5IT9f

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
69
structure length
69
Chain Sequence
b'KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosomal protein uS2
molecule tags Ribosome
source organism Cricket paralysis virus
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
total genus 1
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9f00
5FLXf 3J81f 3J80f 5A2Qf 3JAMf 5IT9f
chains in the Genus database with same CATH superfamily
3CPWY 2K5RA 2OOXB 3HOXI 4MRIA 4A3EI 1Q7Y2 3HOWI 3ESWA 3I551 4EWCA 1Q861 3J81f 2YADA 1RLYA 3CCVZ 3G71Z 1X3WA 2RBLA 1N8R1 3F3FC 2F4MA 1W2BZ 4NBDA 4A3JI 2QKDA 3BG1B 2O53A 2O4HA 1YJWZ 1VQKZ 3S15I 2JMOA 1SFOI 2RHBA 1Y1VI 2AYDA 2BJOA 5D1PA 5FLMI 2IZ3A 2DE6A 2F4OA 1X0TA 4S1TA 4HGZA 1VQ6Z 4NBBA 1YJ9Z 2OTJZ 1YJNZ 2JS4A 1VQMZ 5FLXf 1TWAI 3CC21 2Q51A 2VF1A 3HOVI 5IT9f 3D6WA 2VUGA 4DQYB 4NBHA 3HOYI 3M3YI 1Q7Y1 1YITZ 3GTOI 3IFUA 1YJ91 3MZLB 4BXXI 3NDJA 1TWFI 2E2HI 3I55Z 2QA4Z 3OW2Z 4RVHA 2PMZA 1JWHC 1VQ71 2W04A 2RT9A 3G711 3PO3S 1VQ41 4RVDA 3NH4A 4NH1C 3VMHA 2IV2X 4Y52I 4E32A 3RZDI 3NFZA 1WZNA 1M1K1 4HGYA 3KIFA 2V45A 5T64A 3D9XA 4E2XA 3S16I 3CME1 1S7MA 1KD12 4RVGA 2VPXA 2DE7A 1JJ2Y 1Q821 2OTJ1 2V3VA 2VPWA 2Y0SA 1S72Z 2R92I 3GKQA 2VPZA 3PO2I 2GTHA 2NVYI 2ZAEB 1KQSZ 3D2LA 4NB9A 4MONA 2VPYA 3J80b 1L1OC 2JIPA 4E33A 3HOUI 1P9NA 4XX2A 3I561 3CCJZ 3JAMf 1YHQ1 2NVXI 1VQOZ 1USPA 5D1OA 3MZKB 1K83I 1YIJZ 1FDOA 1KRLA 1Z01A 3G6E1 3S14I 2QRDB 5C3EI 4MD7A 2WB1A 3GTKI 3GTJI 1X3ZA 3HKZA 3CCRZ 3FQMA 1LQLA 2JIRA 3NH8A 3CXCY 3EEDA 3CCR1 1VQLZ 5CM2M 1VQ5Z 3HOZI 2W03A 2HU9A 5T67A 2LEXA 1WIIA 1VQN1 3FQQA 2QEXZ 2J6AA 1TFIA 3IR7A 3I56Z 1Z03A 2OTL1 1Q16A 1K8A1 4QTTA 1Q822 1M901 1USPB 4MD9A 2LIYA 3BG0B 1KC82 1M902 3S2DI 2K3RA 2JA5I 3CCUZ 2WAQA 3P5JB 1ZB9A 2KPIA 3NDIA 1VQM1 1QF8A 1VQ81 4TNUA 1Q811 1K731 3S17I 1NJI2 5IT9b 3OW2Y 1Y1WI 3RZOI 1QXFA 2V8IA 1WJ2A 1Y1VS 1YJW1 1YUAA 3CMAZ 