5IP9I

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I02
1LQLA 1USPB 4A3MI 2E2HI 2R93I 5C3EI 3Q87A 3S1QI 2YU9I 1TFIA 2E2II 3D6WA 3H3VJ 2NVQI 1I6HI 3ESWA 1R9TI 4Y7NI 2JS4A 5IP7I 4X6AI 2NVXI 4BXXI 2JNYA 3GTOI 3GTKI 3S1NI 2AKLA 3GTMI 3GTGI 3CQZI 1NUIA 2NVYI 2R7ZI 3S2HI 1RO4A 2DE5A 3FKII 3PO3I 4A3II 1RLYA 1WCMI 5FLMI 3S14I 1TWGI 3S2DI 3GKQA 4QTUA 2JR6A 1Y1WI 1L1OC 3GTQI 2JA7I 2BJOA 2KPIA 3GTJI 1I3QI 2PK7A 4A3KI 2E2JI 4A3LI 2K5RA 2JA5I 3RZDI 3HOZI 3I4NI 2DE7A 3RZOI 4NOZA 2HF1A 4NBBA 2R92I 1ZB8A 1VLAA 4BBRI 4A3DI 4BBSI 1WW9A 2J6AA 1DL6A 2JA6I 5C4XI 3VMGA 3HOXI 3S1RI 1ML8A 5C4JI 1YUAA 4QTTA 3S15I 1Y1VS 2DE6A 2NVTI 3I07A 3LUSA 1N2FA 3HOUI 3S17I 1USPA 1X3ZA 4NB8A 4Y52I 4NBGA 4NB9A 1I50I 1SFOI 1TWFI 1QYPA 4A3CI 2P3YA 3VMHA 3H0GI 2B63I 4A93I 4BY1I 3HOVI 3S16I 1Y1VI 2F4MA 3VB9A 3HOYI 3GCFA 4NBCA 1TWAI 1TWCI 1PFTA 4A3EI 2VUMI 3M3YI 3I4MI 5IP9I 3GTMS 5C44I 3PO2I 1ZB9A 2RBLA 3GTPI 3PO3S 4A3FI 3VMIA 4NBEA 4A3GI 4XX2A 3U50C 3K7AI 4NBDA 3M4OI 3S1MI 3HOWI 4NBFA 2JA8I 3EERA 4A3JI 3GTLI 4MH4A 1X3WA 2F4OA 5CM2M 1TWHI 4A3BI 4BY7I 4NBHA 1K83I 4NBAA
chains in the Genus database with same CATH superfamily
2VUGA 1RO2A 5C3EI 3I561 4MD7A 2V8JA 3Q87A 3CCRZ 1RQFA 1TFIA 3TDHB 3CD61 3H3VJ 1VQOZ 2WAQA 3CPWZ 3ESWA 1KC82 4Y7NI 2OZKA 5IP7I 4HH4A 2NVXI 4BXXI 4DQYB 3GTOI 3GTKI 3BG1B 3GTMI 2IZ3A 1K732 3CMA1 4RVFA 1VQKZ 1S72Z 1QVGY 2DE5A 3G711 4A3II 2EGTA 3G4S1 3S14I 3S2DI 4QTUA 3G6E1 4HGYA 2BJOA 4RS4A 1I3QI 2PK7A 4A3KI 1M1K2 2K5RA 3IR7A 3CCU1 5T67A 1K8A2 3CCQZ 2JIQA 2QREB 2E7ZA 1DL6A 1YIT1 1Q7Y1 5C4XI 3BG0B 2JIPA 4MXUA 4QTTA 1WIIA 2O53A 3J80b 3CC7Z 2NVTI 2RT9A 1N8R1 4E31A 3CXCY 3S17I 3CCV1 2QLVB 4NB9A 1I50I 1NJI2 1VQ61 4E33A 2QRDB 2ZAEB 1Y1VI 3GCFA 2VF1A 2QKDA 5IP9I 3EEDA 1M901 3PO2I 3OW2Y 1W2BY 1ZB9A 1Q822 3GTPI 3PO3S 3KIFA 1KQSZ 3CC4Z 2QR1B 3VMIA 1RO0A 2OTLZ 2JA8I 3EERA 3GTLI 2OOYB 5CM2M 4BY7I 1LQLA 2KI7B 3MONA 3VTNA 3NDJA 3J80f 4A3MI 2R93I 3S1QI 2RPRA 2YU9I 3CCR1 1K9M1 1R9TI 1VQO1 3I55Z 1YIJZ 1WJ2A 3S1NI 2AKLA 3D9XA 4TNUA 3CQZI 2NVYI 3CMEZ 2VPZA 2R7ZI 3S2HI 4MD8A 1RO4A 1Z01A 3FKII 1Y8CA 1VQK1 1RLYA 1S721 1WCMI 1KC81 5A2Qf 1VQLZ 1VQ8Z 2KPIA 3JAMf 1QVGZ 2E2JI 4A3LI 2QRCB 