5IT9f

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 1
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9f00
5A2Qf 3JAMf 5FLXf 3J80f 5IT9f 3J81f
chains in the Genus database with same CATH superfamily
3CCRZ 1YJ9Z 1QXFA 4QTUA 4BY1I 1DL6A 3IR7A 3MZKB 1YIJZ 1K9M2 1SIWA 3PO3I 1VQK1 3CCQZ 4RVDA 5FLXf 1QVFY 1I3QI 2LIYA 2M6NA 1W2BY 4Y52I 3MONA 2GTIA 2F4OA 4NBDA 4MD7A 1VQKZ 3I4MI 4MD8A 3I551 1Y8CA 1KQSY 3VMIA 1VQ41 1VQ81 4NBAA 3M4OI 2YADA 4NH1C 3ESWA 3HOYI 3PO3S 1Q16A 2JA5I 2IZ3A 5D1OB 3CC21 4BY7I 1NP6A 1TWGI 2QR1B 2LFUA 2RHBA 3CCS1 4BXXI 2P28A 2VPWA 1KRLA 2R93I 3CXCY 2IV2X 2ZAEB 3GTOI 3G6E1 1USPB 2QRDB 2OTJZ 2RIQA 4E32A 1FDIA 4RV9A 1TWFI 3CMA1 2M48A 1VQOZ 1Q861 2VPXA 4E2YA 1YJN1 2K5RA 2JMOA 3FQQA 3J80f 2Q4ZA 3CMAZ 3IF8A 3GTKI 5IT9f 1X0TA 2JA7I 1QVFZ 4X6AI 3G4S1 1K8A2 1Q7Y2 1W2BZ 2I3CA 1L1OC 2OTL1 3NH5A 4RS4A 1RO2A 3CCLZ 1JJ2Y 2V3VA 2R92I 4TNUA 1YUKA 3G4SZ 3D2LA 2JIMA 4MRIA 2OTLZ 1QVGY 3NDIA 2HU9A 2JNYA 1YHQ1 2O53A 5A2Qb 3I561 2GU2A 3BG0B 1KC81 3CCV1 1WIIA 2OOXB 1WJ2A 3T4NB 1Q812 1VQ91 4NBCA 1K8A1 1Q7Y1 2KI7B 3CCJZ 1Q822 1VQ9Z 3S14I 2NVQI 2DE6A 1QF8A 5T6BA 3RZOI 1I6HI 1TWHI 3S17I 3M3YI 2YU9I 4E33A 4A3LI 4XX2A 1YJW1 3G711 2JA6I 3VTNA 2E2HI 2QREB 1Q811 5IP9I 2V8IA 5T64A 2PMZA 4HGZA 4NBEA 4E31A 1YJWZ 3G71Z 3TE5B 2WB1A 5C4JI 1Q821 1M1K2 2WAQA 3I55Z 3GCFA 3PO2I 4A3BI 1JJ2Z 1Q862 1VQ8Z 1VQ4Z 3CC71 2QLVB 3HKZA 2K3RA 2R7ZI 1Z02A 1N8R2 4NBGA 2NVXI 1QVGZ 5AN9F 3MZLB 4E2ZA 3S1MI 3S1NI 2B63I 1P9NA 3CC7Z 3I07A 1VQ71 2JUBA 3S2DI 1TWCI 2JIRA 2QRCB 4QTTA 3JAMb 3CC2Z 5T67A 3TDHB 3CCSZ 3OW2Y 1Z03A 4A3EI 2W03A 1Z01A 1M1K1 1USPA 3G6EZ 5LL6f 3D6WA 1VQ61 3BG1B 3CCM1 4DK1A 5FLMI 2VPYA 1N8R1 1JWHC 2BJOA 3S1RI 1KC82 1VQ6Z 4MH4A 3Q87A 3CCMZ 3KIHA 3F3PC 3GTGI 1YJNZ 3CC41 2F4MA 2LEXA 3VMGA 1YIT1 3CME1 1M902 3CC4Z 3LUSA 3NH8A 2J6AA 2G2KA 2VF1A 3HOZI 3VB9A 3VMHA 3IFUA 3CQZI 3U50C 3CD61 