3JAMf

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamf00
5FLXf 5IT9f 3JAMf 3J81f 5A2Qf 3J80f
chains in the Genus database with same CATH superfamily
1SFOI 1KC81 4NBEA 2E9HA 3NDJA 3HOVI 1S7MA 2LFUA 4RVDA 2PMZA 2HU9A 5CM2M 2GU2A 3CQZI 1USPB 4MXUA 1JJ2Z 2DE5A 1K9M2 4NB9A 1YI21 4S1TA 3I551 4RVGA 4MH4A 2JIMA 4A3II 2VPYA 1Q862 3CC41 2VUMI 1W2BY 3CCV1 3G4S1 4MD9A 4TNUA 3M4OI 4A3CI 2QEXZ 1VQ8Z 1KC82 3JAMf 3HOZI 4E2YA 1FDOA 3S17I 3S14I 3NH5A 3GKQA 5D1PA 3CCVZ 2NAPA 1VQL1 1WJ2A 1N8R1 3I4NI 1VQK1 2RPRA 3OW2Z 2YADA 1Y8CA 3CC4Z 3NH8A 4MONA 2QRCB 2IZ3A 3GTMS 1K9M1 2QR1B 3GTPI 2EGTA 1TWAI 4A3LI 1VQKZ 2QRDB 1I50I 1NUIA 4MD7A 3I07A 2HF1A 4HGYA 3EEDA 3CMA1 1VQ4Z 3GTKI 1TWCI 2V8JA 1YITZ 1VQLZ 2K3RA 3P5JB 1QXFA 2R6MA 3VB9A 4Y7NI 1QVGZ 1M902 1KQSY 2V8KA 1VQ81 4A3FI 3BG0B 2VF1A 3TDHB 1KQSZ 4E2XA 4A3KI 1P9NA 2V45A 1VQM1 2Y0SA 3CC71 3J81b 5T64A 3QWUA 2W03A 1VQ61 2B63I 2PK7A 1Z03A 5IP9I 2LEXA 3I55Z 4A3EI 1VQPZ 3S16I 2ZAEB 2KI7B 4BY7I 1NJI1 3CMEZ 5A2Qf 2P3YA 4BBRI 2IV2X 3GTGI 1RNIA 3VMIA 2O4HA 3JAMb 4E2ZA 5LL6f 2OZKA 3OW2Y 1K8A1 2M48A 2GTHA 2QREB 2JA5I 4NBHA 1Q7Y2 2QLVB 2JA6I 3I4MI 1KRLA 5FLXf 3CCEZ 3GTQI 1W2BZ 2Q51A 1X3ZA 1VQO1 3VMGA 4E32A 1I6HI 2F4MA 1VQN1 1YJNZ 1VQ91 1K732 5IT9b 1RQFA 3GTOI 2WAQA 2DE6A 3CCQ1 1ZB8A 3G4SZ 2RIQA 1KD12 3CCJ1 2OOXB 2E2HI 3FKII 3T4NB 3G71Z 5D1OB 4CL1A 1Q7Y1 2VPZA 1M1K2 2RHBA 1K8A2 3G6E1 4BXXI 2F4OA 4EWCA 1QVFZ 3CPWY 1RLYA 2JA7I 4A3JI 1ML8A 4DGLA 2JMOA 4E2WA 1VQ9Z 1NJI2 1YJ91 3J7A4 1VQ7Z 2VPWA 2OTJZ 4HH4A 1ZB9A 3S1QI 3J81f 3EERA 1RO4A 1VQOZ 3F3PC 3CCUZ 1FDIA 3G711 4X6AI 3RZDI 1RO2A 2JIPA 2NVXI 2JS4A 3NH4A 2YU9I 4E31A 3GTMI 2LIYA 1Q811 1M901 4XX2A 2RT9A 1N2FA 1QF8A 1TWGI 3CC2Z 3HOWI 2V8IA 1YIJ1 3HOUI 1YJW1 5AN9F 1VQ5Z 3NFZA 2G2KA 2NVTI 2JUBA 4NFRA 4NBFA 3CCU1 3S1MI 3FQMA 5IT9f 1SIWA 3CXCZ 3S1NI 2W04A 1WCMI 2OTLZ 1Z02A 3CCMZ 3CCE1 4A3MI 3S2DI 