5IP9I

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip9I02
4A3MI 2JA7I 2JA8I 1N2FA 4A3FI 3GTKI 1RLYA 3D6WA 3GTMI 3GKQA 4A3DI 5C4JI 4NBCA 2DE5A 1YUAA 3S2HI 3HOXI 4NBGA 3K7AI 4X6AI 4NBBA 4A3JI 3I4MI 2RBLA 1Y1WI 2YU9I 1I50I 4QTUA 4BXXI 2E2JI 4A3II 1X3WA 4BBRI 4MH4A 3HOWI 4Y7NI 3H3VJ 1WCMI 4QTTA 2R93I 3HOUI 5CM2M 3GTQI 4A3GI 4NBDA 4NBAA 1I6HI 1TWAI 2NVYI 3VMHA 1X3ZA 2R7ZI 1PFTA 4NBEA 2JR6A 5IP9I 3GTGI 1L1OC 2JS4A 3S1NI 3HOYI 3U50C 4A3KI 1LQLA 4NOZA 1I3QI 1Y1VI 4A3LI 1K83I 2DE6A 3VMGA 3S16I 3PO3S 4Y52I 2DE7A 2P3YA 3FKII 4A3EI 1TWFI 3M3YI 4NB8A 3GTPI 1TFIA 3S14I 4BY1I 1WW9A 3CQZI 3RZOI 1DL6A 4A93I 2NVQI 5C44I 2E2II 2K5RA 4NBHA 4BY7I 4BBSI 2JNYA 3H0GI 3M4OI 1USPB 1VLAA 2KPIA 4XX2A 2F4OA 3RZDI 3I07A 1ZB8A 1RO4A 3S1RI 3S1QI 4A3CI 1R9TI 1TWGI 5C4XI 2J6AA 1SFOI 5C3EI 2JA5I 3PO2I 5IP7I 4A3BI 4NB9A 3I4NI 3GTMS 3S2DI 3S15I 2AKLA 3LUSA 2R92I 3HOVI 1TWCI 3S1MI 2E2HI 3PO3I 1ZB9A 2HF1A 3VB9A 4NBFA 3ESWA 3GCFA 1NUIA 3GTOI 2BJOA 1Y1VS 2PK7A 1QYPA 3Q87A 2VUMI 2NVXI 2F4MA 3GTJI 2B63I 2JA6I 3HOZI 2NVTI 5FLMI 1ML8A 3S17I 3VMIA 1TWHI 3EERA 3GTLI 1USPA
chains in the Genus database with same CATH superfamily
4HH4A 1YJNZ 5T64A 1YJWZ 1M1K1 5C4JI 1Q811 2IV2X 2WAQA 4HGYA 3K7AI 2RPRA 1YJ91 4A3JI 1I50I 4QTUA 1X3WA 3CD6Z 1FDIA 3H3VJ 1WZNA 3IR7A 4AYBA 4A3GI 3D2LA 2EGTA 4NBDA 2QRDB 4MRIA 4E32A 1TWAI 5T6BA 3F3FC 2OOYB 3GTGI 1K9M2 4HGZA 2PM9A 3NH8A 3S1NI 4A3KI 4DGLA 1VQ51 4A3LI 1JJ2Z 5LL6f 2RT9A 1VQPZ 4EWCA 4Y52I 2P3YA 2OTL1 4A3EI 4NB8A 1Q822 2ZAEB 2IZ4A 3RZOI 2PMZA 2NVQI 1YI21 1X0TA 1KQSY 3HKZA 2Q51A 3H0GI 2O4HA 2KPIA 3RZDI 2AYDA 4NH1C 1VQKZ 5FLXb 3S1RI 1TWGI 2Q4ZA 4MONA 3CC7Z 2JMOA 1VQ6Z 4RVFA 1RO0A 2I3CA 1W2BZ 3S2DI 2R92I 1S7MA 4MD8A 4E2YA 2E2HI 3G6EZ 3JAMb 3TDHB 2RIQA 1NUIA 2M48A 2IZ3A 3J80b 2NVXI 1VQL1 2V8KA 4S1TA 3GTJI 2JIQA 3CCL1 1YUKA 5FLMI 3CCMZ 2E7ZA 2W03A 3IFUA 3VMIA 1VQ7Z 3CMA1 2JA8I 3FQQA 4E30A 1VQN1 1VQ81 1N2FA 3VTNA 3J80f 2OTJZ 1RLYA 3D6WA 3GKQA 4A3DI 1Y8CA 1FDOA 3G711 3I55Z 2QEXZ 2VPXA 3HOXI 4NBGA 4X6AI 4NBBA 3I4MI 2RBLA 1Y1WI 3CCS1 4BXXI 2E2JI 4RV9A 1YJN1 4A3II 2LFUA 4E31A 3CCVZ 4MH4A 2W04A 5CM2M 3GTQI 3NDJA 4NBAA 4MXUA 2JR6A 2JUBA 1NJI2 2VUGA 5AN9F 3HOYI 