5T6BA 2M48A 4MH4A 2LFUA 3QWUA 4A3CI 1YIJ1 1K9M1 3GTMI 2OOYB 4NB8A 1VQ7Z 3IX0A 2NVTI 2JIQA 5A2Qf 1VQ91 1ZB8A 1Z02A 4NBGA 3CD6Z 2E2JI 2E7ZA 5C44I 2QRCB 2G2KA 4NBAA 1KQSY 4A3BI 3MONA 3GTPI 1R9TI 1N2FA 1VQ8Z 4E31A 2PK7A 3CC4Z 1Y8CA 4BBRI 2JIMA 1YI2Z 3I4MI 2QREB 3IF8A 2R93I 4AYBA 3PO3I 2M6NA 3G6EZ 3T4NB 4A3GI 3K7AI 2H85A 1KD11 2OTLZ 2QLVB 2V8KA 2E2II 1I3QI 2QEX1 4RV9A 1VQ9Z 1M1K2 2P3YA 1JJ2Z 1VQK1 2JNYA 1RO2A 3S1QI 1K9M2 2AKLA 4CL1A 3S2HI 3CD61 4NBEA 3VB9A 3CC71 1TWCI 3CXCZ 4A3FI 3GTQI 2V8JA 2KI7B 2QR1B 1WCMI 4E2ZA 2B63I 3I4NI 1NP6A 4BY7I 2JUBA 1NUIA 5IP9I 1ZH1A 3FKII 1VQ61 3GCFA 1QVGZ 4MD8A 3H0GI 3H3VJ 2PM9A 3CCS1 3CCMZ 4A3MI 4X6AI 4DK1A 1WW9A 3VTNA 3CCE1 4NBFA 1KC81 4A3DI 1SIWA 3CCQ1 3VMGA 1VQ51 2RIQA 2IZ4A 1NJI1 1K8A2 3F3PC 3S1RI 2I3CA 4QTUA 1TWGI 3CCSZ 2NVQI 3CC2Z 3CCV1 3KIHA 5AN9F 2VUMI 3S1NI 3GTMS 2JA6I 1VQNZ 4BBSI 5D1OB 5FLXb 4A93I 1N8R2 1YUKA 1W2BY 3J81b 1TWHI 2RPRA 5C4JI 2DE5A 1YJN1 1VQ4Z 2HF1A 4NOZA 1FDIA 3EERA 4A3KI 4RVFA 3CCU1 4E2YA 3CCEZ 3CCL1 4E30A 3I07A 2GTIA 4NBCA 3Q87A 3G4SZ 3VMIA 2JR6A 3JAMb 1VQO1 2NAPA 1YI21 1AA6A 4BY1I 1I6HI 1QVGY 4A3II 2P28A 2E9HA 1VQP1 3J80f 1QVFZ 2JA8I 4A3LI 3CMA1 2Q4ZA 3GTLI 2R6MA 3CPWZ 2GU2A 3CCQZ 2YU9I 2QA41 3S1MI 1RNIA 4Y7NI 5LL6f 3CCJ1 1QYPA 3CQZI 2EGTA 1S721 1DL6A 5A2Qb 1Q812 1K732 1Q862 3CCM1 1RO4A 2OZKA 1I50I 4RS4A 4E2WA 1VLAA 4NFRA 3NH5A 3GTGI 3G4S1 3CMEZ 3TDHB 1VQPZ 3LUSA 3TE5B 1RQFA 1YHQZ 3J7A4 1YIT1 1ML8A 3CC41 1VQL1 2JIOA 1PFTA 4MXUA 3CC7Z 1QVFY 2R7ZI 5IP7I 3M4OI 5C4XI 3CCLZ 1RO0A 4DGLA 2JA7I 4HH4A 3U50C
chains in the Genus database with same CATH topology
3CPWY 2K5RA 2OOXB 3HOXI 4MRIA 4A3EI 1Q7Y2 3HOWI 3ESWA 3I551 4EWCA 1Q861 3J81f 2YADA 1RLYA 3CCVZ 3G71Z 1X3WA 2RBLA 1N8R1 3F3FC 2F4MA 1W2BZ 4NBDA 4A3JI 2QKDA 3BG1B 2O53A 2O4HA 1YJWZ 1VQKZ 3S15I 2JMOA 1SFOI 2RHBA 1Y1VI 2BJOA 5D1PA 5FLMI 2IZ3A 2DE6A 2F4OA 1X0TA 4S1TA 4HGZA 1VQ6Z 4NBBA 1YJ9Z 2OTJZ 