3JAMf

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamf00
3J80f 5IT9f 5A2Qf 3J81f 3JAMf 5FLXf
chains in the Genus database with same CATH superfamily
4E31A 4Y52I 3QWUA 2PK7A 1W2BY 2E9HA 3BG0B 3PO3S 5FLXb 1X0TA 4A3KI 1YHQ1 2OTLZ 1N2FA 3CXCY 4TNUA 5FLMI 3CCRZ 3HOXI 3CXCZ 2Q51A 3HOVI 3GTPI 1N8R1 1N8R2 3VB9A 3CMAZ 1SFOI 2QREB 3FQQA 3S14I 2BJOA 2R93I 2K3RA 1SIWA 1Q821 3CCUZ 1LQLA 1Q822 1VQ91 4E2XA 1KC82 2I3CA 2V3VA 1VQN1 3HKZA 2JNYA 2JIPA 3NFZA 3PO2I 1M902 1QVFY 1Y1VS 3CC71 1WZNA 1QXFA 2IZ3A 2YU9I 1QVFZ 1Y1WI 4E2YA 2IV2X 2OTJZ 1YI21 1Q811 3K7AI 1X3ZA 4NBDA 4RV9A 4BY7I 2F4MA 1YIJZ 2JA7I 2VUMI 2RBLA 3GKQA 4BXXI 4NB8A 4RVGA 3GTQI 2W04A 1I3QI 2RHBA 2E7ZA 1Q7Y1 1TWFI 1KD12 1VQ51 1NUIA 3CMEZ 3GTGI 5A2Qf 1ML8A 1L1OC 1VQLZ 5IP9I 3S15I 1I6HI 3T4NB 3H0GI 3VMIA 1VQP1 4EWCA 4A3BI 2OOXB 4NBGA 2JUBA 1VQ61 3CCV1 2M48A 2NVYI 2GTIA 4NBBA 3D6WA 3HOWI 1ZH1A 1VQO1 4MONA 2EGTA 2QEX1 5LL6f 2AKLA 1KQSZ 3F3FC 3I07A 3HOYI 2ZAEB 4A3FI 1VQM1 3G4S1 1USPA 1YJN1 3CD61 2JA6I 1YJWZ 3J81b 3S2HI 3CCLZ 3I551 3MONA 1X3WA 5D1OA 1VQ71 1K83I 3J7A4 4RVHA 1TWCI 2YADA 2VF1A 4BBRI 3RZDI 2M6NA 2B63I 3NH8A 1YHQZ 2OZKA 2RT9A 4E2ZA 2DE6A 3NH5A 4E32A 2E2HI 3IX0A 4DQYB 2IZ4A 1QF8A 1VQ81 4MXUA 1Y8CA 3U50C 4QTUA 3ESWA 3NDJA 2VPYA 4A3GI 3CMA1 3S17I 3Q87A 2P28A 4XX2A 3CCM1 1VQ9Z 1S721 2Q4ZA 2VPXA 2RIQA 1VQ41 4BBSI 1VQNZ 2Y0SA 4MD8A 4NBHA 3LUSA 1VQK1 2P3YA 4RVDA 4NB9A 1NP6A 3CC7Z 4QTTA 2JIRA 1Q812 2PM9A 2R92I 3S1MI 2OTJ1 2V45A 3CC4Z 1YI2Z 1K731 5D1PA 4NBFA 5T64A 2V8JA 1WCMI 3CCSZ 1YIJ1 2QA41 2V8KA 5C4XI 3H3VJ 1Q7Y2 4NOZA 4E33A 3CPWZ 1WW9A 4NH1C 3IFUA 1Q861 3OW2Z 1Q862 4A3DI 3IF8A 3CCJZ 1VQ5Z 4RVFA 5C3EI 1ZB9A 2JIMA 4BY1I 4A3LI 3PO3I 3I561 3HOUI 2NAPA 3GCFA 4NBCA 4E30A 3JAMf 3CCVZ 1KQSY 3BG1B 1Q16A 4MRIA 1WIIA 1USPB 4CL1A 1YITZ 1YJ91 2PMZA 5IP7I 5A2Qb 3G711 1VQOZ 3GTKI 3KIFA 2QEXZ 1RLYA 3G6E1 1TFIA 3CCQ1 