3JAMf

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
b'KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamf00
3JAMf 5A2Qf 3J80f 5FLXf 3J81f 5IT9f
chains in the Genus database with same CATH superfamily
1S7MA 2P28A 2E2HI 4HGYA 3GTMI 2V8IA 2KPIA 3GTKI 1YUKA 4S1TA 1VQ41 3BG0B 1USPB 2O4HA 1NJI1 1RO4A 2R7ZI 3H0GI 1VQ91 1M901 1VQ61 1VQK1 2QREB 5AN9F 2VPXA 3CD61 4BY7I 4E2XA 3D9XA 1RQFA 2Q51A 3I56Z 1RO0A 1X3WA 2QLVB 3CCR1 2DE7A 3CMEZ 2B63I 1K83I 2QKDA 1KD11 5A2Qb 1TWCI 3GTLI 1ML8A 1Q7Y2 2PM9A 4QTUA 1YIJZ 3D2LA 3CC41 4A3FI 1ZH1A 2JA6I 4RVHA 1VQLZ 3S15I 2OOXB 1N8R2 2WB1A 2E2II 4BY1I 2RBLA 3LUSA 2V8JA 1JWHC 3G71Z 4NOZA 3PO3S 2LFUA 2OTLZ 2OTJZ 4MXUA 5LL6f 1YJNZ 2DE6A 3VMIA 4A3DI 1K9M2 2H85A 3GTOI 3HOVI 2YADA 3M4OI 2O53A 3S1MI 1VQ5Z 2RPRA 3FQMA 3GTQI 3CCLZ 3HOYI 3KIHA 1JJ2Y 3IF8A 3I561 5C4JI 2IZ4A 3S1NI 4NBFA 2VF1A 3HKZA 1JJ2Z 3MZKB 5FLXb 3I4MI 3CME1 4NBBA 2E7ZA 2PMZA 1LQLA 1VQ8Z 3CCMZ 1N2FA 2NAPA 1M1K1 3I07A 4A3KI 1Q861 2AYDA 5D1OA 1Q812 2NVQI 2JA8I 1TFIA 3GTGI 2JIPA 3G6EZ 1YIJ1 2OZKA 3FKII 1Y1WI 1YJWZ 2JA7I 2GTIA 2QEXZ 5FLMI 1YITZ 3NH5A 1VQL1 2Q4ZA 2VPWA 4BBSI 5IP7I 5A2Qf 4NBDA 3G4SZ 1YUAA 4MH4A 3G711 2NVXI 2EGTA 2OTL1 3S1RI 3VMGA 2OTJ1 1KQSY 1SFOI 5T67A 1KQSZ 4E2WA 3S16I 1VQ7Z 3HOXI 1VQ51 3K7AI 3H3VJ 2JUBA 3CCUZ 3HOUI 4A93I 3GCFA 4NBHA 1WZNA 1K731 2LEXA 1VQMZ 4AYBA 3MZLB 3EEDA 1VQ81 4TNUA 3ESWA 1ZB8A 1Q821 2VPYA 1WIIA 1VQNZ 1I6HI 4MRIA 3S2DI 2F4OA 2QA4Z 3J81b 1WJ2A 2VPZA 1TWAI 3NH4A 3S14I 2BJOA 3KIFA 3CC7Z 1Y1VI 2LIYA 2JMOA 3NFZA 2QEX1 1YIT1 5FLXf 3GTMS 2RHBA 4RVDA 4NBGA 3CCJ1 1RO2A 3JAMb 2E9HA 3GTJI 3VTNA 1KC81 1RLYA 1K8A1 4NFRA 5D1PA 1QF8A 1SIWA 1X3ZA 2R93I 4MD7A 3CMAZ 1NJI2 4E2YA 2AKLA 1M902 4MONA 5IT9b 3IFUA 2QR1B 3T4NB 2G2KA 2JIMA 1VQ71 3J7A4 1VQ4Z 4A3II 1FDIA 2HF1A 3NH8A 3CCU1 1YI2Z 5C44I 3Q87A 2QRDB 3HOWI 1VQM1 3NDJA 2JS4A 4MD8A 5C4XI 1KD12 1YHQZ 