1YJNZ 2JS4A 1VQMZ 5FLXf 1TWAI 3CC21 2Q51A 2VF1A 3HOVI 5IT9f 3D6WA 2VUGA 4DQYB 4NBHA 3HOYI 3M3YI 1Q7Y1 1YITZ 3GTOI 3IFUA 1YJ91 3MZLB 4BXXI 3NDJA 1TWFI 2E2HI 3I55Z 2QA4Z 3OW2Z 4RVHA 2PMZA 1JWHC 1VQ71 2W04A 2RT9A 3G711 3PO3S 1VQ41 4RVDA 3NH4A 4NH1C 3VMHA 4Y52I 4E32A 3RZDI 3NFZA 1M1K1 4HGYA 3KIFA 5T64A 3D9XA 4E2XA 3S16I 3CME1 1S7MA 1KD12 4RVGA 2DE7A 1JJ2Y 1Q821 2OTJ1 2Y0SA 1S72Z 2R92I 3GKQA 3PO2I 2GTHA 2NVYI 2ZAEB 1KQSZ 4NB9A 4MONA 3J80b 1L1OC 4E33A 3HOUI 1P9NA 4XX2A 3I561 3CCJZ 3JAMf 1YHQ1 2NVXI 1VQOZ 1USPA 5D1OA 3MZKB 1K83I 1YIJZ 1KRLA 1Z01A 3G6E1 3S14I 2QRDB 5C3EI 4MD7A 2WB1A 3GTKI 3GTJI 1X3ZA 3HKZA 3CCRZ 3FQMA 1LQLA 3NH8A 3CXCY 3EEDA 3CCR1 1VQLZ 5CM2M 1VQ5Z 3HOZI 2W03A 2HU9A 5T67A 1WIIA 1VQN1 3FQQA 2QEXZ 2J6AA 1TFIA 3I56Z 1Z03A 2OTL1 1K8A1 4QTTA 1Q822 1M901 1USPB 4MD9A 2LIYA 3BG0B 1KC82 1M902 3S2DI 2K3RA 2JA5I 3CCUZ 2WAQA 3P5JB 1ZB9A 2KPIA 3NDIA 1VQM1 1QF8A 1VQ81 4TNUA 1Q811 1K731 3S17I 1NJI2 5IT9b 3OW2Y 1Y1WI 3RZOI 2V8IA 1Y1VS 1YJW1 1YUAA 3CMAZ 5T6BA 2M48A 4MH4A 2LFUA 3QWUA 4A3CI 1YIJ1 1K9M1 3GTMI 2OOYB 4NB8A 1VQ7Z 3IX0A 2NVTI 5A2Qf 1VQ91 1ZB8A 1Z02A 4NBGA 3CD6Z 2E2JI 5C44I 2QRCB 2G2KA 4NBAA 1KQSY 4A3BI 3MONA 3GTPI 1R9TI 1N2FA 1VQ8Z 4E31A 2PK7A 3CC4Z 4BBRI 1YI2Z 3I4MI 2QREB 3IF8A 2R93I 4AYBA 3PO3I 2M6NA 3G6EZ 3T4NB 4A3GI 3K7AI 2H85A 1KD11 2OTLZ 2QLVB 2V8KA 2E2II 1I3QI 2QEX1 4RV9A 1VQ9Z 1M1K2 2P3YA 1JJ2Z 1VQK1 2JNYA 1RO2A 3S1QI 1K9M2 2AKLA 4CL1A 3S2HI 3CD61 4NBEA 3VB9A 3CC71 1TWCI 3CXCZ 4A3FI 3GTQI 2V8JA 2KI7B 2QR1B 1WCMI 4E2ZA 2B63I 3I4NI 1NP6A 4BY7I 2JUBA 1NUIA 5IP9I 1ZH1A 3FKII 1VQ61 3GCFA 1QVGZ 4MD8A 3H0GI 3H3VJ 2PM9A 3CCS1 3CCMZ 4A3MI 4X6AI 4DK1A 1WW9A 3VTNA 3CCE1 4NBFA 1KC81 4A3DI 3CCQ1 3VMGA 1VQ51 2RIQA 2IZ4A 1NJI1 1K8A2 3F3PC 3S1RI 2I3CA 4QTUA 1TWGI 3CCSZ 2NVQI 3CC2Z 3CCV1 3KIHA 5AN9F 2VUMI 3S1NI 3GTMS 2JA6I 1VQNZ 4BBSI 5D1OB 5FLXb 4A93I 1N8R2 1YUKA 1W2BY 3J81b 1TWHI 2RPRA 5C4JI 