3RZDI 1VQ91 1K731 4NOZA 3FQMA 3CCQ1 1WW9A 2VPYA 3CCMZ 4MD9A 4MRIA 3FQQA 3NFZA 2LIYA 4S1TA 1YUAA 5C4JI 3MZKB 1K8A1 2I3CA 2V45A 4DGLA 3J81b 1P9NA 3CC2Z 1Z03A 3CC71 2LEXA 3HKZA 1WZNA 1USPA 2AYDA 1YUKA 2M48A 4NBGA 1TWFI 1QYPA 5FLXb 1YHQZ 2P3YA 1KD12 3S16I 1VQ5Z 2F4MA 3VB9A 3HOYI 3TE5B 4NBCA 1TWCI 4AYBA 3I4MI 3GTMS 2IV2X 1S7MA 1KRLA 1YI2Z 1Q812 4A3GI 3IX0A 4XX2A 2IZ4A 4NBDA 1VQMZ 3S1MI 3CC41 2V8KA 3OW2Z 3MZLB 1W2BZ 2GTHA 3CCEZ 1X3WA 2OTL1 3G71Z 1Q821 2K3RA 2E2HI 4E32A 3IFUA 2OOXB 2P28A 1YJWZ 1X0TA 1VQ41 3F3PC 4NH1C 5FLXf 1VQ7Z 1Q862 2JS4A 5LL6f 2JNYA 1FDOA 1QXFA 3I551 3GTGI 1YIJ1 3NH4A 1YJ91 4RV9A 2W04A 3CME1 2VPWA 2JR6A 3GTQI 2Q51A 2NAPA 2RIQA 1JJ2Y 1QF8A 1VQL1 2JA5I 1VQ81 3P5JB 4NBBA 1ZB8A 1VLAA 3D2LA 4BBRI 2QA4Z 4A3DI 2QEXZ 3NH5A 3T4NB 2J6AA 2JA6I 4RVDA 3VMGA 3HOXI 5D1OA 3CCM1 2DE6A 1ZH1A 1VQPZ 3LUSA 1N2FA 3CCSZ 3HOUI 2JIMA 1X3ZA 4Y52I 2R6MA 4NB8A 3CC21 1Q16A 1SFOI 4A3CI 4A93I 3HOVI 1YHQ1 1VQNZ 2GTIA 1VQ51 5IT9b 2RHBA 1M1K1 2W03A 3CCJZ 1QVFY 4NFRA 3F3FC 2LFUA 2RBLA 2OTJZ 1NP6A 1KD11 4A3FI 1FDIA 3K7AI 3CCLZ 3M4OI 1YJNZ 1YI21 4NBFA 1JWHC 2JIOA 1VQM1 4A3JI 5D1PA 4MONA 1TWHI 5T6BA 4A3BI 4NBHA 1K83I 3CXCZ 3CCE1 3I56Z 1USPB 1Q811 3CPWY 4RVHA 4E2WA 2M6NA 3KIHA 1YJW1 3CD6Z 2JUBA 1VQ9Z 1NJI1 2PMZA 2E2II 3D6WA 5T64A 2NVQI 1I6HI 3J7A4 4RVGA 1VQ71 4X6AI 4E2ZA 3IF8A 2V3VA 3CMAZ 5IT9f 2V8IA 2YADA 1NUIA 3NDIA 3G4SZ 3G6EZ 3PO3I 1Q861 5FLMI 3J81f 4E30A 1TWGI 1Q7Y2 3GKQA 1Y1WI 3QWUA 1Z02A 1L1OC 2JA7I 3CCUZ 3GTJI 3I4NI 3HOZI 3RZOI 2DE7A 2HF1A 2WB1A 2R92I 1YITZ 4E2XA 4BBSI 1N8R2 1JJ2Z 2G2KA 2QA41 2QEX1 3S1RI 1ML8A 3S15I 1Y1VS 3I07A 3CCVZ 1VQP1 5A2Qb 5AN9F 2Y0SA 3JAMb 1M902 3CCS1 1VQ6Z 4E2YA 4HGZA 2JMOA 3VMHA 3H0GI 2B63I 3NH8A 4DK1A 4BY1I 4EWCA 1TWAI 1KQSY 1PFTA 2HU9A 4A3EI 1VQN1 2VUMI 3M3YI 2E9HA 1VQ4Z 2H85A 5C44I 2VPXA 4CL1A 2O4HA 1RNIA 2PM9A 3CCJ1 4NBEA 5D1OB 1AA6A 2OTJ1 3U50C 1QVFZ 1SIWA 3HOWI 2JIRA 3CCL1 1YJN1 1YJ9Z 2Q4ZA 4MH4A 2GU2A 2F4OA 1K9M2 4NBAA
chains in the Genus database with same CATH topology