4A3GI 2QEX1 1VQ51 5IP7I 3NH4A 3NFZA 1YHQZ 3J81b 4RVHA 3CD6Z 5A2Qf 5C44I 3I56Z 4E30A 3CCVZ 1Y1WI 1M901 2JR6A 3CCE1 4A3FI 5C3EI 1VQM1 3KIFA 3H3VJ 1I50I 3FKII 3NDJA 3OW2Z 4Y7NI 1RLYA 3GTJI 1PFTA 3F3FC 2V45A 1TWAI 3D9XA 2KPIA 4NFRA 4A93I 4BBRI 3S15I 3HOWI 1YJ91 2OZKA 2JIQA 5FLXb 2PM9A 1WW9A 1AA6A 2NVTI 1K731 2OOYB 3P5JB 1NUIA 2QKDA 3I4NI 2DE7A 2V8JA 1VQL1 2AYDA 1K83I 2IZ4A 4DQYB 3EERA 2E7ZA 2Y0SA 4A3CI 4HH4A 1VQLZ 2RPRA 4CL1A 3HOXI 1ZB8A 2E9HA 3GTPI 4NOZA 2NAPA 4MONA 5D1OA 2AKLA 4AYBA 1YI21 1KD11 3CPWY 3S1QI 1NJI2 4A3MI 4E2WA 2R6MA 1VQ7Z 1RO4A 4NB9A 4RVFA 1R9TI 1VQP1 1YI2Z 2W04A 1K9M1 1N2FA 1RQFA 3GKQA 3JAMf 3RZDI 3FQMA 2EGTA 1S721 1TFIA 1VQPZ 3H0GI 3GTLI 2H85A 3S2HI 4S1TA 1ML8A 2NVYI 2OTJ1 1WCMI 1S7MA 2VUGA 2VUMI 1S72Z 1VQO1 1RNIA 1X3WA 2RBLA 3J80b 5IT9b 4MXUA 1NJI1 3HOUI 2E2II 2JA8I 1X3ZA 4EWCA 2O4HA 1YITZ 3GTMI 4A3DI 4NBHA 3GTQI 3CMEZ 3J7A4 3CCL1 4NBBA 3S16I 1VLAA 4NBFA 3K7AI 4RVGA 3HOVI 4BBSI 5CM2M 2JIPA 2JIOA 4NB8A 2QEXZ 1VQ5Z 1KQSZ 2HF1A 1YUAA 1K732 1VQN1 1RO0A 2VPZA 3CCU1 3CPWZ 4E2XA 1Y1VI 4A3KI 3GTMS 1ZB9A 1FDOA 4A3II 3J81f 3EEDA 2Q51A 1WZNA 2DE5A 5D1PA 2V8KA 3QWUA 1VQNZ 2RT9A 3CCUZ 3IX0A 2P3YA 1SFOI 3CCJ1 4DGLA 1ZH1A 3CCEZ 2QA41 1VQMZ 2E2JI 2JS4A 3CCR1 5C4XI 2QA4Z 4HGYA 1LQLA 2GTHA 4A3JI 3CXCZ 1KD12 1YIJ1 2PK7A 4MD9A 1QYPA 1Y1VS 3CCQ1
chains in the Genus database with same CATH topology
3CCRZ 1YJ9Z 4QTUA 4BY1I 1DL6A 3MZKB 1YIJZ 1K9M2 3PO3I 1VQK1 3CCQZ 4RVDA 5FLXf 1QVFY 1I3QI 2LIYA 2M6NA 1W2BY 4Y52I 3MONA 2GTIA 2F4OA 4NBDA 4MD7A 1VQKZ 3I4MI 4MD8A 3I551 1KQSY 3VMIA 1VQ41 1VQ81 4NBAA 3M4OI 2YADA 4NH1C 3ESWA 3HOYI 3PO3S 2JA5I 2IZ3A 5D1OB 3CC21 4BY7I 1NP6A 1TWGI 2QR1B 2LFUA 2RHBA 3CCS1 4BXXI 2P28A 1KRLA 2R93I 3CXCY 2ZAEB 3GTOI 3G6E1 1USPB 2QRDB 2OTJZ 2RIQA 4E32A 4RV9A 1TWFI 3CMA1 2M48A 1VQOZ 1Q861 4E2YA 1YJN1 2K5RA 2JMOA 3FQQA 3J80f 2Q4ZA 3CMAZ 3IF8A 3GTKI 