3EEDA 3CD61 1I3QI 1Y1VI 2H85A 2JIRA 3IX0A 2QA41 1N8R2 4RVGA 3VMGA 3PO3S 3CC4Z 3QWUA 2OOXB 3FKII 1KQSZ 1K8A1 3CCQ1 1KC82 3S14I 1KD12 4A93I 5C44I 2E2II 3CC2Z 1VQO1 4BBSI 2JNYA 4XX2A 2F4OA 2GTHA 2OZKA 1ZB8A 1RO4A 1Q862 2J6AA 4RVHA 3PO2I 5IP7I 4NB9A 3LUSA 3T4NB 1YIT1 3J81b 4NBFA 1Q7Y2 3CMEZ 2K3RA 2BJOA 1Y1VS 4NFRA 1VQK1 1K732 2B63I 1QF8A 3CC71 3HOZI 1AA6A 1YIJZ 3S17I 3CCE1 1TWHI 2QLVB 3J81f 2JA7I 1M1K2 2NAPA 3G6E1 1Q812 1KD11 3GTKI 3CXCZ 3GTMI 5D1PA 1VQM1 5FLXf 3D9XA 2KI7B 2QRCB 3CCJZ 3BG1B 2DE5A 2M6NA 3S2HI 3CCM1 4DK1A 4RVDA 2G2KA 2YU9I 4E2WA 4BBRI 3JAMf 3HOWI 4Y7NI 4QTTA 3OW2Z 3HOUI 3CCR1 1N8R1 1S72Z 2QR1B 1YHQ1 3I551 2NVYI 1X3ZA 2QEX1 4E33A 1QVGY 5IP9I 1QVFY 1L1OC 2R6MA 2JS4A 3CXCY 3U50C 3G4S1 1LQLA 4NOZA 3TE5B 1K9M1 1VQ4Z 3CCLZ 3CCV1 1K83I 2DE6A 2QREB 3S16I 5IT9b 1SIWA 3I56Z 2V8JA 1Q16A 4E2XA 3CCUZ 3M3YI 1TFIA 1M902 1VQNZ 3CPWY 4BY1I 1YJW1 4CL1A 2V3VA 1Z02A 2K5RA 4NBHA 3F3PC 1Q821 3M4OI 3OW2Y 3NFZA 2RHBA 1USPB 1VLAA 3J7A4 1VQ9Z 4TNUA 3I07A 1R9TI 4DQYB 5C4XI 3CC41 3CCSZ 3NH5A 4A3BI 1KRLA 3I4NI 2AKLA 5A2Qb 3HOVI 1TWCI 3S1MI 3CC21 2VPWA 3MZKB 3KIFA 4RS4A 2Y0SA 3NH4A 3P5JB 3GTOI 2PK7A 2F4MA 1NP6A 2E9HA 1JWHC 2V45A 2JA6I 5A2Qf 1RQFA 1VQP1 3GTLI 1YJ9Z 4A3MI 2QA4Z 3MONA 2GU2A 2GTIA 3CCQZ 4A3FI 3BG0B 3IF8A 1ZH1A 3CME1 1QXFA 3NDIA 4NBCA 1VQOZ 1YIJ1 1YUAA 3KIHA 2P28A 1VQ61 1VQ5Z 2JIMA 2VF1A 3FQMA 1WCMI 2R93I 1QVGZ 2OTLZ 1QVFZ 1I6HI 1YITZ 1RO2A 3VMHA 3CCJ1 2R7ZI 1PFTA 4NBEA 1M901 1YI2Z 1VQ71 1NJI1 1K8A2 3CPWZ 3CCEZ 4MD9A 2DE7A 1TWFI 2OTJ1 1WJ2A 3MZLB 1S721 3GTPI 1JJ2Y 1RNIA 1WW9A 1P9NA 2VPZA 3CQZI 1DL6A 1Z03A 1KC81 4BY7I 1Z01A 1VQMZ 2LEXA 2JIPA 1VQ41 3S1QI 1VQLZ 4A3CI 2VPYA 5T67A 1SFOI 5C3EI 3I561 2JA5I 4E2ZA 3CCU1 1Q861 3GTMS 3S15I 3CMAZ 3CCRZ 3PO3I 1ZB9A 2HF1A 3VB9A 1VQ8Z 2WB1A 2LIYA 3ESWA 3GCFA 1W2BY 1YHQZ 5D1OB 2V8IA 4MD7A 1VQ91 1QYPA 3Q87A 2VUMI 3G71Z 2O53A 2QKDA 5IT9f 1Q7Y1 2HU9A 2JIOA 5D1OA 2NVTI 1ML8A 3G4SZ 1K731 2YADA 3EERA 1USPA 1WIIA
chains in the Genus database with same CATH topology
