5IT9f

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 1
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9f00
5FLXf 3J81f 5IT9f 3J80f 3JAMf 5A2Qf
chains in the Genus database with same CATH superfamily
4NB8A 3G4SZ 2JIQA 2Y0SA 3JAMf 1S7MA 3TE5B 2YU9I 2NAPA 4RVHA 3HOWI 1TWAI 1M901 3HKZA 2R92I 2OZKA 4A3FI 1QVGZ 3S14I 1USPA 4X6AI 4Y7NI 2M48A 3S1RI 2EGTA 4E2WA 1VQ71 3CC71 3IX0A 3CCMZ 4NBCA 3MONA 3T4NB 3NH5A 2BJOA 3CME1 5C3EI 5FLMI 1ZB8A 1KC82 1YI21 3NFZA 1L1OC 5IT9b 2JUBA 4MRIA 3HOYI 1VQ61 1YJ91 3G71Z 1VQO1 1Q822 2JR6A 2V8KA 1VQ7Z 5T64A 3CC7Z 3FQQA 2JA8I 3NH8A 2QEX1 2JA7I 2V8JA 2JIRA 1TWHI 3CC41 2VPWA 2VF1A 2JMOA 2W04A 1VQP1 2JNYA 1I50I 2H85A 2J6AA 3VMIA 3S1QI 1VQ6Z 1YJNZ 3GTMS 3MZLB 1YJ9Z 4A3EI 1K732 1VQKZ 2R7ZI 1RQFA 4RV9A 1Q7Y2 3CPWY 5A2Qb 4NOZA 1YITZ 1LQLA 3CCR1 1KC81 4A3GI 2R6MA 3CCUZ 1KRLA 2O4HA 3ESWA 5IP7I 3CC4Z 1YIJZ 3HOVI 3CCSZ 1Q821 3RZOI 1VQPZ 3CPWZ 1M1K2 3VMGA 2GTIA 4MD8A 5D1PA 4DGLA 2R93I 2WB1A 2RT9A 1VQN1 2RBLA 1Z02A 4NBBA 3GKQA 1YHQZ 4DQYB 2WAQA 5IT9f 4RS4A 4NB9A 2RHBA 5C4JI 1S721 3CCRZ 1FDOA 2OTJZ 4MD9A 2DE5A 1Y1WI 1RO0A 3FKII 3QWUA 3TDHB 2E2JI 4NFRA 1FDIA 2F4MA 3HOZI 2W03A 1K731 3CCM1 2G2KA 5IP9I 1Q7Y1 3CXCY 4A3CI 3GTJI 1WJ2A 1QYPA 1N8R2 4RVFA 2QRCB 4MONA 1S72Z 4NBHA 1ML8A 3P5JB 3CXCZ 1PFTA 5LL6f 1TFIA 2E9HA 3S1NI 1M1K1 3G711 1X3ZA 4DK1A 2RIQA 3GTGI 5CM2M 3S2HI 2KPIA 5A2Qf 3CCVZ 2E2HI 4NBAA 3U50C 2HF1A 2O53A 1RO4A 4A3KI 3S15I 3M3YI 1QXFA 3PO3S 5FLXf 3PO3I 2IZ3A 3D6WA 2IV2X 3BG1B 1VQ5Z 3GTQI 2V3VA 1TWCI 1YJN1 4TNUA 1ZB9A 3NDIA 3CCL1 1N2FA 1VQK1 2LFUA 1Y1VI 1Z01A 4E32A 2NVYI 1YIT1 3H0GI 1WCMI 4EWCA 4NBDA 3VB9A 2VUMI 1N8R1 3CCU1 2NVQI 1JJ2Y 1Z03A 1X3WA 2VPXA 4A3LI 1YIJ1 3CCS1 2DE6A 3LUSA 1YUAA 3K7AI 4E33A 1VQ9Z 3EERA 2NVTI 3IR7A 1K83I 3FQMA 3CCLZ 4HGYA 4E2ZA 1YHQ1 2QREB 3I07A 1Y8CA 2P28A 1QVFY 1YJW1 2JA6I 2E2II 1QF8A 5C4XI 2OTJ1 2I3CA 3VTNA 