3HOXI 3CCR1 3VTNA 2Q4ZA 1N8R2 1USPA 2QKDA 5C44I 3CD61 1TWHI 1VQ41 3CCL1 1WZNA 5C4JI 4RVFA 5C3EI 3IF8A 5T6BA 1VLAA 4NBCA 2H85A 4HGZA 1M1K1 3CXCY 5IP7I 2JIOA 1Q822 2VPXA 3HKZA 4RS4A 4A3DI 1R9TI 2E2JI 4NBDA 3GCFA 1Y1VI 1VQP1 1YJ9Z 3S1RI 3CD6Z 3CMAZ 2AYDA 3PO3I 1YIT1 1TWFI 1X3WA 2JR6A 2R93I 4RV9A 3CCRZ 3KIHA 4NH1C 4RVHA 2V3VA 4NBBA 1LQLA 4MD8A 2JNYA 4QTUA 1VQMZ 1Z01A 2I3CA 1AA6A 5A2Qb 3KIFA 2VUGA 4NB8A 3U50C 3S15I 1TFIA 4BY1I 1YJWZ 4NOZA 1JJ2Y 3TE5B 3RZOI 3PO3S 4A93I 2NVQI 4NBAA 4E33A 1Y1VS 3IR7A 5FLXb 2JA8I 3MONA 1NP6A 3K7AI 3I561 2OTL1 3CCM1 1VQ51 3D6WA 4A3GI 3ESWA 3GTJI 3PO2I 4MRIA 1QVFY 1VQ6Z 1RO0A 2KPIA 4E30A 3J80b 5FLMI 3NDIA 3BG1B 2R92I 2JIRA 1YHQ1 1Q812 3CCS1 1Q16A 2O53A 2K5RA 4NBGA 4QTTA 2R7ZI 4A3BI 2IZ4A 3G6EZ 3CC7Z 2OOYB 1KD11 1QVGY 1WW9A 3FQQA 1JWHC 5D1OA 3M3YI 1K731 5T67A 1S72Z 2QA41 3IX0A 4AYBA 1Q821 2QEX1 2WB1A 3I56Z 3HOYI 3H3VJ 3S2HI 1YIJZ 4BBSI 1VQNZ 1YJN1 1YHQZ 3CCSZ 4DK1A 2OTJ1 2E2II 3CME1 1S721 2BJOA 2QA4Z 3MZKB 1I3QI 1QYPA 1YUAA 2GTIA 2M6NA 1L1OC 3F3FC 2DE7A 1Y1WI 2E7ZA 2AKLA 1YUKA 1Q861 3IFUA 2P28A 3CCQZ 3CPWZ 4Y52I 1ZH1A 3H0GI 1WIIA 3VMHA 3CCJZ 2J6AA 5C4XI 3D2LA 3CC21 3Q87A 3D9XA 1YI2Z 1PFTA 2NVYI 2JIQA 1VQ71 3CCLZ 3MZLB 1X0TA 2RBLA 3LUSA 1K83I 3GTLI 2PM9A 3J80f 4DQYB 1DL6A
chains in the Genus database with same CATH topology
1SFOI 1KC81 4NBEA 2E9HA 3NDJA 3HOVI 1S7MA 2LFUA 4RVDA 2PMZA 2HU9A 5CM2M 2GU2A 3CQZI 1USPB 4MXUA 1JJ2Z 2DE5A 1K9M2 4NB9A 1YI21 4S1TA 3I551 4RVGA 4MH4A 4A3II 1Q862 3CC41 2VUMI 1W2BY 3CCV1 3G4S1 4MD9A 4TNUA 3M4OI 4A3CI 2QEXZ 1VQ8Z 1KC82 3JAMf 3HOZI 4E2YA 3S17I 3S14I 3NH5A 3GKQA 5D1PA 3CCVZ 1VQL1 1N8R1 3I4NI 1VQK1 2RPRA 3OW2Z 2YADA 3CC4Z 3NH8A 4MONA 2QRCB 2IZ3A 3GTMS 1K9M1 2QR1B 3GTPI 2EGTA 1TWAI 4A3LI 1VQKZ 2QRDB 1I50I 1NUIA 4MD7A 3I07A 2HF1A 4HGYA 3EEDA 3CMA1 1VQ4Z 3GTKI 1TWCI 2V8JA 1YITZ 1VQLZ 2K3RA 3P5JB 2R6MA 