5C3EI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI02
3HOYI 3HOVI 5C4XI 5C44I 3S17I 4A3CI 3GTQI 4Y52I 1R9TI 2NVYI 2JA8I 4BY1I 3I07A 2R92I 4A3EI 2DE7A 2DE6A 4NBGA 4A3BI 3GCFA 4NBHA 1K83I 1TWGI 4NBEA 3S1QI 1I6HI 2JS4A 2BJOA 3PO3S 2VUMI 4BY7I 3VB9A 3GTGI 3GTMS 2K5RA 3U50C 3S2DI 1TWAI 2E2HI 3S16I 1TFIA 4MH4A 3I4MI 2JR6A 1Y1VS 3K7AI 3HOUI 3FKII 2JNYA 3H0GI 3ESWA 1YUAA 1I50I 3HOWI 5IP9I 3GTLI 4BBSI 1SFOI 1X3ZA 4NBBA 2YU9I 2R93I 1I3QI 1WW9A 4NBFA 4A3KI 3PO3I 4A93I 2JA6I 2E2II 1QYPA 3M4OI 2P3YA 2JA7I 2E2JI 2F4MA 2R7ZI 4NBDA 1RLYA 1ZB9A 4NB8A 4A3JI 1Y1VI 4A3II 3RZOI 3GTPI 3S1RI 2RBLA 3GTJI 3S1NI 3S14I 3VMGA 5C4JI 2JA5I 1N2FA 4A3MI 1TWFI 4NBAA 3S1MI 1TWHI 4A3LI 4A3DI 3CQZI 3HOZI 2DE5A 5IP7I 1L1OC 3S2HI 3GTKI 2NVQI 1USPA 3VMHA 3RZDI 3I4NI 3GTMI 3S15I 3Q87A 4XX2A 2B63I 3VMIA 1DL6A 3HOXI 2NVTI 1ML8A 2NVXI 5CM2M 4BXXI 1NUIA 4NOZA 3GTOI 4A3GI 1VLAA 2KPIA 5FLMI 4QTUA 3PO2I 5C3EI 3H3VJ 4NBCA 1WCMI 3LUSA 3D6WA 4Y7NI 4QTTA 4X6AI 2HF1A 1RO4A 1Y1WI 1PFTA 3EERA 1TWCI 3GKQA 2AKLA 2J6AA 1USPB 1X3WA 2F4OA 4NB9A 3M3YI 4BBRI 1LQLA 4A3FI 1ZB8A 2PK7A
chains in the Genus database with same CATH superfamily
1WIIA 2OOYB 3G711 1Q862 1KC82 3I07A 1YUKA 2LEXA 2R92I 4HGYA 3CMAZ 4MRIA 3MZLB 2DE6A 4NBGA 4E31A 2VUMI 3GTMS 3HKZA 3F3PC 1SIWA 3S2DI 2RHBA 1Y1VS 3HOUI 3NFZA 3ESWA 3CCMZ 4BBSI 1SFOI 1X3ZA 2YADA 1RO2A 2YU9I 4A3KI 1VQLZ 3IX0A 2JIMA 1VQ7Z 3NDIA 2R7ZI 1ZB9A 2Q51A 3RZOI 3CME1 3S1RI 4RS4A 2VUGA 3I56Z 3S14I 2JA5I 2QEXZ 3CCLZ 1AA6A 2QLVB 4A3DI 2QREB 2VPXA 4E30A 1NP6A 3BG0B 3S2HI 3F3FC 2NVQI 1K9M1 1VQ9Z 1FDOA 3D2LA 1YJN1 3GTMI 4XX2A 1YI2Z 4RV9A 3CXCY 1RO0A 1QVFZ 1Q811 3HOXI 1Q812 1KQSZ 1VQKZ 4BXXI 3CC7Z 4NOZA 3CC2Z 3GTOI 3J81f 2KPIA 5FLMI 3TDHB 3H3VJ 2P28A 5A2Qf 3NH8A 1YHQ1 1W2BY 1S72Z 1VQ8Z 2O4HA 3CCR1 3CCSZ 2F4OA 4NB9A 5D1OB 5IT9b 2GTHA 2IZ4A 1P9NA 3GTQI 1R9TI 1VQN1 3MONA 4BY1I 4MXUA 2PMZA 2KI7B 1K83I 1I6HI 2OOXB 3VB9A 3CPWY 2K5RA 4TNUA 3BG1B 1RNIA 1VQL1 3I4MI 3K7AI 3CCJZ 3FKII 1YUAA 1I50I 5IP9I 1VQ5Z 1VQMZ 1Q861 1Z03A 1KC81 1QVGY 2R6MA 1ZH1A 4NBFA 4A93I 2E2II 1QYPA 1JJ2Y 5D1OA 2W03A 2E2JI 5FLXb 1QVGZ 4NBDA 1RLYA 1Y8CA 3T4NB 5AN9F 2Q4ZA 5T6BA 1YJWZ 2RBLA 1K8A2 2JIRA 2QA41 