2VUGA 1RO2A 5C3EI 3I561 4MD7A 2V8JA 3Q87A 3CCRZ 1RQFA 1TFIA 3TDHB 3CD61 3H3VJ 1VQOZ 2WAQA 3CPWZ 3ESWA 1KC82 4Y7NI 2OZKA 5IP7I 4HH4A 2NVXI 4BXXI 4DQYB 3GTOI 3GTKI 3BG1B 3GTMI 2IZ3A 1K732 3CMA1 4RVFA 1VQKZ 1S72Z 1QVGY 2DE5A 3G711 4A3II 2EGTA 3G4S1 3S14I 3S2DI 4QTUA 3G6E1 4HGYA 2BJOA 4RS4A 1I3QI 2PK7A 4A3KI 1M1K2 2K5RA 3CCU1 5T67A 1K8A2 3CCQZ 2QREB 1DL6A 1YIT1 1Q7Y1 5C4XI 3BG0B 4MXUA 4QTTA 1WIIA 2O53A 3J80b 3CC7Z 2NVTI 2RT9A 1N8R1 4E31A 3CXCY 3S17I 3CCV1 2QLVB 4NB9A 1I50I 1NJI2 1VQ61 4E33A 2QRDB 2ZAEB 1Y1VI 3GCFA 2VF1A 2QKDA 5IP9I 3EEDA 1M901 3PO2I 3OW2Y 1W2BY 1ZB9A 1Q822 3GTPI 3PO3S 3KIFA 1KQSZ 3CC4Z 2QR1B 3VMIA 1RO0A 2OTLZ 2JA8I 3EERA 3GTLI 2OOYB 5CM2M 4BY7I 1LQLA 2KI7B 3MONA 3VTNA 3NDJA 3J80f 4A3MI 2R93I 3S1QI 2RPRA 2YU9I 3CCR1 1K9M1 1R9TI 1VQO1 3I55Z 1YIJZ 3S1NI 2AKLA 3D9XA 4TNUA 3CQZI 2NVYI 3CMEZ 2R7ZI 3S2HI 4MD8A 1RO4A 1Z01A 3FKII 1VQK1 1RLYA 1S721 1WCMI 1KC81 5A2Qf 1VQLZ 1VQ8Z 2KPIA 3JAMf 1QVGZ 2E2JI 4A3LI 2QRCB 3RZDI 1VQ91 1K731 4NOZA 3FQMA 3CCQ1 1WW9A 3CCMZ 4MD9A 4MRIA 3FQQA 3NFZA 2LIYA 4S1TA 1YUAA 5C4JI 3MZKB 1K8A1 2I3CA 4DGLA 3J81b 1P9NA 3CC2Z 1Z03A 3CC71 3HKZA 1USPA 1YUKA 2M48A 4NBGA 1TWFI 1QYPA 5FLXb 1YHQZ 2P3YA 1KD12 3S16I 1VQ5Z 2F4MA 3VB9A 3HOYI 3TE5B 4NBCA 1TWCI 4AYBA 3I4MI 3GTMS 1S7MA 1KRLA 1YI2Z 1Q812 4A3GI 3IX0A 4XX2A 2IZ4A 4NBDA 1VQMZ 3S1MI 3CC41 2V8KA 3OW2Z 3MZLB 1W2BZ 2GTHA 3CCEZ 1X3WA 2OTL1 3G71Z 1Q821 2K3RA 2E2HI 4E32A 3IFUA 2OOXB 2P28A 1YJWZ 1X0TA 1VQ41 3F3PC 4NH1C 5FLXf 1VQ7Z 1Q862 2JS4A 5LL6f 2JNYA 3I551 3GTGI 1YIJ1 3NH4A 1YJ91 4RV9A 2W04A 3CME1 2JR6A 3GTQI 2Q51A 2RIQA 1JJ2Y 1QF8A 1VQL1 2JA5I 1VQ81 3P5JB 4NBBA 1ZB8A 1VLAA 4BBRI 2QA4Z 4A3DI 2QEXZ 3NH5A 3T4NB 2J6AA 2JA6I 4RVDA 3VMGA 3HOXI 5D1OA 3CCM1 2DE6A 1ZH1A 1VQPZ 3LUSA 1N2FA 3CCSZ 3HOUI 1X3ZA 4Y52I 2R6MA 4NB8A 3CC21 1SFOI 4A3CI 4A93I 3HOVI 1YHQ1 1VQNZ 2GTIA 1VQ51 5IT9b 2RHBA 1M1K1 2W03A 3CCJZ 1QVFY 4NFRA 3F3FC 2LFUA 2RBLA 2OTJZ 1NP6A 1KD11 4A3FI 3K7AI 3CCLZ 3M4OI 1YJNZ 1YI21 4NBFA 1JWHC 1VQM1 4A3JI 5D1PA 4MONA 1TWHI 5T6BA 4A3BI 4NBHA 1K83I 3CXCZ 3CCE1 3I56Z 1USPB 1Q811 3CPWY 4RVHA 4E2WA 2M6NA 3KIHA 1YJW1 3CD6Z 2JUBA 1VQ9Z 1NJI1 2PMZA 2E2II 3D6WA 5T64A 2NVQI 1I6HI 3J7A4 4RVGA 1VQ71 4X6AI 4E2ZA 3IF8A 3CMAZ 5IT9f 2V8IA 2YADA 1NUIA 3NDIA 3G4SZ 3G6EZ 3PO3I 1Q861 5FLMI 3J81f 4E30A 1TWGI 1Q7Y2 3GKQA 1Y1WI 3QWUA 1Z02A 1L1OC 2JA7I 