2DE5A 1YJN1 1VQ4Z 2HF1A 4NOZA 3EERA 4A3KI 4RVFA 3CCU1 4E2YA 3CCEZ 3CCL1 4E30A 3I07A 2GTIA 4NBCA 3Q87A 3G4SZ 3VMIA 2JR6A 3JAMb 1VQO1 1YI21 4BY1I 1I6HI 1QVGY 4A3II 2P28A 2E9HA 1VQP1 3J80f 1QVFZ 2JA8I 4A3LI 3CMA1 2Q4ZA 3GTLI 2R6MA 3CPWZ 2GU2A 3CCQZ 2YU9I 2QA41 3S1MI 1RNIA 4Y7NI 5LL6f 3CCJ1 1QYPA 3CQZI 2EGTA 1S721 1DL6A 5A2Qb 1Q812 1K732 1Q862 3CCM1 1RO4A 2OZKA 1I50I 4RS4A 4E2WA 1VLAA 4NFRA 3NH5A 3GTGI 3G4S1 3CMEZ 1VQPZ 3TDHB 3LUSA 3TE5B 1RQFA 1YHQZ 3J7A4 1YIT1 1ML8A 3CC41 1VQL1 1PFTA 4MXUA 3CC7Z 1QVFY 2R7ZI 5IP7I 3M4OI 5C4XI 3CCLZ 1RO0A 4DGLA 2JA7I 4HH4A 3U50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX f;  3J81 f;  3J80 f;  5A2Q f;  3JAM f;  5IT9 f; 
#chains in the Genus database with same CATH topology
 3CPW Y;  2K5R A;  2OOX B;  3HOX I;  4MRI A;  4A3E I;  1Q7Y 2;  3HOW I;  3ESW A;  3I55 1;  4EWC A;  1Q86 1;  3J81 f;  2YAD A;  1RLY A;  3CCV Z;  3G71 Z;  1X3W A;  2RBL A;  1N8R 1;  3F3F C;  2F4M A;  1W2B Z;  4NBD A;  4A3J I;  2QKD A;  3BG1 B;  2O53 A;  2O4H A;  1YJW Z;  1VQK Z;  3S15 I;  2JMO A;  1SFO I;  2RHB A;  1Y1V I;  2AYD A;  2BJO A;  5D1P A;  5FLM I;  2IZ3 A;  2DE6 A;  2F4O A;  1X0T A;  4S1T A;  4HGZ A;  1VQ6 Z;  4NBB A;  1YJ9 Z;  2OTJ Z;  1YJN Z;  2JS4 A;  1VQM Z;  5FLX f;  1TWA I;  3CC2 1;  2Q51 A;  2VF1 A;  3HOV I;  5IT9 f;  3D6W A;  2VUG A;  4DQY B;  4NBH A;  3HOY I;  3M3Y I;  1Q7Y 1;  1YIT Z;  3GTO I;  3IFU A;  1YJ9 1;  3MZL B;  4BXX I;  3NDJ A;  1TWF I;  2E2H I;  3I55 Z;  2QA4 Z;  3OW2 Z;  4RVH A;  2PMZ A;  1JWH C;  1VQ7 1;  2W04 A;  2RT9 A;  3G71 1;  3PO3 S;  1VQ4 1;  4RVD A;  3NH4 A;  4NH1 C;  3VMH A;  2IV2 X;  4Y52 I;  4E32 A;  3RZD I;  3NFZ A;  1WZN A;  1M1K 1;  4HGY A;  3KIF A;  2V45 A;  5T64 A;  3D9X A;  4E2X A;  3S16 I;  3CME 1;  1S7M A;  1KD1 2;  4RVG A;  2VPX A;  2DE7 A;  1JJ2 Y;  1Q82 1;  2OTJ 1;  2V3V A;  2VPW A;  2Y0S A;  1S72 Z;  2R92 I;  3GKQ A;  2VPZ A;  