5IT9f 1X0TA 2JA7I 1QVFZ 4X6AI 3G4S1 1K8A2 1Q7Y2 1W2BZ 2I3CA 1L1OC 2OTL1 3NH5A 4RS4A 1RO2A 3CCLZ 1JJ2Y 2R92I 4TNUA 1YUKA 3G4SZ 4MRIA 2OTLZ 1QVGY 3NDIA 2HU9A 2JNYA 1YHQ1 2O53A 5A2Qb 3I561 2GU2A 3BG0B 1KC81 3CCV1 1WIIA 2OOXB 3T4NB 1Q812 1VQ91 4NBCA 1K8A1 1Q7Y1 2KI7B 3CCJZ 1Q822 1VQ9Z 3S14I 2NVQI 2DE6A 1QF8A 5T6BA 3RZOI 1I6HI 1TWHI 3S17I 3M3YI 2YU9I 4E33A 4A3LI 4XX2A 1YJW1 3G711 2JA6I 3VTNA 2E2HI 2QREB 1Q811 5IP9I 2V8IA 5T64A 2PMZA 4HGZA 4NBEA 4E31A 1YJWZ 3G71Z 3TE5B 2WB1A 5C4JI 1Q821 1M1K2 2WAQA 3I55Z 3GCFA 3PO2I 4A3BI 1JJ2Z 1Q862 1VQ8Z 1VQ4Z 3CC71 2QLVB 3HKZA 2K3RA 2R7ZI 1Z02A 1N8R2 4NBGA 2NVXI 1QVGZ 5AN9F 3MZLB 4E2ZA 3S1MI 3S1NI 2B63I 1P9NA 3CC7Z 3I07A 1VQ71 2JUBA 3S2DI 1TWCI 4QTTA 2QRCB 3JAMb 3CC2Z 5T67A 3TDHB 3CCSZ 3OW2Y 1Z03A 4A3EI 2W03A 1Z01A 1M1K1 1USPA 3G6EZ 5LL6f 3D6WA 1VQ61 3BG1B 3CCM1 4DK1A 5FLMI 1N8R1 1JWHC 2BJOA 3S1RI 1KC82 1VQ6Z 4MH4A 3Q87A 3CCMZ 3KIHA 3F3PC 3GTGI 1YJNZ 3CC41 2F4MA 3VMGA 1YIT1 3CME1 1M902 3CC4Z 3LUSA 3NH8A 2J6AA 2G2KA 2VF1A 3HOZI 3VB9A 3VMHA 3IFUA 3CQZI 3U50C 3CD61 4A3GI 2QEX1 1VQ51 5IP7I 3NH4A 3NFZA 1YHQZ 3J81b 4RVHA 3CD6Z 5A2Qf 5C44I 3I56Z 4E30A 3CCVZ 1Y1WI 1M901 2JR6A 3CCE1 4A3FI 5C3EI 1VQM1 3KIFA 3H3VJ 1I50I 3FKII 3NDJA 3OW2Z 4Y7NI 1RLYA 3GTJI 1PFTA 3F3FC 1TWAI 3D9XA 2KPIA 4NFRA 4A93I 4BBRI 3S15I 3HOWI 1YJ91 2OZKA 5FLXb 2PM9A 1WW9A 2NVTI 1K731 2OOYB 3P5JB 1NUIA 2QKDA 3I4NI 2DE7A 2V8JA 1VQL1 1K83I 2IZ4A 4DQYB 3EERA 2Y0SA 4A3CI 4HH4A 1VQLZ 2RPRA 4CL1A 3HOXI 1ZB8A 2E9HA 3GTPI 4NOZA 4MONA 5D1OA 2AKLA 4AYBA 1YI21 1KD11 3CPWY 3S1QI 1NJI2 4A3MI 4E2WA 2R6MA 1VQ7Z 1RO4A 4NB9A 4RVFA 1R9TI 1VQP1 1YI2Z 2W04A 1K9M1 1N2FA 1RQFA 3GKQA 3JAMf 3RZDI 3FQMA 2EGTA 1S721 1TFIA 1VQPZ 3H0GI 3GTLI 2H85A 3S2HI 4S1TA 1ML8A 2NVYI 2OTJ1 1WCMI 1S7MA 2VUGA 2VUMI 1S72Z 1VQO1 1RNIA 1X3WA 2RBLA 3J80b 5IT9b 4MXUA 1NJI1 3HOUI 2E2II 2JA8I 1X3ZA 4EWCA 2O4HA 1YITZ 