3CCUZ 3GTJI 3I4NI 3HOZI 3RZOI 2DE7A 2HF1A 2WB1A 2R92I 1YITZ 4E2XA 4BBSI 1N8R2 1JJ2Z 2G2KA 2QA41 2QEX1 3S1RI 1ML8A 3S15I 1Y1VS 3I07A 3CCVZ 1VQP1 5A2Qb 5AN9F 2Y0SA 3JAMb 1M902 3CCS1 1VQ6Z 4E2YA 4HGZA 2JMOA 3VMHA 3H0GI 2B63I 3NH8A 4DK1A 4BY1I 4EWCA 1TWAI 1KQSY 1PFTA 2HU9A 4A3EI 1VQN1 2VUMI 3M3YI 2E9HA 1VQ4Z 2H85A 5C44I 4CL1A 2O4HA 1RNIA 2PM9A 3CCJ1 4NBEA 5D1OB 2OTJ1 3U50C 1QVFZ 3HOWI 3CCL1 1YJN1 1YJ9Z 2Q4ZA 4MH4A 2GU2A 2F4OA 1K9M2 4NBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  1USP B;  4A3M I;  2E2H I;  2R93 I;  5C3E I;  3Q87 A;  3S1Q I;  2YU9 I;  1TFI A;  2E2I I;  3D6W A;  3H3V J;  2NVQ I;  1I6H I;  3ESW A;  1R9T I;  4Y7N I;  2JS4 A;  5IP7 I;  4X6A I;  2NVX I;  4BXX I;  2JNY A;  3GTO I;  3GTK I;  3S1N I;  2AKL A;  3GTM I;  3GTG I;  3CQZ I;  1NUI A;  2NVY I;  2R7Z I;  3S2H I;  1RO4 A;  2DE5 A;  3FKI I;  3PO3 I;  4A3I I;  1RLY A;  1WCM I;  5FLM I;  3S14 I;  1TWG I;  3S2D I;  3GKQ A;  4QTU A;  2JR6 A;  1Y1W I;  1L1O C;  3GTQ I;  2JA7 I;  2BJO A;  2KPI A;  3GTJ I;  1I3Q I;  2PK7 A;  4A3K I;  2E2J I;  4A3L I;  2K5R A;  2JA5 I;  3RZD I;  3HOZ I;  3I4N I;  2DE7 A;  3RZO I;  4NOZ A;  2HF1 A;  4NBB A;  2R92 I;  1ZB8 A;  1VLA A;  4BBR I;  4A3D I;  4BBS I;  1WW9 A;  2J6A A;  1DL6 A;  2JA6 I;  5C4X I;  3VMG A;  3HOX I;  3S1R I;  1ML8 A;  5C4J I;  1YUA A;  4QTT A;  3S15 I;  1Y1V S;  2DE6 A;  2NVT I;  3I07 A;  3LUS A;  1N2F A;  3HOU I;  3S17 I;  1USP A;  1X3Z A;  4NB8 A;  4Y52 I;  4NBG A;  4NB9 A;  1I50 I;  1SFO I;  1TWF I;  1QYP A;  4A3C I;  2P3Y A;  3VMH A;  3H0G I;  2B63 I;  4A93 I;  4BY1 I;  3HOV I;  3S16 I;  1Y1V I;  2F4M A;  3VB9 A;  3HOY I;  3GCF A;  4NBC A;  1TWA I;  1TWC I;  1PFT A;  4A3E I;  2VUM I;  3M3Y I;  3I4M I;  5IP9 I;  3GTM S;  5C44 I;  3PO2 I;  1ZB9 A;  2RBL A;  3GTP I;  3PO3 S;  4A3F I;  3VMI A;  4NBE A;  4A3G I;  4XX2 A;  3U50 C;  3K7A I;  4NBD A;  3M4O I;  3S1M I;  3HOW I;  4NBF A;  2JA8 I;  3EER A;  4A3J I;  3GTL I;  4MH4 A;  1X3W A;  2F4O A;  5CM2 M;  1TWH I;  4A3B I;  4BY7 I;  4NBH A;  1K83 I;  4NBA A; 
#chains in the Genus database with same CATH topology