1VQN1 4NBCA 4RV9A 1Y8CA 2R6MA 1KRLA 4CL1A 3CPWY 4Y7NI 2JA5I 4RVGA 3CPWZ 2HU9A 4MD9A 3CC71 2V8KA 3VMHA 3J80b 1Z01A 4A3CI 5CM2M 3IX0A 3CCEZ 3PO2I 1DL6A 2R92I 3VB9A 1USPA 1Q7Y1 3CQZI 1ZB9A 1VQPZ 2Y0SA 5T6BA 3NDIA 1I50I 2NVYI 3J81f 2I3CA 1Z03A 2V45A 3MONA 2F4MA 3CCSZ 1YJN1 1N8R1 5D1OB 4E33A 3I4NI 3CMA1 3EERA 1QVGY 4NH1C 4DQYB 1NP6A 3CXCY 1QVGZ 4RVFA 3JAMf 4Y52I 2M6NA 4DGLA 3CXCZ 1WW9A 4QTTA 3CCL1 3F3PC 4BBRI 1R9TI 1K9M1 1X0TA 1YI21 3PO3I 2YU9I 1FDOA 2JIOA 4E31A 2NVTI 1QVFY 5C3EI 3CCM1 3IR7A 3OW2Y 4A3GI 3GKQA 1M1K2 1QVFZ 1YHQ1 3FQQA 1S72Z 1Q862 3D6WA 3OW2Z 5IT9f 2OOYB 1TWFI 4NBEA 2RIQA 1Q16A 2RT9A 1YJ9Z 2K5RA 1VQOZ 3G6E1 3TE5B 1PFTA 4HH4A 1YJW1 2JIQA 3F3FC 1TWHI 2JR6A 4RS4A 3CCE1 4NB8A 3I55Z 1QXFA 1Q811 1VLAA 1W2BY 2QRCB 1TWGI 3G4S1 4NBAA 1VQP1 3S2HI 3M3YI 1W2BZ 2WAQA 5IP9I 4A3MI 2JIRA 2J6AA 3U50C 3CCQZ 1I3QI 3CCVZ 1QYPA 2VUGA 3CC2Z 1L1OC 3CCS1 2E2JI 4EWCA 4E30A 3S1QI 3J80f 4DK1A 2KI7B 2ZAEB 2IZ3A 1RNIA 1WCMI 4A3JI 2GU2A 2PK7A 1VQ9Z 2W04A 4X6AI 1VQ6Z 2M48A 1K732 1VQKZ 4HGZA 4A3EI 2VUMI 3QWUA 3CD6Z 2DE5A 1NUIA 5T64A 1Q822 3TDHB 3RZDI 2GTHA 1S721 2W03A 2QA41 1Y1VS 3RZOI 1YJ91 1AA6A 3CCRZ 1VQO1 4NB9A 3GTPI 4A3BI 4E32A 2P3YA 1P9NA 4BXXI 4A3LI 3I551 1Z02A 2IV2X 4E2ZA 3CC4Z 3S17I 1KC82 1K8A2 2K3RA 3HOZI 3CCQ1 3CCV1 3BG1B 2V3VA 3CC21 3CCJZ 2JNYA 4XX2A 3P5JB
chains in the Genus database with same CATH topology
1S7MA 2P28A 2E2HI 4HGYA 3GTMI 2V8IA 2KPIA 3GTKI 1YUKA 4S1TA 1VQ41 3BG0B 1USPB 2O4HA 1NJI1 1RO4A 2R7ZI 3H0GI 1VQ91 1M901 1VQ61 1VQK1 2QREB 5AN9F 3CD61 4BY7I 4E2XA 3D9XA 1RQFA 2Q51A 3I56Z 1RO0A 1X3WA 2QLVB 3CCR1 2DE7A 3CMEZ 2B63I 1K83I 2QKDA 1KD11 5A2Qb 1TWCI 3GTLI 1ML8A 1Q7Y2 2PM9A 4QTUA 1YIJZ 3CC41 4A3FI 1ZH1A 2JA6I 4RVHA 1VQLZ 3S15I 2OOXB 1N8R2 2WB1A 2E2II 4BY1I 2RBLA 3LUSA 2V8JA 1JWHC 3G71Z 4NOZA 3PO3S 2LFUA 2OTLZ 2OTJZ 4MXUA 5LL6f 1YJNZ 2DE6A 3VMIA 4A3DI 1K9M2 