3GTMI 4A3DI 4NBHA 3GTQI 3CMEZ 3J7A4 3CCL1 4NBBA 3S16I 1VLAA 4NBFA 3K7AI 4RVGA 3HOVI 4BBSI 5CM2M 4NB8A 2QEXZ 1VQ5Z 1KQSZ 2HF1A 1YUAA 1K732 1VQN1 1RO0A 4A3KI 3CCU1 3CPWZ 4E2XA 1Y1VI 3GTMS 1ZB9A 4A3II 3J81f 3EEDA 2Q51A 2DE5A 5D1PA 2V8KA 3QWUA 1VQNZ 2RT9A 3CCUZ 3IX0A 2P3YA 1SFOI 3CCJ1 4DGLA 1ZH1A 3CCEZ 2QA41 1VQMZ 2E2JI 2JS4A 3CCR1 5C4XI 2QA4Z 4HGYA 1LQLA 2GTHA 4A3JI 3CXCZ 1KD12 1YIJ1 2PK7A 4MD9A 1QYPA 1Y1VS 3CCQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q f;  3JAM f;  5FLX f;  3J80 f;  5IT9 f;  3J81 f; 
#chains in the Genus database with same CATH topology
 3CCR Z;  1YJ9 Z;  1QXF A;  4QTU A;  4BY1 I;  1DL6 A;  3IR7 A;  3MZK B;  1YIJ Z;  1K9M 2;  1SIW A;  3PO3 I;  1VQK 1;  3CCQ Z;  4RVD A;  5FLX f;  1QVF Y;  1I3Q I;  2LIY A;  2M6N A;  1W2B Y;  4Y52 I;  3MON A;  2GTI A;  2F4O A;  4NBD A;  4MD7 A;  1VQK Z;  3I4M I;  4MD8 A;  3I55 1;  1Y8C A;  1KQS Y;  3VMI A;  1VQ4 1;  1VQ8 1;  4NBA A;  3M4O I;  2YAD A;  4NH1 C;  3ESW A;  3HOY I;  3PO3 S;  1Q16 A;  2JA5 I;  2IZ3 A;  5D1O B;  3CC2 1;  4BY7 I;  1NP6 A;  1TWG I;  2QR1 B;  2LFU A;  2RHB A;  3CCS 1;  4BXX I;  2P28 A;  2VPW A;  1KRL A;  2R93 I;  3CXC Y;  2IV2 X;  2ZAE B;  3GTO I;  3G6E 1;  1USP B;  2QRD B;  2OTJ Z;  2RIQ A;  4E32 A;  1FDI A;  4RV9 A;  1TWF I;  3CMA 1;  2M48 A;  1VQO Z;  1Q86 1;  2VPX A;  4E2Y A;  1YJN 1;  2K5R A;  2JMO A;  3FQQ A;  3J80 f;  2Q4Z A;  3CMA Z;  3IF8 A;  3GTK I;  5IT9 f;  1X0T A;  2JA7 I;  1QVF Z;  4X6A I;  3G4S 1;  1K8A 2;  1Q7Y 2;  1W2B Z;  2I3C A;  1L1O C;  2OTL 1;  3NH5 A;  4RS4 A;  1RO2 A;  3CCL Z;  1JJ2 Y;  2V3V A;  2R92 I;  4TNU A;  1YUK A;  3G4S Z;  3D2L A;  2JIM A;  4MRI A;  2OTL Z;  1QVG Y;  3NDI A;  2HU9 A;  2JNY A;  1YHQ 1;  2O53 A;  5A2Q b;  3I56 1;  2GU2 A;  3BG0 B;  1KC8 1;  3CCV 1;  1WII A;  2OOX B;  1WJ2 A;  3T4N B;  1Q81 2;  1VQ9 1;  4NBC A;  1K8A 1;  1Q7Y 1;  2KI7 