4HH4A 1YJNZ 5T64A 1YJWZ 1M1K1 5C4JI 1Q811 2WAQA 4HGYA 3K7AI 2RPRA 1YJ91 4A3JI 1I50I 4QTUA 1X3WA 3CD6Z 3H3VJ 4AYBA 4A3GI 4NBDA 2EGTA 2QRDB 4MRIA 4E32A 1TWAI 5T6BA 3F3FC 2OOYB 3GTGI 1K9M2 4HGZA 2PM9A 3NH8A 3S1NI 4A3KI 4DGLA 1VQ51 4A3LI 1JJ2Z 5LL6f 2RT9A 1VQPZ 4EWCA 4Y52I 2P3YA 2OTL1 4A3EI 4NB8A 1Q822 2ZAEB 2IZ4A 3RZOI 2PMZA 2NVQI 1YI21 1X0TA 1KQSY 3HKZA 2Q51A 3H0GI 2O4HA 2KPIA 3RZDI 4NH1C 1VQKZ 5FLXb 3S1RI 1TWGI 2Q4ZA 4MONA 3CC7Z 2JMOA 1VQ6Z 4RVFA 1RO0A 2I3CA 1W2BZ 3S2DI 2R92I 1S7MA 4MD8A 4E2YA 2E2HI 3G6EZ 3JAMb 3TDHB 2RIQA 1NUIA 2M48A 2IZ3A 3J80b 2NVXI 1VQL1 2V8KA 4S1TA 3GTJI 3CCL1 1YUKA 5FLMI 3CCMZ 2W03A 3IFUA 3VMIA 1VQ7Z 3CMA1 2JA8I 3FQQA 4E30A 1VQN1 1VQ81 1N2FA 3VTNA 3J80f 2OTJZ 1RLYA 3D6WA 3GKQA 4A3DI 3G711 3I55Z 2QEXZ 3HOXI 4NBGA 4X6AI 4NBBA 3I4MI 2RBLA 1Y1WI 3CCS1 4BXXI 2E2JI 4RV9A 1YJN1 4A3II 2LFUA 4E31A 3CCVZ 4MH4A 2W04A 5CM2M 3GTQI 3NDJA 4NBAA 4MXUA 2JR6A 2JUBA 1NJI2 2VUGA 5AN9F 3HOYI 3EEDA 3CD61 1I3QI 1Y1VI 2H85A 3IX0A 2QA41 1N8R2 4RVGA 3VMGA 3PO3S 3CC4Z 3QWUA 2OOXB 3FKII 1KQSZ 1K8A1 3CCQ1 1KC82 3S14I 1KD12 4A93I 5C44I 2E2II 3CC2Z 1VQO1 4BBSI 2JNYA 4XX2A 2F4OA 2GTHA 2OZKA 1ZB8A 1RO4A 1Q862 2J6AA 4RVHA 3PO2I 5IP7I 4NB9A 3LUSA 3T4NB 1YIT1 3J81b 4NBFA 1Q7Y2 3CMEZ 2K3RA 2BJOA 1Y1VS 4NFRA 1VQK1 1K732 2B63I 1QF8A 3CC71 3HOZI 1YIJZ 3S17I 3CCE1 1TWHI 2QLVB 3J81f 2JA7I 1M1K2 3G6E1 1Q812 1KD11 3GTKI 3CXCZ 3GTMI 5D1PA 1VQM1 5FLXf 3D9XA 2KI7B 2QRCB 3CCJZ 3BG1B 2DE5A 2M6NA 3S2HI 3CCM1 4DK1A 4RVDA 2G2KA 2YU9I 4E2WA 4BBRI 3JAMf 3HOWI 4Y7NI 4QTTA 3OW2Z 3HOUI 3CCR1 1N8R1 1S72Z 2QR1B 1YHQ1 3I551 2NVYI 1X3ZA 2QEX1 4E33A 1QVGY 5IP9I 1QVFY 1L1OC 2R6MA 2JS4A 3CXCY 3U50C 3G4S1 1LQLA 4NOZA 3TE5B 1K9M1 1VQ4Z 3CCLZ 3CCV1 1K83I 2DE6A 2QREB 3S16I 5IT9b 3I56Z 2V8JA 4E2XA 3CCUZ 3M3YI 1TFIA 1M902 1VQNZ 3CPWY 4BY1I 1YJW1 4CL1A 1Z02A 2K5RA 4NBHA 3F3PC 1Q821 3M4OI 3OW2Y 3NFZA 2RHBA 1USPB 1VLAA 3J7A4 1VQ9Z 4TNUA 3I07A 1R9TI 4DQYB 5C4XI 3CC41 3CCSZ 3NH5A 4A3BI 1KRLA 3I4NI 2AKLA 5A2Qb 3HOVI 1TWCI 3S1MI 3CC21 3MZKB 3KIFA 4RS4A 2Y0SA 3NH4A 3P5JB 3GTOI 2PK7A 2F4MA 1NP6A 2E9HA 1JWHC 2JA6I 5A2Qf 1RQFA 1VQP1 3GTLI 1YJ9Z 4A3MI 2QA4Z 3MONA 2GU2A 2GTIA 3CCQZ 4A3FI 3BG0B 3IF8A 1ZH1A 3CME1 3NDIA 4NBCA 1VQOZ 1YIJ1 1YUAA 3KIHA 2P28A 1VQ61 1VQ5Z 2VF1A 3FQMA 1WCMI 2R93I 1QVGZ 2OTLZ 1QVFZ 1I6HI 1YITZ 1RO2A 3VMHA 3CCJ1 2R7ZI 1PFTA 4NBEA 1M901 