5C3EI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI02
2F4MA 3PO2I 1TWFI 4QTTA 2DE7A 5C44I 1PFTA 3HOYI 4A3DI 3S17I 3HOWI 3LUSA 3D6WA 1ML8A 3FKII 2K5RA 2NVYI 3M3YI 4A3MI 2JNYA 4NBGA 3GTKI 1X3ZA 4X6AI 3H0GI 5C4JI 1Y1VS 1VLAA 3HOXI 4NBCA 5IP7I 3VB9A 5CM2M 3S1RI 2VUMI 1ZB9A 3VMHA 1L1OC 5C4XI 1Y1WI 2B63I 3GTPI 1R9TI 2KPIA 4A3EI 2JA7I 1NUIA 1I50I 5FLMI 3RZDI 4Y7NI 1TWAI 3I4MI 2JA8I 1I3QI 4A3KI 2E2JI 4BBSI 1DL6A 4NBBA 4A3FI 2HF1A 4A3II 2J6AA 1Y1VI 4A3LI 4A3GI 2NVQI 4NBHA 3GKQA 4A3BI 4A93I 2R92I 3S2HI 2AKLA 1I6HI 3HOZI 2PK7A 2JR6A 1N2FA 2P3YA 2JA5I 3GTGI 2NVTI 3S1NI 3GCFA 3S1MI 3U50C 4NB8A 4BXXI 4NBFA 3HOVI 3S15I 4MH4A 2BJOA 1USPB 2R7ZI 2RBLA 2E2HI 3I07A 3S2DI 2DE6A 2DE5A 4NBDA 3GTLI 4Y52I 1QYPA 3GTMS 3H3VJ 4QTUA 2JS4A 3HOUI 4A3JI 3GTQI 2R93I 1ZB8A 4BY7I 3S16I 3M4OI 1LQLA 4NOZA 3PO3S 1TWCI 3GTJI 1YUAA 1TFIA 3EERA 3I4NI 2E2II 3VMIA 3S1QI 3ESWA 3GTOI 1USPA 1TWGI 4NBEA 4BBRI 4A3CI 4NB9A 1K83I 3CQZI 3PO3I 4BY1I 1TWHI 3GTMI 2NVXI 2YU9I 3Q87A 1SFOI 2F4OA 1X3WA 5IP9I 4XX2A 1WW9A 3K7AI 2JA6I 3VMGA 1WCMI 3RZOI 1RLYA 1RO4A 5C3EI 4NBAA 3S14I
chains in the Genus database with same CATH superfamily
2RIQA 3PO2I 3CD61 3G71Z 4QTTA 5C44I 5D1OB 1N8R1 3CC2Z 1YJ91 3FKII 3IFUA 2JIQA 3GTKI 1YJNZ 4HH4A 1QVFY 3H0GI 3HOXI 4CL1A 2Q4ZA 2QLVB 3VB9A 2V8IA 3BG0B 1M1K1 3GTPI 2JUBA 1NP6A 2EGTA 2JA7I 3NDJA 5IT9f 2JIOA 1TWAI 3I4MI 2OOYB 1RNIA 4NH1C 3CC7Z 1Q862 4BBSI 1VQ4Z 4A3II 3G711 4A3LI 2RT9A 4RVHA 3CC21 1AA6A 2VUGA 3D2LA 4A3BI 4A93I 3S2HI 1YI21 3HOZI 2V8JA 4HGZA 2I3CA 1N2FA 2VPZA 3NH8A 1S7MA 3U50C 4MD9A 4MRIA 1W2BY 1Q812 3HOVI 1VQ9Z 1USPB 1Y8CA 2RBLA 1Q861 2E2HI 2E7ZA 3I07A 1FDOA 3MONA 4NBDA 3QWUA 2JS4A 3GTQI 2R93I 4BY7I 3CPWY 3M4OI 1WIIA 3CCR1 1LQLA 4TNUA 3PO3S 1VQ7Z 4MD8A 3TDHB 1VQK1 1TFIA 3EERA 2E2II 1Q811 1JJ2Z 3NDIA 3VMIA 4NBEA 1YIJZ 3JAMf 2GTIA 3CQZI 3CCQZ 1K8A2 2E9HA 1QVGZ 3K7AI 4MXUA 2ZAEB 1VQMZ 5C3EI 3NH4A 2IZ3A 2F4MA 4RVFA 2W03A 1TWFI 4A3DI 1RO2A 3CCL1 3D6WA 1VQPZ 2H85A 2VF1A 1VQOZ 2QREB 4A3MI 1VQ5Z 2JNYA 4NBGA 3KIHA 1Y1VS 1VLAA 5IP7I 2QA41 2Y0SA 