1N2FA 1QXFA 1TWFI 3P5JB 4A3LI 2H85A 3CCEZ 2JMOA 3NDJA 1YIJZ 2OTLZ 4NFRA 2RT9A 5LL6f 5IP7I 1L1OC 1JWHC 3GTKI 1USPA 3I4NI 2IV2X 5D1PA 3G6E1 2ZAEB 3QWUA 3Q87A 3J7A4 2VF1A 1YJ91 4RVHA 1QF8A 3JAMb 4EWCA 2EGTA 4E2YA 5CM2M 1VQO1 1VQ81 1YIT1 3CCU1 2V8KA 1VLAA 2RPRA 5C3EI 1Q7Y2 1WCMI 2V45A 3CCQZ 3CC4Z 3NH4A 1VQP1 4X6AI 3G71Z 1Y1WI 3EERA 3G4S1 3GKQA 3CD61 2JIPA 2OTJ1 4RVGA 1X3WA 3M3YI 1Q16A 3I551 2G2KA 3CCV1 2IZ3A 1LQLA 4A3FI 1ZB8A 1VQ61 3HOYI 5C4XI 3CXCZ 4Y52I 4A3CI 1N8R1 2NVYI 1N8R2 4RVFA 2AYDA 1Z02A 2LFUA 4AYBA 3GCFA 3KIHA 1KRLA 1TWGI 4NBEA 1WJ2A 2BJOA 2RIQA 1Q821 1Q822 2GU2A 3CMA1 3OW2Y 1TWAI 2VPZA 1RQFA 1TFIA 4MH4A 1W2BZ 2JR6A 2WAQA 2JNYA 3HOWI 3J80f 1WZNA 3GTLI 4RVDA 3OW2Z 4NBBA 3CMEZ 2QR1B 4E2ZA 1WW9A 3PO3I 1M901 1M902 3CCM1 4DQYB 2F4MA 4E32A 4NB8A 2HU9A 3TE5B 2QRDB 3GTJI 3S1NI 3VMGA 5C4JI 4A3MI 1YJNZ 1VQ71 3S1MI 4NBAA 3CPWZ 3IFUA 2E9HA 4DGLA 3CQZI 1NJI2 2DE5A 2M6NA 2WB1A 3D9XA 3I561 3VMHA 3RZDI 4HH4A 1M1K2 2QEX1 3CCL1 3S15I 4NH1C 2B63I 3VMIA 5IT9f 2K3RA 2QKDA 1VQ91 1YHQZ 1K8A1 1JJ2Z 2JUBA 1YI21 3FQMA 3PO2I 3CCRZ 4CL1A 1VQK1 2Y0SA 3CC71 3CC21 2PM9A 4NBCA 3LUSA 2VPYA 2E7ZA 4Y7NI 4QTTA 4E2WA 1PFTA 1VQNZ 1TWCI 2AKLA 1K731 1K732 2O53A 2W04A 4BBRI 1VQ4Z 1S721 2V8IA 2OZKA 3HOVI 5C44I 3S17I 2JA8I 3CCS1 4A3EI 4S1TA 3J81b 5FLXf 2DE7A 1Q7Y1 2VPWA 4A3BI 4NBHA 3S1QI 2JS4A 3KIFA 4HGZA 3NH5A 4BY7I 3PO3S 3GTGI 1X0TA 5A2Qb 2LIYA 3U50C 2QRCB 2E2HI 3S16I 2V8JA 3VTNA 3H0GI 1QVFY 2R93I 3EEDA 3J80b 1I3QI 3JAMf 1K9M2 1KQSY 3CCJ1 2JA6I 4MD9A 3M4OI 2QA4Z 1S7MA 1VQ51 2P3YA 2JA7I 1VQM1 3MZKB 4DK1A 1Y1VI 2JIQA 4A3II 4A3JI 3GTPI 3IR7A 3FQQA 2GTIA 4MONA 3G6EZ 1KD11 1KD12 1TWHI 2V3VA 1YJ9Z 4E33A 3HOZI 1YJW1 4MD7A 5T64A 1VQOZ 1YITZ 3CCUZ 3CCE1 1DL6A 1YIJ1 2OTL1 2NVTI 1ML8A 2NVXI 1NUIA 2M48A 2NAPA 4E2XA 1VQPZ 1Z01A 4A3GI 4QTUA 3G4SZ 3CD6Z 2I3CA 5T67A 1NJI1 2OTJZ 1VQ41 3I55Z 3CCVZ 3D6WA 1M1K1 4MD8A 1VQ6Z 2HF1A 1FDIA 1RO4A 2J6AA 1USPB 3CCQ1 2JIOA 3IF8A 3CC41 2PK7A
chains in the Genus database with same CATH topology