3VB9A 4Y7NI 1QVGZ 1M902 1KQSY 2V8KA 1VQ81 4A3FI 3BG0B 2VF1A 3TDHB 1KQSZ 4E2XA 4A3KI 1P9NA 1VQM1 2Y0SA 3CC71 3J81b 5T64A 3QWUA 2W03A 1VQ61 2B63I 2PK7A 1Z03A 5IP9I 1VQPZ 3I55Z 4A3EI 3S16I 2ZAEB 2KI7B 4BY7I 1NJI1 3CMEZ 5A2Qf 2P3YA 4BBRI 3GTGI 1RNIA 3VMIA 2O4HA 3JAMb 4E2ZA 5LL6f 2OZKA 3OW2Y 1K8A1 2M48A 2GTHA 2QREB 2JA5I 4NBHA 1Q7Y2 2QLVB 2JA6I 3I4MI 1KRLA 5FLXf 3CCEZ 3GTQI 1W2BZ 2Q51A 1X3ZA 1VQO1 3VMGA 4E32A 1I6HI 2F4MA 1VQN1 1YJNZ 1VQ91 1K732 5IT9b 1RQFA 3GTOI 2WAQA 2DE6A 3CCQ1 1ZB8A 3G4SZ 2RIQA 1KD12 3CCJ1 2OOXB 2E2HI 3FKII 3T4NB 3G71Z 5D1OB 4CL1A 1Q7Y1 1M1K2 2RHBA 1K8A2 3G6E1 4BXXI 2F4OA 4EWCA 1QVFZ 3CPWY 1RLYA 2JA7I 4A3JI 1ML8A 4DGLA 2JMOA 4E2WA 1VQ9Z 1NJI2 1YJ91 3J7A4 1VQ7Z 2OTJZ 4HH4A 1ZB9A 3S1QI 3J81f 3EERA 1RO4A 1VQOZ 3F3PC 3CCUZ 3G711 4X6AI 3RZDI 1RO2A 2NVXI 2JS4A 3NH4A 2YU9I 4E31A 3GTMI 2LIYA 1Q811 1M901 4XX2A 2RT9A 1N2FA 1QF8A 1TWGI 3CC2Z 3HOWI 2V8IA 1YIJ1 3HOUI 1YJW1 5AN9F 1VQ5Z 3NFZA 2G2KA 2NVTI 2JUBA 4NFRA 4NBFA 3CCU1 3S1MI 3FQMA 5IT9f 3CXCZ 3S1NI 2W04A 1WCMI 2OTLZ 1Z02A 3CCMZ 3CCE1 4A3MI 3S2DI 3HOXI 3CCR1 3VTNA 2Q4ZA 1N8R2 1USPA 2QKDA 5C44I 3CD61 1TWHI 1VQ41 3CCL1 5C4JI 4RVFA 5C3EI 3IF8A 5T6BA 1VLAA 4NBCA 2H85A 4HGZA 1M1K1 3CXCY 5IP7I 1Q822 3HKZA 4RS4A 4A3DI 1R9TI 2E2JI 4NBDA 3GCFA 1Y1VI 1VQP1 1YJ9Z 3S1RI 3CD6Z 3CMAZ 3PO3I 1YIT1 1TWFI 1X3WA 2JR6A 2R93I 4RV9A 3CCRZ 3KIHA 4NH1C 4RVHA 4NBBA 1LQLA 4MD8A 2JNYA 4QTUA 1VQMZ 1Z01A 2I3CA 5A2Qb 3KIFA 2VUGA 4NB8A 3U50C 3S15I 1TFIA 4BY1I 1YJWZ 4NOZA 1JJ2Y 3TE5B 3RZOI 3PO3S 4A93I 2NVQI 4NBAA 4E33A 1Y1VS 5FLXb 2JA8I 3MONA 1NP6A 3K7AI 3I561 2OTL1 3CCM1 1VQ51 3D6WA 4A3GI 3ESWA 3GTJI 3PO2I 4MRIA 1QVFY 1VQ6Z 1RO0A 2KPIA 4E30A 3J80b 5FLMI 3NDIA 3BG1B 2R92I 1YHQ1 1Q812 3CCS1 2O53A 2K5RA 4NBGA 4QTTA 2R7ZI 4A3BI 2IZ4A 3G6EZ 3CC7Z 2OOYB 1KD11 1QVGY 1WW9A 3FQQA 1JWHC 5D1OA 3M3YI 1K731 5T67A 1S72Z 2QA41 3IX0A 4AYBA 