1K8A1 1K8A2 3S1QI 2JS4A 5CM2M 4X6AI 1JJ2Z 5D1OB 2LFUA 2E2JI 2DE7A 3CCEZ 5FLXf 1FDOA 4NFRA 1I50I 2LEXA 2JA8I 4HH4A 4DK1A 3G4SZ 3CC2Z 1Z02A 1TWGI 1YJNZ 3CD6Z 3HOZI 3JAMb 2RPRA 3TE5B 2WB1A 1QVGY 1Y1VI 3I55Z 1QVGZ 1VQ7Z 3MZKB 2OOYB 3F3PC 3KIHA 1JWHC 2OTL1 2QRCB 1P9NA 2G2KA 4A3MI 3CCR1 3VMGA 3GTJI 2JMOA 2K5RA 4HGYA 3CQZI 1W2BZ 2QKDA 2JR6A 2H85A 4S1TA 1VQ8Z 2HF1A 3S2DI 1RO2A 2F4OA 3M4OI 4HGZA 4Y7NI 2WAQA 3CCU1 3NDIA 3D9XA 3M3YI 3FQMA 4MD9A 3CCMZ 3I4NI 2NVTI 1S72Z 1KC81 5C4JI 1VQ4Z 1M1K1 3S1RI 1M1K2 2QLVB 1K9M1 1S7MA 1K9M2 5AN9F 4A3II 2AYDA 1VQKZ 3FKII 2HU9A 1M901 1RO4A 3IR7A 1YUKA 1K732 4E2WA 3GTOI 2W03A 1VLAA 1RO0A 1KRLA 3CC41 3CPWY 4A93I 1Z03A 2QR1B 3NH4A 1NJI1 2KI7B 1NJI2 3GTMI 3OW2Y 4A3EI 3CCS1 2QA4Z 4MH4A 3MZLB 2NVQI 3RZOI 2VUGA 2JIQA 3S16I 4A3JI 3CME1 4A3CI 5T67A 2JIOA 3S1NI 2KPIA 2V8IA 1DL6A 1VQL1 2VPZA 5IT9f 1VQPZ 1FDIA 1KD11 3CCJ1 3EERA 3J80f 1VQ6Z 3P5JB 3VMHA 2O53A 3I56Z 1YUAA 1WJ2A 3EEDA 2NVXI 2O4HA 1JJ2Y 2JA5I 4AYBA 2R6MA 1AA6A 3D2LA 1YJ9Z 1Z01A 1QYPA 3J81f 1YIT1 4RS4A 1RNIA 3G71Z 4NBEA 2J6AA 1R9TI 3I4MI 3G6EZ 3CCQZ 3GTLI 2QRDB 1ZB8A 5IT9b 1VQMZ 2LIYA 4MD7A 1PFTA 2E2II 2DE5A 2VPWA 3J80b 2GTHA 3VTNA 4DGLA 1TWAI 3CCE1 1YJW1 1RQFA 5T6BA 3TDHB 3GTMS 4NBAA 2R7ZI 5C44I 3CCL1 1TWHI 2GU2A 3CC21
chains in the Genus database with same CATH topology
4E31A 4Y52I 3QWUA 2PK7A 1W2BY 2E9HA 3BG0B 3PO3S 5FLXb 1X0TA 4A3KI 1YHQ1 2OTLZ 1N2FA 3CXCY 4TNUA 5FLMI 3CCRZ 3HOXI 3CXCZ 2Q51A 3HOVI 3GTPI 1N8R1 1N8R2 3VB9A 3CMAZ 1SFOI 2QREB 3FQQA 3S14I 2BJOA 2R93I 2K3RA 1Q821 1LQLA 3CCUZ 1Q822 1VQ91 4E2XA 1KC82 2I3CA 1VQN1 3HKZA 2JNYA 3NFZA 3PO2I 1M902 1QVFY 1Y1VS 3CC71 2IZ3A 2YU9I 1QVFZ 1Y1WI 4E2YA 2OTJZ 1YI21 1Q811 3K7AI 1X3ZA 4NBDA 4RV9A 4BY7I 2F4MA 1YIJZ 2JA7I 2VUMI 2RBLA 3GKQA 4BXXI 4NB8A 4RVGA 3GTQI 2W04A 1I3QI 2RHBA 1Q7Y1 1TWFI 1KD12 1VQ51 1NUIA 3CMEZ 3GTGI 5A2Qf 1ML8A 