1WIIA 2OOYB 3G711 1Q862 1KC82 3I07A 1YUKA 2R92I 4HGYA 3CMAZ 4MRIA 3MZLB 2DE6A 4NBGA 4E31A 2VUMI 3GTMS 3HKZA 3F3PC 3S2DI 2RHBA 1Y1VS 3HOUI 3NFZA 3ESWA 3CCMZ 4BBSI 1SFOI 1X3ZA 2YADA 1RO2A 2YU9I 4A3KI 1VQLZ 3IX0A 1VQ7Z 3NDIA 2R7ZI 1ZB9A 2Q51A 3RZOI 3CME1 3S1RI 4RS4A 2VUGA 3I56Z 3S14I 2JA5I 2QEXZ 3CCLZ 2QLVB 4A3DI 2QREB 4E30A 1NP6A 3BG0B 3S2HI 3F3FC 2NVQI 1K9M1 1VQ9Z 1YJN1 3GTMI 4XX2A 1YI2Z 4RV9A 3CXCY 1RO0A 1QVFZ 1Q811 3HOXI 1Q812 1KQSZ 1VQKZ 4BXXI 3CC7Z 4NOZA 3CC2Z 3GTOI 3J81f 2KPIA 5FLMI 3TDHB 3H3VJ 2P28A 5A2Qf 3NH8A 1YHQ1 1W2BY 1S72Z 1VQ8Z 2O4HA 3CCR1 3CCSZ 2F4OA 4NB9A 5D1OB 5IT9b 2GTHA 2IZ4A 1P9NA 3GTQI 1R9TI 1VQN1 3MONA 4BY1I 4MXUA 2PMZA 2KI7B 1K83I 1I6HI 2OOXB 3VB9A 3CPWY 2K5RA 4TNUA 3BG1B 1RNIA 1VQL1 3I4MI 3K7AI 3CCJZ 3FKII 1YUAA 1I50I 5IP9I 1VQ5Z 1VQMZ 1Q861 1Z03A 1KC81 1QVGY 2R6MA 1ZH1A 4NBFA 4A93I 2E2II 1QYPA 1JJ2Y 5D1OA 2W03A 2E2JI 5FLXb 1QVGZ 4NBDA 1RLYA 3T4NB 5AN9F 2Q4ZA 5T6BA 1YJWZ 2RBLA 1K8A2 2QA41 1N2FA 1TWFI 3P5JB 4A3LI 2H85A 3CCEZ 2JMOA 3NDJA 1YIJZ 2OTLZ 4NFRA 2RT9A 5LL6f 5IP7I 1L1OC 1JWHC 3GTKI 1USPA 3I4NI 5D1PA 3G6E1 2ZAEB 3QWUA 3Q87A 3J7A4 2VF1A 1YJ91 4RVHA 1QF8A 3JAMb 4EWCA 2EGTA 4E2YA 5CM2M 1VQO1 1VQ81 1YIT1 3CCU1 2V8KA 1VLAA 2RPRA 5C3EI 1Q7Y2 1WCMI 3CCQZ 3CC4Z 3NH4A 1VQP1 4X6AI 3G71Z 1Y1WI 3EERA 3G4S1 3GKQA 3CD61 2OTJ1 4RVGA 1X3WA 3M3YI 3I551 2G2KA 3CCV1 2IZ3A 1LQLA 4A3FI 1ZB8A 1VQ61 3HOYI 5C4XI 3CXCZ 4Y52I 4A3CI 1N8R1 2NVYI 1N8R2 4RVFA 1Z02A 2LFUA 4AYBA 3GCFA 3KIHA 1KRLA 1TWGI 4NBEA 2BJOA 2RIQA 1Q821 1Q822 2GU2A 3CMA1 3OW2Y 1TWAI 1RQFA 1TFIA 4MH4A 1W2BZ 2JR6A 2WAQA 2JNYA 3HOWI 3J80f 3GTLI 4RVDA 3OW2Z 4NBBA 3CMEZ 2QR1B 4E2ZA 1WW9A 3PO3I 1M901 1M902 3CCM1 4DQYB 2F4MA 4E32A 4NB8A 2HU9A 3TE5B 2QRDB 3GTJI 3S1NI 3VMGA 5C4JI 4A3MI 1YJNZ 1VQ71 3S1MI 4NBAA 3CPWZ 3IFUA 2E9HA 4DGLA 3CQZI 1NJI2 2DE5A 2M6NA 2WB1A 3D9XA 3I561 3VMHA 3RZDI 4HH4A 1M1K2 2QEX1 3CCL1 3S15I 4NH1C 2B63I 3VMIA 5IT9f 2K3RA 2QKDA 1VQ91 1YHQZ 1K8A1 1JJ2Z 2JUBA 1YI21 3FQMA 3PO2I 3CCRZ 4CL1A 1VQK1 2Y0SA 3CC71 3CC21 2PM9A 4NBCA 3LUSA 4Y7NI 4QTTA 4E2WA 1PFTA 1VQNZ 1TWCI 2AKLA 1K731 1K732 2O53A 2W04A 4BBRI 1VQ4Z 1S721 2V8IA 2OZKA 3HOVI 5C44I 3S17I 2JA8I 3CCS1 4A3EI 4S1TA 3J81b 5FLXf 2DE7A 1Q7Y1 4A3BI 4NBHA 3S1QI 2JS4A 3KIFA 4HGZA 3NH5A 4BY7I 3PO3S 3GTGI 1X0TA 5A2Qb 2LIYA 3U50C 2QRCB 2E2HI 3S16I 2V8JA 3VTNA 3H0GI 1QVFY 2R93I 