1VQKZ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqkZ00
1K9M2 1M901 1KQSY 1VQ8Z 1Q861 1VQM1 1VQL1 3CXCZ 3CCSZ 3CC41 3CPWZ 3CC71 1KQSZ 1YHQZ 1NJI2 3CD61 3CCQZ 1M1K1 3G6E1 1Q821 1YJNZ 1Q811 1VQN1 1K8A1 1VQO1 1KD11 1YIT1 1Q7Y2 1N8R1 1VQ4Z 3OW2Z 1VQNZ 3CMA1 2QA41 3G4SZ 3I56Z 3CMEZ 2OTJZ 2QEX1 3CCJZ 3CCU1 3OW2Y 3CME1 1VQ5Z 3I561 1M1K2 1K731 2QEXZ 3CCJ1 1VQ41 1W2BY 1Q812 2OTJ1 1VQP1 1M902 1YITZ 3G4S1 1YJ91 2QA4Z 1KC82 1W2BZ 1YJ9Z 1Q862 1S72Z 1VQPZ 1YIJ1 1VQ7Z 1YI2Z 1VQOZ 1JJ2Y 3CXCY 3CC7Z 3CC4Z 3CPWY 1VQ91 1VQ51 1VQLZ 3G71Z 3CCQ1 3CCUZ 1YJWZ 1VQ81 1JJ2Z 3CCS1 3I551 3CMAZ 1Q7Y1 1N8R2 3CCVZ 1QVFZ 1VQKZ 3CCLZ 3CCEZ 1QVFY 1VQ61 3CCM1 1YJN1 1VQ6Z 3G6EZ 1Q822 3CCE1 3CCL1 1YHQ1 1K732 3CD6Z 1K9M1 1VQK1 3CCV1 1VQMZ 3I55Z 3CC2Z 1QVGY 1KC81 3CC21 1YJW1 3G711 1QVGZ 1VQ9Z 1NJI1 3CCR1 2OTL1 3CCRZ 1YI21 2OTLZ 1YIJZ 1VQ71 3CCMZ 1K8A2 1S721 1KD12
chains in the Genus database with same CATH superfamily
1K9M2 2QKDA 2J6AA 2W03A 4MONA 1WW9A 3NH8A 1VQM1 2VF1A 1VLAA 5C4JI 3VMHA 1TWAI 3CXCZ 1VQL1 4A3DI 3CC71 5T67A 2JA6I 1NJI2 3S1RI 4MD8A 2OOXB 2NVQI 1P9NA 1Y1VS 1Q16A 2JA8I 2O4HA 4BBSI 3OW2Z 2V8JA 4A93I 4MRIA 2NAPA 3BG1B 4HH4A 2QLVB 3I07A 4DGLA 5C4XI 3IX0A 3BG0B 3I561 1M1K2 2RPRA 3HOVI 1PFTA 2OTJ1 2E7ZA 3S14I 4NBFA 1YITZ 3G4S1 1YJ91 2IZ3A 3RZDI 4QTTA 3GTOI 3GTGI 1YI2Z 3HKZA 2RBLA 1X3ZA 2RHBA 3K7AI 2E2HI 1X0TA 1USPA 2ZAEB 4RVDA 2DE6A 3CCQ1 3JAMf 2LFUA 2JA7I 3RZOI 3CCS1 1N8R2 3CCVZ 1QVFZ 4HGYA 1VQKZ 5C3EI 2EGTA 3FQQA 2YU9I 2OOYB 3CCM1 4A3JI 1YHQ1 3CD6Z 1I3QI 1K9M1 5AN9F 3MONA 3GTJI 3I55Z 3CC2Z 1QVGY 5T64A 3G711 2VPYA 4RVHA 1NJI1 3IF8A 3M3YI 3P5JB 5IP9I 1YIJZ 3NH5A 1S721 4RV9A 1M901 4A3MI 3GCFA 3MZKB 4E2WA 2HU9A 4E2XA 1TWGI 3PO3I 3S17I 1I50I 4E33A 2KI7B 2R92I 3S2DI 2Q4ZA 1KQSZ 2JA5I 1YHQZ 3CD61 2HF1A 1M1K1 4TNUA 2PK7A 3U50C 3VTNA 1Y8CA 2NVYI 4XX2A 1K8A1 3J80f 1YIT1 1Q7Y2 1AA6A 4A3KI 1VQNZ 2Q51A 3I56Z 4NBEA 1NUIA 1Y1WI 4X6AI 2PMZA 2WAQA 3S1QI 2QEX1 2GTHA 1FDIA 4NH1C 3CCJ1 4AYBA 1RQFA 1Q812 4NBDA 4DK1A 1R9TI 1KC82 1W2BZ 4BY1I 1WZNA 2PM9A 1YJ9Z 1YUKA 5FLMI 1YUAA 2JS4A 2M48A 3J81f 1VQ7Z 1VQPZ 1VQOZ 3HOUI 