2H85A 3GTOI 3HOVI 2YADA 3M4OI 2O53A 3S1MI 1VQ5Z 2RPRA 3FQMA 3GTQI 3CCLZ 3HOYI 3KIHA 1JJ2Y 3IF8A 3I561 5C4JI 2IZ4A 3S1NI 4NBFA 2VF1A 3HKZA 1JJ2Z 3MZKB 5FLXb 3I4MI 3CME1 4NBBA 2PMZA 1LQLA 1VQ8Z 3CCMZ 1N2FA 1M1K1 3I07A 4A3KI 1Q861 5D1OA 1Q812 2NVQI 2JA8I 1TFIA 3GTGI 3G6EZ 1YIJ1 2OZKA 3FKII 1Y1WI 1YJWZ 2JA7I 2GTIA 2QEXZ 5FLMI 1YITZ 3NH5A 1VQL1 2Q4ZA 4BBSI 5IP7I 5A2Qf 4NBDA 3G4SZ 1YUAA 4MH4A 3G711 2NVXI 2EGTA 2OTL1 3S1RI 3VMGA 2OTJ1 1KQSY 1SFOI 5T67A 1KQSZ 4E2WA 3S16I 1VQ7Z 3HOXI 1VQ51 3K7AI 3H3VJ 2JUBA 3CCUZ 3HOUI 4A93I 3GCFA 4NBHA 1K731 1VQMZ 4AYBA 3MZLB 3EEDA 1VQ81 4TNUA 3ESWA 1ZB8A 1Q821 1WIIA 1VQNZ 1I6HI 4MRIA 3S2DI 2F4OA 2QA4Z 3J81b 1TWAI 3NH4A 3S14I 2BJOA 3KIFA 3CC7Z 1Y1VI 2LIYA 2JMOA 3NFZA 2QEX1 1YIT1 5FLXf 3GTMS 2RHBA 4RVDA 4NBGA 3CCJ1 1RO2A 3JAMb 2E9HA 3GTJI 3VTNA 1KC81 1RLYA 1K8A1 4NFRA 5D1PA 1QF8A 1X3ZA 2R93I 4MD7A 3CMAZ 1NJI2 4E2YA 2AKLA 1M902 4MONA 5IT9b 3IFUA 2QR1B 3T4NB 2G2KA 1VQ71 3J7A4 1VQ4Z 4A3II 2HF1A 3NH8A 3CCU1 1YI2Z 5C44I 3Q87A 2QRDB 3HOWI 1VQM1 3NDJA 2JS4A 4MD8A 5C4XI 1KD12 1YHQZ 1VQN1 4NBCA 4RV9A 2R6MA 1KRLA 4CL1A 3CPWY 4Y7NI 2JA5I 4RVGA 3CPWZ 2HU9A 4MD9A 3CC71 2V8KA 3VMHA 3J80b 1Z01A 4A3CI 5CM2M 3IX0A 3CCEZ 3PO2I 1DL6A 2R92I 3VB9A 1USPA 1Q7Y1 3CQZI 1ZB9A 1VQPZ 2Y0SA 5T6BA 3NDIA 1I50I 2NVYI 3J81f 2I3CA 1Z03A 3MONA 2F4MA 3CCSZ 1YJN1 1N8R1 5D1OB 4E33A 3I4NI 3CMA1 3EERA 1QVGY 4NH1C 4DQYB 1NP6A 3CXCY 1QVGZ 4RVFA 3JAMf 4Y52I 2M6NA 4DGLA 3CXCZ 1WW9A 4QTTA 3CCL1 3F3PC 4BBRI 1R9TI 1K9M1 1X0TA 1YI21 3PO3I 2YU9I 4E31A 2NVTI 1QVFY 5C3EI 3CCM1 3OW2Y 4A3GI 3GKQA 1M1K2 1QVFZ 1YHQ1 3FQQA 1S72Z 1Q862 3D6WA 3OW2Z 5IT9f 2OOYB 1TWFI 4NBEA 2RIQA 2RT9A 1YJ9Z 2K5RA 1VQOZ 3G6E1 3TE5B 1PFTA 4HH4A 1YJW1 3F3FC 1TWHI 2JR6A 4RS4A 3CCE1 4NB8A 3I55Z 1Q811 1VLAA 1W2BY 2QRCB 1TWGI 3G4S1 4NBAA 1VQP1 3S2HI 3M3YI 1W2BZ 2WAQA 5IP9I 4A3MI 2J6AA 3U50C 3CCQZ 1I3QI 3CCVZ 1QYPA 