3EEDA 3J80b 1I3QI 3JAMf 1K9M2 1KQSY 3CCJ1 2JA6I 4MD9A 3M4OI 2QA4Z 1S7MA 1VQ51 2P3YA 2JA7I 1VQM1 3MZKB 4DK1A 1Y1VI 4A3JI 4A3II 3GTPI 3FQQA 2GTIA 4MONA 3G6EZ 1KD11 1KD12 1TWHI 1YJ9Z 4E33A 3HOZI 1YJW1 4MD7A 5T64A 1VQOZ 1YITZ 3CCUZ 3CCE1 1DL6A 1YIJ1 2OTL1 2NVTI 1ML8A 2NVXI 1NUIA 2M48A 4E2XA 1VQPZ 1Z01A 4A3GI 4QTUA 3G4SZ 3CD6Z 2I3CA 5T67A 1NJI1 2OTJZ 1VQ41 3I55Z 3CCVZ 3D6WA 1M1K1 4MD8A 1VQ6Z 2HF1A 1RO4A 2J6AA 1USPB 3CCQ1 3IF8A 3CC41 2PK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  3HOV I;  5C4X I;  5C44 I;  3S17 I;  4A3C I;  3GTQ I;  4Y52 I;  1R9T I;  2NVY I;  2JA8 I;  4BY1 I;  3I07 A;  2R92 I;  4A3E I;  2DE7 A;  2DE6 A;  4NBG A;  4A3B I;  3GCF A;  4NBH A;  1K83 I;  1TWG I;  4NBE A;  3S1Q I;  1I6H I;  2JS4 A;  2BJO A;  3PO3 S;  2VUM I;  4BY7 I;  3VB9 A;  3GTG I;  3GTM S;  2K5R A;  3U50 C;  3S2D I;  1TWA I;  2E2H I;  3S16 I;  1TFI A;  4MH4 A;  3I4M I;  2JR6 A;  1Y1V S;  3K7A I;  3HOU I;  3FKI I;  2JNY A;  3H0G I;  3ESW A;  1YUA A;  1I50 I;  3HOW I;  5IP9 I;  3GTL I;  4BBS I;  1SFO I;  1X3Z A;  4NBB A;  2YU9 I;  2R93 I;  1I3Q I;  1WW9 A;  4NBF A;  4A3K I;  3PO3 I;  4A93 I;  2JA6 I;  2E2I I;  1QYP A;  3M4O I;  2P3Y A;  2JA7 I;  2E2J I;  2F4M A;  2R7Z I;  4NBD A;  1RLY A;  1ZB9 A;  4NB8 A;  4A3J I;  1Y1V I;  4A3I I;  3RZO I;  3GTP I;  3S1R I;  2RBL A;  3GTJ I;  3S1N I;  3S14 I;  3VMG A;  5C4J I;  2JA5 I;  1N2F A;  4A3M I;  1TWF I;  4NBA A;  3S1M I;  1TWH I;  4A3L I;  4A3D I;  3CQZ I;  3HOZ I;  2DE5 A;  5IP7 I;  1L1O C;  3S2H I;  3GTK I;  2NVQ I;  1USP A;  3VMH A;  3RZD I;  3I4N I;  3GTM I;  3S15 I;  3Q87 A;  4XX2 A;  2B63 I;  3VMI A;  1DL6 A;  3HOX I;  2NVT I;  1ML8 A;  2NVX I;  5CM2 M;  4BXX I;  1NUI A;  4NOZ A;  3GTO I;  4A3G I;  1VLA A;  2KPI A;  5FLM I;  4QTU A;  3PO2 I;  5C3E I;  3H3V J;  4NBC A;  1WCM I;  3LUS A;  3D6W A;  4Y7N I;  4QTT A;  4X6A I;  2HF1 A;  1RO4 A;  1Y1W I;  1PFT A;  3EER A;  1TWC I;  3GKQ A;  2AKL A;  2J6A A;  1USP B;  1X3W A;  2F4O A;  4NB9 A;  3M3Y I;  4BBR I;  1LQL A;  4A3F I;  1ZB8 A;  2PK7 A; 
#chains in the Genus database with same CATH topology
