3JAMf

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamf00
3JAMf 3J80f 5IT9f 3J81f 5FLXf 5A2Qf
chains in the Genus database with same CATH superfamily
2OTJ1 1K9M1 3CCJ1 3GTKI 1Z01A 2OTL1 3HKZA 3FQMA 3VMGA 3CME1 1VQ6Z 2O4HA 1K9M2 1I50I 4NB8A 3CD6Z 4NOZA 2V8KA 2KI7B 1YJ9Z 1JJ2Z 1QYPA 3CCL1 3G4S1 4RVDA 1Z02A 4NBHA 4E2XA 4A3JI 1RO2A 2VPWA 4BXXI 3CCQZ 1VQ41 4Y52I 3J81f 2E9HA 5AN9F 1KQSY 3J80f 5T67A 2QEX1 4HGYA 2Q4ZA 2JIOA 2OOYB 1RLYA 2K3RA 2B63I 2WB1A 3S1NI 4DQYB 2O53A 1ZH1A 1VQL1 1TWAI 3GTQI 1S7MA 3NH5A 2NVXI 2JA7I 1RO0A 4RS4A 1VQNZ 3OW2Y 3GTPI 1VQ91 2R92I 3T4NB 2OTJZ 5A2Qb 3D2LA 3CCJZ 1FDOA 2JUBA 1Y1VS 1P9NA 1NJI1 5D1PA 1WCMI 2OTLZ 2JIRA 3BG0B 3S2DI 3CMEZ 4AYBA 3HOUI 1QVGZ 2P3YA 3PO3I 2P28A 1M1K1 1X0TA 3CCS1 1NJI2 2IZ4A 3GTMI 3GTLI 3HOYI 1Q861 3CCLZ 3G4SZ 1Z03A 2I3CA 1Q7Y1 1YHQ1 3RZOI 1M1K2 4BY1I 4E2ZA 1VQ4Z 1Q862 3NFZA 2RBLA 4NBDA 1Q7Y2 2JA6I 1QVFY 3I561 1L1OC 4X6AI 1WIIA 2QEXZ 2JNYA 3CMA1 1Y8CA 1VQLZ 2WAQA 4A3MI 2JA5I 5C4XI 1I6HI 4NFRA 2V3VA 3CC71 1VQO1 3GKQA 1N2FA 2M48A 2BJOA 1NP6A 4MD7A 1VQ9Z 2VF1A 1YUKA 2JIMA 4NBAA 1QXFA 2V8JA 4RVHA 1ZB9A 4MD8A 5T6BA 3VMHA 1FDIA 4NB9A 3J7A4 2H85A 3S1QI 4A3EI 3G711 4MONA 3K7AI 1DL6A 1K8A1 4A3LI 2PMZA 3QWUA 3CCSZ 3VMIA 3S15I 5D1OA 3D9XA 1S721 5D1OB 1KQSZ 2RT9A 1YHQZ 1K8A2 5FLXb 3KIFA 4MRIA 1YJW1 3D6WA 3I56Z 3H3VJ 3TE5B 2NVYI 1WJ2A 4A3KI 2R93I 4NBEA 2E2JI 3OW2Z 3HOXI 3CMAZ 1YIT1 2IV2X 2QLVB 3CCR1 3NDJA 1WW9A 3CC7Z 2QKDA 1VQOZ 3VB9A 3CCU1 1VQ81 4NBFA 3S17I 1ML8A 2W04A 1N8R1 2VPYA 4E2YA 5FLMI 1VQ51 4E32A 3G71Z 3I551 2IZ3A 3Q87A 4XX2A 2YU9I 1N8R2 1YJN1 4S1TA 2JS4A 5A2Qf 2J6AA 3NH8A 1S72Z 1QVFZ 3CCV1 3HOZI 1TWGI 3S14I 1YJWZ 3EEDA 2LFUA 5LL6f 3IX0A 2VUGA 4BBRI 2AKLA 3CXCY 2W03A 1Y1WI 4RVFA 1YITZ 2EGTA 4HH4A 2M6NA 3CCRZ 2QRDB 3P5JB 4E2WA 2RHBA 1YI21 1Q811 2DE5A 1ZB8A 1TWHI 2HU9A 3IR7A 3EERA 3CCUZ 1VQ8Z 3CCM1 1YIJ1 4BBSI 