5IP9I

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I02
3U50C 1RLYA 4A93I 3LUSA 2NVTI 1L1OC 5C3EI 3H3VJ 2NVQI 4A3II 1TWAI 1ZB9A 3GTMS 3EERA 3I4NI 2RBLA 3S16I 4A3FI 3HOZI 2R92I 4A3DI 1Y1VS 3I4MI 3PO3I 4BBSI 1ZB8A 4A3GI 3S1QI 3FKII 1N2FA 3GTOI 2JA6I 2B63I 3S14I 4NBHA 3RZDI 5IP9I 4NBEA 2JA7I 2PK7A 1SFOI 2DE7A 1RO4A 3HOVI 4BXXI 3GTPI 3GTJI 2J6AA 2E2HI 2JR6A 2E2II 3M4OI 2P3YA 1I6HI 4BBRI 3H0GI 2VUMI 4BY1I 3PO3S 2KPIA 3S1NI 3GCFA 1ML8A 1TWFI 1R9TI 1WW9A 5IP7I 2YU9I 4A3JI 4NBBA 4NBDA 3GTGI 4NBAA 2NVYI 3VMGA 4MH4A 1VLAA 3VMIA 3ESWA 4NBGA 3CQZI 3I07A 3S15I 3GTQI 3HOWI 2JS4A 3D6WA 4NB8A 2AKLA 5C4XI 2F4OA 2JA8I 1NUIA 1WCMI 4QTTA 1USPA 2DE6A 1YUAA 1TWHI 2F4MA 3VMHA 3S1MI 2E2JI 5CM2M 1USPB 3S1RI 3HOXI 4X6AI 1K83I 2K5RA 4NOZA 1DL6A 1I50I 2HF1A 3Q87A 5FLMI 1Y1WI 3HOUI 1LQLA 4NB9A 2DE5A 4A3EI 4A3KI 1QYPA 1I3QI 3S2DI 4A3BI 5C4JI 4A3LI 4QTUA 4A3MI 4NBCA 1TWGI 1PFTA 3VB9A 3M3YI 4NBFA 3K7AI 2JA5I 1X3WA 3GTMI 3PO2I 4A3CI 4Y52I 1X3ZA 3GKQA 4Y7NI 1Y1VI 3RZOI 2NVXI 3S2HI 3GTKI 2JNYA 5C44I 3GTLI 4XX2A 1TWCI 4BY7I 1TFIA 3S17I 2BJOA 3HOYI 2R7ZI 2R93I
chains in the Genus database with same CATH superfamily
3G711 5FLXb 3I55Z 4A93I 4RVDA 3CCS1 3LUSA 3FQMA 3GTMS 3J7A4 4A3FI 1ZH1A 3OW2Z 3CCU1 1Q811 3I4MI 2Y0SA 3CMA1 3CPWY 1ZB8A 1FDOA 4RS4A 1N2FA 3GTOI 3S14I 3RZDI 3OW2Y 1VQ5Z 2PK7A 3I56Z 2V45A 3CCQ1 2DE7A 2PMZA 2P28A 4BXXI 3I551 3TDHB 3GTPI 3GTJI 2LEXA 2J6AA 1M901 3CCLZ 2LFUA 2OZKA 3H0GI 2KPIA 4AYBA 3NH8A 2VF1A 2O53A 2YU9I 3J80f 3CC21 4A3JI 3MONA 2EGTA 3VTNA 3GTGI 2NVYI 3VMGA 3JAMb 4NFRA 3CCM1 1VQP1 5T6BA 2NAPA 3CC4Z 3I07A 3S15I 2QREB 4MXUA 1VQ41 1RNIA 1X0TA 3BG0B 3G4SZ 2JA8I 1WCMI 3CCL1 1USPA 2DE6A 2M48A 2JIPA 2YADA 2RT9A 2JUBA 3S1MI 4E33A 4MONA 1Q7Y1 3P5JB 1YJ91 5FLMI 1VQOZ 1YJW1 2LIYA 2ZAEB 2DE5A 4A3EI 2JIOA 1Z03A 2H85A 5C4JI 4QTUA 4A3MI 3CCR1 1VQMZ 4HGZA 3KIFA 2WB1A 2JA5I 3EEDA 1X3WA 1VQKZ 4A3CI 1K731 1NJI2 3GKQA 1NP6A 3J81b 1KD12 5C44I 3GTLI 4XX2A 2W04A 1TFIA 2R93I 4E2XA 3CD61 1WZNA 2QKDA 3U50C 2QEX1 4DQYB 2IV2X 1S7MA 1TWAI 1Q16A 4RV9A 3S16I 4MRIA 3CCVZ 1VQK1 1YI2Z 2R92I 1Y1VS 3PO3I 4A3GI 3CC7Z 1VQ8Z 2QR1B 2OTL1 2JA6I 4RVHA 5IP9I 4NBEA 5LL6f 5T67A 4DK1A 1YUKA 