B;  3CCJ Z;  1Q82 2;  1VQ9 Z;  3S14 I;  2NVQ I;  2DE6 A;  1QF8 A;  5T6B A;  3RZO I;  1I6H I;  1TWH I;  3S17 I;  3M3Y I;  2YU9 I;  4E33 A;  4A3L I;  4XX2 A;  1YJW 1;  3G71 1;  2JA6 I;  3VTN A;  2E2H I;  2QRE B;  1Q81 1;  5IP9 I;  2V8I A;  5T64 A;  2PMZ A;  4HGZ A;  4NBE A;  4E31 A;  1YJW Z;  3G71 Z;  3TE5 B;  2WB1 A;  5C4J I;  1Q82 1;  1M1K 2;  2WAQ A;  3I55 Z;  3GCF A;  3PO2 I;  4A3B I;  1JJ2 Z;  1Q86 2;  1VQ8 Z;  1VQ4 Z;  3CC7 1;  2QLV B;  3HKZ A;  2K3R A;  2R7Z I;  1Z02 A;  1N8R 2;  4NBG A;  2NVX I;  1QVG Z;  5AN9 F;  3MZL B;  4E2Z A;  3S1M I;  3S1N I;  2B63 I;  1P9N A;  3CC7 Z;  3I07 A;  1VQ7 1;  2JUB A;  3S2D I;  1TWC I;  2JIR A;  2QRC B;  4QTT A;  3JAM b;  3CC2 Z;  5T67 A;  3TDH B;  3CCS Z;  3OW2 Y;  1Z03 A;  4A3E I;  2W03 A;  1Z01 A;  1M1K 1;  1USP A;  3G6E Z;  5LL6 f;  3D6W A;  1VQ6 1;  3BG1 B;  3CCM 1;  4DK1 A;  5FLM I;  2VPY A;  1N8R 1;  1JWH C;  2BJO A;  3S1R I;  1KC8 2;  1VQ6 Z;  4MH4 A;  3Q87 A;  3CCM Z;  3KIH A;  3F3P C;  3GTG I;  1YJN Z;  3CC4 1;  2F4M A;  2LEX A;  3VMG A;  1YIT 1;  3CME 1;  1M90 2;  3CC4 Z;  3LUS A;  3NH8 A;  2J6A A;  2G2K A;  2VF1 A;  3HOZ I;  3VB9 A;  3VMH A;  3IFU A;  3CQZ I;  3U50 C;  3CD6 1;  4A3G I;  2QEX 1;  1VQ5 1;  5IP7 I;  3NH4 A;  3NFZ A;  1YHQ Z;  3J81 b;  4RVH A;  3CD6 Z;  5A2Q f;  5C44 I;  3I56 Z;  4E30 A;  3CCV Z;  1Y1W I;  1M90 1;  2JR6 A;  3CCE 1;  4A3F I;  5C3E I;  1VQM 1;  3KIF A;  3H3V J;  1I50 I;  3FKI I;  3NDJ A;  3OW2 Z;  4Y7N I;  1RLY A;  3GTJ I;  1PFT A;  3F3F C;  2V45 A;  1TWA I;  3D9X A;  2KPI A;  4NFR A;  4A93 I;  4BBR I;  3S15 I;  3HOW I;  1YJ9 1;  2OZK A;  2JIQ A;  5FLX b;  2PM9 A;  1WW9 A;  1AA6 A;  2NVT I;  1K73 1;  2OOY B;  3P5J B;  1NUI A;  2QKD A;  3I4N I;  2DE7 A;  2V8J A;  1VQL 1;  2AYD A;  1K83 I;  2IZ4 A;  4DQY B;  3EER A;  2E7Z A;  2Y0S A;  4A3C I;  4HH4 A;  1VQL Z;  2RPR A;  4CL1 A;  3HOX