1YI2Z 1VQ71 1NJI1 1K8A2 3CPWZ 3CCEZ 4MD9A 2DE7A 1TWFI 2OTJ1 1S721 3MZLB 3GTPI 1JJ2Y 1RNIA 1WW9A 1P9NA 3CQZI 1DL6A 1Z03A 1KC81 4BY7I 1Z01A 1VQMZ 1VQ41 3S1QI 1VQLZ 4A3CI 5T67A 1SFOI 5C3EI 3I561 2JA5I 4E2ZA 3CCU1 1Q861 3GTMS 3S15I 3CMAZ 3CCRZ 3PO3I 1ZB9A 2HF1A 3VB9A 1VQ8Z 2WB1A 2LIYA 3ESWA 3GCFA 1W2BY 1YHQZ 5D1OB 2V8IA 4MD7A 1VQ91 1QYPA 3Q87A 2VUMI 3G71Z 2O53A 2QKDA 5IT9f 1Q7Y1 2HU9A 5D1OA 2NVTI 1ML8A 3G4SZ 1K731 2YADA 3EERA 1USPA 1WIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M I;  2JA7 I;  2JA8 I;  1N2F A;  4A3F I;  3GTK I;  1RLY A;  3D6W A;  3GTM I;  3GKQ A;  4A3D I;  5C4J I;  4NBC A;  2DE5 A;  1YUA A;  3S2H I;  3HOX I;  4NBG A;  3K7A I;  4X6A I;  4NBB A;  4A3J I;  3I4M I;  2RBL A;  1Y1W I;  2YU9 I;  1I50 I;  4QTU A;  4BXX I;  2E2J I;  4A3I I;  1X3W A;  4BBR I;  4MH4 A;  3HOW I;  4Y7N I;  3H3V J;  1WCM I;  4QTT A;  2R93 I;  3HOU I;  5CM2 M;  3GTQ I;  4A3G I;  4NBD A;  4NBA A;  1I6H I;  1TWA I;  2NVY I;  3VMH A;  1X3Z A;  2R7Z I;  1PFT A;  4NBE A;  2JR6 A;  5IP9 I;  3GTG I;  1L1O C;  2JS4 A;  3S1N I;  3HOY I;  3U50 C;  4A3K I;  1LQL A;  4NOZ A;  1I3Q I;  1Y1V I;  4A3L I;  1K83 I;  2DE6 A;  3VMG A;  3S16 I;  3PO3 S;  4Y52 I;  2DE7 A;  2P3Y A;  3FKI I;  4A3E I;  1TWF I;  3M3Y I;  4NB8 A;  3GTP I;  1TFI A;  3S14 I;  4BY1 I;  1WW9 A;  3CQZ I;  3RZO I;  1DL6 A;  4A93 I;  2NVQ I;  5C44 I;  2E2I I;  2K5R A;  4NBH A;  4BY7 I;  4BBS I;  2JNY A;  3H0G I;  3M4O I;  1USP B;  1VLA A;  2KPI A;  4XX2 A;  2F4O A;  3RZD I;  3I07 A;  1ZB8 A;  1RO4 A;  3S1R I;  3S1Q I;  4A3C I;  1R9T I;  1TWG I;  5C4X I;  2J6A A;  1SFO I;  5C3E I;  2JA5 I;  3PO2 I;  5IP7 I;  4A3B I;  4NB9 A;  3I4N I;  3GTM S;  3S2D I;  3S15 I;  2AKL A;  3LUS A;  2R92 I;  3HOV I;  1TWC I;  3S1M I;  2E2H I;  3PO3 I;  1ZB9 A;  2HF1 A;  3VB9 A;  4NBF A;  3ESW A;  3GCF A;  1NUI A;  3GTO I;  2BJO A;  1Y1V S;  2PK7 A;  1QYP A;  3Q87 A;  2VUM I;  2NVX I;  2F4M A;  3GTJ I;  2B63 I;  2JA6 I;  3HOZ I;  2NVT I;  5FLM I;  1ML8 A;  3S17 I;  3VMI A;  1TWH I;  3EER A;  3GTL I;  1USP A; 
#chains in the Genus database with same CATH topology