3HOVI 1QVFZ 1VQ6Z 2Q51A 2OTJZ 3M4OI 4RVGA 1I6HI 4BBRI 2VUMI 3G6EZ 3GCFA 1ML8A 5IT9f 1VQNZ 1TWFI 2RPRA 4E2YA 2GTIA 1Q821 4E32A 1N8R2 1KC81 2I3CA 3CQZI 3T4NB 3HOWI 2JS4A 3TE5B 1VQ61 1M1K2 1Q862 2WAQA 1NUIA 5A2Qf 4E31A 3G6E1 3F3PC 2E2JI 5CM2M 1K8A2 3S1RI 1K83I 5T64A 1I50I 2HF1A 3IX0A 1Y1WI 3HOUI 3IR7A 2RIQA 1VQ51 1S72Z 3I561 4A3KI 2VPWA 3IFUA 3HKZA 4E2ZA 2V8JA 1PFTA 2PM9A 2QLVB 3GTMI 3PO2I 1K9M2 4Y52I 1JJ2Z 4MD7A 4Y7NI 2HU9A 3RZOI 3S2HI 3J80b 2JNYA 1KRLA 1Z02A 4BY7I 1FDIA 4DGLA 2BJOA 1VQ7Z 2R7ZI 1VQ9Z 1S721 4TNUA 3CC41 2VUGA 1YJNZ 1W2BZ 4A3II 3CXCZ 3I4NI 1P9NA 5D1OB 1VQLZ 3IF8A 1RO0A 1WJ2A 3HOZI 3G4S1 4HH4A 3NH4A 3CCJZ 1RO2A 3CXCY 1KQSZ 3CCEZ 2VPYA 4NBHA 2JA7I 1SFOI 1VQO1 1KQSY 2AYDA 1VQ91 2JR6A 2OOXB 1YJN1 1Q812 2P3YA 1VQM1 1VQL1 3S1NI 1R9TI 1WW9A 1YIJZ 2JMOA 1QXFA 4NBBA 4NBDA 3CCE1 4NBAA 5AN9F 1VLAA 2OOYB 3VMIA 3ESWA 5FLXf 1M902 2JIMA 3D6WA 2JIQA 2AKLA 5C4XI 4MD8A 3CMAZ 1YUAA 1QVFY 2F4MA 3VMHA 1YHQZ 3CCV1 1YI21 1NJI1 2GTHA 3D9XA 2RHBA 1QF8A 4X6AI 1DL6A 4NH1C 3CC71 1VQ81 3CCQZ 3Q87A 1KD11 2JIRA 1JWHC 3CPWZ 4A3LI 3NDIA 2IZ3A 2OTJ1 4NBFA 1Q7Y2 1X3ZA 3CC2Z 2VPZA 1Y1VI 5IT9b 2NVXI 1YHQ1 3GTKI 1VQN1 1TWCI 3CCMZ 3JAMf 3S17I 1VQPZ 1YITZ 2IZ4A 1Z01A 1RLYA 5D1OA 1VQ4Z 2NVTI 1L1OC 5C3EI 3H3VJ 2NVQI 1K732 1ZB9A 2KI7B 3EERA 3FQQA 2RBLA 2V8IA 2VPXA 5A2Qb 4A3DI 4E30A 4BBSI 2QRCB 3S1QI 3FKII 1YJ9Z 3QWUA 1YJWZ 2B63I 3KIHA 2G2KA 1RQFA 2GU2A 1JJ2Y 1YIT1 2QA4Z 1RO4A 1AA6A 4EWCA 3CCRZ 1N8R1 2R6MA 2E2HI 2E2II 2V3VA 3NH5A 5D1PA 1QVGZ 2K3RA 4BY1I 1M1K1 3PO3S 1Q861 2E7ZA 3CMEZ 1SIWA 3J81f 5IP7I 1W2BY 1QVGY 3CD6Z 1K8A1 4MH4A 4HGYA 2QEXZ 1VQ71 3BG1B 2M6NA 4NBGA 2QA41 3GTQI 4MD9A 3F3FC 4NB8A 2F4OA 4E2WA 4QTTA 1TWHI 2OTLZ 1K9M1 3CME1 1Q822 1USPB 3MZLB 4CL1A 3CCJ1 2O4HA 3HOXI 4NOZA 2K5RA 3MZKB 1KC82 1LQLA 2QRDB 4NB9A 3G71Z 4RVFA 1QYPA 3CCSZ 1Y8CA 1I3QI 3S2DI 3NDJA 4A3BI 4NBCA 1TWGI 3D2LA 3VB9A 3M3YI 3K7AI 2V8KA 3CCUZ 2Q4ZA 3NFZA 2E9HA 4S1TA 2W03A 1YIJ1 1WIIA 3HOYI
chains in the Genus database with same CATH topology