1L1OC 1VQLZ 5IP9I 3S15I 1I6HI 3T4NB 3H0GI 3VMIA 1VQP1 4EWCA 4A3BI 2OOXB 4NBGA 2JUBA 1VQ61 3CCV1 2M48A 2NVYI 2GTIA 4NBBA 3D6WA 3HOWI 1ZH1A 1VQO1 4MONA 2EGTA 2QEX1 5LL6f 2AKLA 1KQSZ 3F3FC 3I07A 3HOYI 2ZAEB 4A3FI 1VQM1 3G4S1 1USPA 1YJN1 3CD61 2JA6I 1YJWZ 3J81b 3S2HI 3CCLZ 3I551 3MONA 1X3WA 5D1OA 1VQ71 1K83I 3J7A4 4RVHA 1TWCI 2YADA 2VF1A 4BBRI 3RZDI 2M6NA 2B63I 3NH8A 1YHQZ 2OZKA 2RT9A 4E2ZA 2DE6A 3NH5A 4E32A 2E2HI 3IX0A 4DQYB 2IZ4A 1QF8A 1VQ81 4MXUA 3U50C 4QTUA 3ESWA 3NDJA 4A3GI 3CMA1 3S17I 3Q87A 2P28A 4XX2A 3CCM1 1VQ9Z 1S721 2Q4ZA 2RIQA 1VQ41 4BBSI 1VQNZ 2Y0SA 4MD8A 4NBHA 3LUSA 1VQK1 2P3YA 4RVDA 4NB9A 1NP6A 3CC7Z 4QTTA 1Q812 2PM9A 2R92I 3S1MI 2OTJ1 3CC4Z 1YI2Z 1K731 5D1PA 4NBFA 5T64A 2V8JA 1WCMI 3CCSZ 1YIJ1 2QA41 2V8KA 5C4XI 3H3VJ 1Q7Y2 4NOZA 4E33A 3CPWZ 1WW9A 4NH1C 3IFUA 1Q861 3OW2Z 1Q862 4A3DI 3IF8A 3CCJZ 1VQ5Z 4RVFA 5C3EI 1ZB9A 4BY1I 4A3LI 3PO3I 3I561 3HOUI 3GCFA 4NBCA 4E30A 3JAMf 3CCVZ 1KQSY 3BG1B 4MRIA 1WIIA 1USPB 4CL1A 1YITZ 1YJ91 2PMZA 5IP7I 5A2Qb 3G711 1VQOZ 3GTKI 3KIFA 2QEXZ 1RLYA 3G6E1 1TFIA 3CCQ1 1K8A1 1K8A2 3S1QI 2JS4A 5CM2M 4X6AI 1JJ2Z 5D1OB 2LFUA 2E2JI 2DE7A 3CCEZ 5FLXf 4NFRA 1I50I 2JA8I 4HH4A 4DK1A 3G4SZ 3CC2Z 1Z02A 1TWGI 1YJNZ 3CD6Z 3HOZI 3JAMb 2RPRA 3TE5B 2WB1A 1QVGY 1Y1VI 3I55Z 1QVGZ 1VQ7Z 3MZKB 2OOYB 3F3PC 3KIHA 1JWHC 2OTL1 2QRCB 1P9NA 2G2KA 4A3MI 3CCR1 3VMGA 3GTJI 2JMOA 2K5RA 4HGYA 3CQZI 1W2BZ 2QKDA 2JR6A 2H85A 4S1TA 1VQ8Z 2HF1A 3S2DI 1RO2A 2F4OA 3M4OI 4HGZA 4Y7NI 2WAQA 3CCU1 3NDIA 3D9XA 3M3YI 3FQMA 4MD9A 3CCMZ 3I4NI 2NVTI 1S72Z 1KC81 5C4JI 1VQ4Z 1M1K1 3S1RI 1M1K2 2QLVB 1K9M1 1S7MA 1K9M2 5AN9F 4A3II 1VQKZ 3FKII 2HU9A 1M901 1RO4A 1YUKA 1K732 4E2WA 3GTOI 2W03A 1VLAA 1RO0A 1KRLA 3CC41 3CPWY 4A93I 1Z03A 2QR1B 3NH4A 1NJI1 2KI7B 1NJI2 3GTMI 3OW2Y 4A3EI 3CCS1 2QA4Z 4MH4A 3MZLB 2NVQI 3RZOI 2VUGA 3S16I 4A3JI 3CME1 4A3CI 5T67A 3S1NI 1DL6A 2KPIA 