2LEXA 3CCM1 2B63I 1R9TI 4A3EI 4E31A 3CCQ1 1I50I 2O53A 2QRCB 2K3RA 5D1OA 3I56Z 1VQNZ 1Q822 3OW2Y 2OTLZ 2PM9A 3J81f 4A3FI 2J6AA 1KC82 4NBHA 2GU2A 3CXCZ 1I6HI 1QF8A 1ZH1A 2JR6A 3GTGI 2JA5I 2LIYA 3S1NI 2QKDA 4S1TA 1Q821 4EWCA 1Z01A 4MH4A 1QXFA 3CMEZ 2KI7B 3CCVZ 3G6EZ 4E2ZA 2DE6A 4Y52I 4HGYA 3I561 1YITZ 3H3VJ 4QTUA 3I55Z 1S72Z 2JMOA 1KD12 4A3JI 3CCSZ 1ZB8A 5T6BA 4RS4A 4NOZA 1TWCI 3GTJI 1YJN1 2W04A 3I4NI 2AYDA 3S1QI 3ESWA 3GTOI 1USPA 1TWGI 4A3CI 5FLXb 1K83I 2WB1A 3CCUZ 4BY1I 1TWHI 3GTMI 3CC4Z 4E32A 4AYBA 3Q87A 5IP9I 3MZKB 2LFUA 3CME1 1QVFZ 1RO4A 3BG1B 3CC71 3CCV1 3G6E1 1WZNA 1VQ8Z 4DK1A 1VQ41 3P5JB 1X0TA 1YIT1 2JIRA 2RPRA 1S721 1K732 3F3FC 3LUSA 1ML8A 2NVYI 3FQMA 3M3YI 4E33A 1X3ZA 3KIFA 1Z03A 1KQSY 5C4JI 2HU9A 5CM2M 1VQ91 1L1OC 1NJI2 1Y1WI 4E30A 4E2WA 3EEDA 2JIPA 3CCJZ 1NUIA 3RZDI 1K731 4RVGA 1Z02A 3D9XA 1VQ81 1W2BZ 4NBBA 2HF1A 5LL6f 4RV9A 1VQ71 1M902 1K9M2 3GKQA 1K8A1 1YJ9Z 2M6NA 3NH5A 1NJI1 2PK7A 1YIJ1 3S1MI 3CPWZ 3CCEZ 2OOXB 5FLXf 2PMZA 2R7ZI 2QEXZ 1VQM1 2VPYA 3CCJ1 1K9M1 1QYPA 3HOUI 1YUKA 2RHBA 5A2Qb 1VQP1 3S16I 4MONA 2R6MA 1VQO1 3IF8A 5AN9F 1VQ51 1YI2Z 2OZKA 3JAMb 1VQ6Z 2NVXI 2YU9I 1RQFA 1KC81 2F4OA 3CCE1 4XX2A 1VQN1 1WW9A 1RO0A 1VQLZ 3RZOI 3J80b 2NAPA 2QEX1 2QR1B 3PO3I 1JJ2Y 2OTL1 4RVDA 2DE7A 1M1K2 1PFTA 3HOYI 3S17I 3HOWI 1KRLA 2VPWA 2K5RA 3CCRZ 3IR7A 3NFZA 1QVGY 4X6AI 1YJWZ 1VQKZ 3MZLB 3OW2Z 4DQYB 1Q16A 4NBCA 1KD11 2GTHA 3S1RI 2VUMI 1ZB9A 3VMHA 2IZ4A 5C4XI 2YADA 1VQ61 2KPIA 2QRDB 5D1PA 4MD7A 5FLMI 1SIWA 3TE5B 4E2XA 4Y7NI 2V45A 3I551 2JA8I 1VQL1 3CCS1 1Q7Y2 1I3QI 4A3KI 3IX0A 2E2JI 1WJ2A 3G4SZ 1DL6A 2P28A 3CMAZ 3J81b 1Y1VI 2WAQA 4A3GI 3HKZA 2NVQI 2OTJZ 3CCLZ 5A2Qf 2R92I 2AKLA 1YHQZ 1P9NA 2P3YA 2NVTI 1FDIA 3GCFA 1YJW1 4NFRA 3CCU1 3CC41 4NB8A 2V8KA 4BXXI 4NBFA 3S15I 2BJOA 2QA4Z 1Q7Y1 5IT9b 3CCMZ 3J7A4 4DGLA 3CXCY 3S2DI 2VPXA 2DE5A 3CD6Z 3GTLI 3T4NB 3GTMS 2G2KA 5T64A 3J80f 5T67A 3G4S1 3CMA1 2Q51A 2IV2X 3VTNA 1YUAA 1JWHC 2OTJ1 1N8R2 2O4HA 4BBRI 1YHQ1 4NB9A 2JIMA 2V3VA 1SFOI 3F3PC 1M901 1X3WA 3FQQA 2JA6I 3VMGA 1WCMI 1RLYA 2M48A 1KQSZ 4NBAA 4E2YA 3S14I