4BBSI 3J81b 3G6EZ 1Q16A 1RNIA 3F3FC 1R9TI 3NH4A 1VQ8Z 3GTOI 3J80b 3HOXI 3I4NI 2KI7B 1SFOI 3NDJA 1VQLZ 1Q862 2PMZA 2M6NA 2DE7A 1YJWZ 3D2LA 2F4OA 4NBFA 2ZAEB 4BXXI 1VQMZ 3CCV1 4A3DI 4MH4A 5T6BA 4E31A 1Q812 2QKDA 3KIFA 1KQSY 1NJI2 4Y52I 2OTL1 3GTPI 1W2BY 1RO2A 3F3PC 1X0TA 4A3JI 4A3BI 2AYDA 5D1OB 3HOUI 4XX2A 1I3QI 1VQ51 4BY1I 1WIIA 1DL6A 1W2BZ 1JWHC 1Q861 2Q51A 2V8IA 2JIOA 3J81f 5T67A 1AA6A 2IZ4A 4A3II 2OTLZ 3CCE1 3I55Z 1VLAA 3RZDI 2HU9A 3CCJ1 4S1TA 2QR1B 3J80f 1VQ91 3D9XA 1TWGI 3VMHA 2JA5I 3CQZI 1Q811 3IFUA 1Y1VS 3H3VJ 2VUGA 4A3MI 3CC2Z 1NJI1 3S16I 4A93I 2Q4ZA 5AN9F 2AKLA 1ZH1A 3GTLI 2P3YA 2QRDB 3MZKB 2YADA 4BBRI 3I561 3G6E1 3CCEZ 3CMA1 2QA41 3CD61 3CCJZ 1TWFI 1VQ81 1K8A2 3KIHA 3GTKI 2PM9A 1WW9A 1JJ2Z 2JS4A 1VQL1 1K9M2 1SIWA 4QTUA 3CMEZ 2K3RA 4AYBA 5C44I 3Q87A 4RVDA 3OW2Y 3BG0B 5D1OA 1YI2Z 3GCFA 3I56Z 3JAMb 3CMAZ 2VPZA 2QA4Z 1USPB 3CD6Z 1VQM1 2GTHA 2VPYA 1VQOZ 1I6HI 3GTMI 1QVFZ 1VQ41 1NP6A 3OW2Z 4MD7A 4BY7I 4NBEA 2B63I 1KD12 2QEXZ 2K5RA 4E2YA 3I4MI 2V45A 5FLXb 4NBGA 4E30A 2LIYA 1K8A1 3CCQ1 4MXUA 1M902 2NVXI 4HH4A 2JIPA 2PK7A 1RLYA 3PO2I 1K9M1 3J7A4 1VQ4Z 3M4OI 3IF8A 3G4S1 2JIMA 3S1MI 2LEXA 3S17I 3S2DI 1YUKA 3I551 4RVGA 4QTTA 2RPRA 2OOXB 4E2XA 3EEDA 3CCQZ 1KQSZ 2GU2A 4NH1C 1WZNA 4HGZA 3CC21 2OOYB 4CL1A 2QLVB 1VQNZ 1P9NA 1NUIA 1QVGY 1KD11 2E7ZA
chains in the Genus database with same CATH topology
4NB8A 3G4SZ 2Y0SA 3JAMf 1S7MA 3TE5B 2YU9I 4RVHA 3HOWI 1TWAI 1M901 3HKZA 2R92I 2OZKA 4A3FI 1QVGZ 3S14I 1USPA 4X6AI 4Y7NI 2M48A 3S1RI 2EGTA 4E2WA 1VQ71 3CC71 3IX0A 3CCMZ 4NBCA 3MONA 3T4NB 3NH5A 2BJOA 3CME1 5C3EI 5FLMI 1ZB8A 1KC82 1YI21 3NFZA 1L1OC 5IT9b 2JUBA 4MRIA 3HOYI 1VQ61 1YJ91 3G71Z 1VQO1 1Q822 2JR6A 2V8KA 1VQ7Z 5T64A 3CC7Z 3FQQA 2JA8I 3NH8A 2QEX1 2JA7I 2V8JA 1TWHI 3CC41 2VF1A 2JMOA 2W04A 1VQP1 2JNYA 1I50I 2H85A 2J6AA 3VMIA 3S1QI 1VQ6Z 1YJNZ 3GTMS 3MZLB 1YJ9Z 4A3EI 