2V8IA 1VQL1 5IT9f 1VQPZ 1KD11 3CCJ1 3EERA 3J80f 1VQ6Z 3P5JB 3VMHA 2O53A 3I56Z 1YUAA 3EEDA 2NVXI 2O4HA 1JJ2Y 2JA5I 4AYBA 2R6MA 1YJ9Z 1Z01A 1QYPA 3J81f 1YIT1 4RS4A 1RNIA 3G71Z 4NBEA 2J6AA 1R9TI 3I4MI 3G6EZ 3CCQZ 3GTLI 2QRDB 1ZB8A 5IT9b 1VQMZ 2LIYA 4MD7A 1PFTA 2E2II 2DE5A 3J80b 2GTHA 3VTNA 4DGLA 1TWAI 3CCE1 1YJW1 1RQFA 5T6BA 3TDHB 3GTMS 4NBAA 2R7ZI 5C44I 3CCL1 1TWHI 2GU2A 3CC21
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 f;  5IT9 f;  5A2Q f;  3J81 f;  3JAM f;  5FLX f; 
#chains in the Genus database with same CATH topology
 4E31 A;  4Y52 I;  3QWU A;  2PK7 A;  1W2B Y;  2E9H A;  3BG0 B;  3PO3 S;  5FLX b;  1X0T A;  4A3K I;  1YHQ 1;  2OTL Z;  1N2F A;  3CXC Y;  4TNU A;  5FLM I;  3CCR Z;  3HOX I;  3CXC Z;  2Q51 A;  3HOV I;  3GTP I;  1N8R 1;  1N8R 2;  3VB9 A;  3CMA Z;  1SFO I;  2QRE B;  3FQQ A;  3S14 I;  2BJO A;  2R93 I;  2K3R A;  1SIW A;  1Q82 1;  3CCU Z;  1LQL A;  1Q82 2;  1VQ9 1;  4E2X A;  1KC8 2;  2I3C A;  2V3V A;  1VQN 1;  3HKZ A;  2JNY A;  2JIP A;  3NFZ A;  3PO2 I;  1M90 2;  1QVF Y;  1Y1V S;  3CC7 1;  1WZN A;  1QXF A;  2IZ3 A;  2YU9 I;  1QVF Z;  1Y1W I;  4E2Y A;  2IV2 X;  2OTJ Z;  1YI2 1;  1Q81 1;  3K7A I;  1X3Z A;  4NBD A;  4RV9 A;  4BY7 I;  2F4M A;  1YIJ Z;  2JA7 I;  2VUM I;  2RBL A;  3GKQ A;  4BXX I;  4NB8 A;  4RVG A;  3GTQ I;  2W04 A;  1I3Q I;  2RHB A;  2E7Z A;  1Q7Y 1;  1TWF I;  1KD1 2;  1VQ5 1;  1NUI A;  3CME Z;  3GTG I;  5A2Q f;  1ML8 A;  1L1O C;  1VQL Z;  5IP9 I;  3S15 I;  1I6H I;  3T4N B;  3H0G I;  3VMI A;  1VQP 1;  4EWC A;  4A3B I;  2OOX B;  4NBG A;  2JUB A;  1VQ6 1;  3CCV 1;  2M48 A;  2NVY I;  2GTI A;  4NBB A;  3D6W A;  3HOW I;  1ZH1 A;  1VQO 1;  4MON A;  2EGT A;  2QEX 1;  5LL6 f;  2AKL A;  1KQS Z;  3F3F C;  3I07 A;  3HOY I;  2ZAE B;  4A3F I;  1VQM 1;  3G4S 1;  1USP A;  1YJN 1;  3CD6 1;  2JA6 I;  1YJW Z;  3J81 b;  3S2H I;  3CCL Z;  3I55 