1VQKZ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqkZ00
3OW2Y 1QVGY 3CMEZ 3CXCZ 3CME1 1M1K1 1VQ6Z 3CCJZ 1VQ61 1VQ9Z 3CCJ1 3CC4Z 3CC41 1K732 2QEXZ 3CCEZ 3G6E1 1VQP1 3CC7Z 1VQMZ 2QA41 2QEX1 3CCE1 3CC71 1VQM1 1YJ9Z 1YJ91 1M901 3CPWY 1YJN1 1VQLZ 1N8R1 1KC81 1VQL1 1K8A2 3CCQZ 1K9M2 2OTJZ 1Q812 1S72Z 3CCQ1 2OTJ1 3CXCY 3CCMZ 1YITZ 1W2BZ 3CCM1 1VQOZ 1YIT1 1VQKZ 1VQO1 1VQK1 1VQ4Z 1VQ41 1K8A1 3CCUZ 1Q811 1VQ91 1VQ8Z 1VQ81 1JJ2Z 3G4SZ 1Q862 3G4S1 1K731 3CCRZ 3CCR1 1QVGZ 3CC2Z 1Q822 3CC21 1W2BY 1Q7Y2 1S721 1YI2Z 1KD12 1YIJZ 1YHQZ 1KQSZ 1YIJ1 1YHQ1 1QVFZ 3CCSZ 1NJI2 1Q821 1K9M1 3CCS1 3CCU1 3CCLZ 1JJ2Y 3CCL1 1M1K2 1NJI1 1VQNZ 1VQN1 2OTLZ 3OW2Z 3I55Z 3CCVZ 2OTL1 3I551 3CCV1 3G71Z 1Q861 3G711 3I56Z 1KQSY 3CD6Z 3I561 1YI21 1QVFY 3G6EZ 1VQPZ 3CD61 1M902 2QA4Z 1VQ7Z 1N8R2 1VQ71 1KC82 1Q7Y1 1VQ5Z 1VQ51 1KD11 1YJNZ 3CMAZ 1YJWZ 3CMA1 3CPWZ 1YJW1
chains in the Genus database with same CATH superfamily
1QVGY 2JA6I 2BJOA 4A3KI 3GCFA 3NH5A 2I3CA 4A3GI 3PO2I 4MD7A 2NAPA 3CC4Z 4NOZA 3CC41 3S14I 4NB8A 3CC7Z 3CC71 2JIRA 5C4JI 2OZKA 1DL6A 2JA8I 2VPWA 4BY1I 2O4HA 1I6HI 1K8A2 3CCQZ 2OTJZ 5IT9b 1Q812 1S72Z 2OOXB 3CCQ1 2OTJ1 1RLYA 3CXCY 1W2BZ 1VLAA 1VQ4Z 3KIHA 1VQ41 1K8A1 3S15I 1Q811 3CQZI 3HOZI 3H3VJ 4NBBA 4RVGA 1S7MA 2W03A 3T4NB 2NVQI 2F4OA 1RNIA 1TWGI 1I50I 3CCRZ 3FQMA 3CCR1 4HGZA 3P5JB 3CC2Z 4NBAA 1Q822 3CC21 3J7A4 3S1MI 2DE5A 5T6BA 4A93I 1YIJZ 1YIJ1 2KI7B 2VPZA 3QWUA 1TFIA 4NB9A 1X3WA 2PK7A 4DK1A 1Q821 3BG0B 3CCU1 3J81b 3S1RI 2QREB 4AYBA 4NFRA 1FDIA 1Q861 2Q51A 2E2HI 3CD6Z 2IZ4A 3CD61 2HF1A 2QA4Z 1Q16A 1VQ7Z 3NDJA 1VQ71 1KC82 5A2Qb 1WZNA 1Q7Y1 1TWFI 2VPXA 2Q4ZA 4CL1A 1YJWZ 3VB9A 3VMHA 1YJW1 2KPIA 5AN9F 4E2WA 3JAMf 2QR1B 4NBDA 2JIPA 3CMEZ 3HKZA 1X0TA 5D1OB 3CME1 1M1K1 1RO0A 2NVTI 1VQ6Z 3CCJZ 3PO3S 1VQ61 1VQ9Z 3CCJ1 3IX0A 4BXXI 1K732 3G6E1 1VQP1 4RVDA 3M4OI 2M6NA 3EERA 3CPWY 3FQQA 1YJN1 1Z01A 1N8R1 3S17I 3D2LA 4DGLA 1K9M2 4NBFA 1QYPA 1RO2A 3GTKI 3IFUA 3IF8A 4TNUA 1NP6A 1ZB9A 2RIQA 1JJ2Z 3S1NI 4RV9A 2IV2X 1WCMI 2JUBA 3MONA 1QVGZ 2QLVB 1Z03A 1W2BY 1S721 3S16I 1KD12 1Y1WI 2QRDB 2B63I 1QVFZ 3HOVI 3PO3I 1KRLA 