1K732 1VQKZ 2R7ZI 1RQFA 4RV9A 1Q7Y2 3CPWY 5A2Qb 4NOZA 1YITZ 1LQLA 3CCR1 1KC81 4A3GI 2R6MA 3CCUZ 1KRLA 2O4HA 3ESWA 5IP7I 3CC4Z 1YIJZ 3HOVI 3CCSZ 1Q821 3RZOI 1VQPZ 3CPWZ 1M1K2 3VMGA 2GTIA 4MD8A 5D1PA 4DGLA 2R93I 2WB1A 2RT9A 1VQN1 2RBLA 1Z02A 4NBBA 3GKQA 1YHQZ 4DQYB 2WAQA 5IT9f 4RS4A 4NB9A 2RHBA 5C4JI 1S721 3CCRZ 2OTJZ 4MD9A 2DE5A 1Y1WI 1RO0A 3FKII 3QWUA 3TDHB 2E2JI 4NFRA 2F4MA 3HOZI 2W03A 1K731 3CCM1 2G2KA 5IP9I 1Q7Y1 3CXCY 4A3CI 3GTJI 1QYPA 1N8R2 4RVFA 2QRCB 4MONA 1S72Z 4NBHA 1ML8A 3P5JB 3CXCZ 1PFTA 5LL6f 1TFIA 2E9HA 3S1NI 1M1K1 3G711 1X3ZA 4DK1A 2RIQA 3GTGI 5CM2M 3S2HI 2KPIA 5A2Qf 3CCVZ 2E2HI 4NBAA 3U50C 2HF1A 2O53A 1RO4A 4A3KI 3S15I 3M3YI 3PO3S 5FLXf 3PO3I 2IZ3A 3D6WA 3BG1B 1VQ5Z 3GTQI 1TWCI 1YJN1 4TNUA 1ZB9A 3NDIA 3CCL1 1N2FA 1VQK1 2LFUA 1Y1VI 1Z01A 4E32A 2NVYI 1YIT1 3H0GI 1WCMI 4EWCA 4NBDA 3VB9A 2VUMI 1N8R1 3CCU1 2NVQI 1JJ2Y 1Z03A 1X3WA 4A3LI 1YIJ1 3CCS1 2DE6A 3LUSA 1YUAA 3K7AI 4E33A 1VQ9Z 3EERA 2NVTI 1K83I 3FQMA 3CCLZ 4HGYA 1YHQ1 4E2ZA 2QREB 3I07A 2P28A 1QVFY 1YJW1 2JA6I 2E2II 1QF8A 5C4XI 2OTJ1 2I3CA 3VTNA 4BBSI 3J81b 3G6EZ 1RNIA 3F3FC 1R9TI 3NH4A 1VQ8Z 3GTOI 3J80b 3HOXI 3I4NI 2KI7B 1SFOI 3NDJA 1VQLZ 1Q862 2PMZA 2M6NA 2DE7A 1YJWZ 2F4OA 4NBFA 2ZAEB 4BXXI 1VQMZ 3CCV1 4A3DI 4MH4A 5T6BA 4E31A 1Q812 2QKDA 3KIFA 1KQSY 1NJI2 4Y52I 2OTL1 3GTPI 1W2BY 1RO2A 3F3PC 1X0TA 4A3JI 4A3BI 5D1OB 3HOUI 4XX2A 1I3QI 1VQ51 4BY1I 1WIIA 1DL6A 1W2BZ 1JWHC 1Q861 2Q51A 2V8IA 3J81f 5T67A 2IZ4A 4A3II 2OTLZ 3CCE1 3I55Z 1VLAA 3RZDI 2HU9A 3CCJ1 4S1TA 2QR1B 3J80f 1VQ91 3D9XA 1TWGI 3VMHA 2JA5I 3CQZI 1Q811 3IFUA 1Y1VS 3H3VJ 2VUGA 4A3MI 3CC2Z 1NJI1 3S16I 4A93I 2Q4ZA 5AN9F 2AKLA 1ZH1A 3GTLI 2P3YA 2QRDB 3MZKB 2YADA 4BBRI 3I561 3G6E1 3CCEZ 3CMA1 2QA41 3CD61 3CCJZ 1TWFI 1VQ81 1K8A2 3KIHA 3GTKI 2PM9A 1WW9A 1JJ2Z 2JS4A 1VQL1 1K9M2 4QTUA 3CMEZ 2K3RA 4AYBA 5C44I 3Q87A 4RVDA 3OW2Y 3BG0B 5D1OA 1YI2Z 