1Q16A 1VQ5Z 1Q812 3JAMb 3I07A 2DE6A 3I55Z 3CPWY 2DE7A 2R7ZI 1KD11 4Y7NI 3H0GI 2PK7A 1YJNZ 5IP7I 1USPA 1USPB 3PO3S 3CCVZ 4MD9A 1KD12 1VLAA 1VQ71 3GTMS 4RVGA 1R9TI 2F4OA 3IF8A 2NVTI 4MXUA 4EWCA 5FLXf 2LEXA 3HOVI 3S1MI 3CC21 2E7ZA 3CCE1 1VQP1 3MONA 2NVQI 2KPIA 1YI2Z 3GTJI 2QRCB 1LQLA 3F3PC 4RV9A 1Q821 3CCMZ 2JMOA 2VUMI 1I3QI 2AYDA 1QF8A 3HOWI 1VQN1 2R6MA 3NDIA 1AA6A 1Q822 1SFOI 3M4OI 2RIQA 3I4NI 2F4MA 2JIQA 4A3CI 1RNIA 1SIWA 3GCFA 2LIYA 3GTGI 3NH4A 5IP9I 2QA41 5C4JI 4A3II 1VQ7Z 3CXCZ 3S2HI 4NBBA 2JR6A 1Y1VI 5C3EI 3F3FC 4A3FI 2VPXA 4DK1A 1TFIA 4A3BI 2YADA 1X3ZA 3VTNA 4HGZA 1WZNA 1W2BY 3CC2Z 4NBCA 4A3GI 3I4MI 3CC41 4A93I 3J81b 2OZKA 2GTHA 3CCEZ 5IT9f 1VQPZ 3ESWA 1KC81 3J80b 2K5RA 3GTOI 3S16I 5IT9b 3CPWZ 1TWFI 2RPRA 4MH4A 5T64A 1KC82 4BY7I 1JJ2Y 2V8IA 1TWCI 1PFTA 2HF1A 2JA8I 3G6E1 2QR1B 4DGLA 4NBGA 2QA4Z 1X3WA 3FQQA 3JAMf 3FKII 1VQM1 2Y0SA 1VQK1 2E2HI 2GU2A 4E30A 1M901 4NH1C 1KRLA 4CL1A 2V45A 2NAPA 3KIHA 4QTTA 3S1RI 2G2KA 4TNUA 4QTUA 3IFUA 1M902 1VQ61 3CC4Z 3PO2I 3CD61 5C44I 1YJ91 2QREB 1K83I 2Q51A 2ZAEB 1QVGY 1JWHC 3MZLB 1RQFA 2JIPA 3CCQ1 3LUSA 1NUIA 3M3YI 3CQZI 1K731 3G6EZ 2GTIA 5CM2M 2OOXB 4E33A 3RZDI 2PM9A 2E2II 4A3DI 3BG1B 3MZKB 1K732 1YIJZ 2VPZA 1YUAA 3U50C 1VQMZ 1W2BZ 1VQKZ 3TDHB 4E31A 1RO4A
chains in the Genus database with same CATH topology
2OTJ1 1K9M1 3CCJ1 3GTKI 1Z01A 2OTL1 3HKZA 3FQMA 3VMGA 3CME1 1VQ6Z 2O4HA 1K9M2 1I50I 4NB8A 3CD6Z 4NOZA 2V8KA 2KI7B 1YJ9Z 1JJ2Z 1QYPA 3CCL1 3G4S1 4RVDA 1Z02A 4NBHA 4E2XA 4A3JI 1RO2A 4BXXI 3CCQZ 1VQ41 4Y52I 3J81f 2E9HA 5AN9F 1KQSY 3J80f 5T67A 2QEX1 4HGYA 2Q4ZA 2OOYB 1RLYA 2K3RA 2B63I 2WB1A 3S1NI 4DQYB 2O53A 1ZH1A 1VQL1 1TWAI 3GTQI 1S7MA 3NH5A 2NVXI 2JA7I 1RO0A 4RS4A 1VQNZ 3OW2Y 3GTPI 1VQ91 2R92I 3T4NB 2OTJZ 5A2Qb 3CCJZ 2JUBA 1Y1VS 1P9NA 1NJI1 5D1PA 1WCMI 2OTLZ 3BG0B 3S2DI 3CMEZ 4AYBA 3HOUI 1QVGZ 2P3YA 3PO3I 2P28A 