3PO2 I;  2GTH A;  2NVY I;  2ZAE B;  1KQS Z;  3D2L A;  4NB9 A;  4MON A;  2VPY A;  3J80 b;  1L1O C;  2JIP A;  4E33 A;  3HOU I;  1P9N A;  4XX2 A;  3I56 1;  3CCJ Z;  3JAM f;  1YHQ 1;  2NVX I;  1VQO Z;  1USP A;  5D1O A;  3MZK B;  1K83 I;  1YIJ Z;  1FDO A;  1KRL A;  1Z01 A;  3G6E 1;  3S14 I;  2QRD B;  5C3E I;  4MD7 A;  2WB1 A;  3GTK I;  3GTJ I;  1X3Z A;  3HKZ A;  3CCR Z;  3FQM A;  1LQL A;  2JIR A;  3NH8 A;  3CXC Y;  3EED A;  3CCR 1;  1VQL Z;  5CM2 M;  1VQ5 Z;  3HOZ I;  2W03 A;  2HU9 A;  5T67 A;  2LEX A;  1WII A;  1VQN 1;  3FQQ A;  2QEX Z;  2J6A A;  1TFI A;  3IR7 A;  3I56 Z;  1Z03 A;  2OTL 1;  1Q16 A;  1K8A 1;  4QTT A;  1Q82 2;  1M90 1;  1USP B;  4MD9 A;  2LIY A;  3BG0 B;  1KC8 2;  1M90 2;  3S2D I;  2K3R A;  2JA5 I;  3CCU Z;  2WAQ A;  3P5J B;  1ZB9 A;  2KPI A;  3NDI A;  1VQM 1;  1QF8 A;  1VQ8 1;  4TNU A;  1Q81 1;  1K73 1;  3S17 I;  1NJI 2;  5IT9 b;  3OW2 Y;  1Y1W I;  3RZO I;  1QXF A;  2V8I A;  1WJ2 A;  1Y1V S;  1YJW 1;  1YUA A;  3CMA Z;  5T6B A;  2M48 A;  4MH4 A;  2LFU A;  3QWU A;  4A3C I;  1YIJ 1;  1K9M 1;  3GTM I;  2OOY B;  4NB8 A;  1VQ7 Z;  3IX0 A;  2NVT I;  2JIQ A;  5A2Q f;  1VQ9 1;  1ZB8 A;  1Z02 A;  4NBG A;  3CD6 Z;  2E2J I;  2E7Z A;  5C44 I;  2QRC B;  2G2K A;  4NBA A;  1KQS Y;  4A3B I;  3MON A;  3GTP I;  1R9T I;  1N2F A;  1VQ8 Z;  4E31 A;  2PK7 A;  3CC4 Z;  1Y8C A;  4BBR I;  2JIM A;  1YI2 Z;  3I4M I;  2QRE B;  3IF8 A;  2R93 I;  4AYB A;  3PO3 I;  2M6N A;  3G6E Z;  3T4N B;  4A3G I;  3K7A I;  2H85 A;  1KD1 1;  2OTL Z;  2QLV B;  2V8K A;  2E2I I;  1I3Q I;  2QEX 1;  4RV9 A;  1VQ9 Z;  1M1K 2;  2P3Y A;  1JJ2 Z;  1VQK 1;  2JNY A;  1RO2 A;  3S1Q I;  1K9M 2;  2AKL A;  4CL1 A;  3S2H I;  3CD6 1;  4NBE A;  3VB9 A;  3CC7 1;  1TWC I;  3CXC Z;  4A3F I;  3GTQ I;  2V8J A;  2KI7 B;  2QR1 B;  1WCM I;  4E2Z A;  2B63 I;  3I4N I;  1NP6 A;  4BY7 I;  2JUB A;  1NUI A;  5IP9 I;  1ZH1 A;  3FKI I;  1VQ6 1;  3GCF A;  