3G711 5FLXb 3I55Z 4A93I 4RVDA 3CCS1 3LUSA 3FQMA 3GTMS 3J7A4 4A3FI 1ZH1A 3OW2Z 3CCU1 1Q811 3I4MI 2Y0SA 3CMA1 3CPWY 1ZB8A 4RS4A 1N2FA 3GTOI 3S14I 3RZDI 3OW2Y 1VQ5Z 2PK7A 3I56Z 3CCQ1 2DE7A 2PMZA 2P28A 4BXXI 3I551 3TDHB 3GTPI 3GTJI 1M901 2J6AA 3CCLZ 2LFUA 2OZKA 3H0GI 2KPIA 4AYBA 3NH8A 2VF1A 2O53A 2YU9I 3J80f 3CC21 4A3JI 3MONA 2EGTA 3VTNA 3GTGI 2NVYI 3VMGA 3JAMb 4NFRA 3CCM1 1VQP1 5T6BA 3CC4Z 3I07A 3S15I 2QREB 4MXUA 1VQ41 1RNIA 1X0TA 3BG0B 3G4SZ 2JA8I 1WCMI 3CCL1 1USPA 2DE6A 2M48A 2YADA 2RT9A 2JUBA 3S1MI 4E33A 4MONA 1Q7Y1 3P5JB 1YJ91 5FLMI 1VQOZ 1YJW1 2LIYA 2ZAEB 2DE5A 4A3EI 1Z03A 2H85A 5C4JI 4QTUA 4A3MI 3CCR1 1VQMZ 4HGZA 3KIFA 2WB1A 2JA5I 3EEDA 1X3WA 1VQKZ 4A3CI 1K731 1NJI2 3GKQA 1NP6A 3J81b 1KD12 5C44I 3GTLI 4XX2A 2W04A 1TFIA 2R93I 4E2XA 3CD61 2QKDA 3U50C 2QEX1 4DQYB 1S7MA 1TWAI 4RV9A 3S16I 4MRIA 3CCVZ 1VQK1 1YI2Z 2R92I 1Y1VS 3PO3I 4A3GI 3CC7Z 1VQ8Z 2QR1B 2OTL1 2JA6I 4RVHA 5IP9I 4NBEA 5LL6f 5T67A 4DK1A 1YUKA 3HOVI 1QVFZ 1VQ6Z 2Q51A 2OTJZ 3M4OI 4RVGA 1I6HI 4BBRI 2VUMI 3G6EZ 3GCFA 1ML8A 5IT9f 1VQNZ 1TWFI 2RPRA 4E2YA 2GTIA 1Q821 4E32A 1N8R2 1KC81 2I3CA 3CQZI 3T4NB 3HOWI 2JS4A 3TE5B 1VQ61 1M1K2 1Q862 2WAQA 1NUIA 5A2Qf 4E31A 3G6E1 3F3PC 2E2JI 5CM2M 1K8A2 3S1RI 1K83I 5T64A 1I50I 2HF1A 3IX0A 1Y1WI 3HOUI 2RIQA 1VQ51 1S72Z 3I561 4A3KI 3IFUA 3HKZA 4E2ZA 2V8JA 1PFTA 2PM9A 2QLVB 3GTMI 3PO2I 1K9M2 4Y52I 1JJ2Z 4MD7A 4Y7NI 2HU9A 3RZOI 3S2HI 3J80b 2JNYA 1KRLA 1Z02A 4BY7I 4DGLA 2BJOA 1VQ7Z 2R7ZI 1VQ9Z 1S721 4TNUA 3CC41 2VUGA 1YJNZ 1W2BZ 4A3II 3CXCZ 3I4NI 1P9NA 5D1OB 1VQLZ 3IF8A 1RO0A 3HOZI 3G4S1 4HH4A 3NH4A 3CCJZ 1RO2A 3CXCY 1KQSZ 3CCEZ 4NBHA 2JA7I 1SFOI 1VQO1 1KQSY 1VQ91 2JR6A 2OOXB 1YJN1 1Q812 2P3YA 1VQM1 1VQL1 3S1NI 1R9TI 1WW9A 1YIJZ 2JMOA 4NBBA 4NBDA 3CCE1 4NBAA 5AN9F 1VLAA 2OOYB 3VMIA 3ESWA 5FLXf 1M902 3D6WA 2AKLA 5C4XI 4MD8A 3CMAZ 1YUAA 1QVFY 2F4MA 3VMHA 1YHQZ 3CCV1 1YI21 1NJI1 2GTHA 3D9XA 2RHBA 1QF8A 4X6AI 1DL6A 4NH1C 3CC71 1VQ81 3CCQZ 3Q87A 1KD11 1JWHC 3CPWZ 4A3LI 3NDIA 2IZ3A 2OTJ1 4NBFA 1Q7Y2 1X3ZA 3CC2Z 1Y1VI 5IT9b 2NVXI 1YHQ1 3GTKI 1VQN1 1TWCI 3CCMZ 3JAMf 3S17I 1VQPZ 1YITZ 2IZ4A 1Z01A 1RLYA 5D1OA 1VQ4Z 2NVTI 1L1OC 5C3EI 3H3VJ 2NVQI 1K732 1ZB9A 2KI7B 3EERA 3FQQA 2RBLA 2V8IA 5A2Qb 4A3DI 4E30A 4BBSI 2QRCB 3S1QI 3FKII 1YJ9Z 3QWUA 1YJWZ 2B63I 3KIHA 2G2KA 1RQFA 2GU2A 1JJ2Y 1YIT1 2QA4Z 1RO4A 4EWCA 3CCRZ 1N8R1 2R6MA 