 2VUG A;  1RO2 A;  5C3E I;  3I56 1;  4MD7 A;  2V8J A;  3Q87 A;  3CCR Z;  1RQF A;  1TFI A;  3TDH B;  3CD6 1;  3H3V J;  1VQO Z;  2WAQ A;  3CPW Z;  3ESW A;  1KC8 2;  4Y7N I;  2OZK A;  5IP7 I;  4HH4 A;  2NVX I;  4BXX I;  4DQY B;  3GTO I;  3GTK I;  3BG1 B;  3GTM I;  2IZ3 A;  1K73 2;  3CMA 1;  4RVF A;  1VQK Z;  1S72 Z;  1QVG Y;  2DE5 A;  3G71 1;  4A3I I;  2EGT A;  3G4S 1;  3S14 I;  3S2D I;  4QTU A;  3G6E 1;  4HGY A;  2BJO A;  4RS4 A;  1I3Q I;  2PK7 A;  4A3K I;  1M1K 2;  2K5R A;  3IR7 A;  3CCU 1;  5T67 A;  1K8A 2;  3CCQ Z;  2JIQ A;  2QRE B;  2E7Z A;  1DL6 A;  1YIT 1;  1Q7Y 1;  5C4X I;  3BG0 B;  2JIP A;  4MXU A;  4QTT A;  1WII A;  2O53 A;  3J80 b;  3CC7 Z;  2NVT I;  2RT9 A;  1N8R 1;  4E31 A;  3CXC Y;  3S17 I;  3CCV 1;  2QLV B;  4NB9 A;  1I50 I;  1NJI 2;  1VQ6 1;  4E33 A;  2QRD B;  2ZAE B;  1Y1V I;  3GCF A;  2VF1 A;  2QKD A;  5IP9 I;  3EED A;  1M90 1;  3PO2 I;  3OW2 Y;  1W2B Y;  1ZB9 A;  1Q82 2;  3GTP I;  3PO3 S;  3KIF A;  1KQS Z;  3CC4 Z;  2QR1 B;  3VMI A;  1RO0 A;  2OTL Z;  2JA8 I;  3EER A;  3GTL I;  2OOY B;  5CM2 M;  4BY7 I;  1LQL A;  2KI7 B;  3MON A;  3VTN A;  3NDJ A;  3J80 f;  4A3M I;  2R93 I;  3S1Q I;  2RPR A;  2YU9 I;  3CCR 1;  1K9M 1;  1R9T I;  1VQO 1;  3I55 Z;  1YIJ Z;  1WJ2 A;  3S1N I;  2AKL A;  3D9X A;  4TNU A;  3CQZ I;  2NVY I;  3CME Z;  2VPZ A;  2R7Z I;  3S2H I;  4MD8 A;  1RO4 A;  1Z01 A;  3FKI I;  1Y8C A;  1VQK 1;  1RLY A;  1S72 1;  1WCM I;  1KC8 1;  5A2Q f;  1VQL Z;  1VQ8 Z;  2KPI A;  3JAM f;  1QVG Z;  2E2J I;  4A3L I;  2QRC B;  3RZD I;  1VQ9 1;  1K73 1;  4NOZ A;  3FQM A;  3CCQ 1;  1WW9 A;  2VPY A;  3CCM Z;  4MD9 A;  4MRI A;  3FQQ A;  3NFZ A;  2LIY A;  4S1T A;  1YUA A;  5C4J I;  3MZK B;  1K8A 1;  2I3C A;  2V45 A;  4DGL A;  3J81 b;  1P9N A;  3CC2 Z;  1Z03 A;  3CC7 1;  2LEX A;  3HKZ A;  1WZN A;  1USP A;  2AYD A;  1YUK A;  2M48 A;  4NBG A;  1TWF I;  1QYP A;  5FLX b;  1YHQ Z;  2P3Y A;  1KD1 2;  3S16 I;  1VQ5 Z;  2F4M A;  3VB9 A;  3HOY I;  3TE5 B;  4NBC A;  1TWC I;  4AYB A;  3I4M I;  3GTM S;  2IV2 X;  1S7M A;  1KRL A;  1YI2 Z;  1Q81 2;  4A3G I;  3IX0 A;  4XX2 A;  2IZ4 A;  4NBD A;  1VQM Z;  3S1M I;  3CC4 1;  2V8K A;  3OW2 Z;  3MZL B;  1W2B Z;  2GTH A;  3CCE Z;  1X3W A;  2OTL 1;  3G71 Z;  1Q82 1;  2K3R A;  