3S1NI 1TWHI 1QYPA 1VQ51 1VQLZ 2KPIA 3S2HI 2K3RA 1JJ2Z 2JR6A 4RVFA 2JIMA 4E30A 3HOZI 2LIYA 3HOXI 2JNYA 1USPB 3TE5B 3M4OI 2I3CA 1RO4A 2QR1B 1VQ61 1ML8A 4EWCA 2M6NA 1Q822 3CCL1 3NDIA 5A2Qb 3JAMb 2QRDB 1VQMZ 2P3YA 3KIFA 1RO0A 5LL6f 1YJW1 2H85A 4A3CI 1VQ9Z 1WJ2A 2F4MA 3NFZA 2R93I 3CCRZ 2OTLZ 4BBRI 1VQ71 1K8A2 4NOZA 4E31A 3H0GI 2V45A 2V8IA 1WCMI 2GU2A 1KQSY 4NBGA 1VQ8Z 1Q861 3EEDA 3TDHB 3PO3S 1X3WA 3H3VJ 4A3LI 2JIPA 2QREB 1SFOI 3CCQZ 1KRLA 2JIQA 1YJNZ 1Q811 1VQO1 4MH4A 1KD11 3IR7A 3D2LA 2JIRA 2P28A 5D1OA 3QWUA 3PO2I 1TWFI 2V8KA 3CMA1 1Z02A 3VMIA 2OTJZ 3CCJZ 3CCU1 1JWHC 3CME1 4A3EI 1K731 4A3GI 4RS4A 2QEXZ 5T6BA 3F3FC 1W2BY 1M902 5IT9b 1ZB8A 4RVGA 1YIJ1 2VUGA 3NH4A 1JJ2Y 3EERA 3CC7Z 3CC4Z 5IP7I 3CPWY 1VQ91 2K5RA 3CCUZ 1YJWZ 5A2Qf 3VMGA 3GTMI 2G2KA 2E2JI 1QF8A 3I551 1Q7Y1 1DL6A 2NVTI 3GTPI 1I6HI 2WB1A 4MD9A 3CCLZ 2VPZA 1TWCI 1VQ6Z 2Y0SA 2AKLA 5C44I 3G6EZ 4BXXI 3J80b 3I4NI 4DQYB 3J7A4 1Z03A 1VQK1 1TFIA 2DE7A 4MD7A 3ESWA 4MXUA 2E2II 2RT9A 1WIIA 3F3PC 2JMOA 4A3FI 2R6MA 2IV2X 1KC81 2F4OA 3CC21 4NBCA 2DE5A 1ZB9A 5IT9f 1QXFA 2VUMI 3CCMZ 4E2YA 2AYDA 1KD12 4A3BI 4NB9A 1SIWA 4BY7I 2LEXA 3IFUA 3LUSA 1Z01A 2JIOA 1S7MA 3J81b 2R7ZI 3CCSZ 3FKII 3CC41 5FLXf 3CPWZ 2IZ4A 3G6E1 1Q821 2NVXI 2VPWA 1VQN1 2GTIA 5CM2M 4NB8A 2VPXA 4NBHA 1N8R1 4Y52I 1VQ4Z 2QA41 2BJOA 3G4SZ 4S1TA 3CMEZ 3S1MI 2YADA 3OW2Y 2JUBA 1VQ5Z 1RNIA 4CL1A 2W04A 1VQ41 1ZH1A 1VQP1 2B63I 2QA4Z 4A3II 3KIHA 1Q862 1S72Z 5D1PA 4HGZA 3CXCY 1LQLA 4NBBA 3G71Z 3I4MI 1VQ81 4E2ZA 2V3VA 3GTMS 3HOWI 3GKQA 3T4NB 4E32A 3GTKI 3CMAZ 3CQZI 4QTUA 3D6WA 3VB9A 1N2FA 3CCEZ 3HOYI 2OZKA 1QVFY 3GTQI 1K83I 1YJN1 1RO2A 3CCE1 1K732 3NDJA 3S15I 3FQMA 3GTLI 1L1OC 3CCV1 3S16I 3Q87A 5FLXb 2O53A 3MZLB 2RIQA 1QVGZ 4NBAA 3CCR1 2OTL1 4Y7NI 1Y1VI 4NFRA 1YI21 2QRCB 1FDOA 3D9XA 5D1OB 2E9HA 1RLYA 1NP6A
chains in the Genus database with same CATH topology