2E2HI 2E2II 3NH5A 5D1PA 1QVGZ 2K3RA 4BY1I 1M1K1 3PO3S 1Q861 3CMEZ 3J81f 5IP7I 1W2BY 1QVGY 3CD6Z 1K8A1 4MH4A 4HGYA 2QEXZ 1VQ71 3BG1B 2M6NA 4NBGA 2QA41 3GTQI 4MD9A 3F3FC 4NB8A 2F4OA 4E2WA 4QTTA 1TWHI 2OTLZ 1K9M1 3CME1 1Q822 1USPB 3MZLB 4CL1A 3CCJ1 2O4HA 3HOXI 4NOZA 2K5RA 3MZKB 1KC82 1LQLA 2QRDB 4NB9A 3G71Z 4RVFA 1QYPA 3CCSZ 1I3QI 3S2DI 3NDJA 4A3BI 4NBCA 1TWGI 3VB9A 3M3YI 3K7AI 2V8KA 3CCUZ 2Q4ZA 3NFZA 2E9HA 4S1TA 2W03A 1YIJ1 1WIIA 3HOYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  1RLY A;  4A93 I;  3LUS A;  2NVT I;  1L1O C;  5C3E I;  3H3V J;  2NVQ I;  4A3I I;  1TWA I;  1ZB9 A;  3GTM S;  3EER A;  3I4N I;  2RBL A;  3S16 I;  4A3F I;  3HOZ I;  2R92 I;  4A3D I;  1Y1V S;  3I4M I;  3PO3 I;  4BBS I;  1ZB8 A;  4A3G I;  3S1Q I;  3FKI I;  1N2F A;  3GTO I;  2JA6 I;  2B63 I;  3S14 I;  4NBH A;  3RZD I;  5IP9 I;  4NBE A;  2JA7 I;  2PK7 A;  1SFO I;  2DE7 A;  1RO4 A;  3HOV I;  4BXX I;  3GTP I;  3GTJ I;  2J6A A;  2E2H I;  2JR6 A;  2E2I I;  3M4O I;  2P3Y A;  1I6H I;  4BBR I;  3H0G I;  2VUM I;  4BY1 I;  3PO3 S;  2KPI A;  3S1N I;  3GCF A;  1ML8 A;  1TWF I;  1R9T I;  1WW9 A;  5IP7 I;  2YU9 I;  4A3J I;  4NBB A;  4NBD A;  3GTG I;  4NBA A;  2NVY I;  3VMG A;  4MH4 A;  1VLA A;  3VMI A;  3ESW A;  4NBG A;  3CQZ I;  3I07 A;  3S15 I;  3GTQ I;  3HOW I;  2JS4 A;  3D6W A;  4NB8 A;  2AKL A;  5C4X I;  2F4O A;  2JA8 I;  1NUI A;  1WCM I;  4QTT A;  1USP A;  2DE6 A;  1YUA A;  1TWH I;  2F4M A;  3VMH A;  3S1M I;  2E2J I;  5CM2 M;  1USP B;  3S1R I;  3HOX I;  4X6A I;  1K83 I;  2K5R A;  4NOZ A;  1DL6 A;  1I50 I;  2HF1 A;  3Q87 A;  5FLM I;  1Y1W I;  3HOU I;  1LQL A;  4NB9 A;  2DE5 A;  4A3E I;  4A3K I;  1QYP A;  1I3Q I;  3S2D I;  4A3B I;  5C4J I;  4A3L I;  4QTU A;  4A3M I;  4NBC A;  1TWG I;  1PFT A;  3VB9 A;  3M3Y I;  4NBF A;  3K7A I;  2JA5 I;  1X3W A;  3GTM I;  3PO2 I;  4A3C I;  4Y52 I;  1X3Z A;  3GKQ A;  4Y7N I;  1Y1V I;  3RZO I;  2NVX I;  3S2H I;  3GTK I;  2JNY A;  5C44 I;  3GTL I;  4XX2 A;  1TWC I;  4BY7 I;  1TFI A;  3S17 I;  2BJO A;  3HOY I;  2R7Z I;  2R93 I; 
#chains in the Genus database with same CATH topology