1;  3MON A;  1X3W A;  5D1O A;  1VQ7 1;  1K83 I;  3J7A 4;  4RVH A;  1TWC I;  2YAD A;  2VF1 A;  4BBR I;  3RZD I;  2M6N A;  2B63 I;  3NH8 A;  1YHQ Z;  2OZK A;  2RT9 A;  4E2Z A;  2DE6 A;  3NH5 A;  4E32 A;  2E2H I;  3IX0 A;  4DQY B;  2IZ4 A;  1QF8 A;  1VQ8 1;  4MXU A;  1Y8C A;  3U50 C;  4QTU A;  3ESW A;  3NDJ A;  2VPY A;  4A3G I;  3CMA 1;  3S17 I;  3Q87 A;  2P28 A;  4XX2 A;  3CCM 1;  1VQ9 Z;  1S72 1;  2Q4Z A;  2VPX A;  2RIQ A;  1VQ4 1;  4BBS I;  1VQN Z;  2Y0S A;  4MD8 A;  4NBH A;  3LUS A;  1VQK 1;  2P3Y A;  4RVD A;  4NB9 A;  1NP6 A;  3CC7 Z;  4QTT A;  2JIR A;  1Q81 2;  2PM9 A;  2R92 I;  3S1M I;  2OTJ 1;  2V45 A;  3CC4 Z;  1YI2 Z;  1K73 1;  5D1P A;  4NBF A;  5T64 A;  2V8J A;  1WCM I;  3CCS Z;  1YIJ 1;  2QA4 1;  2V8K A;  5C4X I;  3H3V J;  1Q7Y 2;  4NOZ A;  4E33 A;  3CPW Z;  1WW9 A;  4NH1 C;  3IFU A;  1Q86 1;  3OW2 Z;  1Q86 2;  4A3D I;  3IF8 A;  3CCJ Z;  1VQ5 Z;  4RVF A;  5C3E I;  1ZB9 A;  2JIM A;  4BY1 I;  4A3L I;  3PO3 I;  3I56 1;  3HOU I;  2NAP A;  3GCF A;  4NBC A;  4E30 A;  3JAM f;  3CCV Z;  1KQS Y;  3BG1 B;  1Q16 A;  4MRI A;  1WII A;  1USP B;  4CL1 A;  1YIT Z;  1YJ9 1;  2PMZ A;  5IP7 I;  5A2Q b;  3G71 1;  1VQO Z;  3GTK I;  3KIF A;  2QEX Z;  1RLY A;  3G6E 1;  1TFI A;  3CCQ 1;  1K8A 1;  1K8A 2;  3S1Q I;  2JS4 A;  5CM2 M;  4X6A I;  1JJ2 Z;  5D1O B;  2LFU A;  2E2J I;  2DE7 A;  3CCE Z;  5FLX f;  1FDO A;  4NFR A;  1I50 I;  2LEX A;  2JA8 I;  4HH4 A;  4DK1 A;  3G4S Z;  3CC2 Z;  1Z02 A;  1TWG I;  1YJN Z;  3CD6 Z;  3HOZ I;  3JAM b;  2RPR A;  3TE5 B;  2WB1 A;  1QVG Y;  1Y1V I;  3I55 Z;  1QVG Z;  1VQ7 Z;  3MZK B;  2OOY B;  3F3P C;  3KIH A;  1JWH C;  2OTL 1;  2QRC B;  1P9N A;  2G2K A;  4A3M I;  3CCR 1;  3VMG A;  3GTJ I;  2JMO A;  2K5R A;  4HGY A;  3CQZ I;  1W2B Z;  2QKD A;  2JR6 A;  2H85 A;  4S1T A;  1VQ8 Z;  2HF1 A;  3S2D I;  1RO2 A;  2F4O A;  3M4O I;  4HGZ A;  4Y7N