2E2H I;  4E32 A;  3IFU A;  2OOX B;  2P28 A;  1YJW Z;  1X0T A;  1VQ4 1;  3F3P C;  4NH1 C;  5FLX f;  1VQ7 Z;  1Q86 2;  2JS4 A;  5LL6 f;  2JNY A;  1FDO A;  1QXF A;  3I55 1;  3GTG I;  1YIJ 1;  3NH4 A;  1YJ9 1;  4RV9 A;  2W04 A;  3CME 1;  2VPW A;  2JR6 A;  3GTQ I;  2Q51 A;  2NAP A;  2RIQ A;  1JJ2 Y;  1QF8 A;  1VQL 1;  2JA5 I;  1VQ8 1;  3P5J B;  4NBB A;  1ZB8 A;  1VLA A;  3D2L A;  4BBR I;  2QA4 Z;  4A3D I;  2QEX Z;  3NH5 A;  3T4N B;  2J6A A;  2JA6 I;  4RVD A;  3VMG A;  3HOX I;  5D1O A;  3CCM 1;  2DE6 A;  1ZH1 A;  1VQP Z;  3LUS A;  1N2F A;  3CCS Z;  3HOU I;  2JIM A;  1X3Z A;  4Y52 I;  2R6M A;  4NB8 A;  3CC2 1;  1Q16 A;  1SFO I;  4A3C I;  4A93 I;  3HOV I;  1YHQ 1;  1VQN Z;  2GTI A;  1VQ5 1;  5IT9 b;  2RHB A;  1M1K 1;  2W03 A;  3CCJ Z;  1QVF Y;  4NFR A;  3F3F C;  2LFU A;  2RBL A;  2OTJ Z;  1NP6 A;  1KD1 1;  4A3F I;  1FDI A;  3K7A I;  3CCL Z;  3M4O I;  1YJN Z;  1YI2 1;  4NBF A;  1JWH C;  2JIO A;  1VQM 1;  4A3J I;  5D1P A;  4MON A;  1TWH I;  5T6B A;  4A3B I;  4NBH A;  1K83 I;  3CXC Z;  3CCE 1;  3I56 Z;  1USP B;  1Q81 1;  3CPW Y;  4RVH A;  4E2W A;  2M6N A;  3KIH A;  1YJW 1;  3CD6 Z;  2JUB A;  1VQ9 Z;  1NJI 1;  2PMZ A;  2E2I I;  3D6W A;  5T64 A;  2NVQ I;  1I6H I;  3J7A 4;  4RVG A;  1VQ7 1;  4X6A I;  4E2Z A;  3IF8 A;  2V3V A;  3CMA Z;  5IT9 f;  2V8I A;  2YAD A;  1NUI A;  3NDI A;  3G4S Z;  3G6E Z;  3PO3 I;  1Q86 1;  5FLM I;  3J81 f;  4E30 A;  1TWG I;  1Q7Y 2;  3GKQ A;  1Y1W I;  3QWU A;  1Z02 A;  1L1O C;  2JA7 I;  3CCU Z;  3GTJ I;  3I4N I;  3HOZ I;  3RZO I;  2DE7 A;  2HF1 A;  2WB1 A;  2R92 I;  1YIT Z;  4E2X A;  4BBS I;  1N8R 2;  1JJ2 Z;  2G2K A;  2QA4 1;  2QEX 1;  3S1R I;  1ML8 A;  3S15 I;  1Y1V S;  3I07 A;  3CCV Z;  1VQP 1;  5A2Q b;  5AN9 F;  2Y0S A;  3JAM b;  1M90 2;  3CCS 1;  1VQ6 Z;  4E2Y A;  4HGZ A;  2JMO A;  3VMH A;  3H0G I;  2B63 I;  3NH8 A;  4DK1 A;  4BY1 I;  4EWC A;  1TWA I;  1KQS Y;  1PFT A;  2HU9 A;  4A3E I;  1VQN 1;  2VUM I;  3M3Y I;  2E9H A;  1VQ4 Z;  2H85 A;  5C44 I;  2VPX A;  4CL1 A;  2O4H A;  1RNI A;  2PM9 A;  3CCJ 1;  4NBE A;  5D1O B;  1AA6 A;  2OTJ 1;  3U50 C;  1QVF Z;  1SIW A;  3HOW I;  2JIR A;  3CCL 1;  1YJN 1;  1YJ9 Z;  2Q4Z A;  4MH4 A;  2GU2 A;  2F4O A;  1K9M 2;  4NBA A; 