1M1K1 1X0TA 3CCS1 1NJI2 2IZ4A 3GTMI 3GTLI 3HOYI 1Q861 3CCLZ 3G4SZ 1Z03A 2I3CA 1Q7Y1 1YHQ1 3RZOI 1M1K2 4BY1I 4E2ZA 1VQ4Z 1Q862 3NFZA 2RBLA 4NBDA 1Q7Y2 2JA6I 1QVFY 3I561 1L1OC 4X6AI 1WIIA 2QEXZ 2JNYA 3CMA1 1VQLZ 2WAQA 4A3MI 2JA5I 5C4XI 1I6HI 4NFRA 3CC71 1VQO1 3GKQA 1N2FA 2M48A 2BJOA 1NP6A 4MD7A 1VQ9Z 2VF1A 1YUKA 4NBAA 2V8JA 4RVHA 1ZB9A 4MD8A 5T6BA 3VMHA 4NB9A 3J7A4 2H85A 3S1QI 4A3EI 3G711 4MONA 3K7AI 1DL6A 1K8A1 4A3LI 2PMZA 3QWUA 3CCSZ 3VMIA 3S15I 5D1OA 3D9XA 1S721 5D1OB 1KQSZ 2RT9A 1YHQZ 1K8A2 5FLXb 3KIFA 4MRIA 1YJW1 3D6WA 3I56Z 3H3VJ 3TE5B 2NVYI 4A3KI 2R93I 4NBEA 2E2JI 3OW2Z 3HOXI 3CMAZ 1YIT1 2QLVB 3CCR1 3NDJA 1WW9A 3CC7Z 2QKDA 1VQOZ 3VB9A 3CCU1 1VQ81 4NBFA 3S17I 1ML8A 2W04A 1N8R1 4E2YA 5FLMI 1VQ51 4E32A 3G71Z 3I551 2IZ3A 3Q87A 4XX2A 2YU9I 1N8R2 1YJN1 4S1TA 2JS4A 5A2Qf 2J6AA 3NH8A 1S72Z 1QVFZ 3CCV1 3HOZI 1TWGI 3S14I 1YJWZ 3EEDA 2LFUA 5LL6f 3IX0A 2VUGA 4BBRI 2AKLA 3CXCY 2W03A 1Y1WI 4RVFA 1YITZ 2EGTA 4HH4A 2M6NA 3CCRZ 2QRDB 3P5JB 4E2WA 2RHBA 1YI21 1Q811 2DE5A 1ZB8A 1TWHI 2HU9A 3EERA 3CCUZ 1VQ8Z 3CCM1 1YIJ1 4BBSI 1VQ5Z 1Q812 3JAMb 3I07A 2DE6A 3I55Z 3CPWY 2DE7A 2R7ZI 1KD11 4Y7NI 3H0GI 2PK7A 1YJNZ 5IP7I 1USPA 1USPB 3PO3S 3CCVZ 4MD9A 1KD12 1VLAA 1VQ71 3GTMS 4RVGA 1R9TI 2F4OA 3IF8A 2NVTI 4MXUA 4EWCA 5FLXf 3HOVI 3S1MI 3CC21 3CCE1 1VQP1 3MONA 2NVQI 2KPIA 1YI2Z 3GTJI 2QRCB 1LQLA 3F3PC 4RV9A 1Q821 3CCMZ 2JMOA 2VUMI 1I3QI 1QF8A 3HOWI 1VQN1 2R6MA 3NDIA 1Q822 1SFOI 3M4OI 2RIQA 3I4NI 2F4MA 4A3CI 1RNIA 3GCFA 2LIYA 3GTGI 3NH4A 5IP9I 2QA41 5C4JI 4A3II 1VQ7Z 3CXCZ 3S2HI 4NBBA 2JR6A 1Y1VI 5C3EI 3F3FC 4A3FI 4DK1A 1TFIA 4A3BI 2YADA 1X3ZA 3VTNA 4HGZA 1W2BY 3CC2Z 4NBCA 4A3GI 3I4MI 3CC41 4A93I 3J81b 2OZKA 2GTHA 3CCEZ 5IT9f 1VQPZ 3ESWA 1KC81 3J80b 2K5RA 3GTOI 3S16I 5IT9b 3CPWZ 1TWFI 2RPRA 4MH4A 5T64A 1KC82 4BY7I 1JJ2Y 2V8IA 1TWCI 1PFTA 2HF1A 2JA8I 3G6E1 2QR1B 4DGLA 4NBGA 2QA4Z 