIF A;  2QEX 1;  2HF1 A;  1Y8C A;  3NH4 A;  2IZ3 A;  3CME Z;  4A93 I;  1W2B Y;  2JS4 A;  3J7A 4;  3Q87 A;  4NBG A;  5CM2 M;  2GU2 A;  2QR1 B;  2V8I A;  1S72 1;  4NFR A;  3CXC Y;  4RS4 A;  3CCM Z;  4BBR I;  5LL6 f;  1YJN 1;  2OTJ Z;  3GCF A;  4NBA A;  1R9T I;  3CQZ I;  4QTU A;  1YHQ 1;  3LUS A;  3CD6 1;  3CC4 Z;  2JIM A;  3FQM A;  1QXF A;  5C4X I;  1KQS Z;  2QKD A;  2V8J A;  1K9M 2;  3CCL 1;  1KRL A;  3HOU I;  3NH5 A;  4NBH A;  1X3Z A;  2NVT I;  1TWG I;  1VQ5 1;  3CCU 1;  1NJI 2;  2YAD A;  5D1O A;  2QLV B;  1RO4 A;  1WCM I;  4A3C I;  2O4H A;  1Y1W I;  1TWC I;  2HU9 A;  2R6M A;  1Z01 A;  2M48 A;  2OOY B;  5IT9 b;  3S1M I;  4Y7N I;  1VQ7 Z;  1TWA I;  3GTP I;  5IP9 I;  1KD1 1;  1DL6 A;  2M6N A;  5C44 I;  4XX2 A;  2OTL Z;  1Q86 1;  4A3G I;  1WW9 A;  3I56 Z;  3MZL B;  1YUK A;  2E9H A;  3GTG I;  1X0T A;  2NAP A;  3D9X A;  2JIR A;  3I55 Z;  4E2W A;  1VQ4 1;  5C4J I;  3CCQ Z;  1KC8 1;  3CCS Z;  1Q82 2;  2VUG A;  1QVF Z;  3TE5 B;  1KQS Y;  2W03 A;  1VQK Z;  3I4N I;  1NP6 A;  2JIQ A;  4E2X A;  1Y1V I;  2JA8 I;  4NBE A;  3CCJ Z;  5D1O B;  3F3P C;  3IX0 A;  2K5R A;  4NBB A;  1YJW 1;  4RVD A;  1Q81 2;  3D6W A;  2RT9 A;  3ESW A;  3S1N I;  3JAM f;  2OOX B;  2BJO A;  2OTL 1;  1N2F A;  3CPW Z;  2ZAE B;  4Y52 I;  2P28 A;  4A3K I;  2JMO A;  1YI2 Z;  3CC7 Z;  4MD8 A;  3PO2 I;  2VUM I;  1K83 I;  1VQP 1;  2WAQ A;  3K7A I;  1K9M 1;  3GTQ I;  1VQ6 Z;  1QVF Y;  4E31 A;  1QVG Z;  2KPI A;  2RPR A;  1VQO 1;  2JA7 I;  1NJI 1;  1QYP A;  3NFZ A;  3BG0 B;  5IP7 I;  1I6H I;  2GTI A;  4MD9 A;  1VQK 1;  4NBD A;  1ZB8 A;  1Z03 A;  1TFI A;  3M4O I;  1Y1V S;  4DK1 A;  3VMI A;  4EWC A;  1M1K 2;  1LQL A;  4BY7 I;  2VPX A;  3P5J B;  3G4S Z;  5FLM I;  4BY1 I;  2NVY I;  3I07 A;  1YJ9 Z;  3CPW Y;  4S1T A;  2YU9 I;  1K8A 2;  3RZD I;  3U50 C;  3IFU A;  2IZ4 A;  2QA4 Z;  3EER A;  1Q82 1;  2R93 I;  3CME 1;  3GTJ I;  2NVQ I;  3GKQ A;  1YIJ Z;  1ZB9 A;  3PO3 I;  3FKI I;  2JR6 A;  3CMA Z;  3HKZ A;  3G71 Z;  1QVG Y;  1VQ6 1;  2E7Z A;  4NB9 A;  2DE6 A;  2GTH A;  2IV2 X;  3JAM b;  1X3W A;  2JIP A;  4MON A;  1VQ9 Z;  2OZK A;  3CCM 1;  4NBC A;  3OW2 Z;  1K73 2;  3CC2 Z;  1VQM Z;  1I3Q I;  1Q81 1;  1TWF I;  4NBF A;  2I3C A;  2WB1 A;  1TWH I;  3VMG A;  2QRC B;  2E2J I;  2OTJ 1;  3GTO I;  1YUA A;  1JJ2 Z;  3CC4 1;  2LFU A;  3G4S 1;  2QEX Z;  3VTN A;  5FLX b;  1FDI A;  3BG1 B;  3TDH B;  3CCR Z;  1YJ9 1;  2Y0S A;  4A3L I;  3F3F C;  2JA5 I;  3MON A;  5T6B A;  4BBS I;  5A2Q b;  3S16 I;  2VF1 A;  3J81 b;  4RVF A;  3I4M I;  4NOZ A;  3S17 I;  4RVG A;  3GTL I;  1SFO