 3G71 1;  5FLX b;  3I55 Z;  4A93 I;  4RVD A;  3CCS 1;  3LUS A;  3FQM A;  3GTM S;  3J7A 4;  4A3F I;  1ZH1 A;  3OW2 Z;  3CCU 1;  1Q81 1;  3I4M I;  2Y0S A;  3CMA 1;  3CPW Y;  1ZB8 A;  1FDO A;  4RS4 A;  1N2F A;  3GTO I;  3S14 I;  3RZD I;  3OW2 Y;  1VQ5 Z;  2PK7 A;  3I56 Z;  2V45 A;  3CCQ 1;  2DE7 A;  2PMZ A;  2P28 A;  4BXX I;  3I55 1;  3TDH B;  3GTP I;  3GTJ I;  2LEX A;  2J6A A;  1M90 1;  3CCL Z;  2LFU A;  2OZK A;  3H0G I;  2KPI A;  4AYB A;  3NH8 A;  2VF1 A;  2O53 A;  2YU9 I;  3J80 f;  3CC2 1;  4A3J I;  3MON A;  2EGT A;  3VTN A;  3GTG I;  2NVY I;  3VMG A;  3JAM b;  4NFR A;  3CCM 1;  1VQP 1;  5T6B A;  2NAP A;  3CC4 Z;  3I07 A;  3S15 I;  2QRE B;  4MXU A;  1VQ4 1;  1RNI A;  1X0T A;  3BG0 B;  3G4S Z;  2JA8 I;  1WCM I;  3CCL 1;  1USP A;  2DE6 A;  2M48 A;  2JIP A;  2YAD A;  2RT9 A;  2JUB A;  3S1M I;  4E33 A;  4MON A;  1Q7Y 1;  3P5J B;  1YJ9 1;  5FLM I;  1VQO Z;  1YJW 1;  2LIY A;  2ZAE B;  2DE5 A;  4A3E I;  2JIO A;  1Z03 A;  2H85 A;  5C4J I;  4QTU A;  4A3M I;  3CCR 1;  1VQM Z;  4HGZ A;  3KIF A;  2WB1 A;  2JA5 I;  3EED A;  1X3W A;  1VQK Z;  4A3C I;  1K73 1;  1NJI 2;  3GKQ A;  1NP6 A;  3J81 b;  1KD1 2;  5C44 I;  3GTL I;  4XX2 A;  2W04 A;  1TFI A;  2R93 I;  4E2X A;  3CD6 1;  1WZN A;  2QKD A;  3U50 C;  2QEX 1;  4DQY B;  2IV2 X;  1S7M A;  1TWA I;  1Q16 A;  4RV9 A;  3S16 I;  4MRI A;  3CCV Z;  1VQK 1;  1YI2 Z;  2R92 I;  1Y1V S;  3PO3 I;  4A3G I;  3CC7 Z;  1VQ8 Z;  2QR1 B;  2OTL 1;  2JA6 I;  4RVH A;  5IP9 I;  4NBE A;  5LL6 f;  5T67 A;  4DK1 A;  1YUK A;  3HOV I;  1QVF Z;  1VQ6 Z;  2Q51 A;  2OTJ Z;  3M4O I;  4RVG A;  1I6H I;  4BBR I;  2VUM I;  3G6E Z;  3GCF A;  1ML8 A;  5IT9 f;  1VQN Z;  1TWF I;  2RPR A;  4E2Y A;  2GTI A;  1Q82 1;  4E32 A;  1N8R 2;  1KC8 1;  2I3C A;  3CQZ I;  3T4N B;  3HOW I;  2JS4 A;  3TE5 B;  1VQ6 1;  1M1K 2;  1Q86 2;  2WAQ A;  1NUI A;  5A2Q f;  4E31 A;  3G6E 1;  3F3P C;  2E2J I;  5CM2 M;  1K8A 2;  3S1R I;  1K83 I;  5T64 A;  1I50 I;  2HF1 A;  3IX0 A;  1Y1W I;  3HOU I;  3IR7 A;  2RIQ A;  1VQ5 1;  1S72 Z;  3I56 1;  4A3K I;  2VPW A;  3IFU A;  3HKZ A;  4E2Z A;  2V8J A;  1PFT A;  2PM9 A;  2QLV B;  3GTM I;  3PO2 I;  1K9M 2;  4Y52 I;  1JJ2 Z;  4MD7 A;  4Y7N I;  2HU9 A;  3RZO I;  3S2H I;  3J80 b;  2JNY A;  1KRL A;  