1Q821 2QEX1 2WB1A 3I56Z 3HOYI 3H3VJ 3S2HI 1YIJZ 4BBSI 1VQNZ 1YJN1 1YHQZ 3CCSZ 4DK1A 2OTJ1 2E2II 3CME1 1S721 2BJOA 2QA4Z 3MZKB 1I3QI 1QYPA 1YUAA 2GTIA 2M6NA 1L1OC 3F3FC 2DE7A 1Y1WI 2AKLA 1YUKA 1Q861 3IFUA 2P28A 3CCQZ 3CPWZ 4Y52I 1ZH1A 3H0GI 1WIIA 3VMHA 3CCJZ 2J6AA 5C4XI 3CC21 3Q87A 3D9XA 1YI2Z 1PFTA 2NVYI 1VQ71 3CCLZ 3MZLB 1X0TA 2RBLA 3LUSA 1K83I 3GTLI 2PM9A 3J80f 4DQYB 1DL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX f;  5IT9 f;  3JAM f;  3J81 f;  5A2Q f;  3J80 f; 
#chains in the Genus database with same CATH topology
 1SFO I;  1KC8 1;  4NBE A;  2E9H A;  3NDJ A;  3HOV I;  1S7M A;  2LFU A;  4RVD A;  2PMZ A;  2HU9 A;  5CM2 M;  2GU2 A;  3CQZ I;  1USP B;  4MXU A;  1JJ2 Z;  2DE5 A;  1K9M 2;  4NB9 A;  1YI2 1;  4S1T A;  3I55 1;  4RVG A;  4MH4 A;  2JIM A;  4A3I I;  2VPY A;  1Q86 2;  3CC4 1;  2VUM I;  1W2B Y;  3CCV 1;  3G4S 1;  4MD9 A;  4TNU A;  3M4O I;  4A3C I;  2QEX Z;  1VQ8 Z;  1KC8 2;  3JAM f;  3HOZ I;  4E2Y A;  1FDO A;  3S17 I;  3S14 I;  3NH5 A;  3GKQ A;  5D1P A;  3CCV Z;  2NAP A;  1VQL 1;  1WJ2 A;  1N8R 1;  3I4N I;  1VQK 1;  2RPR A;  3OW2 Z;  2YAD A;  1Y8C A;  3CC4 Z;  3NH8 A;  4MON A;  2QRC B;  2IZ3 A;  3GTM S;  1K9M 1;  2QR1 B;  3GTP I;  2EGT A;  1TWA I;  4A3L I;  1VQK Z;  2QRD B;  1I50 I;  1NUI A;  4MD7 A;  3I07 A;  2HF1 A;  4HGY A;  3EED A;  3CMA 1;  1VQ4 Z;  3GTK I;  1TWC I;  2V8J A;  1YIT Z;  1VQL Z;  2K3R A;  3P5J B;  1QXF A;  2R6M A;  3VB9 A;  4Y7N I;  1QVG Z;  1M90 2;  1KQS Y;  2V8K A;  1VQ8 1;  4A3F I;  3BG0 B;  2VF1 A;  3TDH B;  1KQS Z;  4E2X A;  4A3K I;  1P9N A;  2V45 A;  1VQM 1;  2Y0S A;  3CC7 1;  3J81 b;  5T64 A;  3QWU A;  2W03 A;  1VQ6 1;  2B63 I;  2PK7 A;  1Z03 A;  5IP9 I;  2LEX A;  3I55 Z;  4A3E I;  1VQP Z;  3S16 I;  2ZAE B;  2KI7 B;  4BY7 I;  1NJI 1;  3CME Z;  5A2Q f;  2P3Y A;  4BBR I;  2IV2 X;  3GTG I;  1RNI A;  3VMI A;  2O4H