chains in the Genus database with same CATH topology
2RIQA 3PO2I 3CD61 3G71Z 4QTTA 5C44I 5D1OB 1N8R1 3CC2Z 1YJ91 3FKII 3IFUA 3GTKI 1YJNZ 4HH4A 1QVFY 3H0GI 3HOXI 4CL1A 2Q4ZA 2QLVB 3VB9A 2V8IA 3BG0B 1M1K1 3GTPI 2JUBA 1NP6A 2EGTA 2JA7I 3NDJA 5IT9f 1TWAI 3I4MI 2OOYB 1RNIA 4NH1C 3CC7Z 1Q862 4BBSI 1VQ4Z 4A3II 3G711 4A3LI 2RT9A 4RVHA 3CC21 2VUGA 4A3BI 4A93I 3S2HI 1YI21 3HOZI 2V8JA 4HGZA 2I3CA 1N2FA 3NH8A 1S7MA 3U50C 4MD9A 4MRIA 1W2BY 1Q812 3HOVI 1VQ9Z 1USPB 2RBLA 1Q861 2E2HI 3I07A 3MONA 4NBDA 3QWUA 2JS4A 3GTQI 2R93I 4BY7I 3CPWY 3M4OI 1WIIA 3CCR1 1LQLA 4TNUA 3PO3S 1VQ7Z 4MD8A 3TDHB 1VQK1 1TFIA 3EERA 2E2II 1Q811 1JJ2Z 3NDIA 3VMIA 4NBEA 1YIJZ 3JAMf 2GTIA 3CQZI 3CCQZ 1K8A2 2E9HA 1QVGZ 3K7AI 4MXUA 2ZAEB 1VQMZ 5C3EI 3NH4A 2IZ3A 2F4MA 4RVFA 2W03A 1TWFI 4A3DI 1RO2A 3CCL1 3D6WA 1VQPZ 2H85A 2VF1A 1VQOZ 2QREB 4A3MI 1VQ5Z 2JNYA 4NBGA 3KIHA 1Y1VS 1VLAA 5IP7I 2QA41 2Y0SA 3CCM1 2B63I 1R9TI 4A3EI 4E31A 3CCQ1 1I50I 2O53A 2QRCB 2K3RA 5D1OA 3I56Z 1VQNZ 1Q822 3OW2Y 2OTLZ 2PM9A 3J81f 4A3FI 2J6AA 1KC82 4NBHA 2GU2A 3CXCZ 1I6HI 1QF8A 1ZH1A 2JR6A 3GTGI 2JA5I 2LIYA 3S1NI 2QKDA 4S1TA 1Q821 4EWCA 1Z01A 4MH4A 3CMEZ 2KI7B 3CCVZ 3G6EZ 4E2ZA 2DE6A 4Y52I 4HGYA 3I561 1YITZ 3H3VJ 4QTUA 3I55Z 1S72Z 2JMOA 1KD12 4A3JI 3CCSZ 1ZB8A 5T6BA 4RS4A 4NOZA 1TWCI 3GTJI 1YJN1 2W04A 3I4NI 3S1QI 3ESWA 3GTOI 1USPA 1TWGI 4A3CI 5FLXb 1K83I 2WB1A 3CCUZ 4BY1I 1TWHI 3GTMI 3CC4Z 4E32A 4AYBA 3Q87A 5IP9I 3MZKB 2LFUA 3CME1 1QVFZ 1RO4A 3BG1B 3CC71 3CCV1 3G6E1 1VQ8Z 4DK1A 1VQ41 3P5JB 1X0TA 1YIT1 2RPRA 1S721 1K732 3F3FC 3LUSA 1ML8A 2NVYI 3FQMA 3M3YI 4E33A 1X3ZA 3KIFA 1Z03A 1KQSY 5C4JI 2HU9A 5CM2M 1VQ91 1L1OC 1NJI2 1Y1WI 4E30A 4E2WA 3EEDA 3CCJZ 1NUIA 3RZDI 1K731 4RVGA 1Z02A 3D9XA 1VQ81 1W2BZ 4NBBA 2HF1A 5LL6f 4RV9A 1VQ71 1M902 1K9M2 3GKQA 1K8A1 1YJ9Z 2M6NA 3NH5A 1NJI1 2PK7A 1YIJ1 3S1MI 3CPWZ 3CCEZ 2OOXB 5FLXf 2PMZA 2R7ZI 2QEXZ 1VQM1 3CCJ1 1K9M1 1QYPA 3HOUI 1YUKA 2RHBA 5A2Qb 1VQP1 3S16I 4MONA 2R6MA 1VQO1 3IF8A 5AN9F 1VQ51 1YI2Z 2OZKA 3JAMb 1VQ6Z 2NVXI 2YU9I 1RQFA 1KC81 2F4OA 3CCE1 