1K9M2 2QKDA 2J6AA 2W03A 4MONA 1WW9A 3NH8A 1VQM1 2VF1A 1VLAA 5C4JI 3VMHA 1TWAI 3CXCZ 1VQL1 4A3DI 3CC71 5T67A 2JA6I 1NJI2 3S1RI 4MD8A 2OOXB 2NVQI 1P9NA 1Y1VS 2JA8I 2O4HA 4BBSI 3OW2Z 2V8JA 4A93I 4MRIA 3BG1B 4HH4A 2QLVB 3I07A 4DGLA 5C4XI 3IX0A 3BG0B 3I561 1M1K2 2RPRA 3HOVI 1PFTA 2OTJ1 3S14I 4NBFA 1YITZ 3G4S1 1YJ91 2IZ3A 3RZDI 4QTTA 3GTOI 3GTGI 1YI2Z 3HKZA 2RBLA 1X3ZA 2RHBA 3K7AI 2E2HI 1X0TA 1USPA 2ZAEB 4RVDA 2DE6A 3CCQ1 3JAMf 2LFUA 2JA7I 3RZOI 3CCS1 1N8R2 3CCVZ 1QVFZ 4HGYA 1VQKZ 5C3EI 2EGTA 3FQQA 2YU9I 2OOYB 3CCM1 4A3JI 1YHQ1 3CD6Z 1I3QI 1K9M1 5AN9F 3MONA 3GTJI 3I55Z 3CC2Z 1QVGY 5T64A 3G711 4RVHA 1NJI1 3IF8A 3M3YI 3P5JB 5IP9I 1YIJZ 3NH5A 1S721 4RV9A 1M901 4A3MI 3GCFA 3MZKB 4E2WA 2HU9A 4E2XA 1TWGI 3PO3I 3S17I 1I50I 4E33A 2KI7B 2R92I 3S2DI 2Q4ZA 1KQSZ 2JA5I 1YHQZ 3CD61 2HF1A 1M1K1 4TNUA 2PK7A 3U50C 3VTNA 4XX2A 2NVYI 1K8A1 3J80f 1YIT1 1Q7Y2 4A3KI 1VQNZ 2Q51A 3I56Z 4NBEA 1NUIA 1Y1WI 4X6AI 2PMZA 2WAQA 3S1QI 2QEX1 2GTHA 4NH1C 3CCJ1 4AYBA 1RQFA 1Q812 4NBDA 4DK1A 1R9TI 1KC82 1W2BZ 4BY1I 2PM9A 1YJ9Z 1YUKA 5FLMI 2M48A 1VQPZ 2JS4A 1YUAA 3J81f 1VQ7Z 1VQOZ 3HOUI 3S1NI 1TWHI 1QYPA 1VQ51 1VQLZ 2KPIA 3S2HI 2K3RA 1JJ2Z 2JR6A 4RVFA 4E30A 3HOZI 2LIYA 3HOXI 2JNYA 1USPB 3TE5B 3M4OI 2I3CA 1RO4A 2QR1B 1VQ61 1ML8A 4EWCA 2M6NA 1Q822 3CCL1 3NDIA 5A2Qb 3JAMb 2QRDB 1VQMZ 2P3YA 3KIFA 1RO0A 5LL6f 1YJW1 2H85A 4A3CI 1VQ9Z 2F4MA 3NFZA 2R93I 3CCRZ 2OTLZ 4BBRI 1VQ71 1K8A2 4NOZA 4E31A 3H0GI 2V8IA 1WCMI 2GU2A 1KQSY 4NBGA 1VQ8Z 1Q861 3EEDA 3TDHB 3PO3S 1X3WA 3H3VJ 4A3LI 2QREB 1SFOI 3CCQZ 1KRLA 1YJNZ 1Q811 1VQO1 4MH4A 1KD11 2P28A 5D1OA 3QWUA 3PO2I 1TWFI 2V8KA 3CMA1 1Z02A 3VMIA 2OTJZ 3CCJZ 3CCU1 1JWHC 3CME1 4A3EI 1K731 4A3GI 4RS4A 2QEXZ 5T6BA 3F3FC 1W2BY 1M902 5IT9b 1ZB8A 4RVGA 1YIJ1 2VUGA 3NH4A 1JJ2Y 3EERA 3CC7Z 3CC4Z 5IP7I 3CPWY 1VQ91 2K5RA 3CCUZ 1YJWZ 5A2Qf 3VMGA 3GTMI 2G2KA 2E2JI 1QF8A 3I551 1Q7Y1 1DL6A 2NVTI 3GTPI 1I6HI 2WB1A 4MD9A 3CCLZ 1TWCI 1VQ6Z 2Y0SA 2AKLA 5C44I 3G6EZ 4BXXI 3J80b 3I4NI 4DQYB 3J7A4 1Z03A 1VQK1 1TFIA 2DE7A 4MD7A 3ESWA 4MXUA 2E2II 2RT9A 1WIIA 3F3PC 2JMOA 4A3FI 2R6MA 1KC81 2F4OA 3CC21 4NBCA 2DE5A 1ZB9A 5IT9f 2VUMI 3CCMZ 4E2YA 1KD12 4A3BI 4NB9A 4BY7I 3IFUA 3LUSA 1Z01A 1S7MA 3J81b 2R7ZI 3CCSZ 3FKII 3CC41 5FLXf 3CPWZ 2IZ4A 3G6E1 1Q821 2NVXI 1VQN1 2GTIA 5CM2M 4NB8A 4NBHA 1N8R1 4Y52I 1VQ4Z 2QA41 2BJOA 3G4SZ 4S1TA 3CMEZ 3S1MI 2YADA 3OW2Y 