3GCFA 3I56Z 3JAMb 3CMAZ 2QA4Z 1USPB 3CD6Z 1VQM1 2GTHA 1VQOZ 1I6HI 3GTMI 1QVFZ 1VQ41 1NP6A 3OW2Z 4MD7A 4BY7I 4NBEA 2B63I 1KD12 2QEXZ 2K5RA 4E2YA 3I4MI 5FLXb 4NBGA 4E30A 2LIYA 1K8A1 3CCQ1 4MXUA 1M902 2NVXI 4HH4A 2PK7A 1RLYA 3PO2I 1K9M1 3J7A4 1VQ4Z 3M4OI 3IF8A 3G4S1 3S1MI 3S17I 3S2DI 1YUKA 3I551 4RVGA 4QTTA 2RPRA 2OOXB 4E2XA 3EEDA 3CCQZ 1KQSZ 2GU2A 4NH1C 4HGZA 3CC21 2OOYB 4CL1A 2QLVB 1VQNZ 1P9NA 1NUIA 1QVGY 1KD11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX f;  3J81 f;  5IT9 f;  3J80 f;  3JAM f;  5A2Q f; 
#chains in the Genus database with same CATH topology
 4NB8 A;  3G4S Z;  2JIQ A;  2Y0S A;  3JAM f;  1S7M A;  3TE5 B;  2YU9 I;  2NAP A;  4RVH A;  3HOW I;  1TWA I;  1M90 1;  3HKZ A;  2R92 I;  2OZK A;  4A3F I;  1QVG Z;  3S14 I;  1USP A;  4X6A I;  4Y7N I;  2M48 A;  3S1R I;  2EGT A;  4E2W A;  1VQ7 1;  3CC7 1;  3IX0 A;  3CCM Z;  4NBC A;  3MON A;  3T4N B;  3NH5 A;  2BJO A;  3CME 1;  5C3E I;  5FLM I;  1ZB8 A;  1KC8 2;  1YI2 1;  3NFZ A;  1L1O C;  5IT9 b;  2JUB A;  4MRI A;  3HOY I;  1VQ6 1;  1YJ9 1;  3G71 Z;  1VQO 1;  1Q82 2;  2JR6 A;  2V8K A;  1VQ7 Z;  5T64 A;  3CC7 Z;  3FQQ A;  2JA8 I;  3NH8 A;  2QEX 1;  2JA7 I;  2V8J A;  2JIR A;  1TWH I;  3CC4 1;  2VPW A;  2VF1 A;  2JMO A;  2W04 A;  1VQP 1;  2JNY A;  1I50 I;  2H85 A;  2J6A A;  3VMI A;  3S1Q I;  1VQ6 Z;  1YJN Z;  3GTM S;  3MZL B;  1YJ9 Z;  4A3E I;  1K73 2;  1VQK Z;  2R7Z I;  1RQF A;  4RV9 A;  1Q7Y 2;  3CPW Y;  5A2Q b;  4NOZ A;  1YIT Z;  1LQL A;  3CCR 1;  1KC8 1;  4A3G I;  2R6M A;  3CCU Z;  1KRL A;  2O4H A;  3ESW A;  5IP7 I;  3CC4 Z;  1YIJ Z;  3HOV I;  3CCS Z;  1Q82 1;  3RZO I;  1VQP Z;  3CPW Z;  1M1K 2;  3VMG A;  2GTI A;  4MD8 A;  5D1P A;  4DGL A;  2R93 I;  2WB1 A;  2RT9 A;  1VQN 1;  2RBL A;  1Z02 A;  4NBB A;  3GKQ A;  1YHQ Z;  4DQY B;  2WAQ A;  5IT9 f;  4RS4 A;  4NB9 A;  2RHB A;  5C4J I;  1S72 1;  3CCR Z;  1FDO