1X3WA 3FQQA 3JAMf 3FKII 1VQM1 2Y0SA 1VQK1 2E2HI 2GU2A 4E30A 1M901 4NH1C 1KRLA 4CL1A 3KIHA 4QTTA 3S1RI 2G2KA 4TNUA 4QTUA 3IFUA 1M902 1VQ61 3CC4Z 3PO2I 3CD61 5C44I 1YJ91 2QREB 1K83I 2Q51A 2ZAEB 1QVGY 1JWHC 3MZLB 1RQFA 3CCQ1 3LUSA 1NUIA 3M3YI 3CQZI 1K731 3G6EZ 2GTIA 5CM2M 2OOXB 4E33A 3RZDI 2PM9A 2E2II 4A3DI 3BG1B 3MZKB 1K732 1YIJZ 1YUAA 3U50C 1VQMZ 1W2BZ 1VQKZ 3TDHB 4E31A 1RO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM f;  3J80 f;  5IT9 f;  3J81 f;  5FLX f;  5A2Q f; 
#chains in the Genus database with same CATH topology
 2OTJ 1;  1K9M 1;  3CCJ 1;  3GTK I;  1Z01 A;  2OTL 1;  3HKZ A;  3FQM A;  3VMG A;  3CME 1;  1VQ6 Z;  2O4H A;  1K9M 2;  1I50 I;  4NB8 A;  3CD6 Z;  4NOZ A;  2V8K A;  2KI7 B;  1YJ9 Z;  1JJ2 Z;  1QYP A;  3CCL 1;  3G4S 1;  4RVD A;  1Z02 A;  4NBH A;  4E2X A;  4A3J I;  1RO2 A;  2VPW A;  4BXX I;  3CCQ Z;  1VQ4 1;  4Y52 I;  3J81 f;  2E9H A;  5AN9 F;  1KQS Y;  3J80 f;  5T67 A;  2QEX 1;  4HGY A;  2Q4Z A;  2JIO A;  2OOY B;  1RLY A;  2K3R A;  2B63 I;  2WB1 A;  3S1N I;  4DQY B;  2O53 A;  1ZH1 A;  1VQL 1;  1TWA I;  3GTQ I;  1S7M A;  3NH5 A;  2NVX I;  2JA7 I;  1RO0 A;  4RS4 A;  1VQN Z;  3OW2 Y;  3GTP I;  1VQ9 1;  2R92 I;  3T4N B;  2OTJ Z;  5A2Q b;  3D2L A;  3CCJ Z;  1FDO A;  2JUB A;  1Y1V S;  1P9N A;  1NJI 1;  5D1P A;  1WCM I;  2OTL Z;  2JIR A;  3BG0 B;  3S2D I;  3CME Z;  4AYB A;  3HOU I;  1QVG Z;  2P3Y A;  3PO3 I;  2P28 A;  1M1K 1;  1X0T A;  3CCS 1;  1NJI 2;  2IZ4 A;  3GTM I;  3GTL I;  3HOY I;  1Q86 1;  3CCL Z;  3G4S Z;  1Z03 A;  2I3C A;  1Q7Y 1;  1YHQ 1;  3RZO I;  1M1K 2;  4BY1 I;  4E2Z A;  1VQ4 Z;  1Q86 2;  3NFZ A;  2RBL A;  4NBD A;  1Q7Y 2;  2JA6 I;  1QVF Y;  3I56 1;  1L1O C;  4X6A I;  1WII A;  2QEX Z;  2JNY A;  3CMA 1;  1Y8C A;  1VQL Z;  2WAQ A;  4A3M I;  2JA5 I;  5C4X I;  1I6H I;  4NFR A;  2V3V A;  3CC7 1;  1VQO 1;  3GKQ A;  1N2F A;  2M48 