2JUBA 1VQ5Z 1RNIA 4CL1A 2W04A 1VQ41 1ZH1A 1VQP1 2B63I 2QA4Z 4A3II 3KIHA 1Q862 1S72Z 5D1PA 4HGZA 3CXCY 1LQLA 4NBBA 3G71Z 3I4MI 1VQ81 4E2ZA 3GTMS 3HOWI 3GKQA 3T4NB 4E32A 3GTKI 3CMAZ 3CQZI 4QTUA 3D6WA 3VB9A 1N2FA 3CCEZ 3HOYI 2OZKA 1QVFY 3GTQI 1K83I 1YJN1 1RO2A 3CCE1 1K732 3NDJA 3S15I 3FQMA 3GTLI 1L1OC 3CCV1 3S16I 3Q87A 5FLXb 2O53A 3MZLB 2RIQA 1QVGZ 4NBAA 3CCR1 2OTL1 4Y7NI 1Y1VI 4NFRA 1YI21 2QRCB 3D9XA 5D1OB 2E9HA 1RLYA 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  1M90 1;  1KQS Y;  1VQ8 Z;  1Q86 1;  1VQM 1;  1VQL 1;  3CXC Z;  3CCS Z;  3CC4 1;  3CPW Z;  3CC7 1;  1KQS Z;  1YHQ Z;  1NJI 2;  3CD6 1;  3CCQ Z;  1M1K 1;  3G6E 1;  1Q82 1;  1YJN Z;  1Q81 1;  1VQN 1;  1K8A 1;  1VQO 1;  1KD1 1;  1YIT 1;  1Q7Y 2;  1N8R 1;  1VQ4 Z;  3OW2 Z;  1VQN Z;  3CMA 1;  2QA4 1;  3G4S Z;  3I56 Z;  3CME Z;  2OTJ Z;  2QEX 1;  3CCJ Z;  3CCU 1;  3OW2 Y;  3CME 1;  1VQ5 Z;  3I56 1;  1M1K 2;  1K73 1;  2QEX Z;  3CCJ 1;  1VQ4 1;  1W2B Y;  1Q81 2;  2OTJ 1;  1VQP 1;  1M90 2;  1YIT Z;  3G4S 1;  1YJ9 1;  2QA4 Z;  1KC8 2;  1W2B Z;  1YJ9 Z;  1Q86 2;  1S72 Z;  1VQP Z;  1YIJ 1;  1VQ7 Z;  1YI2 Z;  1VQO Z;  1JJ2 Y;  3CXC Y;  3CC7 Z;  3CC4 Z;  3CPW Y;  1VQ9 1;  1VQ5 1;  1VQL Z;  3G71 Z;  3CCQ 1;  3CCU Z;  1YJW Z;  1VQ8 1;  1JJ2 Z;  3CCS 1;  3I55 1;  3CMA Z;  1Q7Y 1;  1N8R 2;  3CCV Z;  1QVF Z;  1VQK Z;  3CCL Z;  3CCE Z;  1QVF Y;  1VQ6 1;  3CCM 1;  1YJN 1;  1VQ6 Z;  3G6E Z;  1Q82 2;  3CCE 1;  3CCL 1;  1YHQ 1;  1K73 2;  3CD6 Z;  1K9M 1;  1VQK 1;  3CCV 1;  1VQM Z;  3I55 Z;  3CC2 Z;  1QVG Y;  1KC8 1;  3CC2 1;  1YJW 1;  3G71 1;  1QVG Z;  1VQ9 Z;  1NJI 1;  3CCR 1;  2OTL 1;  3CCR Z;  1YI2 1;  2OTL Z;  1YIJ Z;  1VQ7 1;  3CCM Z;  1K8A 2;  1S72 1;  1KD1 2; 
#chains in the Genus database with same CATH topology
 1K9M 2;  2QKD A;  2J6A A;  2W03 A;  4MON A;  1WW9 A;  3NH8 A;  1VQM 1;  2VF1 A;  1VLA A;  5C4J I;  3VMH A;  1TWA I;  3CXC Z;  1VQL 1;  4A3D I;  3CC7 1;  5T67 A;  2JA6 I;  1NJI 2;  3S1R I;  4MD8 A;  2OOX B;  2NVQ I;  1P9N A;  1Y1V S;  1Q16 A;  2JA8 I;  2O4H A;  4BBS I;  3OW2 Z;  2V8J A;  4A93 I;  4MRI A;  2NAP A;  3BG1 