2VUGA 3CC2Z 1L1OC 3CCS1 2E2JI 4EWCA 4E30A 3S1QI 3J80f 4DK1A 2KI7B 2ZAEB 2IZ3A 1RNIA 1WCMI 4A3JI 2GU2A 2PK7A 1VQ9Z 2W04A 4X6AI 1VQ6Z 2M48A 1K732 1VQKZ 4HGZA 4A3EI 2VUMI 3QWUA 3CD6Z 2DE5A 1NUIA 5T64A 1Q822 3TDHB 3RZDI 2GTHA 1S721 2W03A 2QA41 1Y1VS 3RZOI 1YJ91 3CCRZ 1VQO1 4NB9A 3GTPI 4A3BI 4E32A 2P3YA 1P9NA 4BXXI 4A3LI 3I551 1Z02A 4E2ZA 3CC4Z 3S17I 1KC82 1K8A2 2K3RA 3HOZI 3CCQ1 3CCV1 3BG1B 3CC21 3CCJZ 2JNYA 4XX2A 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM f;  5A2Q f;  3J80 f;  5FLX f;  3J81 f;  5IT9 f; 
#chains in the Genus database with same CATH topology
 1S7M A;  2P28 A;  2E2H I;  4HGY A;  3GTM I;  2V8I A;  2KPI A;  3GTK I;  1YUK A;  4S1T A;  1VQ4 1;  3BG0 B;  1USP B;  2O4H A;  1NJI 1;  1RO4 A;  2R7Z I;  3H0G I;  1VQ9 1;  1M90 1;  1VQ6 1;  1VQK 1;  2QRE B;  5AN9 F;  2VPX A;  3CD6 1;  4BY7 I;  4E2X A;  3D9X A;  1RQF A;  2Q51 A;  3I56 Z;  1RO0 A;  1X3W A;  2QLV B;  3CCR 1;  2DE7 A;  3CME Z;  2B63 I;  1K83 I;  2QKD A;  1KD1 1;  5A2Q b;  1TWC I;  3GTL I;  1ML8 A;  1Q7Y 2;  2PM9 A;  4QTU A;  1YIJ Z;  3D2L A;  3CC4 1;  4A3F I;  1ZH1 A;  2JA6 I;  4RVH A;  1VQL Z;  3S15 I;  2OOX B;  1N8R 2;  2WB1 A;  2E2I I;  4BY1 I;  2RBL A;  3LUS A;  2V8J A;  1JWH C;  3G71 Z;  4NOZ A;  3PO3 S;  2LFU A;  2OTL Z;  2OTJ Z;  4MXU A;  5LL6 f;  1YJN Z;  2DE6 A;  3VMI A;  4A3D I;  1K9M 2;  2H85 A;  3GTO I;  3HOV I;  2YAD A;  3M4O I;  2O53 A;  3S1M I;  1VQ5 Z;  2RPR A;  3FQM A;  3GTQ I;  3CCL Z;  3HOY I;  3KIH A;  1JJ2 Y;  3IF8 A;  3I56 1;  5C4J I;  2IZ4 A;  3S1N I;  4NBF A;  2VF1 A;  3HKZ A;  1JJ2 Z;  3MZK B;  5FLX b;  3I4M I;  3CME 1;  4NBB A;  2E7Z A;  2PMZ A;  1LQL A;  1VQ8 Z;  3CCM Z;  1N2F A;  2NAP A;  1M1K 1;  3I07 A;  4A3K I;  1Q86 1;  2AYD A;  5D1O A;  1Q81 2;  2NVQ I;  2JA8 I;  1TFI A;  3GTG I;  2JIP A;  3G6E Z;  1YIJ 1;  2OZK A;  3FKI I;  1Y1W I;  1YJW Z;  2JA7 I;  2GTI