 4HH4 A;  1YJN Z;  5T64 A;  1YJW Z;  1M1K 1;  5C4J I;  1Q81 1;  2IV2 X;  2WAQ A;  4HGY A;  3K7A I;  2RPR A;  1YJ9 1;  4A3J I;  1I50 I;  4QTU A;  1X3W A;  3CD6 Z;  1FDI A;  3H3V J;  1WZN A;  3IR7 A;  4AYB A;  4A3G I;  3D2L A;  2EGT A;  4NBD A;  2QRD B;  4MRI A;  4E32 A;  1TWA I;  5T6B A;  3F3F C;  2OOY B;  3GTG I;  1K9M 2;  4HGZ A;  2PM9 A;  3NH8 A;  3S1N I;  4A3K I;  4DGL A;  1VQ5 1;  4A3L I;  1JJ2 Z;  5LL6 f;  2RT9 A;  1VQP Z;  4EWC A;  4Y52 I;  2P3Y A;  2OTL 1;  4A3E I;  4NB8 A;  1Q82 2;  2ZAE B;  2IZ4 A;  3RZO I;  2PMZ A;  2NVQ I;  1YI2 1;  1X0T A;  1KQS Y;  3HKZ A;  2Q51 A;  3H0G I;  2O4H A;  2KPI A;  3RZD I;  2AYD A;  4NH1 C;  1VQK Z;  5FLX b;  3S1R I;  1TWG I;  2Q4Z A;  4MON A;  3CC7 Z;  2JMO A;  1VQ6 Z;  4RVF A;  1RO0 A;  2I3C A;  1W2B Z;  3S2D I;  2R92 I;  1S7M A;  4MD8 A;  4E2Y A;  2E2H I;  3G6E Z;  3JAM b;  3TDH B;  2RIQ A;  1NUI A;  2M48 A;  2IZ3 A;  3J80 b;  2NVX I;  1VQL 1;  2V8K A;  4S1T A;  3GTJ I;  2JIQ A;  3CCL 1;  1YUK A;  5FLM I;  3CCM Z;  2E7Z A;  2W03 A;  3IFU A;  3VMI A;  1VQ7 Z;  3CMA 1;  2JA8 I;  3FQQ A;  4E30 A;  1VQN 1;  1VQ8 1;  1N2F A;  3VTN A;  3J80 f;  2OTJ Z;  1RLY A;  3D6W A;  3GKQ A;  4A3D I;  1Y8C A;  1FDO A;  3G71 1;  3I55 Z;  2QEX Z;  2VPX A;  3HOX I;  4NBG A;  4X6A I;  4NBB A;  3I4M I;  2RBL A;  1Y1W I;  3CCS 1;  4BXX I;  2E2J I;  4RV9 A;  1YJN 1;  4A3I I;  2LFU A;  4E31 A;  3CCV Z;  4MH4 A;  2W04 A;  5CM2 M;  3GTQ I;  3NDJ A;  4NBA A;  4MXU A;  2JR6 A;  2JUB A;  1NJI 2;  2VUG A;  5AN9 F;  3HOY I;  3EED A;  3CD6 1;  1I3Q I;  1Y1V I;  2H85 A;  2JIR A;  3IX0 A;  2QA4 1;  1N8R 2;  4RVG A;  3VMG A;  3PO3 S;  3CC4 Z;  3QWU A;  2OOX B;  3FKI I;  1KQS Z;  1K8A 1;  3CCQ 1;  1KC8 2;  3S14 I;  1KD1 2;  4A93 I;  5C44 I;  2E2I I;  3CC2 Z;  1VQO 1;  4BBS I;  2JNY A;  4XX2 A;  2F4O A;  2GTH A;  2OZK A;  1ZB8 A;  1RO4 A;  1Q86 2;  2J6A A;  4RVH A;  3PO2 I;  5IP7 I;  4NB9 A;  3LUS A;  3T4N B;  1YIT 1;  3J81 b;  4NBF A;  1Q7Y 2;  3CME Z;  2K3R A;  2BJO A;  1Y1V S;  4NFR A;  1VQK 1;  1K73 2;  2B63 I;  1QF8 A;  3CC7 1;  3HOZ I;  1AA6 A;  1YIJ Z;  3S17 I;  3CCE 1;  1TWH I;  2QLV B;  3J81 f;  2JA7 I;  1M1K 2;  2NAP A;  3G6E 1;  1Q81 2;  1KD1 1;  3GTK I;  3CXC Z;  3GTM I;  5D1P A;  1VQM 1;  