A;  2OTJ Z;  4MD9 A;  2DE5 A;  1Y1W I;  1RO0 A;  3FKI I;  3QWU A;  3TDH B;  2E2J I;  4NFR A;  1FDI A;  2F4M A;  3HOZ I;  2W03 A;  1K73 1;  3CCM 1;  2G2K A;  5IP9 I;  1Q7Y 1;  3CXC Y;  4A3C I;  3GTJ I;  1WJ2 A;  1QYP A;  1N8R 2;  4RVF A;  2QRC B;  4MON A;  1S72 Z;  4NBH A;  1ML8 A;  3P5J B;  3CXC Z;  1PFT A;  5LL6 f;  1TFI A;  2E9H A;  3S1N I;  1M1K 1;  3G71 1;  1X3Z A;  4DK1 A;  2RIQ A;  3GTG I;  5CM2 M;  3S2H I;  2KPI A;  5A2Q f;  3CCV Z;  2E2H I;  4NBA A;  3U50 C;  2HF1 A;  2O53 A;  1RO4 A;  4A3K I;  3S15 I;  3M3Y I;  1QXF A;  3PO3 S;  5FLX f;  3PO3 I;  2IZ3 A;  3D6W A;  2IV2 X;  3BG1 B;  1VQ5 Z;  3GTQ I;  2V3V A;  1TWC I;  1YJN 1;  4TNU A;  1ZB9 A;  3NDI A;  3CCL 1;  1N2F A;  1VQK 1;  2LFU A;  1Y1V I;  1Z01 A;  4E32 A;  2NVY I;  1YIT 1;  3H0G I;  1WCM I;  4EWC A;  4NBD A;  3VB9 A;  2VUM I;  1N8R 1;  3CCU 1;  2NVQ I;  1JJ2 Y;  1Z03 A;  1X3W A;  2VPX A;  4A3L I;  1YIJ 1;  3CCS 1;  2DE6 A;  3LUS A;  1YUA A;  3K7A I;  4E33 A;  1VQ9 Z;  3EER A;  2NVT I;  3IR7 A;  1K83 I;  3FQM A;  3CCL Z;  4HGY A;  4E2Z A;  1YHQ 1;  2QRE B;  3I07 A;  1Y8C A;  2P28 A;  1QVF Y;  1YJW 1;  2JA6 I;  2E2I I;  1QF8 A;  5C4X I;  2OTJ 1;  2I3C A;  3VTN A;  4BBS I;  3J81 b;  3G6E Z;  1Q16 A;  1RNI A;  3F3F C;  1R9T I;  3NH4 A;  1VQ8 Z;  3GTO I;  3J80 b;  3HOX I;  3I4N I;  2KI7 B;  1SFO I;  3NDJ A;  1VQL Z;  1Q86 2;  2PMZ A;  2M6N A;  2DE7 A;  1YJW Z;  3D2L A;  2F4O A;  4NBF A;  2ZAE B;  4BXX I;  1VQM Z;  3CCV 1;  4A3D I;  4MH4 A;  5T6B A;  4E31 A;  1Q81 2;  2QKD A;  3KIF A;  1KQS Y;  1NJI 2;  4Y52 I;  2OTL 1;  3GTP I;  1W2B Y;  1RO2 A;  3F3P C;  1X0T A;  4A3J I;  4A3B I;  2AYD A;  5D1O B;  3HOU I;  4XX2 A;  1I3Q I;  1VQ5 1;  4BY1 I;  1WII A;  1DL6 A;  1W2B Z;  1JWH C;  1Q86 1;  2Q51 A;  2V8I A;  2JIO A;  3J81 f;  5T67 A;  1AA6 A;  2IZ4 A;  4A3I I;  2OTL Z;  3CCE 1;  3I55 Z;  1VLA A;  3RZD