A;  2BJO A;  1NP6 A;  4MD7 A;  1VQ9 Z;  2VF1 A;  1YUK A;  2JIM A;  4NBA A;  1QXF A;  2V8J A;  4RVH A;  1ZB9 A;  4MD8 A;  5T6B A;  3VMH A;  1FDI A;  4NB9 A;  3J7A 4;  2H85 A;  3S1Q I;  4A3E I;  3G71 1;  4MON A;  3K7A I;  1DL6 A;  1K8A 1;  4A3L I;  2PMZ A;  3QWU A;  3CCS Z;  3VMI A;  3S15 I;  5D1O A;  3D9X A;  1S72 1;  5D1O B;  1KQS Z;  2RT9 A;  1YHQ Z;  1K8A 2;  5FLX b;  3KIF A;  4MRI A;  1YJW 1;  3D6W A;  3I56 Z;  3H3V J;  3TE5 B;  2NVY I;  1WJ2 A;  4A3K I;  2R93 I;  4NBE A;  2E2J I;  3OW2 Z;  3HOX I;  3CMA Z;  1YIT 1;  2IV2 X;  2QLV B;  3CCR 1;  3NDJ A;  1WW9 A;  3CC7 Z;  2QKD A;  1VQO Z;  3VB9 A;  3CCU 1;  1VQ8 1;  4NBF A;  3S17 I;  1ML8 A;  2W04 A;  1N8R 1;  2VPY A;  4E2Y A;  5FLM I;  1VQ5 1;  4E32 A;  3G71 Z;  3I55 1;  2IZ3 A;  3Q87 A;  4XX2 A;  2YU9 I;  1N8R 2;  1YJN 1;  4S1T A;  2JS4 A;  5A2Q f;  2J6A A;  3NH8 A;  1S72 Z;  1QVF Z;  3CCV 1;  3HOZ I;  1TWG I;  3S14 I;  1YJW Z;  3EED A;  2LFU A;  5LL6 f;  3IX0 A;  2VUG A;  4BBR I;  2AKL A;  3CXC Y;  2W03 A;  1Y1W I;  4RVF A;  1YIT Z;  2EGT A;  4HH4 A;  2M6N A;  3CCR Z;  2QRD B;  3P5J B;  4E2W A;  2RHB A;  1YI2 1;  1Q81 1;  2DE5 A;  1ZB8 A;  1TWH I;  2HU9 A;  3IR7 A;  3EER A;  3CCU Z;  1VQ8 Z;  3CCM 1;  1YIJ 1;  4BBS I;  1Q16 A;  1VQ5 Z;  1Q81 2;  3JAM b;  3I07 A;  2DE6 A;  3I55 Z;  3CPW Y;  2DE7 A;  2R7Z I;  1KD1 1;  4Y7N I;  3H0G I;  2PK7 A;  1YJN Z;  5IP7 I;  1USP A;  1USP B;  3PO3 S;  3CCV Z;  4MD9 A;  1KD1 2;  1VLA A;  1VQ7 1;  3GTM S;  4RVG A;  1R9T I;  2F4O A;  3IF8 A;  2NVT I;  4MXU A;  4EWC A;  5FLX f;  2LEX A;  3HOV I;  3S1M I;  3CC2 1;  2E7Z A;  3CCE 1;  1VQP 1;  3MON A;  2NVQ I;  2KPI A;  1YI2 Z;  3GTJ I;  2QRC B;  1LQL A;  3F3P C;  4RV9 A;  1Q82 1;  3CCM Z;  2JMO A;  2VUM I;  1I3Q I;  2AYD A;  1QF8 A;  3HOW I;  1VQN 1;  2R6M A;  3NDI A;  1AA6 A;  1Q82 2;  1SFO I;  3M4O I;  2RIQ A;  3I4N