A;  3JAM b;  4E2Z A;  5LL6 f;  2OZK A;  3OW2 Y;  1K8A 1;  2M48 A;  2GTH A;  2QRE B;  2JA5 I;  4NBH A;  1Q7Y 2;  2QLV B;  2JA6 I;  3I4M I;  1KRL A;  5FLX f;  3CCE Z;  3GTQ I;  1W2B Z;  2Q51 A;  1X3Z A;  1VQO 1;  3VMG A;  4E32 A;  1I6H I;  2F4M A;  1VQN 1;  1YJN Z;  1VQ9 1;  1K73 2;  5IT9 b;  1RQF A;  3GTO I;  2WAQ A;  2DE6 A;  3CCQ 1;  1ZB8 A;  3G4S Z;  2RIQ A;  1KD1 2;  3CCJ 1;  2OOX B;  2E2H I;  3FKI I;  3T4N B;  3G71 Z;  5D1O B;  4CL1 A;  1Q7Y 1;  2VPZ A;  1M1K 2;  2RHB A;  1K8A 2;  3G6E 1;  4BXX I;  2F4O A;  4EWC A;  1QVF Z;  3CPW Y;  1RLY A;  2JA7 I;  4A3J I;  1ML8 A;  4DGL A;  2JMO A;  4E2W A;  1VQ9 Z;  1NJI 2;  1YJ9 1;  3J7A 4;  1VQ7 Z;  2VPW A;  2OTJ Z;  4HH4 A;  1ZB9 A;  3S1Q I;  3J81 f;  3EER A;  1RO4 A;  1VQO Z;  3F3P C;  3CCU Z;  1FDI A;  3G71 1;  4X6A I;  3RZD I;  1RO2 A;  2JIP A;  2NVX I;  2JS4 A;  3NH4 A;  2YU9 I;  4E31 A;  3GTM I;  2LIY A;  1Q81 1;  1M90 1;  4XX2 A;  2RT9 A;  1N2F A;  1QF8 A;  1TWG I;  3CC2 Z;  3HOW I;  2V8I A;  1YIJ 1;  3HOU I;  1YJW 1;  5AN9 F;  1VQ5 Z;  3NFZ A;  2G2K A;  2NVT I;  2JUB A;  4NFR A;  4NBF A;  3CCU 1;  3S1M I;  3FQM A;  5IT9 f;  1SIW A;  3CXC Z;  3S1N I;  2W04 A;  1WCM I;  2OTL Z;  1Z02 A;  3CCM Z;  3CCE 1;  4A3M I;  3S2D I;  3HOX I;  3CCR 1;  3VTN A;  2Q4Z A;  1N8R 2;  1USP A;  2QKD A;  5C44 I;  3CD6 1;  1TWH I;  1VQ4 1;  3CCL 1;  1WZN A;  5C4J I;  4RVF A;  5C3E I;  3IF8 A;  5T6B A;  1VLA A;  4NBC A;  2H85 A;  4HGZ A;  1M1K 1;  3CXC Y;  5IP7 I;  2JIO A;  1Q82 2;  2VPX A;  3HKZ A;  4RS4 A;  4A3D I;  1R9T I;  2E2J I;  4NBD A;  3GCF A;  1Y1V I;  1VQP 1;  1YJ9 Z;  3S1R I;  3CD6 Z;  3CMA Z;  2AYD A;  3PO3 I;  1YIT 1;  1TWF I;  1X3W A;  2JR6 A;  2R93 I;  4RV9 A;  3CCR Z;  3KIH A;  4NH1 C;  4RVH A;  2V3V A;  4NBB A;  1LQL A;  4MD8 A;  2JNY A;  4QTU A;  1VQM Z;  1Z01 A;  2I3C A;  1AA6 A;  5A2Q b;  3KIF A;  2VUG