1QVG Z;  4MD8 A;  3H0G I;  3H3V J;  2PM9 A;  3CCS 1;  3CCM Z;  4A3M I;  4X6A I;  4DK1 A;  1WW9 A;  3VTN A;  3CCE 1;  4NBF A;  1KC8 1;  4A3D I;  1SIW A;  3CCQ 1;  3VMG A;  1VQ5 1;  2RIQ A;  2IZ4 A;  1NJI 1;  1K8A 2;  3F3P C;  3S1R I;  2I3C A;  4QTU A;  1TWG I;  3CCS Z;  2NVQ I;  3CC2 Z;  3CCV 1;  3KIH A;  5AN9 F;  2VUM I;  3S1N I;  3GTM S;  2JA6 I;  1VQN Z;  4BBS I;  5D1O B;  5FLX b;  4A93 I;  1N8R 2;  1YUK A;  1W2B Y;  3J81 b;  1TWH I;  2RPR A;  5C4J I;  2DE5 A;  1YJN 1;  1VQ4 Z;  2HF1 A;  4NOZ A;  1FDI A;  3EER A;  4A3K I;  4RVF A;  3CCU 1;  4E2Y A;  3CCE Z;  3CCL 1;  4E30 A;  3I07 A;  2GTI A;  4NBC A;  3Q87 A;  3G4S Z;  3VMI A;  2JR6 A;  3JAM b;  1VQO 1;  2NAP A;  1YI2 1;  1AA6 A;  4BY1 I;  1I6H I;  1QVG Y;  4A3I I;  2P28 A;  2E9H A;  1VQP 1;  3J80 f;  1QVF Z;  2JA8 I;  4A3L I;  3CMA 1;  2Q4Z A;  3GTL I;  2R6M A;  3CPW Z;  2GU2 A;  3CCQ Z;  2YU9 I;  2QA4 1;  3S1M I;  1RNI A;  4Y7N I;  5LL6 f;  3CCJ 1;  1QYP A;  3CQZ I;  2EGT A;  1S72 1;  1DL6 A;  5A2Q b;  1Q81 2;  1K73 2;  1Q86 2;  3CCM 1;  1RO4 A;  2OZK A;  1I50 I;  4RS4 A;  4E2W A;  1VLA A;  4NFR A;  3NH5 A;  3GTG I;  3G4S 1;  3CME Z;  3TDH B;  1VQP Z;  3LUS A;  3TE5 B;  1RQF A;  1YHQ Z;  3J7A 4;  1YIT 1;  1ML8 A;  3CC4 1;  1VQL 1;  2JIO A;  1PFT A;  4MXU A;  3CC7 Z;  1QVF Y;  2R7Z I;  5IP7 I;  3M4O I;  5C4X I;  3CCL Z;  1RO0 A;  4DGL A;  2JA7 I;  4HH4 A;  3U50 C; 
#chains in the Genus database with same CATH homology
 3CPW Y;  2K5R A;  2OOX B;  3HOX I;  4MRI A;  4A3E I;  1Q7Y 2;  3HOW I;  3ESW A;  3I55 1;  4EWC A;  1Q86 1;  3J81 f;  2YAD A;  1RLY A;  3CCV Z;  3G71 Z;  1X3W A;  2RBL A;  1N8R 1;  3F3F C;  2F4M A;  1W2B Z;  4NBD A;  4A3J I;  2QKD A;  3BG1 B;  2O53 A;  2O4H A;  1YJW Z;  1VQK Z;  3S15 I;  2JMO A;  1SFO I;  2RHB A;  1Y1V I;  2BJO A;  5D1P A;  5FLM I;  2IZ3 A;  2DE6 A;  2F4O A;  1X0T A;  4S1T A;  4HGZ A;  1VQ6 Z;  4NBB A;  1YJ9 