#chains in the Genus database with same CATH homology
 2VUG A;  1RO2 A;  5C3E I;  3I56 1;  4MD7 A;  2V8J A;  3Q87 A;  3CCR Z;  1RQF A;  1TFI A;  3TDH B;  3CD6 1;  3H3V J;  1VQO Z;  2WAQ A;  3CPW Z;  3ESW A;  1KC8 2;  4Y7N I;  2OZK A;  5IP7 I;  4HH4 A;  2NVX I;  4BXX I;  4DQY B;  3GTO I;  3GTK I;  3BG1 B;  3GTM I;  2IZ3 A;  1K73 2;  3CMA 1;  4RVF A;  1VQK Z;  1S72 Z;  1QVG Y;  2DE5 A;  3G71 1;  4A3I I;  2EGT A;  3G4S 1;  3S14 I;  3S2D I;  4QTU A;  3G6E 1;  4HGY A;  2BJO A;  4RS4 A;  1I3Q I;  2PK7 A;  4A3K I;  1M1K 2;  2K5R A;  3CCU 1;  5T67 A;  1K8A 2;  3CCQ Z;  2QRE B;  1DL6 A;  1YIT 1;  1Q7Y 1;  5C4X I;  3BG0 B;  4MXU A;  4QTT A;  1WII A;  2O53 A;  3J80 b;  3CC7 Z;  2NVT I;  2RT9 A;  1N8R 1;  4E31 A;  3CXC Y;  3S17 I;  3CCV 1;  2QLV B;  4NB9 A;  1I50 I;  1NJI 2;  1VQ6 1;  4E33 A;  2QRD B;  2ZAE B;  1Y1V I;  3GCF A;  2VF1 A;  2QKD A;  5IP9 I;  3EED A;  1M90 1;  3PO2 I;  3OW2 Y;  1W2B Y;  1ZB9 A;  1Q82 2;  3GTP I;  3PO3 S;  3KIF A;  1KQS Z;  3CC4 Z;  2QR1 B;  3VMI A;  1RO0 A;  2OTL Z;  2JA8 I;  3EER A;  3GTL I;  2OOY B;  5CM2 M;  4BY7 I;  1LQL A;  2KI7 B;  3MON A;  3VTN A;  3NDJ A;  3J80 f;  4A3M I;  2R93 I;  3S1Q I;  2RPR A;  2YU9 I;  3CCR 1;  1K9M 1;  1R9T I;  1VQO 1;  3I55 Z;  1YIJ Z;  3S1N I;  2AKL A;  3D9X A;  4TNU A;  3CQZ I;  2NVY I;  3CME Z;  2R7Z I;  3S2H I;  4MD8 A;  1RO4 A;  1Z01 A;  3FKI I;  1VQK 1;  1RLY A;  1S72 1;  1WCM I;  1KC8 1;  5A2Q f;  1VQL Z;  1VQ8 Z;  2KPI A;  3JAM f;  1QVG Z;  2E2J I;  4A3L I;  2QRC B;  3RZD I;  1VQ9 1;  1K73 1;  4NOZ A;  3FQM A;  3CCQ 1;  1WW9 A;  3CCM Z;  4MD9 A;  4MRI A;  3FQQ A;  3NFZ A;  2LIY A;  4S1T A;  1YUA A;  5C4J I;  3MZK B;  1K8A 1;  2I3C A;  4DGL A;  3J81 b;  1P9N A;  3CC2 Z;  1Z03 A;  3CC7 1;  3HKZ A;  1USP A;  1YUK A;  2M48 A;  4NBG A;  1TWF I;  1QYP A;  5FLX b;  1YHQ Z;  2P3Y A;  1KD1 2;  3S16 I;  1VQ5 Z;  2F4M A;  3VB9 A;  3HOY I;  3TE5 B;  4NBC A;  1TWC I;  4AYB A;  3I4M I;  3GTM S;  1S7M A;  1KRL A;  1YI2 Z;  1Q81 2;  4A3G I;  3IX0 A;  4XX2 A;  2IZ4 A;  4NBD A;  1VQM Z;  3S1M I;  3CC4 1;  2V8K A;  3OW2 Z;  3MZL B;  1W2B Z;  2GTH A;  3CCE Z;  1X3W