I;  1ZB8 A;  2E9H A;  3GTP I;  4NOZ A;  2NAP A;  4MON A;  5D1O A;  2AKL A;  4AYB A;  1YI2 1;  1KD1 1;  3CPW Y;  3S1Q I;  1NJI 2;  4A3M I;  4E2W A;  2R6M A;  1VQ7 Z;  1RO4 A;  4NB9 A;  4RVF A;  1R9T I;  1VQP 1;  1YI2 Z;  2W04 A;  1K9M 1;  1N2F A;  1RQF A;  3GKQ A;  3JAM f;  3RZD I;  3FQM A;  2EGT A;  1S72 1;  1TFI A;  1VQP Z;  3H0G I;  3GTL I;  2H85 A;  3S2H I;  4S1T A;  1ML8 A;  2NVY I;  2OTJ 1;  1WCM I;  1S7M A;  2VUG A;  2VUM I;  1S72 Z;  1VQO 1;  1RNI A;  1X3W A;  2RBL A;  3J80 b;  5IT9 b;  4MXU A;  1NJI 1;  3HOU I;  2E2I I;  2JA8 I;  1X3Z A;  4EWC A;  2O4H A;  1YIT Z;  3GTM I;  4A3D I;  4NBH A;  3GTQ I;  3CME Z;  3J7A 4;  3CCL 1;  4NBB A;  3S16 I;  1VLA A;  4NBF A;  3K7A I;  4RVG A;  3HOV I;  4BBS I;  5CM2 M;  2JIP A;  2JIO A;  4NB8 A;  2QEX Z;  1VQ5 Z;  1KQS Z;  2HF1 A;  1YUA A;  1K73 2;  1VQN 1;  1RO0 A;  2VPZ A;  3CCU 1;  3CPW Z;  4E2X A;  1Y1V I;  4A3K I;  3GTM S;  1ZB9 A;  1FDO A;  4A3I I;  3J81 f;  3EED A;  2Q51 A;  1WZN A;  2DE5 A;  5D1P A;  2V8K A;  3QWU A;  1VQN Z;  2RT9 A;  3CCU Z;  3IX0 A;  2P3Y A;  1SFO I;  3CCJ 1;  4DGL A;  1ZH1 A;  3CCE Z;  2QA4 1;  1VQM Z;  2E2J I;  2JS4 A;  3CCR 1;  5C4X I;  2QA4 Z;  4HGY A;  1LQL A;  2GTH A;  4A3J I;  3CXC Z;  1KD1 2;  1YIJ 1;  2PK7 A;  4MD9 A;  1QYP A;  1Y1V S;  3CCQ 1; 
#chains in the Genus database with same CATH homology
 3CCR Z;  1YJ9 Z;  4QTU A;  4BY1 I;  1DL6 A;  3MZK B;  1YIJ Z;  1K9M 2;  3PO3 I;  1VQK 1;  3CCQ Z;  4RVD A;  5FLX f;  1QVF Y;  1I3Q I;  2LIY A;  2M6N A;  1W2B Y;  4Y52 I;  3MON A;  2GTI A;  2F4O A;  4NBD A;  4MD7 A;  1VQK Z;  3I4M I;  4MD8 A;  3I55 1;  1KQS Y;  3VMI A;  1VQ4 1;  1VQ8 1;  4NBA A;  3M4O I;  2YAD A;  4NH1 C;  3ESW A;  3HOY I;  3PO3 S;  2JA5 I;  2IZ3 A;  5D1O B;  3CC2 1;  4BY7 I;  1NP6 A;  1TWG I;  2QR1 B;  2LFU A;  2RHB A;  3CCS 1;  4BXX I;  2P28 A;  1KRL A;  2R93 I;  