A;  4NB8 A;  3U50 C;  3S15 I;  1TFI A;  4BY1 I;  1YJW Z;  4NOZ A;  1JJ2 Y;  3TE5 B;  3RZO I;  3PO3 S;  4A93 I;  2NVQ I;  4NBA A;  4E33 A;  1Y1V S;  3IR7 A;  5FLX b;  2JA8 I;  3MON A;  1NP6 A;  3K7A I;  3I56 1;  2OTL 1;  3CCM 1;  1VQ5 1;  3D6W A;  4A3G I;  3ESW A;  3GTJ I;  3PO2 I;  4MRI A;  1QVF Y;  1VQ6 Z;  1RO0 A;  2KPI A;  4E30 A;  3J80 b;  5FLM I;  3NDI A;  3BG1 B;  2R92 I;  2JIR A;  1YHQ 1;  1Q81 2;  3CCS 1;  1Q16 A;  2O53 A;  2K5R A;  4NBG A;  4QTT A;  2R7Z I;  4A3B I;  2IZ4 A;  3G6E Z;  3CC7 Z;  2OOY B;  1KD1 1;  1QVG Y;  1WW9 A;  3FQQ A;  1JWH C;  5D1O A;  3M3Y I;  1K73 1;  5T67 A;  1S72 Z;  2QA4 1;  3IX0 A;  4AYB A;  1Q82 1;  2QEX 1;  2WB1 A;  3I56 Z;  3HOY I;  3H3V J;  3S2H I;  1YIJ Z;  4BBS I;  1VQN Z;  1YJN 1;  1YHQ Z;  3CCS Z;  4DK1 A;  2OTJ 1;  2E2I I;  3CME 1;  1S72 1;  2BJO A;  2QA4 Z;  3MZK B;  1I3Q I;  1QYP A;  1YUA A;  2GTI A;  2M6N A;  1L1O C;  3F3F C;  2DE7 A;  1Y1W I;  2E7Z A;  2AKL A;  1YUK A;  1Q86 1;  3IFU A;  2P28 A;  3CCQ Z;  3CPW Z;  4Y52 I;  1ZH1 A;  3H0G I;  1WII A;  3VMH A;  3CCJ Z;  2J6A A;  5C4X I;  3D2L A;  3CC2 1;  3Q87 A;  3D9X A;  1YI2 Z;  1PFT A;  2NVY I;  2JIQ A;  1VQ7 1;  3CCL Z;  3MZL B;  1X0T A;  2RBL A;  3LUS A;  1K83 I;  3GTL I;  2PM9 A;  3J80 f;  4DQY B;  1DL6 A; 
#chains in the Genus database with same CATH homology
 1SFO I;  1KC8 1;  4NBE A;  2E9H A;  3NDJ A;  3HOV I;  1S7M A;  2LFU A;  4RVD A;  2PMZ A;  2HU9 A;  5CM2 M;  2GU2 A;  3CQZ I;  1USP B;  4MXU A;  1JJ2 Z;  2DE5 A;  1K9M 2;  4NB9 A;  1YI2 1;  4S1T A;  3I55 1;  4RVG A;  4MH4 A;  4A3I I;  1Q86 2;  3CC4 1;  2VUM I;  1W2B Y;  3CCV 1;  3G4S 1;  4MD9 A;  4TNU A;  3M4O I;  4A3C I;  2QEX Z;  1VQ8 Z;  1KC8 2;  3JAM f;  3HOZ I;  4E2Y A;  3S17 I;  3S14 I;  3NH5 A;  3GKQ A;  5D1P A;  3CCV Z;  1VQL 1;  1N8R 1;  3I4N I;  1VQK 1;  2RPR A;  3OW2 Z;  2YAD A;  3CC4 