B;  4HH4 A;  2QLV B;  3I07 A;  4DGL A;  5C4X I;  3IX0 A;  3BG0 B;  3I56 1;  1M1K 2;  2RPR A;  3HOV I;  1PFT A;  2OTJ 1;  2E7Z A;  3S14 I;  4NBF A;  1YIT Z;  3G4S 1;  1YJ9 1;  2IZ3 A;  3RZD I;  4QTT A;  3GTO I;  3GTG I;  1YI2 Z;  3HKZ A;  2RBL A;  1X3Z A;  2RHB A;  3K7A I;  2E2H I;  1X0T A;  1USP A;  2ZAE B;  4RVD A;  2DE6 A;  3CCQ 1;  3JAM f;  2LFU A;  2JA7 I;  3RZO I;  3CCS 1;  1N8R 2;  3CCV Z;  1QVF Z;  4HGY A;  1VQK Z;  5C3E I;  2EGT A;  3FQQ A;  2YU9 I;  2OOY B;  3CCM 1;  4A3J I;  1YHQ 1;  3CD6 Z;  1I3Q I;  1K9M 1;  5AN9 F;  3MON A;  3GTJ I;  3I55 Z;  3CC2 Z;  1QVG Y;  5T64 A;  3G71 1;  2VPY A;  4RVH A;  1NJI 1;  3IF8 A;  3M3Y I;  3P5J B;  5IP9 I;  1YIJ Z;  3NH5 A;  1S72 1;  4RV9 A;  1M90 1;  4A3M I;  3GCF A;  3MZK B;  4E2W A;  2HU9 A;  4E2X A;  1TWG I;  3PO3 I;  3S17 I;  1I50 I;  4E33 A;  2KI7 B;  2R92 I;  3S2D I;  2Q4Z A;  1KQS Z;  2JA5 I;  1YHQ Z;  3CD6 1;  2HF1 A;  1M1K 1;  4TNU A;  2PK7 A;  3U50 C;  3VTN A;  1Y8C A;  2NVY I;  4XX2 A;  1K8A 1;  3J80 f;  1YIT 1;  1Q7Y 2;  1AA6 A;  4A3K I;  1VQN Z;  2Q51 A;  3I56 Z;  4NBE A;  1NUI A;  1Y1W I;  4X6A I;  2PMZ A;  2WAQ A;  3S1Q I;  2QEX 1;  2GTH A;  1FDI A;  4NH1 C;  3CCJ 1;  4AYB A;  1RQF A;  1Q81 2;  4NBD A;  4DK1 A;  1R9T I;  1KC8 2;  1W2B Z;  4BY1 I;  1WZN A;  2PM9 A;  1YJ9 Z;  1YUK A;  5FLM I;  1YUA A;  2JS4 A;  2M48 A;  3J81 f;  1VQ7 Z;  1VQP Z;  1VQO Z;  3HOU I;  3S1N I;  1TWH I;  1QYP A;  1VQ5 1;  1VQL Z;  2KPI A;  3S2H I;  2K3R A;  1JJ2 Z;  2JR6 A;  4RVF A;  2JIM A;  4E30 A;  3HOZ I;  2LIY A;  3HOX I;  2JNY A;  1USP B;  3TE5 B;  3M4O I;  2I3C A;  1RO4 A;  2QR1 B;  1VQ6 1;  1ML8 A;  4EWC A;  2M6N A;  1Q82 2;  3CCL 1;  3NDI A;  5A2Q b;  3JAM b;  2QRD B;  1VQM Z;  2P3Y A;  3KIF A;  1RO0 A;  5LL6 f;  1YJW 1;  2H85 A;  4A3C I;  1VQ9 Z;  1WJ2 A;  2F4M A;  3NFZ A;  2R93 I;  3CCR Z;  2OTL Z;  4BBR I;  1VQ7 1;  1K8A 2;  4NOZ A;  4E31 A;  3H0G I;  2V45 A;  2V8I A;  1WCM I;  2GU2 A;  1KQS Y;  4NBG A;  1VQ8 Z;  1Q86 1;  3EED A;  3TDH B;  3PO3 S;  1X3W A;  3H3V J;  4A3L I;  2JIP A;  2QRE B;  1SFO I;  3CCQ Z;  1KRL A;  2JIQ A;  