 1WII A;  2OOY B;  3G71 1;  1Q86 2;  1KC8 2;  3I07 A;  1YUK A;  2LEX A;  2R92 I;  4HGY A;  3CMA Z;  4MRI A;  3MZL B;  2DE6 A;  4NBG A;  4E31 A;  2VUM I;  3GTM S;  3HKZ A;  3F3P C;  1SIW A;  3S2D I;  2RHB A;  1Y1V S;  3HOU I;  3NFZ A;  3ESW A;  3CCM Z;  4BBS I;  1SFO I;  1X3Z A;  2YAD A;  1RO2 A;  2YU9 I;  4A3K I;  1VQL Z;  3IX0 A;  2JIM A;  1VQ7 Z;  3NDI A;  2R7Z I;  1ZB9 A;  2Q51 A;  3RZO I;  3CME 1;  3S1R I;  4RS4 A;  2VUG A;  3I56 Z;  3S14 I;  2JA5 I;  2QEX Z;  3CCL Z;  1AA6 A;  2QLV B;  4A3D I;  2QRE B;  2VPX A;  4E30 A;  1NP6 A;  3BG0 B;  3S2H I;  3F3F C;  2NVQ I;  1K9M 1;  1VQ9 Z;  1FDO A;  3D2L A;  1YJN 1;  3GTM I;  4XX2 A;  1YI2 Z;  4RV9 A;  3CXC Y;  1RO0 A;  1QVF Z;  1Q81 1;  3HOX I;  1Q81 2;  1KQS Z;  1VQK Z;  4BXX I;  3CC7 Z;  4NOZ A;  3CC2 Z;  3GTO I;  3J81 f;  2KPI A;  5FLM I;  3TDH B;  3H3V J;  2P28 A;  5A2Q f;  3NH8 A;  1YHQ 1;  1W2B Y;  1S72 Z;  1VQ8 Z;  2O4H A;  3CCR 1;  3CCS Z;  2F4O A;  4NB9 A;  5D1O B;  5IT9 b;  2GTH A;  2IZ4 A;  1P9N A;  3GTQ I;  1R9T I;  1VQN 1;  3MON A;  4BY1 I;  4MXU A;  2PMZ A;  2KI7 B;  1K83 I;  1I6H I;  2OOX B;  3VB9 A;  3CPW Y;  2K5R A;  4TNU A;  3BG1 B;  1RNI A;  1VQL 1;  3I4M I;  3K7A I;  3CCJ Z;  3FKI I;  1YUA A;  1I50 I;  5IP9 I;  1VQ5 Z;  1VQM Z;  1Q86 1;  1Z03 A;  1KC8 1;  1QVG Y;  2R6M A;  1ZH1 A;  4NBF A;  4A93 I;  2E2I I;  1QYP A;  1JJ2 Y;  5D1O A;  2W03 A;  2E2J I;  5FLX b;  1QVG Z;  4NBD A;  1RLY A;  1Y8C A;  3T4N B;  5AN9 F;  2Q4Z A;  5T6B A;  1YJW Z;  2RBL A;  1K8A 2;  2JIR A;  2QA4 1;  1N2F A;  1QXF A;  1TWF I;  3P5J B;  4A3L I;  2H85 A;  3CCE Z;  2JMO A;  3NDJ A;  1YIJ Z;  2OTL Z;  4NFR A;  2RT9 A;  5LL6 f;  5IP7 I;  1L1O C;  1JWH C;  3GTK I;  1USP A;  3I4N I;  2IV2 X;  5D1P A;  3G6E 1;  2ZAE B;  3QWU A;  3Q87 A;  3J7A 4;  2VF1 A;  1YJ9 1;  4RVH A;  1QF8 A;  3JAM b;  4EWC A;  2EGT A;  4E2Y A;  5CM2 M;  1VQO 1;  1VQ8 1;  1YIT 1;  3CCU 1;  2V8K A;  1VLA A;  2RPR A;  5C3E I;  1Q7Y 2;  1WCM I;  2V45 A;  3CCQ Z;  3CC4 Z;  3NH4 A;  1VQP 1;  4X6A I;  3G71 Z;  1Y1W I;  3EER A;  3G4S 1;  3GKQ A;  3CD6 1;  2JIP A;  2OTJ 1;  4RVG A;  1X3W A;  3M3Y I;  1Q16 A;  3I55 1;  2G2K A;  3CCV 1;  2IZ3 A;  1LQL A;  4A3F I;  1ZB8 A;  1VQ6 1;  3HOY I;  5C4X I;  3CXC Z;  