I;  2WAQ A;  3CCU 1;  3NDI A;  3D9X A;  3M3Y I;  3FQM A;  4MD9 A;  3CCM Z;  3I4N I;  2NVT I;  1S72 Z;  1KC8 1;  5C4J I;  1VQ4 Z;  1M1K 1;  3S1R I;  1M1K 2;  2QLV B;  1K9M 1;  1S7M A;  1K9M 2;  5AN9 F;  4A3I I;  2AYD A;  1VQK Z;  3FKI I;  2HU9 A;  1M90 1;  1RO4 A;  3IR7 A;  1YUK A;  1K73 2;  4E2W A;  3GTO I;  2W03 A;  1VLA A;  1RO0 A;  1KRL A;  3CC4 1;  3CPW Y;  4A93 I;  1Z03 A;  2QR1 B;  3NH4 A;  1NJI 1;  2KI7 B;  1NJI 2;  3GTM I;  3OW2 Y;  4A3E I;  3CCS 1;  2QA4 Z;  4MH4 A;  3MZL B;  2NVQ I;  3RZO I;  2VUG A;  2JIQ A;  3S16 I;  4A3J I;  3CME 1;  4A3C I;  5T67 A;  2JIO A;  3S1N I;  2KPI A;  2V8I A;  1DL6 A;  1VQL 1;  2VPZ A;  5IT9 f;  1VQP Z;  1FDI A;  1KD1 1;  3CCJ 1;  3EER A;  3J80 f;  1VQ6 Z;  3P5J B;  3VMH A;  2O53 A;  3I56 Z;  1YUA A;  1WJ2 A;  3EED A;  2NVX I;  2O4H A;  1JJ2 Y;  2JA5 I;  4AYB A;  2R6M A;  1AA6 A;  3D2L A;  1YJ9 Z;  1Z01 A;  1QYP A;  3J81 f;  1YIT 1;  4RS4 A;  1RNI A;  3G71 Z;  4NBE A;  2J6A A;  1R9T I;  3I4M I;  3G6E Z;  3CCQ Z;  3GTL I;  2QRD B;  1ZB8 A;  5IT9 b;  1VQM Z;  2LIY A;  4MD7 A;  1PFT A;  2E2I I;  2DE5 A;  2VPW A;  3J80 b;  2GTH A;  3VTN A;  4DGL A;  1TWA I;  3CCE 1;  1YJW 1;  1RQF A;  5T6B A;  3TDH B;  3GTM S;  4NBA A;  2R7Z I;  5C44 I;  3CCL 1;  1TWH I;  2GU2 A;  3CC2 1; 
#chains in the Genus database with same CATH homology
 4E31 A;  4Y52 I;  3QWU A;  2PK7 A;  1W2B Y;  2E9H A;  3BG0 B;  3PO3 S;  5FLX b;  1X0T A;  4A3K I;  1YHQ 1;  2OTL Z;  1N2F A;  3CXC Y;  4TNU A;  5FLM I;  3CCR Z;  3HOX I;  3CXC Z;  2Q51 A;  3HOV I;  3GTP I;  1N8R 1;  1N8R 2;  3VB9 A;  3CMA Z;  1SFO I;  2QRE B;  3FQQ A;  3S14 I;  2BJO A;  2R93 I;  2K3R A;  1Q82 1;  1LQL A;  3CCU Z;  1Q82 2;  1VQ9 1;  4E2X A;  1KC8 2;  2I3C A;  1VQN 1;  3HKZ A;  2JNY A;  3NFZ A;  3PO2 I;  1M90 2;  1QVF Y;  1Y1V S;  3CC7 1;  2IZ3 A;  2YU9 I;  1QVF Z;  1Y1W I;  4E2Y