A;  2QEX Z;  5FLM I;  1YIT Z;  3NH5 A;  1VQL 1;  2Q4Z A;  2VPW A;  4BBS I;  5IP7 I;  5A2Q f;  4NBD A;  3G4S Z;  1YUA A;  4MH4 A;  3G71 1;  2NVX I;  2EGT A;  2OTL 1;  3S1R I;  3VMG A;  2OTJ 1;  1KQS Y;  1SFO I;  5T67 A;  1KQS Z;  4E2W A;  3S16 I;  1VQ7 Z;  3HOX I;  1VQ5 1;  3K7A I;  3H3V J;  2JUB A;  3CCU Z;  3HOU I;  4A93 I;  3GCF A;  4NBH A;  1WZN A;  1K73 1;  2LEX A;  1VQM Z;  4AYB A;  3MZL B;  3EED A;  1VQ8 1;  4TNU A;  3ESW A;  1ZB8 A;  1Q82 1;  2VPY A;  1WII A;  1VQN Z;  1I6H I;  4MRI A;  3S2D I;  2F4O A;  2QA4 Z;  3J81 b;  1WJ2 A;  2VPZ A;  1TWA I;  3NH4 A;  3S14 I;  2BJO A;  3KIF A;  3CC7 Z;  1Y1V I;  2LIY A;  2JMO A;  3NFZ A;  2QEX 1;  1YIT 1;  5FLX f;  3GTM S;  2RHB A;  4RVD A;  4NBG A;  3CCJ 1;  1RO2 A;  3JAM b;  2E9H A;  3GTJ I;  3VTN A;  1KC8 1;  1RLY A;  1K8A 1;  4NFR A;  5D1P A;  1QF8 A;  1SIW A;  1X3Z A;  2R93 I;  4MD7 A;  3CMA Z;  1NJI 2;  4E2Y A;  2AKL A;  1M90 2;  4MON A;  5IT9 b;  3IFU A;  2QR1 B;  3T4N B;  2G2K A;  2JIM A;  1VQ7 1;  3J7A 4;  1VQ4 Z;  4A3I I;  1FDI A;  2HF1 A;  3NH8 A;  3CCU 1;  1YI2 Z;  5C44 I;  3Q87 A;  2QRD B;  3HOW I;  1VQM 1;  3NDJ A;  2JS4 A;  4MD8 A;  5C4X I;  1KD1 2;  1YHQ Z;  1VQN 1;  4NBC A;  4RV9 A;  1Y8C A;  2R6M A;  1KRL A;  4CL1 A;  3CPW Y;  4Y7N I;  2JA5 I;  4RVG A;  3CPW Z;  2HU9 A;  4MD9 A;  3CC7 1;  2V8K A;  3VMH A;  3J80 b;  1Z01 A;  4A3C I;  5CM2 M;  3IX0 A;  3CCE Z;  3PO2 I;  1DL6 A;  2R92 I;  3VB9 A;  1USP A;  1Q7Y 1;  3CQZ I;  1ZB9 A;  1VQP Z;  2Y0S A;  5T6B A;  3NDI A;  1I50 I;  2NVY I;  3J81 f;  2I3C A;  1Z03 A;  2V45 A;  3MON A;  2F4M A;  3CCS Z;  1YJN 1;  1N8R 1;  5D1O B;  4E33 A;  3I4N I;  3CMA 1;  3EER A;  1QVG Y;  4NH1 C;  4DQY B;  1NP6 A;  3CXC Y;  1QVG Z;  4RVF A;  3JAM f;  4Y52 I;  2M6N A;  4DGL A;  3CXC Z;  1WW9 A;  4QTT A;  3CCL 1;  3F3P C;  4BBR I;  1R9T I;  1K9M 1;  1X0T A;  1YI2 1;  