2V8KA 2JR6A 2V8JA 3F3FC 3RZOI 2VPYA 1R9TI 3F3PC 3FKII 2V45A 2Y0SA 2OTLZ 3OW2Z 3CCVZ 2OTL1 3CCV1 1JWHC 4MRIA 3G71Z 2R7ZI 2PMZA 3G711 3J80f 3GTQI 4HH4A 4NBHA 1X3ZA 1PFTA 2WB1A 1M902 3HOWI 5T67A 4E33A 3LUSA 5FLMI 1VQ5Z 3D9XA 2V8IA 1VQ51 3GTPI 2LFUA 3Q87A 3D6WA 2H85A 3RZDI 5C3EI 2QRCB 4QTUA 2GU2A 2JIMA 2WAQA 3MZKB 4MXUA 2V3VA 3I07A 3U50C 1ML8A 4MD8A 1VQMZ 2QA41 1Z02A 1VQM1 3GTLI 1YJ9Z 4A3DI 1YJ91 2K5RA 4A3CI 4XX2A 5A2Qf 2JIQA 1KC81 1LQLA 1WW9A 4A3MI 3K7AI 3CCMZ 4E30A 2P3YA 3VMIA 3CCM1 1VQOZ 4MONA 1TWHI 1VQO1 2R92I 3GTOI 2AKLA 4E31A 1VQ91 2YADA 4A3BI 3JAMb 3G4SZ 5FLXf 3G4S1 4BBSI 3S2HI 2DE6A 1USPB 2GTIA 1K731 1Y8CA 4A3LI 2PM9A 1SFOI 2LEXA 1YI2Z 2F4MA 5D1OA 1YHQZ 4Y52I 1KQSZ 1YHQ1 1NJI2 3TDHB 3TE5B 1K9M1 3CCLZ 1JJ2Y 3CCL1 3NH8A 1SIWA 2JNYA 2JMOA 1NJI1 1USPA 4BY7I 3I55Z 3I551 4E32A 2VUGA 2RHBA 4S1TA 1QVFY 5IT9f 2YU9I 2NVYI 2EGTA 3GTJI 1KD11 4NBCA 4NBEA 4BBRI 3GTGI 1L1OC 2JS4A 1QXFA 4A3FI 3OW2Y 3VMGA 5C44I 2E2JI 5C4XI 2JIOA 3CXCZ 3HOXI 4E2ZA 1YUAA 1NUIA 5T64A 3HOUI 4MH4A 2LIYA 2QEXZ 4NBGA 3CCEZ 4A3II 2QEX1 3CCE1 2JA7I 1N2FA 4RS4A 4A3JI 1QF8A 1AA6A 4E2YA 2E7ZA 3J80b 1M901 3GKQA 4NH1C 1VQLZ 3J81f 2RPRA 1VQL1 5IP9I 3EEDA 4EWCA 2OOYB 2RBLA 4RVFA 3NFZA 2DE7A 2IZ3A 1YITZ 1YIT1 4E2XA 1VQKZ 4A3EI 1VQK1 1Y1VS 3H0GI 5D1PA 2ZAEB 3CCUZ 2HU9A 2P28A 3ESWA 3M3YI 1VQ8Z 1VQ81 5CM2M 1RQFA 1Q862 3HOYI 2O53A 1TWAI 3GTMS 2J6AA 3MZLB 2AYDA 3VTNA 1TWCI 1FDOA 4RVHA 1P9NA 2M48A 2K3RA 2R93I 3S1QI 1Q7Y2 1ZB8A 3I4NI 2QKDA 3NH4A 4HGYA 3NDIA 2W04A 1RO4A 3IR7A 3CCSZ 3CCS1 1I3QI 2JA5I 5LL6f 4X6AI 1ZH1A 1WIIA 3KIFA 4DQYB 1M1K2 1YUKA 2G2KA 1VQNZ 2VF1A 4QTTA 1VQN1 4Y7NI 4MD9A 2E2II 2R6MA 3GTMI 3I56Z 2RT9A 2NVXI 1KQSY 3I561 5FLXb 1YI21 3G6EZ 1VQPZ 3I4MI 1Y1VI 1N8R2 3S2DI 1WJ2A 1K83I 2GTHA 3BG1B 1YJNZ 3CMAZ 3CMA1 2E9HA 2VUMI 3CPWZ 5IP7I
chains in the Genus database with same CATH topology