I;  2HU9 A;  3CCJ 1;  4S1T A;  2QR1 B;  3J80 f;  1VQ9 1;  3D9X A;  1TWG I;  3VMH A;  2JA5 I;  3CQZ I;  1Q81 1;  3IFU A;  1Y1V S;  3H3V J;  2VUG A;  4A3M I;  3CC2 Z;  1NJI 1;  3S16 I;  4A93 I;  2Q4Z A;  5AN9 F;  2AKL A;  1ZH1 A;  3GTL I;  2P3Y A;  2QRD B;  3MZK B;  2YAD A;  4BBR I;  3I56 1;  3G6E 1;  3CCE Z;  3CMA 1;  2QA4 1;  3CD6 1;  3CCJ Z;  1TWF I;  1VQ8 1;  1K8A 2;  3KIH A;  3GTK I;  2PM9 A;  1WW9 A;  1JJ2 Z;  2JS4 A;  1VQL 1;  1K9M 2;  1SIW A;  4QTU A;  3CME Z;  2K3R A;  4AYB A;  5C44 I;  3Q87 A;  4RVD A;  3OW2 Y;  3BG0 B;  5D1O A;  1YI2 Z;  3GCF A;  3I56 Z;  3JAM b;  3CMA Z;  2VPZ A;  2QA4 Z;  1USP B;  3CD6 Z;  1VQM 1;  2GTH A;  2VPY A;  1VQO Z;  1I6H I;  3GTM I;  1QVF Z;  1VQ4 1;  1NP6 A;  3OW2 Z;  4MD7 A;  4BY7 I;  4NBE A;  2B63 I;  1KD1 2;  2QEX Z;  2K5R A;  4E2Y A;  3I4M I;  2V45 A;  5FLX b;  4NBG A;  4E30 A;  2LIY A;  1K8A 1;  3CCQ 1;  4MXU A;  1M90 2;  2NVX I;  4HH4 A;  2JIP A;  2PK7 A;  1RLY A;  3PO2 I;  1K9M 1;  3J7A 4;  1VQ4 Z;  3M4O I;  3IF8 A;  3G4S 1;  2JIM A;  3S1M I;  2LEX A;  3S17 I;  3S2D I;  1YUK A;  3I55 1;  4RVG A;  4QTT A;  2RPR A;  2OOX B;  4E2X A;  3EED A;  3CCQ Z;  1KQS Z;  2GU2 A;  4NH1 C;  1WZN A;  4HGZ A;  3CC2 1;  2OOY B;  4CL1 A;  2QLV B;  1VQN Z;  1P9N A;  1NUI A;  1QVG Y;  1KD1 1;  2E7Z A; 
#chains in the Genus database with same CATH homology
 4NB8 A;  3G4S Z;  2Y0S A;  3JAM f;  1S7M A;  3TE5 B;  2YU9 I;  4RVH A;  3HOW I;  1TWA I;  1M90 1;  3HKZ A;  2R92 I;  2OZK A;  4A3F I;  1QVG Z;  3S14 I;  1USP A;  4X6A I;  4Y7N I;  2M48 A;  3S1R I;  2EGT A;  4E2W A;  1VQ7 1;  3CC7 1;  3IX0 A;  3CCM Z;  4NBC A;  3MON A;  3T4N B;  3NH5 A;  2BJO A;  3CME 1;  5C3E I;  5FLM I;  1ZB8 A;  1KC8 2;  1YI2 1;  3NFZ A;  1L1O C;  5IT9 b;  2JUB A;  4MRI A;  3HOY I;  1VQ6 1;  1YJ9 1;  3G71 Z;  1VQO 1;  1Q82 2;  2JR6 A;  2V8K A;  1VQ7 Z;  5T64 A;  