3PO3 I;  2YU9 I;  1FDO A;  2JIO A;  4E31 A;  2NVT I;  1QVF Y;  5C3E I;  3CCM 1;  3IR7 A;  3OW2 Y;  4A3G I;  3GKQ A;  1M1K 2;  1QVF Z;  1YHQ 1;  3FQQ A;  1S72 Z;  1Q86 2;  3D6W A;  3OW2 Z;  5IT9 f;  2OOY B;  1TWF I;  4NBE A;  2RIQ A;  1Q16 A;  2RT9 A;  1YJ9 Z;  2K5R A;  1VQO Z;  3G6E 1;  3TE5 B;  1PFT A;  4HH4 A;  1YJW 1;  2JIQ A;  3F3F C;  1TWH I;  2JR6 A;  4RS4 A;  3CCE 1;  4NB8 A;  3I55 Z;  1QXF A;  1Q81 1;  1VLA A;  1W2B Y;  2QRC B;  1TWG I;  3G4S 1;  4NBA A;  1VQP 1;  3S2H I;  3M3Y I;  1W2B Z;  2WAQ A;  5IP9 I;  4A3M I;  2JIR A;  2J6A A;  3U50 C;  3CCQ Z;  1I3Q I;  3CCV Z;  1QYP A;  2VUG A;  3CC2 Z;  1L1O C;  3CCS 1;  2E2J I;  4EWC A;  4E30 A;  3S1Q I;  3J80 f;  4DK1 A;  2KI7 B;  2ZAE B;  2IZ3 A;  1RNI A;  1WCM I;  4A3J I;  2GU2 A;  2PK7 A;  1VQ9 Z;  2W04 A;  4X6A I;  1VQ6 Z;  2M48 A;  1K73 2;  1VQK Z;  4HGZ A;  4A3E I;  2VUM I;  3QWU A;  3CD6 Z;  2DE5 A;  1NUI A;  5T64 A;  1Q82 2;  3TDH B;  3RZD I;  2GTH A;  1S72 1;  2W03 A;  2QA4 1;  1Y1V S;  3RZO I;  1YJ9 1;  1AA6 A;  3CCR Z;  1VQO 1;  4NB9 A;  3GTP I;  4A3B I;  4E32 A;  2P3Y A;  1P9N A;  4BXX I;  4A3L I;  3I55 1;  1Z02 A;  2IV2 X;  4E2Z A;  3CC4 Z;  3S17 I;  1KC8 2;  1K8A 2;  2K3R A;  3HOZ I;  3CCQ 1;  3CCV 1;  3BG1 B;  2V3V A;  3CC2 1;  3CCJ Z;  2JNY A;  4XX2 A;  3P5J B; 
#chains in the Genus database with same CATH homology
 1S7M A;  2P28 A;  2E2H I;  4HGY A;  3GTM I;  2V8I A;  2KPI A;  3GTK I;  1YUK A;  4S1T A;  1VQ4 1;  3BG0 B;  1USP B;  2O4H A;  1NJI 1;  1RO4 A;  2R7Z I;  3H0G I;  1VQ9 1;  1M90 1;  1VQ6 1;  1VQK 1;  2QRE B;  5AN9 F;  3CD6 1;  4BY7 I;  4E2X A;  3D9X A;  1RQF A;  2Q51 A;  3I56 Z;  1RO0 A;  1X3W A;  2QLV B;  3CCR 1;  2DE7 A;  3CME Z;  2B63 I;  1K83 I;  2QKD A;  1KD1 1;  5A2Q b;  1TWC I;  3GTL I;  1ML8 A;  1Q7Y 2;  2PM9 A;  4QTU A;  1YIJ Z;  3CC4 1;  4A3F I;  1ZH1 A;  2JA6 I;  4RVH