1Z02 A;  4BY7 I;  1FDI A;  4DGL A;  2BJO A;  1VQ7 Z;  2R7Z I;  1VQ9 Z;  1S72 1;  4TNU A;  3CC4 1;  2VUG A;  1YJN Z;  1W2B Z;  4A3I I;  3CXC Z;  3I4N I;  1P9N A;  5D1O B;  1VQL Z;  3IF8 A;  1RO0 A;  1WJ2 A;  3HOZ I;  3G4S 1;  4HH4 A;  3NH4 A;  3CCJ Z;  1RO2 A;  3CXC Y;  1KQS Z;  3CCE Z;  2VPY A;  4NBH A;  2JA7 I;  1SFO I;  1VQO 1;  1KQS Y;  2AYD A;  1VQ9 1;  2JR6 A;  2OOX B;  1YJN 1;  1Q81 2;  2P3Y A;  1VQM 1;  1VQL 1;  3S1N I;  1R9T I;  1WW9 A;  1YIJ Z;  2JMO A;  1QXF A;  4NBB A;  4NBD A;  3CCE 1;  4NBA A;  5AN9 F;  1VLA A;  2OOY B;  3VMI A;  3ESW A;  5FLX f;  1M90 2;  2JIM A;  3D6W A;  2JIQ A;  2AKL A;  5C4X I;  4MD8 A;  3CMA Z;  1YUA A;  1QVF Y;  2F4M A;  3VMH A;  1YHQ Z;  3CCV 1;  1YI2 1;  1NJI 1;  2GTH A;  3D9X A;  2RHB A;  1QF8 A;  4X6A I;  1DL6 A;  4NH1 C;  3CC7 1;  1VQ8 1;  3CCQ Z;  3Q87 A;  1KD1 1;  2JIR A;  1JWH C;  3CPW Z;  4A3L I;  3NDI A;  2IZ3 A;  2OTJ 1;  4NBF A;  1Q7Y 2;  1X3Z A;  3CC2 Z;  2VPZ A;  1Y1V I;  5IT9 b;  2NVX I;  1YHQ 1;  3GTK I;  1VQN 1;  1TWC I;  3CCM Z;  3JAM f;  3S17 I;  1VQP Z;  1YIT Z;  2IZ4 A;  1Z01 A;  1RLY A;  5D1O A;  1VQ4 Z;  2NVT I;  1L1O C;  5C3E I;  3H3V J;  2NVQ I;  1K73 2;  1ZB9 A;  2KI7 B;  3EER A;  3FQQ A;  2RBL A;  2V8I A;  2VPX A;  5A2Q b;  4A3D I;  4E30 A;  4BBS I;  2QRC B;  3S1Q I;  3FKI I;  1YJ9 Z;  3QWU A;  1YJW Z;  2B63 I;  3KIH A;  2G2K A;  1RQF A;  2GU2 A;  1JJ2 Y;  1YIT 1;  2QA4 Z;  1RO4 A;  1AA6 A;  4EWC A;  3CCR Z;  1N8R 1;  2R6M A;  2E2H I;  2E2I I;  2V3V A;  3NH5 A;  5D1P A;  1QVG Z;  2K3R A;  4BY1 I;  1M1K 1;  3PO3 S;  1Q86 1;  2E7Z A;  3CME Z;  1SIW A;  3J81 f;  5IP7 I;  1W2B Y;  1QVG Y;  3CD6 Z;  1K8A 1;  4MH4 A;  4HGY A;  2QEX Z;  1VQ7 1;  3BG1 B;  2M6N A;  4NBG A;  2QA4 1;  3GTQ I;  4MD9 A;  3F3F C;  4NB8 A;  2F4O A;  4E2W A;  4QTT A;  1TWH I;  2OTL Z;  1K9M 1;  3CME 1;  1Q82 2;  1USP B;  3MZL B;  4CL1 A;  3CCJ 1;  2O4H A;  3HOX I;  4NOZ A;  2K5R A;  3MZK B;  1KC8 2;  1LQL A;  2QRD B;  4NB9 A;  3G71 Z;  4RVF A;  1QYP A;  3CCS Z;  1Y8C A;  1I3Q I;  3S2D I;  3NDJ A;  4A3B I;  4NBC A;  1TWG I;  3D2L A;  3VB9 A;  3M3Y I;  3K7A I;  2V8K A;  3CCU Z;  2Q4Z A;  3NFZ A;  2E9H A;  4S1T A;  2W03 A;  1YIJ 1;  1WII A;  3HOY I; 