3CC7 Z;  3FQQ A;  2JA8 I;  3NH8 A;  2QEX 1;  2JA7 I;  2V8J A;  1TWH I;  3CC4 1;  2VF1 A;  2JMO A;  2W04 A;  1VQP 1;  2JNY A;  1I50 I;  2H85 A;  2J6A A;  3VMI A;  3S1Q I;  1VQ6 Z;  1YJN Z;  3GTM S;  3MZL B;  1YJ9 Z;  4A3E I;  1K73 2;  1VQK Z;  2R7Z I;  1RQF A;  4RV9 A;  1Q7Y 2;  3CPW Y;  5A2Q b;  4NOZ A;  1YIT Z;  1LQL A;  3CCR 1;  1KC8 1;  4A3G I;  2R6M A;  3CCU Z;  1KRL A;  2O4H A;  3ESW A;  5IP7 I;  3CC4 Z;  1YIJ Z;  3HOV I;  3CCS Z;  1Q82 1;  3RZO I;  1VQP Z;  3CPW Z;  1M1K 2;  3VMG A;  2GTI A;  4MD8 A;  5D1P A;  4DGL A;  2R93 I;  2WB1 A;  2RT9 A;  1VQN 1;  2RBL A;  1Z02 A;  4NBB A;  3GKQ A;  1YHQ Z;  4DQY B;  2WAQ A;  5IT9 f;  4RS4 A;  4NB9 A;  2RHB A;  5C4J I;  1S72 1;  3CCR Z;  2OTJ Z;  4MD9 A;  2DE5 A;  1Y1W I;  1RO0 A;  3FKI I;  3QWU A;  3TDH B;  2E2J I;  4NFR A;  2F4M A;  3HOZ I;  2W03 A;  1K73 1;  3CCM 1;  2G2K A;  5IP9 I;  1Q7Y 1;  3CXC Y;  4A3C I;  3GTJ I;  1QYP A;  1N8R 2;  4RVF A;  2QRC B;  4MON A;  1S72 Z;  4NBH A;  1ML8 A;  3P5J B;  3CXC Z;  1PFT A;  5LL6 f;  1TFI A;  2E9H A;  3S1N I;  1M1K 1;  3G71 1;  1X3Z A;  4DK1 A;  2RIQ A;  3GTG I;  5CM2 M;  3S2H I;  2KPI A;  5A2Q f;  3CCV Z;  2E2H I;  4NBA A;  3U50 C;  2HF1 A;  2O53 A;  1RO4 A;  4A3K I;  3S15 I;  3M3Y I;  3PO3 S;  5FLX f;  3PO3 I;  2IZ3 A;  3D6W A;  3BG1 B;  1VQ5 Z;  3GTQ I;  1TWC I;  1YJN 1;  4TNU A;  1ZB9 A;  3NDI A;  3CCL 1;  1N2F A;  1VQK 1;  2LFU A;  1Y1V I;  1Z01 A;  4E32 A;  2NVY I;  1YIT 1;  3H0G I;  1WCM I;  4EWC A;  4NBD A;  3VB9 A;  2VUM I;  1N8R 1;  3CCU 1;  2NVQ I;  1JJ2 Y;  1Z03 A;  1X3W A;  4A3L I;  1YIJ 1;  3CCS 1;  2DE6 A;  3LUS A;  1YUA A;  3K7A I;  4E33 A;  1VQ9 Z;  3EER A;  2NVT I;  1K83 I;  3FQM A;  3CCL Z;  4HGY A;  1YHQ 1;  4E2Z A;  2QRE B;  3I07 A;  2P28 A;  1QVF Y;  1YJW 1;  2JA6 I;  2E2I I;  1QF8 A;  5C4X I;  2OTJ 1;  2I3C A;  3VTN A;  4BBS I;  3J81 b;  3G6E Z;  