4Y52 I;  4A3C I;  1N8R 1;  2NVY I;  1N8R 2;  4RVF A;  2AYD A;  1Z02 A;  2LFU A;  4AYB A;  3GCF A;  3KIH A;  1KRL A;  1TWG I;  4NBE A;  1WJ2 A;  2BJO A;  2RIQ A;  1Q82 1;  1Q82 2;  2GU2 A;  3CMA 1;  3OW2 Y;  1TWA I;  2VPZ A;  1RQF A;  1TFI A;  4MH4 A;  1W2B Z;  2JR6 A;  2WAQ A;  2JNY A;  3HOW I;  3J80 f;  1WZN A;  3GTL I;  4RVD A;  3OW2 Z;  4NBB A;  3CME Z;  2QR1 B;  4E2Z A;  1WW9 A;  3PO3 I;  1M90 1;  1M90 2;  3CCM 1;  4DQY B;  2F4M A;  4E32 A;  4NB8 A;  2HU9 A;  3TE5 B;  2QRD B;  3GTJ I;  3S1N I;  3VMG A;  5C4J I;  4A3M I;  1YJN Z;  1VQ7 1;  3S1M I;  4NBA A;  3CPW Z;  3IFU A;  2E9H A;  4DGL A;  3CQZ I;  1NJI 2;  2DE5 A;  2M6N A;  2WB1 A;  3D9X A;  3I56 1;  3VMH A;  3RZD I;  4HH4 A;  1M1K 2;  2QEX 1;  3CCL 1;  3S15 I;  4NH1 C;  2B63 I;  3VMI A;  5IT9 f;  2K3R A;  2QKD A;  1VQ9 1;  1YHQ Z;  1K8A 1;  1JJ2 Z;  2JUB A;  1YI2 1;  3FQM A;  3PO2 I;  3CCR Z;  4CL1 A;  1VQK 1;  2Y0S A;  3CC7 1;  3CC2 1;  2PM9 A;  4NBC A;  3LUS A;  2VPY A;  2E7Z A;  4Y7N I;  4QTT A;  4E2W A;  1PFT A;  1VQN Z;  1TWC I;  2AKL A;  1K73 1;  1K73 2;  2O53 A;  2W04 A;  4BBR I;  1VQ4 Z;  1S72 1;  2V8I A;  2OZK A;  3HOV I;  5C44 I;  3S17 I;  2JA8 I;  3CCS 1;  4A3E I;  4S1T A;  3J81 b;  5FLX f;  2DE7 A;  1Q7Y 1;  2VPW A;  4A3B I;  4NBH A;  3S1Q I;  2JS4 A;  3KIF A;  4HGZ A;  3NH5 A;  4BY7 I;  3PO3 S;  3GTG I;  1X0T A;  5A2Q b;  2LIY A;  3U50 C;  2QRC B;  2E2H I;  3S16 I;  2V8J A;  3VTN A;  3H0G I;  1QVF Y;  2R93 I;  3EED A;  3J80 b;  1I3Q I;  3JAM f;  1K9M 2;  1KQS Y;  3CCJ 1;  2JA6 I;  4MD9 A;  3M4O I;  2QA4 Z;  1S7M A;  1VQ5 1;  2P3Y A;  2JA7 I;  1VQM 1;  3MZK B;  4DK1 A;  1Y1V I;  2JIQ A;  4A3I I;  4A3J I;  3GTP I;  3IR7 A;  3FQQ A;  2GTI A;  4MON A;  3G6E Z;  1KD1 1;  1KD1 2;  1TWH I;  2V3V A;  1YJ9 Z;  4E33 A;  3HOZ I;  1YJW 1;  4MD7 A;  5T64 A;  1VQO Z;  1YIT Z;  3CCU Z;  3CCE 1;  1DL6 A;  1YIJ 1;  2OTL 1;  2NVT I;  1ML8 A;  2NVX I;  1NUI A;  2M48 A;  2NAP A;  4E2X A;  1VQP Z;  1Z01 A;  4A3G I;  4QTU A;  3G4S Z;  3CD6 Z;  2I3C A;  5T67 A;  1NJI 1;  2OTJ Z;  1VQ4 1;  3I55 Z;  3CCV Z;  3D6W A;  1M1K 1;  4MD8 A;  1VQ6 Z;  2HF1 A;  1FDI A;  1RO4 A;  2J6A A;  1USP B;  3CCQ 1;  2JIO A;  3IF8 A;  3CC4 1;  2PK7 A; 