#chains in the Genus database with same CATH homology
 3G71 1;  5FLX b;  3I55 Z;  4A93 I;  4RVD A;  3CCS 1;  3LUS A;  3FQM A;  3GTM S;  3J7A 4;  4A3F I;  1ZH1 A;  3OW2 Z;  3CCU 1;  1Q81 1;  3I4M I;  2Y0S A;  3CMA 1;  3CPW Y;  1ZB8 A;  4RS4 A;  1N2F A;  3GTO I;  3S14 I;  3RZD I;  3OW2 Y;  1VQ5 Z;  2PK7 A;  3I56 Z;  3CCQ 1;  2DE7 A;  2PMZ A;  2P28 A;  4BXX I;  3I55 1;  3TDH B;  3GTP I;  3GTJ I;  1M90 1;  2J6A A;  3CCL Z;  2LFU A;  2OZK A;  3H0G I;  2KPI A;  4AYB A;  3NH8 A;  2VF1 A;  2O53 A;  2YU9 I;  3J80 f;  3CC2 1;  4A3J I;  3MON A;  2EGT A;  3VTN A;  3GTG I;  2NVY I;  3VMG A;  3JAM b;  4NFR A;  3CCM 1;  1VQP 1;  5T6B A;  3CC4 Z;  3I07 A;  3S15 I;  2QRE B;  4MXU A;  1VQ4 1;  1RNI A;  1X0T A;  3BG0 B;  3G4S Z;  2JA8 I;  1WCM I;  3CCL 1;  1USP A;  2DE6 A;  2M48 A;  2YAD A;  2RT9 A;  2JUB A;  3S1M I;  4E33 A;  4MON A;  1Q7Y 1;  3P5J B;  1YJ9 1;  5FLM I;  1VQO Z;  1YJW 1;  2LIY A;  2ZAE B;  2DE5 A;  4A3E I;  1Z03 A;  2H85 A;  5C4J I;  4QTU A;  4A3M I;  3CCR 1;  1VQM Z;  4HGZ A;  3KIF A;  2WB1 A;  2JA5 I;  3EED A;  1X3W A;  1VQK Z;  4A3C I;  1K73 1;  1NJI 2;  3GKQ A;  1NP6 A;  3J81 b;  1KD1 2;  5C44 I;  3GTL I;  4XX2 A;  2W04 A;  1TFI A;  2R93 I;  4E2X A;  3CD6 1;  2QKD A;  3U50 C;  2QEX 1;  4DQY B;  1S7M A;  1TWA I;  4RV9 A;  3S16 I;  4MRI A;  3CCV Z;  1VQK 1;  1YI2 Z;  2R92 I;  1Y1V S;  3PO3 I;  4A3G I;  3CC7 Z;  1VQ8 Z;  2QR1 B;  2OTL 1;  2JA6 I;  4RVH A;  5IP9 I;  4NBE A;  5LL6 f;  5T67 A;  4DK1 A;  1YUK A;  3HOV I;  1QVF Z;  1VQ6 Z;  2Q51 A;  2OTJ Z;  3M4O I;  4RVG A;  1I6H I;  4BBR I;  2VUM I;  3G6E Z;  3GCF A;  1ML8 A;  5IT9 f;  1VQN Z;  1TWF I;  2RPR A;  4E2Y A;  2GTI A;  1Q82 1;  4E32 A;  1N8R 2;  1KC8 1;  2I3C A;  3CQZ I;  3T4N B;  3HOW I;  2JS4 A;  3TE5 B;  1VQ6 1;  1M1K 2;  1Q86 2;  2WAQ A;  1NUI A;  5A2Q f;  4E31 A;  3G6E 1;  3F3P C;  2E2J I;  5CM2 M;  1K8A 2;  3S1R I;  1K83 I;  5T64 A;  1I50 I;  2HF1 A;  3IX0 A;  1Y1W I;  3HOU I;  2RIQ A;  1VQ5 1;  1S72 Z;  3I56 1;  4A3K I;  3IFU A;  3HKZ A;  4E2Z A;  2V8J A;  1PFT A;  2PM9 A;  2QLV B;  3GTM I;  3PO2 I;  1K9M 2;  4Y52 I;  1JJ2 Z;  4MD7 A;  4Y7N I;  