I;  2F4M A;  2JIQ A;  4A3C I;  1RNI A;  1SIW A;  3GCF A;  2LIY A;  3GTG I;  3NH4 A;  5IP9 I;  2QA4 1;  5C4J I;  4A3I I;  1VQ7 Z;  3CXC Z;  3S2H I;  4NBB A;  2JR6 A;  1Y1V I;  5C3E I;  3F3F C;  4A3F I;  2VPX A;  4DK1 A;  1TFI A;  4A3B I;  2YAD A;  1X3Z A;  3VTN A;  4HGZ A;  1WZN A;  1W2B Y;  3CC2 Z;  4NBC A;  4A3G I;  3I4M I;  3CC4 1;  4A93 I;  3J81 b;  2OZK A;  2GTH A;  3CCE Z;  5IT9 f;  1VQP Z;  3ESW A;  1KC8 1;  3J80 b;  2K5R A;  3GTO I;  3S16 I;  5IT9 b;  3CPW Z;  1TWF I;  2RPR A;  4MH4 A;  5T64 A;  1KC8 2;  4BY7 I;  1JJ2 Y;  2V8I A;  1TWC I;  1PFT A;  2HF1 A;  2JA8 I;  3G6E 1;  2QR1 B;  4DGL A;  4NBG A;  2QA4 Z;  1X3W A;  3FQQ A;  3JAM f;  3FKI I;  1VQM 1;  2Y0S A;  1VQK 1;  2E2H I;  2GU2 A;  4E30 A;  1M90 1;  4NH1 C;  1KRL A;  4CL1 A;  2V45 A;  2NAP A;  3KIH A;  4QTT A;  3S1R I;  2G2K A;  4TNU A;  4QTU A;  3IFU A;  1M90 2;  1VQ6 1;  3CC4 Z;  3PO2 I;  3CD6 1;  5C44 I;  1YJ9 1;  2QRE B;  1K83 I;  2Q51 A;  2ZAE B;  1QVG Y;  1JWH C;  3MZL B;  1RQF A;  2JIP A;  3CCQ 1;  3LUS A;  1NUI A;  3M3Y I;  3CQZ I;  1K73 1;  3G6E Z;  2GTI A;  5CM2 M;  2OOX B;  4E33 A;  3RZD I;  2PM9 A;  2E2I I;  4A3D I;  3BG1 B;  3MZK B;  1K73 2;  1YIJ Z;  2VPZ A;  1YUA A;  3U50 C;  1VQM Z;  1W2B Z;  1VQK Z;  3TDH B;  4E31 A;  1RO4 A; 
#chains in the Genus database with same CATH homology
 2OTJ 1;  1K9M 1;  3CCJ 1;  3GTK I;  1Z01 A;  2OTL 1;  3HKZ A;  3FQM A;  3VMG A;  3CME 1;  1VQ6 Z;  2O4H A;  1K9M 2;  1I50 I;  4NB8 A;  3CD6 Z;  4NOZ A;  2V8K A;  2KI7 B;  1YJ9 Z;  1JJ2 Z;  1QYP A;  3CCL 1;  3G4S 1;  4RVD A;  1Z02 A;  4NBH A;  4E2X A;  4A3J I;  1RO2 A;  4BXX I;  3CCQ Z;  1VQ4 1;  4Y52 I;  3J81 f;  2E9H A;  5AN9 F;  1KQS Y;  3J80 f;  5T67 A;  2QEX 1;  4HGY A;  2Q4Z A;  2OOY B;  1RLY A;  2K3R A;  2B63 I;  2WB1 A;  3S1N I;  4DQY B;  2O53 A;  1ZH1 A;  1VQL 1;  1TWA I;  3GTQ I;  1S7M