#chains in the Genus database with same CATH homology
 1WII A;  2OOY B;  3G71 1;  1Q86 2;  1KC8 2;  3I07 A;  1YUK A;  2R92 I;  4HGY A;  3CMA Z;  4MRI A;  3MZL B;  2DE6 A;  4NBG A;  4E31 A;  2VUM I;  3GTM S;  3HKZ A;  3F3P C;  3S2D I;  2RHB A;  1Y1V S;  3HOU I;  3NFZ A;  3ESW A;  3CCM Z;  4BBS I;  1SFO I;  1X3Z A;  2YAD A;  1RO2 A;  2YU9 I;  4A3K I;  1VQL Z;  3IX0 A;  1VQ7 Z;  3NDI A;  2R7Z I;  1ZB9 A;  2Q51 A;  3RZO I;  3CME 1;  3S1R I;  4RS4 A;  2VUG A;  3I56 Z;  3S14 I;  2JA5 I;  2QEX Z;  3CCL Z;  2QLV B;  4A3D I;  2QRE B;  4E30 A;  1NP6 A;  3BG0 B;  3S2H I;  3F3F C;  2NVQ I;  1K9M 1;  1VQ9 Z;  1YJN 1;  3GTM I;  4XX2 A;  1YI2 Z;  4RV9 A;  3CXC Y;  1RO0 A;  1QVF Z;  1Q81 1;  3HOX I;  1Q81 2;  1KQS Z;  1VQK Z;  4BXX I;  3CC7 Z;  4NOZ A;  3CC2 Z;  3GTO I;  3J81 f;  2KPI A;  5FLM I;  3TDH B;  3H3V J;  2P28 A;  5A2Q f;  3NH8 A;  1YHQ 1;  1W2B Y;  1S72 Z;  1VQ8 Z;  2O4H A;  3CCR 1;  3CCS Z;  2F4O A;  4NB9 A;  5D1O B;  5IT9 b;  2GTH A;  2IZ4 A;  1P9N A;  3GTQ I;  1R9T I;  1VQN 1;  3MON A;  4BY1 I;  4MXU A;  2PMZ A;  2KI7 B;  1K83 I;  1I6H I;  2OOX B;  3VB9 A;  3CPW Y;  2K5R A;  4TNU A;  3BG1 B;  1RNI A;  1VQL 1;  3I4M I;  3K7A I;  3CCJ Z;  3FKI I;  1YUA A;  1I50 I;  5IP9 I;  1VQ5 Z;  1VQM Z;  1Q86 1;  1Z03 A;  1KC8 1;  1QVG Y;  2R6M A;  1ZH1 A;  4NBF A;  4A93 I;  2E2I I;  1QYP A;  1JJ2 Y;  5D1O A;  2W03 A;  2E2J I;  5FLX b;  1QVG Z;  4NBD A;  1RLY A;  3T4N B;  5AN9 F;  2Q4Z A;  5T6B A;  1YJW Z;  2RBL A;  1K8A 2;  2QA4 1;  1N2F A;  1TWF I;  3P5J B;  4A3L I;  2H85 A;  3CCE Z;  2JMO A;  3NDJ A;  1YIJ Z;  2OTL Z;  4NFR A;  2RT9 A;  5LL6 f;  5IP7 I;  1L1O C;  1JWH C;  3GTK I;  1USP A;  3I4N I;  5D1P A;  3G6E 1;  2ZAE B;  3QWU A;  3Q87 A;  3J7A 4;  2VF1 A;  1YJ9 1;  4RVH A;  1QF8 A;  3JAM b;  4EWC A;  2EGT A;  4E2Y A;  5CM2 M;  1VQO 1;  1VQ8 1;  1YIT 1;  3CCU 1;  2V8K A;  1VLA A;  2RPR A;  5C3E I;  1Q7Y 2;  1WCM I;  3CCQ Z;  3CC4 Z;  3NH4 A;  1VQP 1;  4X6A I;  3G71 Z;  1Y1W I;  3EER A;  3G4S 1;  3GKQ A;  3CD6 1;  2OTJ 1;  4RVG A;  1X3W A;  3M3Y I;  3I55 1;  2G2K A;  3CCV 1;  2IZ3 A;  1LQL A;  4A3F I;  1ZB8 A;  1VQ6 