2HU9 A;  3RZO I;  3S2H I;  3J80 b;  2JNY A;  1KRL A;  1Z02 A;  4BY7 I;  4DGL A;  2BJO A;  1VQ7 Z;  2R7Z I;  1VQ9 Z;  1S72 1;  4TNU A;  3CC4 1;  2VUG A;  1YJN Z;  1W2B Z;  4A3I I;  3CXC Z;  3I4N I;  1P9N A;  5D1O B;  1VQL Z;  3IF8 A;  1RO0 A;  3HOZ I;  3G4S 1;  4HH4 A;  3NH4 A;  3CCJ Z;  1RO2 A;  3CXC Y;  1KQS Z;  3CCE Z;  4NBH A;  2JA7 I;  1SFO I;  1VQO 1;  1KQS Y;  1VQ9 1;  2JR6 A;  2OOX B;  1YJN 1;  1Q81 2;  2P3Y A;  1VQM 1;  1VQL 1;  3S1N I;  1R9T I;  1WW9 A;  1YIJ Z;  2JMO A;  4NBB A;  4NBD A;  3CCE 1;  4NBA A;  5AN9 F;  1VLA A;  2OOY B;  3VMI A;  3ESW A;  5FLX f;  1M90 2;  3D6W A;  2AKL A;  5C4X I;  4MD8 A;  3CMA Z;  1YUA A;  1QVF Y;  2F4M A;  3VMH A;  1YHQ Z;  3CCV 1;  1YI2 1;  1NJI 1;  2GTH A;  3D9X A;  2RHB A;  1QF8 A;  4X6A I;  1DL6 A;  4NH1 C;  3CC7 1;  1VQ8 1;  3CCQ Z;  3Q87 A;  1KD1 1;  1JWH C;  3CPW Z;  4A3L I;  3NDI A;  2IZ3 A;  2OTJ 1;  4NBF A;  1Q7Y 2;  1X3Z A;  3CC2 Z;  1Y1V I;  5IT9 b;  2NVX I;  1YHQ 1;  3GTK I;  1VQN 1;  1TWC I;  3CCM Z;  3JAM f;  3S17 I;  1VQP Z;  1YIT Z;  2IZ4 A;  1Z01 A;  1RLY A;  5D1O A;  1VQ4 Z;  2NVT I;  1L1O C;  5C3E I;  3H3V J;  2NVQ I;  1K73 2;  1ZB9 A;  2KI7 B;  3EER A;  3FQQ A;  2RBL A;  2V8I A;  5A2Q b;  4A3D I;  4E30 A;  4BBS I;  2QRC B;  3S1Q I;  3FKI I;  1YJ9 Z;  3QWU A;  1YJW Z;  2B63 I;  3KIH A;  2G2K A;  1RQF A;  2GU2 A;  1JJ2 Y;  1YIT 1;  2QA4 Z;  1RO4 A;  4EWC A;  3CCR Z;  1N8R 1;  2R6M A;  2E2H I;  2E2I I;  3NH5 A;  5D1P A;  1QVG Z;  2K3R A;  4BY1 I;  1M1K 1;  3PO3 S;  1Q86 1;  3CME Z;  3J81 f;  5IP7 I;  1W2B Y;  1QVG Y;  3CD6 Z;  1K8A 1;  4MH4 A;  4HGY A;  2QEX Z;  1VQ7 1;  3BG1 B;  2M6N A;  4NBG A;  2QA4 1;  3GTQ I;  4MD9 A;  3F3F C;  4NB8 A;  2F4O A;  4E2W A;  4QTT A;  1TWH I;  2OTL Z;  1K9M 1;  3CME 1;  1Q82 2;  1USP B;  3MZL B;  4CL1 A;  3CCJ 1;  2O4H A;  3HOX I;  4NOZ A;  2K5R A;  3MZK B;  1KC8 2;  1LQL A;  2QRD B;  4NB9 A;  3G71 Z;  4RVF A;  1QYP A;  3CCS Z;  1I3Q I;  3S2D I;  3NDJ A;  4A3B I;  4NBC A;  1TWG I;  3VB9 A;  3M3Y I;  3K7A I;  2V8K A;  3CCU Z;  2Q4Z A;  3NFZ A;  2E9H A;  4S1T A;  2W03 A;  1YIJ 1;  1WII A;  3HOY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...