A;  2OTJ Z;  1YI2 1;  1Q81 1;  3K7A I;  1X3Z A;  4NBD A;  4RV9 A;  4BY7 I;  2F4M A;  1YIJ Z;  2JA7 I;  2VUM I;  2RBL A;  3GKQ A;  4BXX I;  4NB8 A;  4RVG A;  3GTQ I;  2W04 A;  1I3Q I;  2RHB A;  1Q7Y 1;  1TWF I;  1KD1 2;  1VQ5 1;  1NUI A;  3CME Z;  3GTG I;  5A2Q f;  1ML8 A;  1L1O C;  1VQL Z;  5IP9 I;  3S15 I;  1I6H I;  3T4N B;  3H0G I;  3VMI A;  1VQP 1;  4EWC A;  4A3B I;  2OOX B;  4NBG A;  2JUB A;  1VQ6 1;  3CCV 1;  2M48 A;  2NVY I;  2GTI A;  4NBB A;  3D6W A;  3HOW I;  1ZH1 A;  1VQO 1;  4MON A;  2EGT A;  2QEX 1;  5LL6 f;  2AKL A;  1KQS Z;  3F3F C;  3I07 A;  3HOY I;  2ZAE B;  4A3F I;  1VQM 1;  3G4S 1;  1USP A;  1YJN 1;  3CD6 1;  2JA6 I;  1YJW Z;  3J81 b;  3S2H I;  3CCL Z;  3I55 1;  3MON A;  1X3W A;  5D1O A;  1VQ7 1;  1K83 I;  3J7A 4;  4RVH A;  1TWC I;  2YAD A;  2VF1 A;  4BBR I;  3RZD I;  2M6N A;  2B63 I;  3NH8 A;  1YHQ Z;  2OZK A;  2RT9 A;  4E2Z A;  2DE6 A;  3NH5 A;  4E32 A;  2E2H I;  3IX0 A;  4DQY B;  2IZ4 A;  1QF8 A;  1VQ8 1;  4MXU A;  3U50 C;  4QTU A;  3ESW A;  3NDJ A;  4A3G I;  3CMA 1;  3S17 I;  3Q87 A;  2P28 A;  4XX2 A;  3CCM 1;  1VQ9 Z;  1S72 1;  2Q4Z A;  2RIQ A;  1VQ4 1;  4BBS I;  1VQN Z;  2Y0S A;  4MD8 A;  4NBH A;  3LUS A;  1VQK 1;  2P3Y A;  4RVD A;  4NB9 A;  1NP6 A;  3CC7 Z;  4QTT A;  1Q81 2;  2PM9 A;  2R92 I;  3S1M I;  2OTJ 1;  3CC4 Z;  1YI2 Z;  1K73 1;  5D1P A;  4NBF A;  5T64 A;  2V8J A;  1WCM I;  3CCS Z;  1YIJ 1;  2QA4 1;  2V8K A;  5C4X I;  3H3V J;  1Q7Y 2;  4NOZ A;  4E33 A;  3CPW Z;  1WW9 A;  4NH1 C;  3IFU A;  1Q86 1;  3OW2 Z;  1Q86 2;  4A3D I;  3IF8 A;  3CCJ Z;  1VQ5 Z;  4RVF A;  5C3E I;  1ZB9 A;  4BY1 I;  4A3L I;  3PO3 I;  3I56 1;  3HOU I;  3GCF A;  4NBC A;  4E30 A;  3JAM f;  3CCV Z;  1KQS Y;  3BG1 B;  4MRI A;  1WII A;  1USP B;  4CL1 A;  1YIT Z;  1YJ9 1;  2PMZ A;  5IP7 I;  5A2Q b;  3G71 1;  1VQO Z;  3GTK I;  3KIF A;  2QEX Z;  1RLY A;  3G6E 