1QVGY 2JA6I 2BJOA 4A3KI 3GCFA 3NH5A 2I3CA 4A3GI 3PO2I 4MD7A 3CC4Z 4NOZA 3CC41 3S14I 4NB8A 3CC7Z 3CC71 5C4JI 2OZKA 1DL6A 2JA8I 4BY1I 2O4HA 1I6HI 1K8A2 3CCQZ 2OTJZ 5IT9b 1Q812 1S72Z 2OOXB 3CCQ1 2OTJ1 1RLYA 3CXCY 1W2BZ 1VLAA 1VQ4Z 3KIHA 1VQ41 1K8A1 3S15I 1Q811 3CQZI 3HOZI 3H3VJ 4NBBA 4RVGA 1S7MA 2W03A 3T4NB 2NVQI 2F4OA 1RNIA 1TWGI 1I50I 3CCRZ 3FQMA 3CCR1 4HGZA 3P5JB 3CC2Z 4NBAA 1Q822 3CC21 3J7A4 3S1MI 2DE5A 5T6BA 4A93I 1YIJZ 1YIJ1 2KI7B 3QWUA 4NB9A 1TFIA 1X3WA 2PK7A 4DK1A 1Q821 3BG0B 3CCU1 3J81b 3S1RI 2QREB 4AYBA 4NFRA 1Q861 2Q51A 2E2HI 3CD6Z 2IZ4A 3CD61 2HF1A 2QA4Z 1VQ7Z 3NDJA 1VQ71 1KC82 5A2Qb 1Q7Y1 1TWFI 2Q4ZA 4CL1A 1YJWZ 3VB9A 3VMHA 1YJW1 2KPIA 5AN9F 4E2WA 3JAMf 2QR1B 4NBDA 3CMEZ 3HKZA 1X0TA 5D1OB 3CME1 1M1K1 1RO0A 2NVTI 1VQ6Z 3CCJZ 3PO3S 1VQ61 1VQ9Z 3CCJ1 3IX0A 4BXXI 1K732 3G6E1 1VQP1 4RVDA 3M4OI 2M6NA 3EERA 3CPWY 3FQQA 1YJN1 1Z01A 1N8R1 3S17I 4DGLA 1K9M2 4NBFA 1QYPA 1RO2A 3GTKI 3IFUA 3IF8A 4TNUA 1NP6A 1ZB9A 2RIQA 1JJ2Z 3S1NI 4RV9A 1WCMI 2JUBA 3MONA 1QVGZ 2QLVB 1Z03A 1W2BY 1S721 3S16I 1KD12 1Y1WI 2QRDB 2B63I 1QVFZ 3HOVI 3PO3I 1KRLA 2V8KA 2JR6A 2V8JA 3F3FC 3RZOI 1R9TI 3F3PC 3FKII 2Y0SA 2OTLZ 3OW2Z 3CCVZ 2OTL1 3CCV1 1JWHC 4MRIA 3G71Z 2R7ZI 2PMZA 3G711 3J80f 3GTQI 4HH4A 4NBHA 1X3ZA 1PFTA 2WB1A 1M902 3HOWI 5T67A 4E33A 3LUSA 5FLMI 1VQ5Z 3D9XA 2V8IA 1VQ51 3GTPI 2LFUA 3Q87A 3D6WA 2H85A 3RZDI 5C3EI 2QRCB 4QTUA 2GU2A 2WAQA 3MZKB 4MXUA 3I07A 3U50C 1ML8A 4MD8A 1VQMZ 2QA41 1Z02A 1VQM1 3GTLI 1YJ9Z 4A3DI 1YJ91 2K5RA 4A3CI 4XX2A 5A2Qf 1KC81 1LQLA 1WW9A 4A3MI 3K7AI 3CCMZ 4E30A 2P3YA 3VMIA 3CCM1 1VQOZ 4MONA 1TWHI 1VQO1 2R92I 3GTOI 2AKLA 4E31A 1VQ91 2YADA 4A3BI 3JAMb 3G4SZ 5FLXf 3G4S1 4BBSI 3S2HI 2DE6A 1USPB 2GTIA 1K731 4A3LI 2PM9A 1SFOI 1YI2Z 2F4MA 5D1OA 1YHQZ 4Y52I 1KQSZ 1YHQ1 1NJI2 3TDHB 3TE5B 1K9M1 3CCLZ 1JJ2Y 3CCL1 3NH8A 2JNYA 2JMOA 1NJI1 1USPA 4BY7I 3I55Z 3I551 4E32A 2VUGA 2RHBA 4S1TA 1QVFY 5IT9f 2YU9I 2NVYI 2EGTA 3GTJI 1KD11 4NBCA 4NBEA 4BBRI 3GTGI 1L1OC 2JS4A 4A3FI 3OW2Y 3VMGA 5C44I 2E2JI 5C4XI 3CXCZ 3HOXI 4E2ZA 1YUAA 1NUIA 5T64A 3HOUI 4MH4A 2LIYA 2QEXZ 4NBGA 3CCEZ 4A3II 2QEX1 3CCE1 2JA7I 1N2FA 4RS4A 4A3JI 1QF8A 4E2YA 3J80b 1M901 3GKQA 4NH1C 1VQLZ 3J81f 2RPRA 1VQL1 5IP9I 3EEDA 4EWCA 2OOYB 2RBLA 4RVFA 3NFZA 2DE7A 2IZ3A 1YITZ 1YIT1 4E2XA 1VQKZ 4A3EI 1VQK1 1Y1VS 3H0GI 5D1PA 2ZAEB 3CCUZ 2HU9A 2P28A 3ESWA 3M3YI 1VQ8Z 1VQ81 