A;  2OTL 1;  3G71 Z;  1Q82 1;  2K3R A;  2E2H I;  4E32 A;  3IFU A;  2OOX B;  2P28 A;  1YJW Z;  1X0T A;  1VQ4 1;  3F3P C;  4NH1 C;  5FLX f;  1VQ7 Z;  1Q86 2;  2JS4 A;  5LL6 f;  2JNY A;  3I55 1;  3GTG I;  1YIJ 1;  3NH4 A;  1YJ9 1;  4RV9 A;  2W04 A;  3CME 1;  2JR6 A;  3GTQ I;  2Q51 A;  2RIQ A;  1JJ2 Y;  1QF8 A;  1VQL 1;  2JA5 I;  1VQ8 1;  3P5J B;  4NBB A;  1ZB8 A;  1VLA A;  4BBR I;  2QA4 Z;  4A3D I;  2QEX Z;  3NH5 A;  3T4N B;  2J6A A;  2JA6 I;  4RVD A;  3VMG A;  3HOX I;  5D1O A;  3CCM 1;  2DE6 A;  1ZH1 A;  1VQP Z;  3LUS A;  1N2F A;  3CCS Z;  3HOU I;  1X3Z A;  4Y52 I;  2R6M A;  4NB8 A;  3CC2 1;  1SFO I;  4A3C I;  4A93 I;  3HOV I;  1YHQ 1;  1VQN Z;  2GTI A;  1VQ5 1;  5IT9 b;  2RHB A;  1M1K 1;  2W03 A;  3CCJ Z;  1QVF Y;  4NFR A;  3F3F C;  2LFU A;  2RBL A;  2OTJ Z;  1NP6 A;  1KD1 1;  4A3F I;  3K7A I;  3CCL Z;  3M4O I;  1YJN Z;  1YI2 1;  4NBF A;  1JWH C;  1VQM 1;  4A3J I;  5D1P A;  4MON A;  1TWH I;  5T6B A;  4A3B I;  4NBH A;  1K83 I;  3CXC Z;  3CCE 1;  3I56 Z;  1USP B;  1Q81 1;  3CPW Y;  4RVH A;  4E2W A;  2M6N A;  3KIH A;  1YJW 1;  3CD6 Z;  2JUB A;  1VQ9 Z;  1NJI 1;  2PMZ A;  2E2I I;  3D6W A;  5T64 A;  2NVQ I;  1I6H I;  3J7A 4;  4RVG A;  1VQ7 1;  4X6A I;  4E2Z A;  3IF8 A;  3CMA Z;  5IT9 f;  2V8I A;  2YAD A;  1NUI A;  3NDI A;  3G4S Z;  3G6E Z;  3PO3 I;  1Q86 1;  5FLM I;  3J81 f;  4E30 A;  1TWG I;  1Q7Y 2;  3GKQ A;  1Y1W I;  3QWU A;  1Z02 A;  1L1O C;  2JA7 I;  3CCU Z;  3GTJ I;  3I4N I;  3HOZ I;  3RZO I;  2DE7 A;  2HF1 A;  2WB1 A;  2R92 I;  1YIT Z;  4E2X A;  4BBS I;  1N8R 2;  1JJ2 Z;  2G2K A;  2QA4 1;  2QEX 1;  3S1R I;  1ML8 A;  3S15 I;  1Y1V S;  3I07 A;  3CCV Z;  1VQP 1;  5A2Q b;  5AN9 F;  2Y0S A;  3JAM b;  1M90 2;  3CCS 1;  1VQ6 Z;  4E2Y A;  4HGZ A;  2JMO A;  3VMH A;  3H0G I;  2B63 I;  3NH8 A;  4DK1 A;  4BY1 I;  4EWC A;  1TWA I;  1KQS Y;  1PFT A;  2HU9 A;  4A3E I;  1VQN 1;  2VUM I;  3M3Y I;  2E9H A;  1VQ4 Z;  2H85 A;  5C44 I;  4CL1 A;  2O4H A;  1RNI A;  2PM9 A;  3CCJ 1;  4NBE A;  5D1O B;  2OTJ 1;  3U50 C;  1QVF Z;  3HOW I;  3CCL 1;  1YJN 1;  1YJ9 Z;  2Q4Z A;  4MH4 A;  2GU2 A;  2F4O A;  1K9M 2;  4NBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...