5FLX f;  3D9X A;  2KI7 B;  2QRC B;  3CCJ Z;  3BG1 B;  2DE5 A;  2M6N A;  3S2H I;  3CCM 1;  4DK1 A;  4RVD A;  2G2K A;  2YU9 I;  4E2W A;  4BBR I;  3JAM f;  3HOW I;  4Y7N I;  4QTT A;  3OW2 Z;  3HOU I;  3CCR 1;  1N8R 1;  1S72 Z;  2QR1 B;  1YHQ 1;  3I55 1;  2NVY I;  1X3Z A;  2QEX 1;  4E33 A;  1QVG Y;  5IP9 I;  1QVF Y;  1L1O C;  2R6M A;  2JS4 A;  3CXC Y;  3U50 C;  3G4S 1;  1LQL A;  4NOZ A;  3TE5 B;  1K9M 1;  1VQ4 Z;  3CCL Z;  3CCV 1;  1K83 I;  2DE6 A;  2QRE B;  3S16 I;  5IT9 b;  1SIW A;  3I56 Z;  2V8J A;  1Q16 A;  4E2X A;  3CCU Z;  3M3Y I;  1TFI A;  1M90 2;  1VQN Z;  3CPW Y;  4BY1 I;  1YJW 1;  4CL1 A;  2V3V A;  1Z02 A;  2K5R A;  4NBH A;  3F3P C;  1Q82 1;  3M4O I;  3OW2 Y;  3NFZ A;  2RHB A;  1USP B;  1VLA A;  3J7A 4;  1VQ9 Z;  4TNU A;  3I07 A;  1R9T I;  4DQY B;  5C4X I;  3CC4 1;  3CCS Z;  3NH5 A;  4A3B I;  1KRL A;  3I4N I;  2AKL A;  5A2Q b;  3HOV I;  1TWC I;  3S1M I;  3CC2 1;  2VPW A;  3MZK B;  3KIF A;  4RS4 A;  2Y0S A;  3NH4 A;  3P5J B;  3GTO I;  2PK7 A;  2F4M A;  1NP6 A;  2E9H A;  1JWH C;  2V45 A;  2JA6 I;  5A2Q f;  1RQF A;  1VQP 1;  3GTL I;  1YJ9 Z;  4A3M I;  2QA4 Z;  3MON A;  2GU2 A;  2GTI A;  3CCQ Z;  4A3F I;  3BG0 B;  3IF8 A;  1ZH1 A;  3CME 1;  1QXF A;  3NDI A;  4NBC A;  1VQO Z;  1YIJ 1;  1YUA A;  3KIH A;  2P28 A;  1VQ6 1;  1VQ5 Z;  2JIM A;  2VF1 A;  3FQM A;  1WCM I;  2R93 I;  1QVG Z;  2OTL Z;  1QVF Z;  1I6H I;  1YIT Z;  1RO2 A;  3VMH A;  3CCJ 1;  2R7Z I;  1PFT A;  4NBE A;  1M90 1;  1YI2 Z;  1VQ7 1;  1NJI 1;  1K8A 2;  3CPW Z;  3CCE Z;  4MD9 A;  2DE7 A;  1TWF I;  2OTJ 1;  1WJ2 A;  3MZL B;  1S72 1;  3GTP I;  1JJ2 Y;  1RNI A;  1WW9 A;  1P9N A;  2VPZ A;  3CQZ I;  1DL6 A;  1Z03 A;  1KC8 1;  4BY7 I;  1Z01 A;  1VQM Z;  2LEX A;  2JIP A;  1VQ4 1;  3S1Q I;  1VQL Z;  4A3C I;  2VPY A;  5T67 A;  1SFO I;  5C3E I;  3I56 1;  2JA5 I;  4E2Z A;  3CCU 1;  1Q86 1;  3GTM S;  3S15 I;  3CMA Z;  3CCR Z;  3PO3 I;  1ZB9 A;  2HF1 A;  3VB9 A;  1VQ8 Z;  2WB1 A;  2LIY A;  3ESW A;  3GCF A;  1W2B Y;  1YHQ Z;  5D1O B;  2V8I A;  4MD7 A;  1VQ9 1;  1QYP A;  3Q87 A;  2VUM I;  3G71 Z;  2O53 A;  2QKD A;  5IT9 f;  1Q7Y 1;  2HU9 A;  2JIO A;  5D1O A;  2NVT I;  1ML8 A;  3G4S Z;  1K73 1;  2YAD A;  3EER A;  1USP A;  1WII A; 