5CM2M 1RQFA 1Q862 3HOYI 2O53A 1TWAI 3GTMS 2J6AA 3MZLB 3VTNA 1TWCI 4RVHA 1P9NA 2M48A 2K3RA 2R93I 3S1QI 1Q7Y2 1ZB8A 3I4NI 2QKDA 3NH4A 4HGYA 3NDIA 2W04A 1RO4A 3CCSZ 3CCS1 1I3QI 2JA5I 5LL6f 4X6AI 1ZH1A 1WIIA 3KIFA 4DQYB 1M1K2 1YUKA 2G2KA 1VQNZ 2VF1A 4QTTA 1VQN1 4Y7NI 4MD9A 2E2II 2R6MA 3GTMI 3I56Z 2RT9A 2NVXI 1KQSY 3I561 5FLXb 1YI21 3G6EZ 1VQPZ 3I4MI 1Y1VI 1N8R2 3S2DI 1K83I 2GTHA 3BG1B 1YJNZ 3CMAZ 3CMA1 2E9HA 2VUMI 3CPWZ 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Y;  1QVG Y;  3CME Z;  3CXC Z;  3CME 1;  1M1K 1;  1VQ6 Z;  3CCJ Z;  1VQ6 1;  1VQ9 Z;  3CCJ 1;  3CC4 Z;  3CC4 1;  1K73 2;  2QEX Z;  3CCE Z;  3G6E 1;  1VQP 1;  3CC7 Z;  1VQM Z;  2QA4 1;  2QEX 1;  3CCE 1;  3CC7 1;  1VQM 1;  1YJ9 Z;  1YJ9 1;  1M90 1;  3CPW Y;  1YJN 1;  1VQL Z;  1N8R 1;  1KC8 1;  1VQL 1;  1K8A 2;  3CCQ Z;  1K9M 2;  2OTJ Z;  1Q81 2;  1S72 Z;  3CCQ 1;  2OTJ 1;  3CXC Y;  3CCM Z;  1YIT Z;  1W2B Z;  3CCM 1;  1VQO Z;  1YIT 1;  1VQK Z;  1VQO 1;  1VQK 1;  1VQ4 Z;  1VQ4 1;  1K8A 1;  3CCU Z;  1Q81 1;  1VQ9 1;  1VQ8 Z;  1VQ8 1;  1JJ2 Z;  3G4S Z;  1Q86 2;  3G4S 1;  1K73 1;  3CCR Z;  3CCR 1;  1QVG Z;  3CC2 Z;  1Q82 2;  3CC2 1;  1W2B Y;  1Q7Y 2;  1S72 1;  1YI2 Z;  1KD1 2;  1YIJ Z;  1YHQ Z;  1KQS Z;  1YIJ 1;  1YHQ 1;  1QVF Z;  3CCS Z;  1NJI 2;  1Q82 1;  1K9M 1;  3CCS 1;  3CCU 1;  3CCL Z;  1JJ2 Y;  3CCL 1;  1M1K 2;  1NJI 1;  1VQN Z;  1VQN 1;  2OTL Z;  3OW2 Z;  3I55 Z;  3CCV Z;  2OTL 1;  3I55 1;  3CCV 1;  3G71 Z;  1Q86 1;  3G71 1;  3I56 Z;  1KQS Y;  3CD6 Z;  3I56 1;  1YI2 1;  1QVF Y;  3G6E Z;  1VQP Z;  3CD6 1;  1M90 2;  2QA4 Z;  1VQ7 Z;  1N8R 2;  1VQ7 1;  1KC8 2;  1Q7Y 1;  1VQ5 Z;  1VQ5 1;  1KD1 1;  1YJN Z;  3CMA Z;  1YJW Z;  3CMA 1;  3CPW Z;  1YJW 1; 
#chains in the Genus database with same CATH topology
 1QVG Y;  2JA6 I;  2BJO A;  4A3K I;  3GCF A;  3NH5 A;  2I3C A;  4A3G I;  3PO2 I;  4MD7 A;  2NAP A;  3CC4 Z;  4NOZ A;  3CC4 1;  3S14 I;  4NB8 A;  3CC7 Z;  3CC7 1;  2JIR A;  5C4J I;  2OZK A;  1DL6 A;  2JA8 I;  2VPW A;  4BY1 I;  2O4H A;  1I6H I;  1K8A 2;  3CCQ Z;  2OTJ Z;  5IT9 b;  1Q81 2;  1S72 Z;  2OOX B;  3CCQ 1;  2OTJ 