A;  3NH5 A;  2NVX I;  2JA7 I;  1RO0 A;  4RS4 A;  1VQN Z;  3OW2 Y;  3GTP I;  1VQ9 1;  2R92 I;  3T4N B;  2OTJ Z;  5A2Q b;  3CCJ Z;  2JUB A;  1Y1V S;  1P9N A;  1NJI 1;  5D1P A;  1WCM I;  2OTL Z;  3BG0 B;  3S2D I;  3CME Z;  4AYB A;  3HOU I;  1QVG Z;  2P3Y A;  3PO3 I;  2P28 A;  1M1K 1;  1X0T A;  3CCS 1;  1NJI 2;  2IZ4 A;  3GTM I;  3GTL I;  3HOY I;  1Q86 1;  3CCL Z;  3G4S Z;  1Z03 A;  2I3C A;  1Q7Y 1;  1YHQ 1;  3RZO I;  1M1K 2;  4BY1 I;  4E2Z A;  1VQ4 Z;  1Q86 2;  3NFZ A;  2RBL A;  4NBD A;  1Q7Y 2;  2JA6 I;  1QVF Y;  3I56 1;  1L1O C;  4X6A I;  1WII A;  2QEX Z;  2JNY A;  3CMA 1;  1VQL Z;  2WAQ A;  4A3M I;  2JA5 I;  5C4X I;  1I6H I;  4NFR A;  3CC7 1;  1VQO 1;  3GKQ A;  1N2F A;  2M48 A;  2BJO A;  1NP6 A;  4MD7 A;  1VQ9 Z;  2VF1 A;  1YUK A;  4NBA A;  2V8J A;  4RVH A;  1ZB9 A;  4MD8 A;  5T6B A;  3VMH A;  4NB9 A;  3J7A 4;  2H85 A;  3S1Q I;  4A3E I;  3G71 1;  4MON A;  3K7A I;  1DL6 A;  1K8A 1;  4A3L I;  2PMZ A;  3QWU A;  3CCS Z;  3VMI A;  3S15 I;  5D1O A;  3D9X A;  1S72 1;  5D1O B;  1KQS Z;  2RT9 A;  1YHQ Z;  1K8A 2;  5FLX b;  3KIF A;  4MRI A;  1YJW 1;  3D6W A;  3I56 Z;  3H3V J;  3TE5 B;  2NVY I;  4A3K I;  2R93 I;  4NBE A;  2E2J I;  3OW2 Z;  3HOX I;  3CMA Z;  1YIT 1;  2QLV B;  3CCR 1;  3NDJ A;  1WW9 A;  3CC7 Z;  2QKD A;  1VQO Z;  3VB9 A;  3CCU 1;  1VQ8 1;  4NBF A;  3S17 I;  1ML8 A;  2W04 A;  1N8R 1;  4E2Y A;  5FLM I;  1VQ5 1;  4E32 A;  3G71 Z;  3I55 1;  2IZ3 A;  3Q87 A;  4XX2 A;  2YU9 I;  1N8R 2;  1YJN 1;  4S1T A;  2JS4 A;  5A2Q f;  2J6A A;  3NH8 A;  1S72 Z;  1QVF Z;  3CCV 1;  3HOZ I;  1TWG I;  3S14 I;  1YJW Z;  3EED A;  2LFU A;  5LL6 f;  3IX0 A;  2VUG A;  4BBR I;  2AKL A;  3CXC Y;  2W03 A;  1Y1W I;  4RVF A;  1YIT Z;  2EGT A;  4HH4 A;  2M6N A;  3CCR Z;  2QRD B;  3P5J B;  4E2W A;  2RHB A;  1YI2 1;  1Q81 1;  2DE5 A;  1ZB8 A;  1TWH I;  2HU9 A;  3EER A;  3CCU Z;  1VQ8 