3CXC Y;  2ZAE B;  3GTO I;  3G6E 1;  1USP B;  2QRD B;  2OTJ Z;  2RIQ A;  4E32 A;  4RV9 A;  1TWF I;  3CMA 1;  2M48 A;  1VQO Z;  1Q86 1;  4E2Y A;  1YJN 1;  2K5R A;  2JMO A;  3FQQ A;  3J80 f;  2Q4Z A;  3CMA Z;  3IF8 A;  3GTK I;  5IT9 f;  1X0T A;  2JA7 I;  1QVF Z;  4X6A I;  3G4S 1;  1K8A 2;  1Q7Y 2;  1W2B Z;  2I3C A;  1L1O C;  2OTL 1;  3NH5 A;  4RS4 A;  1RO2 A;  3CCL Z;  1JJ2 Y;  2R92 I;  4TNU A;  1YUK A;  3G4S Z;  4MRI A;  2OTL Z;  1QVG Y;  3NDI A;  2HU9 A;  2JNY A;  1YHQ 1;  2O53 A;  5A2Q b;  3I56 1;  2GU2 A;  3BG0 B;  1KC8 1;  3CCV 1;  1WII A;  2OOX B;  3T4N B;  1Q81 2;  1VQ9 1;  4NBC A;  1K8A 1;  1Q7Y 1;  2KI7 B;  3CCJ Z;  1Q82 2;  1VQ9 Z;  3S14 I;  2NVQ I;  2DE6 A;  1QF8 A;  5T6B A;  3RZO I;  1I6H I;  1TWH I;  3S17 I;  3M3Y I;  2YU9 I;  4E33 A;  4A3L I;  4XX2 A;  1YJW 1;  3G71 1;  2JA6 I;  3VTN A;  2E2H I;  2QRE B;  1Q81 1;  5IP9 I;  2V8I A;  5T64 A;  2PMZ A;  4HGZ A;  4NBE A;  4E31 A;  1YJW Z;  3G71 Z;  3TE5 B;  2WB1 A;  5C4J I;  1Q82 1;  1M1K 2;  2WAQ A;  3I55 Z;  3GCF A;  3PO2 I;  4A3B I;  1JJ2 Z;  1Q86 2;  1VQ8 Z;  1VQ4 Z;  3CC7 1;  2QLV B;  3HKZ A;  2K3R A;  2R7Z I;  1Z02 A;  1N8R 2;  4NBG A;  2NVX I;  1QVG Z;  5AN9 F;  3MZL B;  4E2Z A;  3S1M I;  3S1N I;  2B63 I;  1P9N A;  3CC7 Z;  3I07 A;  1VQ7 1;  2JUB A;  3S2D I;  1TWC I;  4QTT A;  2QRC B;  3JAM b;  3CC2 Z;  5T67 A;  3TDH B;  3CCS Z;  3OW2 Y;  1Z03 A;  4A3E I;  2W03 A;  1Z01 A;  1M1K 1;  1USP A;  3G6E Z;  5LL6 f;  3D6W A;  1VQ6 1;  3BG1 B;  3CCM 1;  4DK1 A;  5FLM I;  1N8R 1;  1JWH C;  2BJO A;  3S1R I;  1KC8 2;  1VQ6 Z;  4MH4 A;  3Q87 A;  3CCM Z;  3KIH A;  3F3P C;  3GTG I;  1YJN Z;  3CC4 1;  2F4M A;  3VMG A;  1YIT 1;  3CME 1;  1M90 2;  3CC4 Z;  3LUS A;  3NH8 A;  2J6A A;  2G2K A;  2VF1 A;  3HOZ I;  3VB9 A;  3VMH A;  3IFU A;  3CQZ I;  3U50 C;  3CD6 1;  4A3G I;  2QEX 1;  1VQ5 1;  5IP7 I;  3NH4 A;  3NFZ A;  