1;  1RLY A;  3CXC Y;  1W2B Z;  1VLA A;  1VQ4 Z;  3KIH A;  1VQ4 1;  1K8A 1;  3S15 I;  1Q81 1;  3CQZ I;  3HOZ I;  3H3V J;  4NBB A;  4RVG A;  1S7M A;  2W03 A;  3T4N B;  2NVQ I;  2F4O A;  1RNI A;  1TWG I;  1I50 I;  3CCR Z;  3FQM A;  3CCR 1;  4HGZ A;  3P5J B;  3CC2 Z;  4NBA A;  1Q82 2;  3CC2 1;  3J7A 4;  3S1M I;  2DE5 A;  5T6B A;  4A93 I;  1YIJ Z;  1YIJ 1;  2KI7 B;  2VPZ A;  3QWU A;  1TFI A;  4NB9 A;  1X3W A;  2PK7 A;  4DK1 A;  1Q82 1;  3BG0 B;  3CCU 1;  3J81 b;  3S1R I;  2QRE B;  4AYB A;  4NFR A;  1FDI A;  1Q86 1;  2Q51 A;  2E2H I;  3CD6 Z;  2IZ4 A;  3CD6 1;  2HF1 A;  2QA4 Z;  1Q16 A;  1VQ7 Z;  3NDJ A;  1VQ7 1;  1KC8 2;  5A2Q b;  1WZN A;  1Q7Y 1;  1TWF I;  2VPX A;  2Q4Z A;  4CL1 A;  1YJW Z;  3VB9 A;  3VMH A;  1YJW 1;  2KPI A;  5AN9 F;  4E2W A;  3JAM f;  2QR1 B;  4NBD A;  2JIP A;  3CME Z;  3HKZ A;  1X0T A;  5D1O B;  3CME 1;  1M1K 1;  1RO0 A;  2NVT I;  1VQ6 Z;  3CCJ Z;  3PO3 S;  1VQ6 1;  1VQ9 Z;  3CCJ 1;  3IX0 A;  4BXX I;  1K73 2;  3G6E 1;  1VQP 1;  4RVD A;  3M4O I;  2M6N A;  3EER A;  3CPW Y;  3FQQ A;  1YJN 1;  1Z01 A;  1N8R 1;  3S17 I;  3D2L A;  4DGL A;  1K9M 2;  4NBF A;  1QYP A;  1RO2 A;  3GTK I;  3IFU A;  3IF8 A;  4TNU A;  1NP6 A;  1ZB9 A;  2RIQ A;  1JJ2 Z;  3S1N I;  4RV9 A;  2IV2 X;  1WCM I;  2JUB A;  3MON A;  1QVG Z;  2QLV B;  1Z03 A;  1W2B Y;  1S72 1;  3S16 I;  1KD1 2;  1Y1W I;  2QRD B;  2B63 I;  1QVF Z;  3HOV I;  3PO3 I;  1KRL A;  2V8K A;  2JR6 A;  2V8J A;  3F3F C;  3RZO I;  2VPY A;  1R9T I;  3F3P C;  3FKI I;  2V45 A;  2Y0S A;  2OTL Z;  3OW2 Z;  3CCV Z;  2OTL 1;  3CCV 1;  1JWH C;  4MRI A;  3G71 Z;  2R7Z I;  2PMZ A;  3G71 1;  3J80 f;  3GTQ I;  4HH4 A;  4NBH A;  1X3Z A;  1PFT A;  2WB1 A;  1M90 2;  3HOW I;  5T67 A;  4E33 A;  3LUS A;  5FLM I;  1VQ5 Z;  3D9X A;  2V8I A;  1VQ5 1;  3GTP I;  2LFU A;  3Q87 A;  3D6W A;  2H85 A;  3RZD I;  5C3E I;  2QRC B;  4QTU A;  2GU2 A;  2JIM A;  2WAQ A;  3MZK B;  4MXU A;  2V3V A;  3I07 A;  3U50 C;  1ML8 A;  4MD8 A;  1VQM Z;  2QA4 1;  1Z02 A;  1VQM 1;  3GTL I;  1YJ9 Z;  4A3D I;  1YJ9 1;  2K5R A;  4A3C I;  4XX2 A;  5A2Q f;  2JIQ A;  1KC8 1;  1LQL A;  