Z;  2OTJ Z;  1YJN Z;  2JS4 A;  1VQM Z;  5FLX f;  1TWA I;  3CC2 1;  2Q51 A;  2VF1 A;  3HOV I;  5IT9 f;  3D6W A;  2VUG A;  4DQY B;  4NBH A;  3HOY I;  3M3Y I;  1Q7Y 1;  1YIT Z;  3GTO I;  3IFU A;  1YJ9 1;  3MZL B;  4BXX I;  3NDJ A;  1TWF I;  2E2H I;  3I55 Z;  2QA4 Z;  3OW2 Z;  4RVH A;  2PMZ A;  1JWH C;  1VQ7 1;  2W04 A;  2RT9 A;  3G71 1;  3PO3 S;  1VQ4 1;  4RVD A;  3NH4 A;  4NH1 C;  3VMH A;  4Y52 I;  4E32 A;  3RZD I;  3NFZ A;  1M1K 1;  4HGY A;  3KIF A;  5T64 A;  3D9X A;  4E2X A;  3S16 I;  3CME 1;  1S7M A;  1KD1 2;  4RVG A;  2DE7 A;  1JJ2 Y;  1Q82 1;  2OTJ 1;  2Y0S A;  1S72 Z;  2R92 I;  3GKQ A;  3PO2 I;  2GTH A;  2NVY I;  2ZAE B;  1KQS Z;  4NB9 A;  4MON A;  3J80 b;  1L1O C;  4E33 A;  3HOU I;  1P9N A;  4XX2 A;  3I56 1;  3CCJ Z;  3JAM f;  1YHQ 1;  2NVX I;  1VQO Z;  1USP A;  5D1O A;  3MZK B;  1K83 I;  1YIJ Z;  1KRL A;  1Z01 A;  3G6E 1;  3S14 I;  2QRD B;  5C3E I;  4MD7 A;  2WB1 A;  3GTK I;  3GTJ I;  1X3Z A;  3HKZ A;  3CCR Z;  3FQM A;  1LQL A;  3NH8 A;  3CXC Y;  3EED A;  3CCR 1;  1VQL Z;  5CM2 M;  1VQ5 Z;  3HOZ I;  2W03 A;  2HU9 A;  5T67 A;  1WII A;  1VQN 1;  3FQQ A;  2QEX Z;  2J6A A;  1TFI A;  3I56 Z;  1Z03 A;  2OTL 1;  1K8A 1;  4QTT A;  1Q82 2;  1M90 1;  1USP B;  4MD9 A;  2LIY A;  3BG0 B;  1KC8 2;  1M90 2;  3S2D I;  2K3R A;  2JA5 I;  3CCU Z;  2WAQ A;  3P5J B;  1ZB9 A;  2KPI A;  3NDI A;  1VQM 1;  1QF8 A;  1VQ8 1;  4TNU A;  1Q81 1;  1K73 1;  3S17 I;  1NJI 2;  5IT9 b;  3OW2 Y;  1Y1W I;  3RZO I;  2V8I A;  1Y1V S;  1YJW 1;  1YUA A;  3CMA Z;  5T6B A;  2M48 A;  4MH4 A;  2LFU A;  3QWU A;  4A3C I;  1YIJ 1;  1K9M 1;  3GTM I;  2OOY B;  4NB8 A;  1VQ7 Z;  3IX0 A;  2NVT I;  5A2Q f;  1VQ9 1;  1ZB8 A;  1Z02 A;  4NBG A;  3CD6 Z;  2E2J I;  5C44 I;  2QRC B;  2G2K A;  4NBA A;  1KQS Y;  4A3B I;  3MON A;  3GTP I;  1R9T I;  1N2F A;  1VQ8 Z;  4E31 A;  2PK7 A;  3CC4 Z;  4BBR I;  1YI2 Z;  3I4M I;  2QRE B;  3IF8 A;  2R93 