A;  1VQL Z;  3S15 I;  2OOX B;  1N8R 2;  2WB1 A;  2E2I I;  4BY1 I;  2RBL A;  3LUS A;  2V8J A;  1JWH C;  3G71 Z;  4NOZ A;  3PO3 S;  2LFU A;  2OTL Z;  2OTJ Z;  4MXU A;  5LL6 f;  1YJN Z;  2DE6 A;  3VMI A;  4A3D I;  1K9M 2;  2H85 A;  3GTO I;  3HOV I;  2YAD A;  3M4O I;  2O53 A;  3S1M I;  1VQ5 Z;  2RPR A;  3FQM A;  3GTQ I;  3CCL Z;  3HOY I;  3KIH A;  1JJ2 Y;  3IF8 A;  3I56 1;  5C4J I;  2IZ4 A;  3S1N I;  4NBF A;  2VF1 A;  3HKZ A;  1JJ2 Z;  3MZK B;  5FLX b;  3I4M I;  3CME 1;  4NBB A;  2PMZ A;  1LQL A;  1VQ8 Z;  3CCM Z;  1N2F A;  1M1K 1;  3I07 A;  4A3K I;  1Q86 1;  5D1O A;  1Q81 2;  2NVQ I;  2JA8 I;  1TFI A;  3GTG I;  3G6E Z;  1YIJ 1;  2OZK A;  3FKI I;  1Y1W I;  1YJW Z;  2JA7 I;  2GTI A;  2QEX Z;  5FLM I;  1YIT Z;  3NH5 A;  1VQL 1;  2Q4Z A;  4BBS I;  5IP7 I;  5A2Q f;  4NBD A;  3G4S Z;  1YUA A;  4MH4 A;  3G71 1;  2NVX I;  2EGT A;  2OTL 1;  3S1R I;  3VMG A;  2OTJ 1;  1KQS Y;  1SFO I;  5T67 A;  1KQS Z;  4E2W A;  3S16 I;  1VQ7 Z;  3HOX I;  1VQ5 1;  3K7A I;  3H3V J;  2JUB A;  3CCU Z;  3HOU I;  4A93 I;  3GCF A;  4NBH A;  1K73 1;  1VQM Z;  4AYB A;  3MZL B;  3EED A;  1VQ8 1;  4TNU A;  3ESW A;  1ZB8 A;  1Q82 1;  1WII A;  1VQN Z;  1I6H I;  4MRI A;  3S2D I;  2F4O A;  2QA4 Z;  3J81 b;  1TWA I;  3NH4 A;  3S14 I;  2BJO A;  3KIF A;  3CC7 Z;  1Y1V I;  2LIY A;  2JMO A;  3NFZ A;  2QEX 1;  1YIT 1;  5FLX f;  3GTM S;  2RHB A;  4RVD A;  4NBG A;  3CCJ 1;  1RO2 A;  3JAM b;  2E9H A;  3GTJ I;  3VTN A;  1KC8 1;  1RLY A;  1K8A 1;  4NFR A;  5D1P A;  1QF8 A;  1X3Z A;  2R93 I;  4MD7 A;  3CMA Z;  1NJI 2;  4E2Y A;  2AKL A;  1M90 2;  4MON A;  5IT9 b;  3IFU A;  2QR1 B;  3T4N B;  2G2K A;  1VQ7 1;  3J7A 4;  1VQ4 Z;  4A3I I;  2HF1 A;  3NH8 A;  3CCU 1;  1YI2 Z;  5C44 I;  3Q87 A;  2QRD B;  3HOW I;  1VQM 1;  3NDJ A;  2JS4 A;  4MD8 A;  5C4X I;  1KD1 2;  1YHQ Z;  1VQN 1;  4NBC A;  4RV9 A;  2R6M A;  1KRL A;  4CL1 