1WW9 A;  4A3M I;  3K7A I;  3CCM Z;  4E30 A;  2P3Y A;  3VMI A;  3CCM 1;  1VQO Z;  4MON A;  1TWH I;  1VQO 1;  2R92 I;  3GTO I;  2AKL A;  4E31 A;  1VQ9 1;  2YAD A;  4A3B I;  3JAM b;  3G4S Z;  5FLX f;  3G4S 1;  4BBS I;  3S2H I;  2DE6 A;  1USP B;  2GTI A;  1K73 1;  1Y8C A;  4A3L I;  2PM9 A;  1SFO I;  2LEX A;  1YI2 Z;  2F4M A;  5D1O A;  1YHQ Z;  4Y52 I;  1KQS Z;  1YHQ 1;  1NJI 2;  3TDH B;  3TE5 B;  1K9M 1;  3CCL Z;  1JJ2 Y;  3CCL 1;  3NH8 A;  1SIW A;  2JNY A;  2JMO A;  1NJI 1;  1USP A;  4BY7 I;  3I55 Z;  3I55 1;  4E32 A;  2VUG A;  2RHB A;  4S1T A;  1QVF Y;  5IT9 f;  2YU9 I;  2NVY I;  2EGT A;  3GTJ I;  1KD1 1;  4NBC A;  4NBE A;  4BBR I;  3GTG I;  1L1O C;  2JS4 A;  1QXF A;  4A3F I;  3OW2 Y;  3VMG A;  5C44 I;  2E2J I;  5C4X I;  2JIO A;  3CXC Z;  3HOX I;  4E2Z A;  1YUA A;  1NUI A;  5T64 A;  3HOU I;  4MH4 A;  2LIY A;  2QEX Z;  4NBG A;  3CCE Z;  4A3I I;  2QEX 1;  3CCE 1;  2JA7 I;  1N2F A;  4RS4 A;  4A3J I;  1QF8 A;  1AA6 A;  4E2Y A;  2E7Z A;  3J80 b;  1M90 1;  3GKQ A;  4NH1 C;  1VQL Z;  3J81 f;  2RPR A;  1VQL 1;  5IP9 I;  3EED A;  4EWC A;  2OOY B;  2RBL A;  4RVF A;  3NFZ A;  2DE7 A;  2IZ3 A;  1YIT Z;  1YIT 1;  4E2X A;  1VQK Z;  4A3E I;  1VQK 1;  1Y1V S;  3H0G I;  5D1P A;  2ZAE B;  3CCU Z;  2HU9 A;  2P28 A;  3ESW A;  3M3Y I;  1VQ8 Z;  1VQ8 1;  5CM2 M;  1RQF A;  1Q86 2;  3HOY I;  2O53 A;  1TWA I;  3GTM S;  2J6A A;  3MZL B;  2AYD A;  3VTN A;  1TWC I;  1FDO A;  4RVH A;  1P9N A;  2M48 A;  2K3R A;  2R93 I;  3S1Q I;  1Q7Y 2;  1ZB8 A;  3I4N I;  2QKD A;  3NH4 A;  4HGY A;  3NDI A;  2W04 A;  1RO4 A;  3IR7 A;  3CCS Z;  3CCS 1;  1I3Q I;  2JA5 I;  5LL6 f;  4X6A I;  1ZH1 A;  1WII A;  3KIF A;  4DQY B;  1M1K 2;  1YUK A;  2G2K A;  1VQN Z;  2VF1 A;  4QTT A;  1VQN 1;  4Y7N I;  4MD9 A;  2E2I I;  2R6M A;  3GTM I;  3I56 Z;  2RT9 A;  2NVX I;  1KQS Y;  3I56 1;  5FLX b;  1YI2 1;  3G6E Z;  1VQP Z;  3I4M I;  1Y1V I;  1N8R 2;  3S2D I;  1WJ2 A;  1K83 I;  2GTH A;  3BG1 B;  1YJN Z;  3CMA Z;  3CMA 1;  2E9H A;  2VUM I;  3CPW Z;  5IP7 I; 
#chains in the Genus database with same CATH homology