I;  4AYB A;  3PO3 I;  2M6N A;  3G6E Z;  3T4N B;  4A3G I;  3K7A I;  2H85 A;  1KD1 1;  2OTL Z;  2QLV B;  2V8K A;  2E2I I;  1I3Q I;  2QEX 1;  4RV9 A;  1VQ9 Z;  1M1K 2;  2P3Y A;  1JJ2 Z;  1VQK 1;  2JNY A;  1RO2 A;  3S1Q I;  1K9M 2;  2AKL A;  4CL1 A;  3S2H I;  3CD6 1;  4NBE A;  3VB9 A;  3CC7 1;  1TWC I;  3CXC Z;  4A3F I;  3GTQ I;  2V8J A;  2KI7 B;  2QR1 B;  1WCM I;  4E2Z A;  2B63 I;  3I4N I;  1NP6 A;  4BY7 I;  2JUB A;  1NUI A;  5IP9 I;  1ZH1 A;  3FKI I;  1VQ6 1;  3GCF A;  1QVG Z;  4MD8 A;  3H0G I;  3H3V J;  2PM9 A;  3CCS 1;  3CCM Z;  4A3M I;  4X6A I;  4DK1 A;  1WW9 A;  3VTN A;  3CCE 1;  4NBF A;  1KC8 1;  4A3D I;  3CCQ 1;  3VMG A;  1VQ5 1;  2RIQ A;  2IZ4 A;  1NJI 1;  1K8A 2;  3F3P C;  3S1R I;  2I3C A;  4QTU A;  1TWG I;  3CCS Z;  2NVQ I;  3CC2 Z;  3CCV 1;  3KIH A;  5AN9 F;  2VUM I;  3S1N I;  3GTM S;  2JA6 I;  1VQN Z;  4BBS I;  5D1O B;  5FLX b;  4A93 I;  1N8R 2;  1YUK A;  1W2B Y;  3J81 b;  1TWH I;  2RPR A;  5C4J I;  2DE5 A;  1YJN 1;  1VQ4 Z;  2HF1 A;  4NOZ A;  3EER A;  4A3K I;  4RVF A;  3CCU 1;  4E2Y A;  3CCE Z;  3CCL 1;  4E30 A;  3I07 A;  2GTI A;  4NBC A;  3Q87 A;  3G4S Z;  3VMI A;  2JR6 A;  3JAM b;  1VQO 1;  1YI2 1;  4BY1 I;  1I6H I;  1QVG Y;  4A3I I;  2P28 A;  2E9H A;  1VQP 1;  3J80 f;  1QVF Z;  2JA8 I;  4A3L I;  3CMA 1;  2Q4Z A;  3GTL I;  2R6M A;  3CPW Z;  2GU2 A;  3CCQ Z;  2YU9 I;  2QA4 1;  3S1M I;  1RNI A;  4Y7N I;  5LL6 f;  3CCJ 1;  1QYP A;  3CQZ I;  2EGT A;  1S72 1;  1DL6 A;  5A2Q b;  1Q81 2;  1K73 2;  1Q86 2;  3CCM 1;  1RO4 A;  2OZK A;  1I50 I;  4RS4 A;  4E2W A;  1VLA A;  4NFR A;  3NH5 A;  3GTG I;  3G4S 1;  3CME Z;  1VQP Z;  3TDH B;  3LUS A;  3TE5 B;  1RQF A;  1YHQ Z;  3J7A 4;  1YIT 1;  1ML8 A;  3CC4 1;  1VQL 1;  1PFT A;  4MXU A;  3CC7 Z;  1QVF Y;  2R7Z I;  5IP7 I;  3M4O I;  5C4X I;  3CCL Z;  1RO0 A;  4DGL A;  2JA7 I;  4HH4 A;  3U50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...