1RNI A;  3F3F C;  1R9T I;  3NH4 A;  1VQ8 Z;  3GTO I;  3J80 b;  3HOX I;  3I4N I;  2KI7 B;  1SFO I;  3NDJ A;  1VQL Z;  1Q86 2;  2PMZ A;  2M6N A;  2DE7 A;  1YJW Z;  2F4O A;  4NBF A;  2ZAE B;  4BXX I;  1VQM Z;  3CCV 1;  4A3D I;  4MH4 A;  5T6B A;  4E31 A;  1Q81 2;  2QKD A;  3KIF A;  1KQS Y;  1NJI 2;  4Y52 I;  2OTL 1;  3GTP I;  1W2B Y;  1RO2 A;  3F3P C;  1X0T A;  4A3J I;  4A3B I;  5D1O B;  3HOU I;  4XX2 A;  1I3Q I;  1VQ5 1;  4BY1 I;  1WII A;  1DL6 A;  1W2B Z;  1JWH C;  1Q86 1;  2Q51 A;  2V8I A;  3J81 f;  5T67 A;  2IZ4 A;  4A3I I;  2OTL Z;  3CCE 1;  3I55 Z;  1VLA A;  3RZD I;  2HU9 A;  3CCJ 1;  4S1T A;  2QR1 B;  3J80 f;  1VQ9 1;  3D9X A;  1TWG I;  3VMH A;  2JA5 I;  3CQZ I;  1Q81 1;  3IFU A;  1Y1V S;  3H3V J;  2VUG A;  4A3M I;  3CC2 Z;  1NJI 1;  3S16 I;  4A93 I;  2Q4Z A;  5AN9 F;  2AKL A;  1ZH1 A;  3GTL I;  2P3Y A;  2QRD B;  3MZK B;  2YAD A;  4BBR I;  3I56 1;  3G6E 1;  3CCE Z;  3CMA 1;  2QA4 1;  3CD6 1;  3CCJ Z;  1TWF I;  1VQ8 1;  1K8A 2;  3KIH A;  3GTK I;  2PM9 A;  1WW9 A;  1JJ2 Z;  2JS4 A;  1VQL 1;  1K9M 2;  4QTU A;  3CME Z;  2K3R A;  4AYB A;  5C44 I;  3Q87 A;  4RVD A;  3OW2 Y;  3BG0 B;  5D1O A;  1YI2 Z;  3GCF A;  3I56 Z;  3JAM b;  3CMA Z;  2QA4 Z;  1USP B;  3CD6 Z;  1VQM 1;  2GTH A;  1VQO Z;  1I6H I;  3GTM I;  1QVF Z;  1VQ4 1;  1NP6 A;  3OW2 Z;  4MD7 A;  4BY7 I;  4NBE A;  2B63 I;  1KD1 2;  2QEX Z;  2K5R A;  4E2Y A;  3I4M I;  5FLX b;  4NBG A;  4E30 A;  2LIY A;  1K8A 1;  3CCQ 1;  4MXU A;  1M90 2;  2NVX I;  4HH4 A;  2PK7 A;  1RLY A;  3PO2 I;  1K9M 1;  3J7A 4;  1VQ4 Z;  3M4O I;  3IF8 A;  3G4S 1;  3S1M I;  3S17 I;  3S2D I;  1YUK A;  3I55 1;  4RVG A;  4QTT A;  2RPR A;  2OOX B;  4E2X A;  3EED A;  3CCQ Z;  1KQS Z;  2GU2 A;  4NH1 C;  4HGZ A;  3CC2 1;  2OOY B;  4CL1 A;  2QLV B;  1VQN Z;  1P9N A;  1NUI A;  1QVG Y;  1KD1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...