 1QVG Y;  2JA6 I;  2BJO A;  4A3K I;  3GCF A;  3NH5 A;  2I3C A;  4A3G I;  3PO2 I;  4MD7 A;  3CC4 Z;  4NOZ A;  3CC4 1;  3S14 I;  4NB8 A;  3CC7 Z;  3CC7 1;  5C4J I;  2OZK A;  1DL6 A;  2JA8 I;  4BY1 I;  2O4H A;  1I6H I;  1K8A 2;  3CCQ Z;  2OTJ Z;  5IT9 b;  1Q81 2;  1S72 Z;  2OOX B;  3CCQ 1;  2OTJ 1;  1RLY A;  3CXC Y;  1W2B Z;  1VLA A;  1VQ4 Z;  3KIH A;  1VQ4 1;  1K8A 1;  3S15 I;  1Q81 1;  3CQZ I;  3HOZ I;  3H3V J;  4NBB A;  4RVG A;  1S7M A;  2W03 A;  3T4N B;  2NVQ I;  2F4O A;  1RNI A;  1TWG I;  1I50 I;  3CCR Z;  3FQM A;  3CCR 1;  4HGZ A;  3P5J B;  3CC2 Z;  4NBA A;  1Q82 2;  3CC2 1;  3J7A 4;  3S1M I;  2DE5 A;  5T6B A;  4A93 I;  1YIJ Z;  1YIJ 1;  2KI7 B;  3QWU A;  4NB9 A;  1TFI A;  1X3W A;  2PK7 A;  4DK1 A;  1Q82 1;  3BG0 B;  3CCU 1;  3J81 b;  3S1R I;  2QRE B;  4AYB A;  4NFR A;  1Q86 1;  2Q51 A;  2E2H I;  3CD6 Z;  2IZ4 A;  3CD6 1;  2HF1 A;  2QA4 Z;  1VQ7 Z;  3NDJ A;  1VQ7 1;  1KC8 2;  5A2Q b;  1Q7Y 1;  1TWF I;  2Q4Z A;  4CL1 A;  1YJW Z;  3VB9 A;  3VMH A;  1YJW 1;  2KPI A;  5AN9 F;  4E2W A;  3JAM f;  2QR1 B;  4NBD A;  3CME Z;  3HKZ A;  1X0T A;  5D1O B;  3CME 1;  1M1K 1;  1RO0 A;  2NVT I;  1VQ6 Z;  3CCJ Z;  3PO3 S;  1VQ6 1;  1VQ9 Z;  3CCJ 1;  3IX0 A;  4BXX I;  1K73 2;  3G6E 1;  1VQP 1;  4RVD A;  3M4O I;  2M6N A;  3EER A;  3CPW Y;  3FQQ A;  1YJN 1;  1Z01 A;  1N8R 1;  3S17 I;  4DGL A;  1K9M 2;  4NBF A;  1QYP A;  1RO2 A;  3GTK I;  3IFU A;  3IF8 A;  4TNU A;  1NP6 A;  1ZB9 A;  2RIQ A;  1JJ2 Z;  3S1N I;  4RV9 A;  1WCM I;  2JUB A;  3MON A;  1QVG Z;  2QLV B;  1Z03 A;  1W2B Y;  1S72 1;  3S16 I;  1KD1 2;  1Y1W I;  2QRD B;  2B63 I;  1QVF Z;  3HOV I;  3PO3 I;  1KRL A;  2V8K A;  2JR6 A;  2V8J A;  3F3F C;  3RZO I;  1R9T I;  3F3P C;  3FKI I;  2Y0S A;  2OTL Z;  3OW2 Z;  3CCV Z;  2OTL 1;  3CCV 1;  1JWH C;  4MRI A;  3G71 Z;  2R7Z I;  2PMZ A;  3G71 1;  3J80 f;  3GTQ I;  4HH4 A;  4NBH A;  1X3Z A;  1PFT A;  2WB1 A;  1M90 2;  3HOW I;  5T67 A;  4E33 A;  3LUS A;  5FLM I;  1VQ5 Z;  3D9X A;  2V8I A;  1VQ5 1;  3GTP I;  2LFU A;  3Q87 A;  3D6W A;  2H85 A;  3RZD I;  5C3E I;  2QRC B;  4QTU A;  2GU2 A;  2WAQ A;  3MZK B;  4MXU A;  3I07 A;  3U50 C;  1ML8 