#chains in the Genus database with same CATH homology
 4HH4 A;  1YJN Z;  5T64 A;  1YJW Z;  1M1K 1;  5C4J I;  1Q81 1;  2WAQ A;  4HGY A;  3K7A I;  2RPR A;  1YJ9 1;  4A3J I;  1I50 I;  4QTU A;  1X3W A;  3CD6 Z;  3H3V J;  4AYB A;  4A3G I;  4NBD A;  2EGT A;  2QRD B;  4MRI A;  4E32 A;  1TWA I;  5T6B A;  3F3F C;  2OOY B;  3GTG I;  1K9M 2;  4HGZ A;  2PM9 A;  3NH8 A;  3S1N I;  4A3K I;  4DGL A;  1VQ5 1;  4A3L I;  1JJ2 Z;  5LL6 f;  2RT9 A;  1VQP Z;  4EWC A;  4Y52 I;  2P3Y A;  2OTL 1;  4A3E I;  4NB8 A;  1Q82 2;  2ZAE B;  2IZ4 A;  3RZO I;  2PMZ A;  2NVQ I;  1YI2 1;  1X0T A;  1KQS Y;  3HKZ A;  2Q51 A;  3H0G I;  2O4H A;  2KPI A;  3RZD I;  4NH1 C;  1VQK Z;  5FLX b;  3S1R I;  1TWG I;  2Q4Z A;  4MON A;  3CC7 Z;  2JMO A;  1VQ6 Z;  4RVF A;  1RO0 A;  2I3C A;  1W2B Z;  3S2D I;  2R92 I;  1S7M A;  4MD8 A;  4E2Y A;  2E2H I;  3G6E Z;  3JAM b;  3TDH B;  2RIQ A;  1NUI A;  2M48 A;  2IZ3 A;  3J80 b;  2NVX I;  1VQL 1;  2V8K A;  4S1T A;  3GTJ I;  3CCL 1;  1YUK A;  5FLM I;  3CCM Z;  2W03 A;  3IFU A;  3VMI A;  1VQ7 Z;  3CMA 1;  2JA8 I;  3FQQ A;  4E30 A;  1VQN 1;  1VQ8 1;  1N2F A;  3VTN A;  3J80 f;  2OTJ Z;  1RLY A;  3D6W A;  3GKQ A;  4A3D I;  3G71 1;  3I55 Z;  2QEX Z;  3HOX I;  4NBG A;  4X6A I;  4NBB A;  3I4M I;  2RBL A;  1Y1W I;  3CCS 1;  4BXX I;  2E2J I;  4RV9 A;  1YJN 1;  4A3I I;  2LFU A;  4E31 A;  3CCV Z;  4MH4 A;  2W04 A;  5CM2 M;  3GTQ I;  3NDJ A;  4NBA A;  4MXU A;  2JR6 A;  2JUB A;  1NJI 2;  2VUG A;  5AN9 F;  3HOY I;  3EED A;  3CD6 1;  1I3Q I;  1Y1V I;  2H85 A;  3IX0 A;  2QA4 1;  1N8R 2;  4RVG A;  3VMG A;  3PO3 S;  3CC4 Z;  3QWU A;  2OOX B;  3FKI I;  1KQS Z;  1K8A 1;  3CCQ 1;  1KC8 2;  3S14 I;  1KD1 2;  4A93 I;  5C44 I;  2E2I I;  3CC2 Z;  1VQO 1;  4BBS I;  2JNY A;  4XX2 A;  2F4O A;  2GTH A;  2OZK A;  1ZB8 A;  1RO4 A;  1Q86 2;  2J6A A;  4RVH A;  3PO2 I;  5IP7 I;  4NB9 A;  3LUS A;  3T4N B;  1YIT 1;  3J81 b;  4NBF A;  1Q7Y 2;  3CME Z;  2K3R A;  2BJO A;  1Y1V S;  4NFR A;  1VQK 1;  1K73 2;  2B63 I;  1QF8 A;  3CC7 1;  3HOZ I;  1YIJ Z;  3S17 I;  3CCE 1;  1TWH I;  2QLV B;  3J81 f;  2JA7 I;  1M1K 2;  3G6E 1;  1Q81 2;  1KD1 1;  3GTK I;  3CXC