1YJN Z;  1Q81 1;  1VQO 1;  4MH4 A;  1KD1 1;  3IR7 A;  3D2L A;  2JIR A;  2P28 A;  5D1O A;  3QWU A;  3PO2 I;  1TWF I;  2V8K A;  3CMA 1;  1Z02 A;  3VMI A;  2OTJ Z;  3CCJ Z;  3CCU 1;  1JWH C;  3CME 1;  4A3E I;  1K73 1;  4A3G I;  4RS4 A;  2QEX Z;  5T6B A;  3F3F C;  1W2B Y;  1M90 2;  5IT9 b;  1ZB8 A;  4RVG A;  1YIJ 1;  2VUG A;  3NH4 A;  1JJ2 Y;  3EER A;  3CC7 Z;  3CC4 Z;  5IP7 I;  3CPW Y;  1VQ9 1;  2K5R A;  3CCU Z;  1YJW Z;  5A2Q f;  3VMG A;  3GTM I;  2G2K A;  2E2J I;  1QF8 A;  3I55 1;  1Q7Y 1;  1DL6 A;  2NVT I;  3GTP I;  1I6H I;  2WB1 A;  4MD9 A;  3CCL Z;  2VPZ A;  1TWC I;  1VQ6 Z;  2Y0S A;  2AKL A;  5C44 I;  3G6E Z;  4BXX I;  3J80 b;  3I4N I;  4DQY B;  3J7A 4;  1Z03 A;  1VQK 1;  1TFI A;  2DE7 A;  4MD7 A;  3ESW A;  4MXU A;  2E2I I;  2RT9 A;  1WII A;  3F3P C;  2JMO A;  4A3F I;  2R6M A;  2IV2 X;  1KC8 1;  2F4O A;  3CC2 1;  4NBC A;  2DE5 A;  1ZB9 A;  5IT9 f;  1QXF A;  2VUM I;  3CCM Z;  4E2Y A;  2AYD A;  1KD1 2;  4A3B I;  4NB9 A;  1SIW A;  4BY7 I;  2LEX A;  3IFU A;  3LUS A;  1Z01 A;  2JIO A;  1S7M A;  3J81 b;  2R7Z I;  3CCS Z;  3FKI I;  3CC4 1;  5FLX f;  3CPW Z;  2IZ4 A;  3G6E 1;  1Q82 1;  2NVX I;  2VPW A;  1VQN 1;  2GTI A;  5CM2 M;  4NB8 A;  2VPX A;  4NBH A;  1N8R 1;  4Y52 I;  1VQ4 Z;  2QA4 1;  2BJO A;  3G4S Z;  4S1T A;  3CME Z;  3S1M I;  2YAD A;  3OW2 Y;  2JUB A;  1VQ5 Z;  1RNI A;  4CL1 A;  2W04 A;  1VQ4 1;  1ZH1 A;  1VQP 1;  2B63 I;  2QA4 Z;  4A3I I;  3KIH A;  1Q86 2;  1S72 Z;  5D1P A;  4HGZ A;  3CXC Y;  1LQL A;  4NBB A;  3G71 Z;  3I4M I;  1VQ8 1;  4E2Z A;  2V3V A;  3GTM S;  3HOW I;  3GKQ A;  3T4N B;  4E32 A;  3GTK I;  3CMA Z;  3CQZ I;  4QTU A;  3D6W A;  3VB9 A;  1N2F A;  3CCE Z;  3HOY I;  2OZK A;  1QVF Y;  3GTQ I;  1K83 I;  1YJN 1;  1RO2 A;  3CCE 1;  1K73 2;  3NDJ A;  3S15 I;  3FQM A;  3GTL I;  1L1O C;  3CCV 1;  3S16 I;  3Q87 A;  5FLX b;  2O53 A;  3MZL B;  2RIQ A;  1QVG Z;  4NBA A;  3CCR 1;  2OTL 1;  4Y7N I;  1Y1V I;  4NFR A;  1YI2 1;  2QRC B;  1FDO A;  3D9X A;  5D1O B;  2E9H A;  1RLY A;  1NP6 A; 
#chains in the Genus database with same CATH homology