1;  3HOY I;  5C4X I;  3CXC Z;  4Y52 I;  4A3C I;  1N8R 1;  2NVY I;  1N8R 2;  4RVF A;  1Z02 A;  2LFU A;  4AYB A;  3GCF A;  3KIH A;  1KRL A;  1TWG I;  4NBE A;  2BJO A;  2RIQ A;  1Q82 1;  1Q82 2;  2GU2 A;  3CMA 1;  3OW2 Y;  1TWA I;  1RQF A;  1TFI A;  4MH4 A;  1W2B Z;  2JR6 A;  2WAQ A;  2JNY A;  3HOW I;  3J80 f;  3GTL I;  4RVD A;  3OW2 Z;  4NBB A;  3CME Z;  2QR1 B;  4E2Z A;  1WW9 A;  3PO3 I;  1M90 1;  1M90 2;  3CCM 1;  4DQY B;  2F4M A;  4E32 A;  4NB8 A;  2HU9 A;  3TE5 B;  2QRD B;  3GTJ I;  3S1N I;  3VMG A;  5C4J I;  4A3M I;  1YJN Z;  1VQ7 1;  3S1M I;  4NBA A;  3CPW Z;  3IFU A;  2E9H A;  4DGL A;  3CQZ I;  1NJI 2;  2DE5 A;  2M6N A;  2WB1 A;  3D9X A;  3I56 1;  3VMH A;  3RZD I;  4HH4 A;  1M1K 2;  2QEX 1;  3CCL 1;  3S15 I;  4NH1 C;  2B63 I;  3VMI A;  5IT9 f;  2K3R A;  2QKD A;  1VQ9 1;  1YHQ Z;  1K8A 1;  1JJ2 Z;  2JUB A;  1YI2 1;  3FQM A;  3PO2 I;  3CCR Z;  4CL1 A;  1VQK 1;  2Y0S A;  3CC7 1;  3CC2 1;  2PM9 A;  4NBC A;  3LUS A;  4Y7N I;  4QTT A;  4E2W A;  1PFT A;  1VQN Z;  1TWC I;  2AKL A;  1K73 1;  1K73 2;  2O53 A;  2W04 A;  4BBR I;  1VQ4 Z;  1S72 1;  2V8I A;  2OZK A;  3HOV I;  5C44 I;  3S17 I;  2JA8 I;  3CCS 1;  4A3E I;  4S1T A;  3J81 b;  5FLX f;  2DE7 A;  1Q7Y 1;  4A3B I;  4NBH A;  3S1Q I;  2JS4 A;  3KIF A;  4HGZ A;  3NH5 A;  4BY7 I;  3PO3 S;  3GTG I;  1X0T A;  5A2Q b;  2LIY A;  3U50 C;  2QRC B;  2E2H I;  3S16 I;  2V8J A;  3VTN A;  3H0G I;  1QVF Y;  2R93 I;  3EED A;  3J80 b;  1I3Q I;  3JAM f;  1K9M 2;  1KQS Y;  3CCJ 1;  2JA6 I;  4MD9 A;  3M4O I;  2QA4 Z;  1S7M A;  1VQ5 1;  2P3Y A;  2JA7 I;  1VQM 1;  3MZK B;  4DK1 A;  1Y1V I;  4A3J I;  4A3I I;  3GTP I;  3FQQ A;  2GTI A;  4MON A;  3G6E Z;  1KD1 1;  1KD1 2;  1TWH I;  1YJ9 Z;  4E33 A;  3HOZ I;  1YJW 1;  4MD7 A;  5T64 A;  1VQO Z;  1YIT Z;  3CCU Z;  3CCE 1;  1DL6 A;  1YIJ 1;  2OTL 1;  2NVT I;  1ML8 A;  2NVX I;  1NUI A;  2M48 A;  4E2X A;  1VQP Z;  1Z01 A;  4A3G I;  4QTU A;  3G4S Z;  3CD6 Z;  2I3C A;  5T67 A;  1NJI 1;  2OTJ Z;  1VQ4 1;  3I55 Z;  3CCV Z;  3D6W A;  1M1K 1;  4MD8 A;  1VQ6 Z;  2HF1 A;  1RO4 A;  2J6A A;  1USP B;  3CCQ 1;  3IF8 A;  3CC4 1;  2PK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...