1;  1TFI A;  3CCQ 1;  1K8A 1;  1K8A 2;  3S1Q I;  2JS4 A;  5CM2 M;  4X6A I;  1JJ2 Z;  5D1O B;  2LFU A;  2E2J I;  2DE7 A;  3CCE Z;  5FLX f;  4NFR A;  1I50 I;  2JA8 I;  4HH4 A;  4DK1 A;  3G4S Z;  3CC2 Z;  1Z02 A;  1TWG I;  1YJN Z;  3CD6 Z;  3HOZ I;  3JAM b;  2RPR A;  3TE5 B;  2WB1 A;  1QVG Y;  1Y1V I;  3I55 Z;  1QVG Z;  1VQ7 Z;  3MZK B;  2OOY B;  3F3P C;  3KIH A;  1JWH C;  2OTL 1;  2QRC B;  1P9N A;  2G2K A;  4A3M I;  3CCR 1;  3VMG A;  3GTJ I;  2JMO A;  2K5R A;  4HGY A;  3CQZ I;  1W2B Z;  2QKD A;  2JR6 A;  2H85 A;  4S1T A;  1VQ8 Z;  2HF1 A;  3S2D I;  1RO2 A;  2F4O A;  3M4O I;  4HGZ A;  4Y7N I;  2WAQ A;  3CCU 1;  3NDI A;  3D9X A;  3M3Y I;  3FQM A;  4MD9 A;  3CCM Z;  3I4N I;  2NVT I;  1S72 Z;  1KC8 1;  5C4J I;  1VQ4 Z;  1M1K 1;  3S1R I;  1M1K 2;  2QLV B;  1K9M 1;  1S7M A;  1K9M 2;  5AN9 F;  4A3I I;  1VQK Z;  3FKI I;  2HU9 A;  1M90 1;  1RO4 A;  1YUK A;  1K73 2;  4E2W A;  3GTO I;  2W03 A;  1VLA A;  1RO0 A;  1KRL A;  3CC4 1;  3CPW Y;  4A93 I;  1Z03 A;  2QR1 B;  3NH4 A;  1NJI 1;  2KI7 B;  1NJI 2;  3GTM I;  3OW2 Y;  4A3E I;  3CCS 1;  2QA4 Z;  4MH4 A;  3MZL B;  2NVQ I;  3RZO I;  2VUG A;  3S16 I;  4A3J I;  3CME 1;  4A3C I;  5T67 A;  3S1N I;  1DL6 A;  2KPI A;  2V8I A;  1VQL 1;  5IT9 f;  1VQP Z;  1KD1 1;  3CCJ 1;  3EER A;  3J80 f;  1VQ6 Z;  3P5J B;  3VMH A;  2O53 A;  3I56 Z;  1YUA A;  3EED A;  2NVX I;  2O4H A;  1JJ2 Y;  2JA5 I;  4AYB A;  2R6M A;  1YJ9 Z;  1Z01 A;  1QYP A;  3J81 f;  1YIT 1;  4RS4 A;  1RNI A;  3G71 Z;  4NBE A;  2J6A A;  1R9T I;  3I4M I;  3G6E Z;  3CCQ Z;  3GTL I;  2QRD B;  1ZB8 A;  5IT9 b;  1VQM Z;  2LIY A;  4MD7 A;  1PFT A;  2E2I I;  2DE5 A;  3J80 b;  2GTH A;  3VTN A;  4DGL A;  1TWA I;  3CCE 1;  1YJW 1;  1RQF A;  5T6B A;  3TDH B;  3GTM S;  4NBA A;  2R7Z I;  5C44 I;  3CCL 1;  1TWH I;  2GU2 A;  3CC2 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...