 1K9M 2;  2QKD A;  2J6A A;  2W03 A;  4MON A;  1WW9 A;  3NH8 A;  1VQM 1;  2VF1 A;  1VLA A;  5C4J I;  3VMH A;  1TWA I;  3CXC Z;  1VQL 1;  4A3D I;  3CC7 1;  5T67 A;  2JA6 I;  1NJI 2;  3S1R I;  4MD8 A;  2OOX B;  2NVQ I;  1P9N A;  1Y1V S;  2JA8 I;  2O4H A;  4BBS I;  3OW2 Z;  2V8J A;  4A93 I;  4MRI A;  3BG1 B;  4HH4 A;  2QLV B;  3I07 A;  4DGL A;  5C4X I;  3IX0 A;  3BG0 B;  3I56 1;  1M1K 2;  2RPR A;  3HOV I;  1PFT A;  2OTJ 1;  3S14 I;  4NBF A;  1YIT Z;  3G4S 1;  1YJ9 1;  2IZ3 A;  3RZD I;  4QTT A;  3GTO I;  3GTG I;  1YI2 Z;  3HKZ A;  2RBL A;  1X3Z A;  2RHB A;  3K7A I;  2E2H I;  1X0T A;  1USP A;  2ZAE B;  4RVD A;  2DE6 A;  3CCQ 1;  3JAM f;  2LFU A;  2JA7 I;  3RZO I;  3CCS 1;  1N8R 2;  3CCV Z;  1QVF Z;  4HGY A;  1VQK Z;  5C3E I;  2EGT A;  3FQQ A;  2YU9 I;  2OOY B;  3CCM 1;  4A3J I;  1YHQ 1;  3CD6 Z;  1I3Q I;  1K9M 1;  5AN9 F;  3MON A;  3GTJ I;  3I55 Z;  3CC2 Z;  1QVG Y;  5T64 A;  3G71 1;  4RVH A;  1NJI 1;  3IF8 A;  3M3Y I;  3P5J B;  5IP9 I;  1YIJ Z;  3NH5 A;  1S72 1;  4RV9 A;  1M90 1;  4A3M I;  3GCF A;  3MZK B;  4E2W A;  2HU9 A;  4E2X A;  1TWG I;  3PO3 I;  3S17 I;  1I50 I;  4E33 A;  2KI7 B;  2R92 I;  3S2D I;  2Q4Z A;  1KQS Z;  2JA5 I;  1YHQ Z;  3CD6 1;  2HF1 A;  1M1K 1;  4TNU A;  2PK7 A;  3U50 C;  3VTN A;  4XX2 A;  2NVY I;  1K8A 1;  3J80 f;  1YIT 1;  1Q7Y 2;  4A3K I;  1VQN Z;  2Q51 A;  3I56 Z;  4NBE A;  1NUI A;  1Y1W I;  4X6A I;  2PMZ A;  2WAQ A;  3S1Q I;  2QEX 1;  2GTH A;  4NH1 C;  3CCJ 1;  4AYB A;  1RQF A;  1Q81 2;  4NBD A;  4DK1 A;  1R9T I;  1KC8 2;  1W2B Z;  4BY1 I;  2PM9 A;  1YJ9 Z;  1YUK A;  5FLM I;  2M48 A;  1VQP Z;  2JS4 A;  1YUA A;  3J81 f;  1VQ7 Z;  1VQO Z;  3HOU I;  3S1N I;  1TWH I;  1QYP A;  1VQ5 1;  1VQL Z;  2KPI A;  3S2H I;  2K3R A;  1JJ2 Z;  2JR6 A;  4RVF A;  4E30 A;  3HOZ I;  2LIY A;  3HOX I;  2JNY A;  1USP B;  3TE5 B;  3M4O I;  2I3C A;  1RO4 A;  2QR1 B;  1VQ6 1;  1ML8 A;  4EWC A;  2M6N A;  1Q82 2;  3CCL 1;  3NDI A;  5A2Q b;  3JAM b;  2QRD B;  1VQM Z;  2P3Y A;  3KIF A;  1RO0 A;  5LL6 f;  1YJW 1;  2H85 A;  4A3C I;  1VQ9 Z;  2F4M A;  3NFZ A;  2R93 I;  3CCR Z;  2OTL Z;  4BBR I;  1VQ7 1;  1K8A 2;  4NOZ A;  4E31 