I;  1VQ7 1;  1RO2 A;  1YIJ 1;  2F4M A;  2VPZ A;  3GTK I;  3CMA 1;  1P9N A;  1S72 Z;  4DGL A;  1PFT A;  1KD1 2;  2DE7 A;  3MZK B;  2J6A A;  2W04 A;  2B63 I;  3PO3 S;  3I56 1;  2P3Y A;  2JUB A;  4RV9 A;  4E30 A;  1RQF A;  3OW2 Y;  4BXX I;  3CD6 Z;  3HOY I;  3D2L A;  1M1K 1;  3I55 1;  2V3V A;  2PMZ A;  3H3V J;  4E2Z A;  1JJ2 Y;  3S1Q I;  3S14 I;  2AYD A;  3NH8 A;  3VB9 A;  5FLX f;  3CCQ 1;  3CCL Z;  3NDI A;  3CCS 1;  2LEX A;  1K8A 1;  2R7Z I;  4MXU A;  1ZH1 A;  4NB8 A;  4RVH A;  5A2Q f;  1Q7Y 2;  1NUI A;  1RNI A;  3FQQ A;  2VPW A;  1Z02 A;  3RZO I;  3J81 f;  3CCR 1;  3G6E Z;  4A3M I;  1USP A;  3IR7 A;  2JA6 I;  3HOV I;  1QF8 A;  3M3Y I;  3CCJ 1;  3GTM I;  5D1P A;  3CCV Z;  1N8R 2;  4AYB A;  5T64 A;  2PM9 A;  2RHB A;  1K73 1;  3CCE Z;  3NDJ A;  1JWH C; 
#chains in the Genus database with same CATH homology
 2E2H I;  1VQ8 Z;  1VQ4 Z;  4A3J I;  2EGT A;  1M90 2;  1YI2 1;  3CC7 1;  4CL1 A;  2Q4Z A;  3KIH A;  3J80 b;  5C3E I;  5T67 A;  3S2H I;  4A3B I;  4A3D I;  3HOW I;  2DE5 A;  2H85 A;  1YIT Z;  4TNU A;  3VMH A;  5AN9 F;  2QRD B;  1VQL Z;  2K3R A;  3H0G I;  3G6E 1;  1VQN Z;  1YJW Z;  4DQY B;  1WII A;  1USP B;  4HGZ A;  2RIQ A;  4E32 A;  4QTT A;  2Q51 A;  2E2I I;  1RLY A;  3HOX I;  3HOZ I;  3IF8 A;  4E2Y A;  3S2D I;  3CCV 1;  3GTM S;  1I50 I;  2G2K A;  3S1R I;  3CCE 1;  3J80 f;  1VQ8 1;  1VQP Z;  2QRE B;  2O53 A;  2QA4 1;  1W2B Z;  1VLA A;  4A3F I;  1VQO Z;  2LIY A;  1Q7Y 1;  4X6A I;  3G71 1;  4MH4 A;  2R92 I;  4HH4 A;  4MRI A;  1Q86 2;  3CXC Z;  2PK7 A;  4A3E I;  2V8K A;  5IT9 f;  1YIT 1;  4MD7 A;  1YJN Z;  2JNY A;  3T4N B;  4HGY A;  1VQ9 1;  1VQL 1;  1YHQ Z;  1VQN 1;  2F4O A;  4E33 A;  3CC2 1;  1VQM 1;  3EED A;  1ML8 A;  1N8R 1;  4NH1 C;  4A3I I;  1S7M A;  1L1O C;  1RO0 A;  1KC8 2;  2KI7 B;  2AKL A;  3QWU A;  1VQ5 Z;  3S15 I;  3CCU Z;  2NVX I;  1M90 1;  2RBL A;  3KIF A;  2QEX 1;  2HF1 A;  3NH4 A;  2IZ3 A;  3CME Z;  4A93 I;  1W2B Y;  2JS4 A;  3J7A 4;  3Q87 A;  4NBG A;  5CM2 M;  2GU2 A;  2QR1 B;  2V8I A;  1S72 1;  4NFR A;  3CXC Y;  4RS4 A;  3CCM Z;  4BBR I;  5LL6 f;  1YJN 1;  2OTJ Z;  3GCF A;  4NBA A;  1R9T I;  3CQZ I;  4QTU A;  1YHQ 1;  3LUS A;  3CD6 1;  3CC4 Z;  3FQM A;  5C4X I;  1KQS Z;  2QKD A;  2V8J A;  1K9M 2;  3CCL 1;  1KRL A;  3HOU I;  3NH5 A;  4NBH A;  1X3Z A;  2NVT I;  1TWG I;  1VQ5 1;  3CCU 1;  1NJI 2;  2YAD A;  5D1O A;  2QLV B;  1RO4 A;  1WCM I;  4A3C I;  2O4H A;  1Y1W I;  1TWC I;  2HU9 A;  2R6M A;  1Z01 A;  2M48 A;  2OOY B;  5IT9 b;  3S1M I;  4Y7N I;  1VQ7 Z;  1TWA I;  3GTP I;  5IP9 I;  1KD1 