1YHQ Z;  3J81 b;  4RVH A;  3CD6 Z;  5A2Q f;  5C44 I;  3I56 Z;  4E30 A;  3CCV Z;  1Y1W I;  1M90 1;  2JR6 A;  3CCE 1;  4A3F I;  5C3E I;  1VQM 1;  3KIF A;  3H3V J;  1I50 I;  3FKI I;  3NDJ A;  3OW2 Z;  4Y7N I;  1RLY A;  3GTJ I;  1PFT A;  3F3F C;  1TWA I;  3D9X A;  2KPI A;  4NFR A;  4A93 I;  4BBR I;  3S15 I;  3HOW I;  1YJ9 1;  2OZK A;  5FLX b;  2PM9 A;  1WW9 A;  2NVT I;  1K73 1;  2OOY B;  3P5J B;  1NUI A;  2QKD A;  3I4N I;  2DE7 A;  2V8J A;  1VQL 1;  1K83 I;  2IZ4 A;  4DQY B;  3EER A;  2Y0S A;  4A3C I;  4HH4 A;  1VQL Z;  2RPR A;  4CL1 A;  3HOX I;  1ZB8 A;  2E9H A;  3GTP I;  4NOZ A;  4MON A;  5D1O A;  2AKL A;  4AYB A;  1YI2 1;  1KD1 1;  3CPW Y;  3S1Q I;  1NJI 2;  4A3M I;  4E2W A;  2R6M A;  1VQ7 Z;  1RO4 A;  4NB9 A;  4RVF A;  1R9T I;  1VQP 1;  1YI2 Z;  2W04 A;  1K9M 1;  1N2F A;  1RQF A;  3GKQ A;  3JAM f;  3RZD I;  3FQM A;  2EGT A;  1S72 1;  1TFI A;  1VQP Z;  3H0G I;  3GTL I;  2H85 A;  3S2H I;  4S1T A;  1ML8 A;  2NVY I;  2OTJ 1;  1WCM I;  1S7M A;  2VUG A;  2VUM I;  1S72 Z;  1VQO 1;  1RNI A;  1X3W A;  2RBL A;  3J80 b;  5IT9 b;  4MXU A;  1NJI 1;  3HOU I;  2E2I I;  2JA8 I;  1X3Z A;  4EWC A;  2O4H A;  1YIT Z;  3GTM I;  4A3D I;  4NBH A;  3GTQ I;  3CME Z;  3J7A 4;  3CCL 1;  4NBB A;  3S16 I;  1VLA A;  4NBF A;  3K7A I;  4RVG A;  3HOV I;  4BBS I;  5CM2 M;  4NB8 A;  2QEX Z;  1VQ5 Z;  1KQS Z;  2HF1 A;  1YUA A;  1K73 2;  1VQN 1;  1RO0 A;  4A3K I;  3CCU 1;  3CPW Z;  4E2X A;  1Y1V I;  3GTM S;  1ZB9 A;  4A3I I;  3J81 f;  3EED A;  2Q51 A;  2DE5 A;  5D1P A;  2V8K A;  3QWU A;  1VQN Z;  2RT9 A;  3CCU Z;  3IX0 A;  2P3Y A;  1SFO I;  3CCJ 1;  4DGL A;  1ZH1 A;  3CCE Z;  2QA4 1;  1VQM Z;  2E2J I;  2JS4 A;  3CCR 1;  5C4X I;  2QA4 Z;  4HGY A;  1LQL A;  2GTH A;  4A3J I;  3CXC Z;  1KD1 2;  1YIJ 1;  2PK7 A;  4MD9 A;  1QYP A;  1Y1V S;  3CCQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...