Z;  3CCM 1;  1YIJ 1;  4BBS I;  1VQ5 Z;  1Q81 2;  3JAM b;  3I07 A;  2DE6 A;  3I55 Z;  3CPW Y;  2DE7 A;  2R7Z I;  1KD1 1;  4Y7N I;  3H0G I;  2PK7 A;  1YJN Z;  5IP7 I;  1USP A;  1USP B;  3PO3 S;  3CCV Z;  4MD9 A;  1KD1 2;  1VLA A;  1VQ7 1;  3GTM S;  4RVG A;  1R9T I;  2F4O A;  3IF8 A;  2NVT I;  4MXU A;  4EWC A;  5FLX f;  3HOV I;  3S1M I;  3CC2 1;  3CCE 1;  1VQP 1;  3MON A;  2NVQ I;  2KPI A;  1YI2 Z;  3GTJ I;  2QRC B;  1LQL A;  3F3P C;  4RV9 A;  1Q82 1;  3CCM Z;  2JMO A;  2VUM I;  1I3Q I;  1QF8 A;  3HOW I;  1VQN 1;  2R6M A;  3NDI A;  1Q82 2;  1SFO I;  3M4O I;  2RIQ A;  3I4N I;  2F4M A;  4A3C I;  1RNI A;  3GCF A;  2LIY A;  3GTG I;  3NH4 A;  5IP9 I;  2QA4 1;  5C4J I;  4A3I I;  1VQ7 Z;  3CXC Z;  3S2H I;  4NBB A;  2JR6 A;  1Y1V I;  5C3E I;  3F3F C;  4A3F I;  4DK1 A;  1TFI A;  4A3B I;  2YAD A;  1X3Z A;  3VTN A;  4HGZ A;  1W2B Y;  3CC2 Z;  4NBC A;  4A3G I;  3I4M I;  3CC4 1;  4A93 I;  3J81 b;  2OZK A;  2GTH A;  3CCE Z;  5IT9 f;  1VQP Z;  3ESW A;  1KC8 1;  3J80 b;  2K5R A;  3GTO I;  3S16 I;  5IT9 b;  3CPW Z;  1TWF I;  2RPR A;  4MH4 A;  5T64 A;  1KC8 2;  4BY7 I;  1JJ2 Y;  2V8I A;  1TWC I;  1PFT A;  2HF1 A;  2JA8 I;  3G6E 1;  2QR1 B;  4DGL A;  4NBG A;  2QA4 Z;  1X3W A;  3FQQ A;  3JAM f;  3FKI I;  1VQM 1;  2Y0S A;  1VQK 1;  2E2H I;  2GU2 A;  4E30 A;  1M90 1;  4NH1 C;  1KRL A;  4CL1 A;  3KIH A;  4QTT A;  3S1R I;  2G2K A;  4TNU A;  4QTU A;  3IFU A;  1M90 2;  1VQ6 1;  3CC4 Z;  3PO2 I;  3CD6 1;  5C44 I;  1YJ9 1;  2QRE B;  1K83 I;  2Q51 A;  2ZAE B;  1QVG Y;  1JWH C;  3MZL B;  1RQF A;  3CCQ 1;  3LUS A;  1NUI A;  3M3Y I;  3CQZ I;  1K73 1;  3G6E Z;  2GTI A;  5CM2 M;  2OOX B;  4E33 A;  3RZD I;  2PM9 A;  2E2I I;  4A3D I;  3BG1 B;  3MZK B;  1K73 2;  1YIJ Z;  1YUA A;  3U50 C;  1VQM Z;  1W2B Z;  1VQK Z;  3TDH B;  4E31 A;  1RO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...