A;  4MD8 A;  1VQM Z;  2QA4 1;  1Z02 A;  1VQM 1;  3GTL I;  1YJ9 Z;  4A3D I;  1YJ9 1;  2K5R A;  4A3C I;  4XX2 A;  5A2Q f;  1KC8 1;  1LQL A;  1WW9 A;  4A3M I;  3K7A I;  3CCM Z;  4E30 A;  2P3Y A;  3VMI A;  3CCM 1;  1VQO Z;  4MON A;  1TWH I;  1VQO 1;  2R92 I;  3GTO I;  2AKL A;  4E31 A;  1VQ9 1;  2YAD A;  4A3B I;  3JAM b;  3G4S Z;  5FLX f;  3G4S 1;  4BBS I;  3S2H I;  2DE6 A;  1USP B;  2GTI A;  1K73 1;  4A3L I;  2PM9 A;  1SFO I;  1YI2 Z;  2F4M A;  5D1O A;  1YHQ Z;  4Y52 I;  1KQS Z;  1YHQ 1;  1NJI 2;  3TDH B;  3TE5 B;  1K9M 1;  3CCL Z;  1JJ2 Y;  3CCL 1;  3NH8 A;  2JNY A;  2JMO A;  1NJI 1;  1USP A;  4BY7 I;  3I55 Z;  3I55 1;  4E32 A;  2VUG A;  2RHB A;  4S1T A;  1QVF Y;  5IT9 f;  2YU9 I;  2NVY I;  2EGT A;  3GTJ I;  1KD1 1;  4NBC A;  4NBE A;  4BBR I;  3GTG I;  1L1O C;  2JS4 A;  4A3F I;  3OW2 Y;  3VMG A;  5C44 I;  2E2J I;  5C4X I;  3CXC Z;  3HOX I;  4E2Z A;  1YUA A;  1NUI A;  5T64 A;  3HOU I;  4MH4 A;  2LIY A;  2QEX Z;  4NBG A;  3CCE Z;  4A3I I;  2QEX 1;  3CCE 1;  2JA7 I;  1N2F A;  4RS4 A;  4A3J I;  1QF8 A;  4E2Y A;  3J80 b;  1M90 1;  3GKQ A;  4NH1 C;  1VQL Z;  3J81 f;  2RPR A;  1VQL 1;  5IP9 I;  3EED A;  4EWC A;  2OOY B;  2RBL A;  4RVF A;  3NFZ A;  2DE7 A;  2IZ3 A;  1YIT Z;  1YIT 1;  4E2X A;  1VQK Z;  4A3E I;  1VQK 1;  1Y1V S;  3H0G I;  5D1P A;  2ZAE B;  3CCU Z;  2HU9 A;  2P28 A;  3ESW A;  3M3Y I;  1VQ8 Z;  1VQ8 1;  5CM2 M;  1RQF A;  1Q86 2;  3HOY I;  2O53 A;  1TWA I;  3GTM S;  2J6A A;  3MZL B;  3VTN A;  1TWC I;  4RVH A;  1P9N A;  2M48 A;  2K3R A;  2R93 I;  3S1Q I;  1Q7Y 2;  1ZB8 A;  3I4N I;  2QKD A;  3NH4 A;  4HGY A;  3NDI A;  2W04 A;  1RO4 A;  3CCS Z;  3CCS 1;  1I3Q I;  2JA5 I;  5LL6 f;  4X6A I;  1ZH1 A;  1WII A;  3KIF A;  4DQY B;  1M1K 2;  1YUK A;  2G2K A;  1VQN Z;  2VF1 A;  4QTT A;  1VQN 1;  4Y7N I;  4MD9 A;  2E2I I;  2R6M A;  3GTM I;  3I56 Z;  2RT9 A;  2NVX I;  1KQS Y;  3I56 1;  5FLX b;  1YI2 1;  3G6E Z;  1VQP Z;  3I4M I;  1Y1V I;  1N8R 2;  3S2D I;  1K83 I;  2GTH A;  3BG1 B;  1YJN Z;  3CMA Z;  3CMA 1;  2E9H A;  2VUM I;  3CPW Z;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...