A;  3CPW Y;  4Y7N I;  2JA5 I;  4RVG A;  3CPW Z;  2HU9 A;  4MD9 A;  3CC7 1;  2V8K A;  3VMH A;  3J80 b;  1Z01 A;  4A3C I;  5CM2 M;  3IX0 A;  3CCE Z;  3PO2 I;  1DL6 A;  2R92 I;  3VB9 A;  1USP A;  1Q7Y 1;  3CQZ I;  1ZB9 A;  1VQP Z;  2Y0S A;  5T6B A;  3NDI A;  1I50 I;  2NVY I;  3J81 f;  2I3C A;  1Z03 A;  3MON A;  2F4M A;  3CCS Z;  1YJN 1;  1N8R 1;  5D1O B;  4E33 A;  3I4N I;  3CMA 1;  3EER A;  1QVG Y;  4NH1 C;  4DQY B;  1NP6 A;  3CXC Y;  1QVG Z;  4RVF A;  3JAM f;  4Y52 I;  2M6N A;  4DGL A;  3CXC Z;  1WW9 A;  4QTT A;  3CCL 1;  3F3P C;  4BBR I;  1R9T I;  1K9M 1;  1X0T A;  1YI2 1;  3PO3 I;  2YU9 I;  4E31 A;  2NVT I;  1QVF Y;  5C3E I;  3CCM 1;  3OW2 Y;  4A3G I;  3GKQ A;  1M1K 2;  1QVF Z;  1YHQ 1;  3FQQ A;  1S72 Z;  1Q86 2;  3D6W A;  3OW2 Z;  5IT9 f;  2OOY B;  1TWF I;  4NBE A;  2RIQ A;  2RT9 A;  1YJ9 Z;  2K5R A;  1VQO Z;  3G6E 1;  3TE5 B;  1PFT A;  4HH4 A;  1YJW 1;  3F3F C;  1TWH I;  2JR6 A;  4RS4 A;  3CCE 1;  4NB8 A;  3I55 Z;  1Q81 1;  1VLA A;  1W2B Y;  2QRC B;  1TWG I;  3G4S 1;  4NBA A;  1VQP 1;  3S2H I;  3M3Y I;  1W2B Z;  2WAQ A;  5IP9 I;  4A3M I;  2J6A A;  3U50 C;  3CCQ Z;  1I3Q I;  3CCV Z;  1QYP A;  2VUG A;  3CC2 Z;  1L1O C;  3CCS 1;  2E2J I;  4EWC A;  4E30 A;  3S1Q I;  3J80 f;  4DK1 A;  2KI7 B;  2ZAE B;  2IZ3 A;  1RNI A;  1WCM I;  4A3J I;  2GU2 A;  2PK7 A;  1VQ9 Z;  2W04 A;  4X6A I;  1VQ6 Z;  2M48 A;  1K73 2;  1VQK Z;  4HGZ A;  4A3E I;  2VUM I;  3QWU A;  3CD6 Z;  2DE5 A;  1NUI A;  5T64 A;  1Q82 2;  3TDH B;  3RZD I;  2GTH A;  1S72 1;  2W03 A;  2QA4 1;  1Y1V S;  3RZO I;  1YJ9 1;  3CCR Z;  1VQO 1;  4NB9 A;  3GTP I;  4A3B I;  4E32 A;  2P3Y A;  1P9N A;  4BXX I;  4A3L I;  3I55 1;  1Z02 A;  4E2Z A;  3CC4 Z;  3S17 I;  1KC8 2;  1K8A 2;  2K3R A;  3HOZ I;  3CCQ 1;  3CCV 1;  3BG1 B;  3CC2 1;  3CCJ Z;  2JNY A;  4XX2 A;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...