Z;  3NH8 A;  4MON A;  2QRC B;  2IZ3 A;  3GTM S;  1K9M 1;  2QR1 B;  3GTP I;  2EGT A;  1TWA I;  4A3L I;  1VQK Z;  2QRD B;  1I50 I;  1NUI A;  4MD7 A;  3I07 A;  2HF1 A;  4HGY A;  3EED A;  3CMA 1;  1VQ4 Z;  3GTK I;  1TWC I;  2V8J A;  1YIT Z;  1VQL Z;  2K3R A;  3P5J B;  2R6M A;  3VB9 A;  4Y7N I;  1QVG Z;  1M90 2;  1KQS Y;  2V8K A;  1VQ8 1;  4A3F I;  3BG0 B;  2VF1 A;  3TDH B;  1KQS Z;  4E2X A;  4A3K I;  1P9N A;  1VQM 1;  2Y0S A;  3CC7 1;  3J81 b;  5T64 A;  3QWU A;  2W03 A;  1VQ6 1;  2B63 I;  2PK7 A;  1Z03 A;  5IP9 I;  1VQP Z;  3I55 Z;  4A3E I;  3S16 I;  2ZAE B;  2KI7 B;  4BY7 I;  1NJI 1;  3CME Z;  5A2Q f;  2P3Y A;  4BBR I;  3GTG I;  1RNI A;  3VMI A;  2O4H A;  3JAM b;  4E2Z A;  5LL6 f;  2OZK A;  3OW2 Y;  1K8A 1;  2M48 A;  2GTH A;  2QRE B;  2JA5 I;  4NBH A;  1Q7Y 2;  2QLV B;  2JA6 I;  3I4M I;  1KRL A;  5FLX f;  3CCE Z;  3GTQ I;  1W2B Z;  2Q51 A;  1X3Z A;  1VQO 1;  3VMG A;  4E32 A;  1I6H I;  2F4M A;  1VQN 1;  1YJN Z;  1VQ9 1;  1K73 2;  5IT9 b;  1RQF A;  3GTO I;  2WAQ A;  2DE6 A;  3CCQ 1;  1ZB8 A;  3G4S Z;  2RIQ A;  1KD1 2;  3CCJ 1;  2OOX B;  2E2H I;  3FKI I;  3T4N B;  3G71 Z;  5D1O B;  4CL1 A;  1Q7Y 1;  1M1K 2;  2RHB A;  1K8A 2;  3G6E 1;  4BXX I;  2F4O A;  4EWC A;  1QVF Z;  3CPW Y;  1RLY A;  2JA7 I;  4A3J I;  1ML8 A;  4DGL A;  2JMO A;  4E2W A;  1VQ9 Z;  1NJI 2;  1YJ9 1;  3J7A 4;  1VQ7 Z;  2OTJ Z;  4HH4 A;  1ZB9 A;  3S1Q I;  3J81 f;  3EER A;  1RO4 A;  1VQO Z;  3F3P C;  3CCU Z;  3G71 1;  4X6A I;  3RZD I;  1RO2 A;  2NVX I;  2JS4 A;  3NH4 A;  2YU9 I;  4E31 A;  3GTM I;  2LIY A;  1Q81 1;  1M90 1;  4XX2 A;  2RT9 A;  1N2F A;  1QF8 A;  1TWG I;  3CC2 Z;  3HOW I;  2V8I A;  1YIJ 1;  3HOU I;  1YJW 1;  5AN9 F;  1VQ5 Z;  3NFZ A;  2G2K A;  2NVT I;  2JUB A;  4NFR A;  4NBF A;  3CCU 1;  3S1M I;  3FQM A;  5IT9 f;  3CXC Z;  3S1N I;  2W04 A;  1WCM I;  2OTL Z;  1Z02 A;  3CCM Z;  3CCE 