Z;  3GTM I;  5D1P A;  1VQM 1;  5FLX f;  3D9X A;  2KI7 B;  2QRC B;  3CCJ Z;  3BG1 B;  2DE5 A;  2M6N A;  3S2H I;  3CCM 1;  4DK1 A;  4RVD A;  2G2K A;  2YU9 I;  4E2W A;  4BBR I;  3JAM f;  3HOW I;  4Y7N I;  4QTT A;  3OW2 Z;  3HOU I;  3CCR 1;  1N8R 1;  1S72 Z;  2QR1 B;  1YHQ 1;  3I55 1;  2NVY I;  1X3Z A;  2QEX 1;  4E33 A;  1QVG Y;  5IP9 I;  1QVF Y;  1L1O C;  2R6M A;  2JS4 A;  3CXC Y;  3U50 C;  3G4S 1;  1LQL A;  4NOZ A;  3TE5 B;  1K9M 1;  1VQ4 Z;  3CCL Z;  3CCV 1;  1K83 I;  2DE6 A;  2QRE B;  3S16 I;  5IT9 b;  3I56 Z;  2V8J A;  4E2X A;  3CCU Z;  3M3Y I;  1TFI A;  1M90 2;  1VQN Z;  3CPW Y;  4BY1 I;  1YJW 1;  4CL1 A;  1Z02 A;  2K5R A;  4NBH A;  3F3P C;  1Q82 1;  3M4O I;  3OW2 Y;  3NFZ A;  2RHB A;  1USP B;  1VLA A;  3J7A 4;  1VQ9 Z;  4TNU A;  3I07 A;  1R9T I;  4DQY B;  5C4X I;  3CC4 1;  3CCS Z;  3NH5 A;  4A3B I;  1KRL A;  3I4N I;  2AKL A;  5A2Q b;  3HOV I;  1TWC I;  3S1M I;  3CC2 1;  3MZK B;  3KIF A;  4RS4 A;  2Y0S A;  3NH4 A;  3P5J B;  3GTO I;  2PK7 A;  2F4M A;  1NP6 A;  2E9H A;  1JWH C;  2JA6 I;  5A2Q f;  1RQF A;  1VQP 1;  3GTL I;  1YJ9 Z;  4A3M I;  2QA4 Z;  3MON A;  2GU2 A;  2GTI A;  3CCQ Z;  4A3F I;  3BG0 B;  3IF8 A;  1ZH1 A;  3CME 1;  3NDI A;  4NBC A;  1VQO Z;  1YIJ 1;  1YUA A;  3KIH A;  2P28 A;  1VQ6 1;  1VQ5 Z;  2VF1 A;  3FQM A;  1WCM I;  2R93 I;  1QVG Z;  2OTL Z;  1QVF Z;  1I6H I;  1YIT Z;  1RO2 A;  3VMH A;  3CCJ 1;  2R7Z I;  1PFT A;  4NBE A;  1M90 1;  1YI2 Z;  1VQ7 1;  1NJI 1;  1K8A 2;  3CPW Z;  3CCE Z;  4MD9 A;  2DE7 A;  1TWF I;  2OTJ 1;  1S72 1;  3MZL B;  3GTP I;  1JJ2 Y;  1RNI A;  1WW9 A;  1P9N A;  3CQZ I;  1DL6 A;  1Z03 A;  1KC8 1;  4BY7 I;  1Z01 A;  1VQM Z;  1VQ4 1;  3S1Q I;  1VQL Z;  4A3C I;  5T67 A;  1SFO I;  5C3E I;  3I56 1;  2JA5 I;  4E2Z A;  3CCU 1;  1Q86 1;  3GTM S;  3S15 I;  3CMA Z;  3CCR Z;  3PO3 I;  1ZB9 A;  2HF1 A;  3VB9 A;  1VQ8 Z;  2WB1 A;  2LIY A;  3ESW A;  3GCF A;  1W2B Y;  1YHQ Z;  5D1O B;  2V8I A;  4MD7 A;  1VQ9 1;  1QYP A;  3Q87 A;  2VUM I;  3G71 Z;  2O53 A;  2QKD A;  5IT9 f;  1Q7Y 1;  2HU9 A;  5D1O A;  2NVT I;  1ML8 A;  3G4S Z;  1K73 1;  2YAD A;  3EER A;  1USP A;  1WII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...