1;  1DL6 A;  2M6N A;  5C44 I;  4XX2 A;  2OTL Z;  1Q86 1;  4A3G I;  1WW9 A;  3I56 Z;  3MZL B;  1YUK A;  2E9H A;  3GTG I;  1X0T A;  3D9X A;  3I55 Z;  4E2W A;  1VQ4 1;  5C4J I;  3CCQ Z;  1KC8 1;  3CCS Z;  1Q82 2;  2VUG A;  1QVF Z;  3TE5 B;  1KQS Y;  2W03 A;  1VQK Z;  3I4N I;  1NP6 A;  4E2X A;  1Y1V I;  2JA8 I;  4NBE A;  3CCJ Z;  5D1O B;  3F3P C;  3IX0 A;  2K5R A;  4NBB A;  1YJW 1;  4RVD A;  1Q81 2;  3D6W A;  2RT9 A;  3ESW A;  3S1N I;  3JAM f;  2OOX B;  2BJO A;  2OTL 1;  1N2F A;  3CPW Z;  2ZAE B;  4Y52 I;  2P28 A;  4A3K I;  2JMO A;  1YI2 Z;  3CC7 Z;  4MD8 A;  3PO2 I;  2VUM I;  1K83 I;  1VQP 1;  2WAQ A;  3K7A I;  1K9M 1;  3GTQ I;  1VQ6 Z;  1QVF Y;  4E31 A;  1QVG Z;  2KPI A;  2RPR A;  1VQO 1;  2JA7 I;  1NJI 1;  1QYP A;  3NFZ A;  3BG0 B;  5IP7 I;  1I6H I;  2GTI A;  4MD9 A;  1VQK 1;  4NBD A;  1ZB8 A;  1Z03 A;  1TFI A;  3M4O I;  1Y1V S;  4DK1 A;  3VMI A;  4EWC A;  1M1K 2;  1LQL A;  4BY7 I;  3P5J B;  3G4S Z;  5FLM I;  4BY1 I;  2NVY I;  3I07 A;  1YJ9 Z;  3CPW Y;  4S1T A;  2YU9 I;  1K8A 2;  3RZD I;  3U50 C;  3IFU A;  2IZ4 A;  2QA4 Z;  3EER A;  1Q82 1;  2R93 I;  3CME 1;  3GTJ I;  2NVQ I;  3GKQ A;  1YIJ Z;  1ZB9 A;  3PO3 I;  3FKI I;  2JR6 A;  3CMA Z;  3HKZ A;  3G71 Z;  1QVG Y;  1VQ6 1;  4NB9 A;  2DE6 A;  2GTH A;  3JAM b;  1X3W A;  4MON A;  1VQ9 Z;  2OZK A;  3CCM 1;  4NBC A;  3OW2 Z;  1K73 2;  3CC2 Z;  1VQM Z;  1I3Q I;  1Q81 1;  1TWF I;  4NBF A;  2I3C A;  2WB1 A;  1TWH I;  3VMG A;  2QRC B;  2E2J I;  2OTJ 1;  3GTO I;  1YUA A;  1JJ2 Z;  3CC4 1;  2LFU A;  3G4S 1;  2QEX Z;  3VTN A;  5FLX b;  3BG1 B;  3TDH B;  3CCR Z;  1YJ9 1;  2Y0S A;  4A3L I;  3F3F C;  2JA5 I;  3MON A;  5T6B A;  4BBS I;  5A2Q b;  3S16 I;  2VF1 A;  3J81 b;  4RVF A;  3I4M I;  4NOZ A;  3S17 I;  4RVG A;  3GTL I;  1SFO I;  1VQ7 1;  1RO2 A;  1YIJ 1;  2F4M A;  3GTK I;  3CMA 1;  1P9N A;  1S72 Z;  4DGL A;  1PFT A;  1KD1 2;  2DE7 A;  3MZK B;  2J6A A;  2W04 A;  2B63 I;  3PO3 S;  3I56 1;  2P3Y A;  2JUB A;  4RV9 A;  4E30 A;  1RQF A;  3OW2 Y;  4BXX I;  3CD6 Z;  3HOY I;  1M1K 1;  3I55 1;  2PMZ A;  3H3V J;  4E2Z A;  1JJ2 Y;  3S1Q I;  3S14 I;  3NH8 A;  3VB9 A;  5FLX f;  3CCQ 1;  3CCL Z;  3NDI A;  3CCS 1;  1K8A 1;  2R7Z I;  4MXU A;  1ZH1 A;  4NB8 A;  4RVH A;  5A2Q f;  1Q7Y 2;  1NUI A;  1RNI A;  3FQQ A;  1Z02 A;  3RZO I;  3J81 f;  3CCR 1;  3G6E Z;  4A3M I;  1USP A;  2JA6 I;  3HOV I;  1QF8 A;  3M3Y I;  3CCJ 1;  3GTM I;  5D1P A;  3CCV Z;  1N8R 2;  4AYB A;  5T64 A;  2PM9 A;  2RHB A;  1K73 1;  3CCE Z;  3NDJ A;  1JWH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...