1;  4A3M I;  3S2D I;  3HOX I;  3CCR 1;  3VTN A;  2Q4Z A;  1N8R 2;  1USP A;  2QKD A;  5C44 I;  3CD6 1;  1TWH I;  1VQ4 1;  3CCL 1;  5C4J I;  4RVF A;  5C3E I;  3IF8 A;  5T6B A;  1VLA A;  4NBC A;  2H85 A;  4HGZ A;  1M1K 1;  3CXC Y;  5IP7 I;  1Q82 2;  3HKZ A;  4RS4 A;  4A3D I;  1R9T I;  2E2J I;  4NBD A;  3GCF A;  1Y1V I;  1VQP 1;  1YJ9 Z;  3S1R I;  3CD6 Z;  3CMA Z;  3PO3 I;  1YIT 1;  1TWF I;  1X3W A;  2JR6 A;  2R93 I;  4RV9 A;  3CCR Z;  3KIH A;  4NH1 C;  4RVH A;  4NBB A;  1LQL A;  4MD8 A;  2JNY A;  4QTU A;  1VQM Z;  1Z01 A;  2I3C A;  5A2Q b;  3KIF A;  2VUG A;  4NB8 A;  3U50 C;  3S15 I;  1TFI A;  4BY1 I;  1YJW Z;  4NOZ A;  1JJ2 Y;  3TE5 B;  3RZO I;  3PO3 S;  4A93 I;  2NVQ I;  4NBA A;  4E33 A;  1Y1V S;  5FLX b;  2JA8 I;  3MON A;  1NP6 A;  3K7A I;  3I56 1;  2OTL 1;  3CCM 1;  1VQ5 1;  3D6W A;  4A3G I;  3ESW A;  3GTJ I;  3PO2 I;  4MRI A;  1QVF Y;  1VQ6 Z;  1RO0 A;  2KPI A;  4E30 A;  3J80 b;  5FLM I;  3NDI A;  3BG1 B;  2R92 I;  1YHQ 1;  1Q81 2;  3CCS 1;  2O53 A;  2K5R A;  4NBG A;  4QTT A;  2R7Z I;  4A3B I;  2IZ4 A;  3G6E Z;  3CC7 Z;  2OOY B;  1KD1 1;  1QVG Y;  1WW9 A;  3FQQ A;  1JWH C;  5D1O A;  3M3Y I;  1K73 1;  5T67 A;  1S72 Z;  2QA4 1;  3IX0 A;  4AYB A;  1Q82 1;  2QEX 1;  2WB1 A;  3I56 Z;  3HOY I;  3H3V J;  3S2H I;  1YIJ Z;  4BBS I;  1VQN Z;  1YJN 1;  1YHQ Z;  3CCS Z;  4DK1 A;  2OTJ 1;  2E2I I;  3CME 1;  1S72 1;  2BJO A;  2QA4 Z;  3MZK B;  1I3Q I;  1QYP A;  1YUA A;  2GTI A;  2M6N A;  1L1O C;  3F3F C;  2DE7 A;  1Y1W I;  2AKL A;  1YUK A;  1Q86 1;  3IFU A;  2P28 A;  3CCQ Z;  3CPW Z;  4Y52 I;  1ZH1 A;  3H0G I;  1WII A;  3VMH A;  3CCJ Z;  2J6A A;  5C4X I;  3CC2 1;  3Q87 A;  3D9X A;  1YI2 Z;  1PFT A;  2NVY I;  1VQ7 1;  3CCL Z;  3MZL B;  1X0T A;  2RBL A;  3LUS A;  1K83 I;  3GTL I;  2PM9 A;  3J80 f;  4DQY B;  1DL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...