A;  3H0G I;  2V8I A;  1WCM I;  2GU2 A;  1KQS Y;  4NBG A;  1VQ8 Z;  1Q86 1;  3EED A;  3TDH B;  3PO3 S;  1X3W A;  3H3V J;  4A3L I;  2QRE B;  1SFO I;  3CCQ Z;  1KRL A;  1YJN Z;  1Q81 1;  1VQO 1;  4MH4 A;  1KD1 1;  2P28 A;  5D1O A;  3QWU A;  3PO2 I;  1TWF I;  2V8K A;  3CMA 1;  1Z02 A;  3VMI A;  2OTJ Z;  3CCJ Z;  3CCU 1;  1JWH C;  3CME 1;  4A3E I;  1K73 1;  4A3G I;  4RS4 A;  2QEX Z;  5T6B A;  3F3F C;  1W2B Y;  1M90 2;  5IT9 b;  1ZB8 A;  4RVG A;  1YIJ 1;  2VUG A;  3NH4 A;  1JJ2 Y;  3EER A;  3CC7 Z;  3CC4 Z;  5IP7 I;  3CPW Y;  1VQ9 1;  2K5R A;  3CCU Z;  1YJW Z;  5A2Q f;  3VMG A;  3GTM I;  2G2K A;  2E2J I;  1QF8 A;  3I55 1;  1Q7Y 1;  1DL6 A;  2NVT I;  3GTP I;  1I6H I;  2WB1 A;  4MD9 A;  3CCL Z;  1TWC I;  1VQ6 Z;  2Y0S A;  2AKL A;  5C44 I;  3G6E Z;  4BXX I;  3J80 b;  3I4N I;  4DQY B;  3J7A 4;  1Z03 A;  1VQK 1;  1TFI A;  2DE7 A;  4MD7 A;  3ESW A;  4MXU A;  2E2I I;  2RT9 A;  1WII A;  3F3P C;  2JMO A;  4A3F I;  2R6M A;  1KC8 1;  2F4O A;  3CC2 1;  4NBC A;  2DE5 A;  1ZB9 A;  5IT9 f;  2VUM I;  3CCM Z;  4E2Y A;  1KD1 2;  4A3B I;  4NB9 A;  4BY7 I;  3IFU A;  3LUS A;  1Z01 A;  1S7M A;  3J81 b;  2R7Z I;  3CCS Z;  3FKI I;  3CC4 1;  5FLX f;  3CPW Z;  2IZ4 A;  3G6E 1;  1Q82 1;  2NVX I;  1VQN 1;  2GTI A;  5CM2 M;  4NB8 A;  4NBH A;  1N8R 1;  4Y52 I;  1VQ4 Z;  2QA4 1;  2BJO A;  3G4S Z;  4S1T A;  3CME Z;  3S1M I;  2YAD A;  3OW2 Y;  2JUB A;  1VQ5 Z;  1RNI A;  4CL1 A;  2W04 A;  1VQ4 1;  1ZH1 A;  1VQP 1;  2B63 I;  2QA4 Z;  4A3I I;  3KIH A;  1Q86 2;  1S72 Z;  5D1P A;  4HGZ A;  3CXC Y;  1LQL A;  4NBB A;  3G71 Z;  3I4M I;  1VQ8 1;  4E2Z A;  3GTM S;  3HOW I;  3GKQ A;  3T4N B;  4E32 A;  3GTK I;  3CMA Z;  3CQZ I;  4QTU A;  3D6W A;  3VB9 A;  1N2F A;  3CCE Z;  3HOY I;  2OZK A;  1QVF Y;  3GTQ I;  1K83 I;  1YJN 1;  1RO2 A;  3CCE 1;  1K73 2;  3NDJ A;  3S15 I;  3FQM A;  3GTL I;  1L1O C;  3CCV 1;  3S16 I;  3Q87 A;  5FLX b;  2O53 A;  3MZL B;  2RIQ A;  1QVG Z;  4NBA A;  3CCR 1;  2OTL 1;  4Y7N I;  1Y1V I;  4NFR A;  1YI2 1;  2QRC B;  3D9X A;  5D1O B;  2E9H A;  1RLY A;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...