4XX2A 1VQN1 1WW9A 1RO0A 1VQLZ 3RZOI 3J80b 2QEX1 2QR1B 3PO3I 1JJ2Y 2OTL1 4RVDA 2DE7A 1M1K2 1PFTA 3HOYI 3S17I 3HOWI 1KRLA 2K5RA 3CCRZ 1QVGY 3NFZA 4X6AI 1YJWZ 1VQKZ 3MZLB 3OW2Z 4DQYB 4NBCA 1KD11 2GTHA 3S1RI 2VUMI 1ZB9A 3VMHA 2IZ4A 5C4XI 2YADA 1VQ61 2KPIA 2QRDB 5D1PA 4MD7A 5FLMI 3TE5B 4E2XA 4Y7NI 3I551 2JA8I 1VQL1 3CCS1 1Q7Y2 1I3QI 4A3KI 3IX0A 2E2JI 3G4SZ 1DL6A 2P28A 3CMAZ 3J81b 1Y1VI 2WAQA 4A3GI 3HKZA 2NVQI 2OTJZ 3CCLZ 5A2Qf 2R92I 2AKLA 1YHQZ 1P9NA 2P3YA 2NVTI 3GCFA 1YJW1 4NFRA 3CCU1 3CC41 4NB8A 2V8KA 4BXXI 4NBFA 3S15I 2BJOA 2QA4Z 1Q7Y1 5IT9b 3CCMZ 3J7A4 4DGLA 3CXCY 3S2DI 2DE5A 3CD6Z 3GTLI 3T4NB 3GTMS 2G2KA 5T64A 3J80f 5T67A 3G4S1 3CMA1 2Q51A 3VTNA 1YUAA 1JWHC 2OTJ1 1N8R2 2O4HA 4BBRI 1YHQ1 4NB9A 1SFOI 3F3PC 1M901 1X3WA 3FQQA 2JA6I 3VMGA 1WCMI 1RLYA 2M48A 1KQSZ 4NBAA 4E2YA 3S14I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4M A;  3PO2 I;  1TWF I;  4QTT A;  2DE7 A;  5C44 I;  1PFT A;  3HOY I;  4A3D I;  3S17 I;  3HOW I;  3LUS A;  3D6W A;  1ML8 A;  3FKI I;  2K5R A;  2NVY I;  3M3Y I;  4A3M I;  2JNY A;  4NBG A;  3GTK I;  1X3Z A;  4X6A I;  3H0G I;  5C4J I;  1Y1V S;  1VLA A;  3HOX I;  4NBC A;  5IP7 I;  3VB9 A;  5CM2 M;  3S1R I;  2VUM I;  1ZB9 A;  3VMH A;  1L1O C;  5C4X I;  1Y1W I;  2B63 I;  3GTP I;  1R9T I;  2KPI A;  4A3E I;  2JA7 I;  1NUI A;  1I50 I;  5FLM I;  3RZD I;  4Y7N I;  1TWA I;  3I4M I;  2JA8 I;  1I3Q I;  4A3K I;  2E2J I;  4BBS I;  1DL6 A;  4NBB A;  4A3F I;  2HF1 A;  4A3I I;  2J6A A;  1Y1V I;  4A3L I;  4A3G I;  2NVQ I;  4NBH A;  3GKQ A;  4A3B I;  4A93 I;  2R92 I;  3S2H I;  2AKL A;  1I6H I;  3HOZ I;  2PK7 A;  2JR6 A;  1N2F A;  2P3Y A;  2JA5 I;  3GTG I;  2NVT I;  3S1N I;  3GCF A;  3S1M I;  3U50 C;  4NB8 A;  4BXX I;  4NBF A;  3HOV I;  3S15 I;  4MH4 A;  2BJO A;  1USP B;  2R7Z I;  2RBL A;  2E2H I;  3I07 A;  3S2D I;  2DE6 A;  2DE5 A;  4NBD A;  3GTL I;  4Y52 I;  1QYP A;  3GTM S;  3H3V J;  4QTU A;  2JS4 A;  3HOU I;  4A3J I;  3GTQ I;  2R93 I;  1ZB8 A;  4BY7 I;  3S16 I;  3M4O I;  1LQL A;  4NOZ A;  3PO3 S;  1TWC I;  3GTJ I;  1YUA A;  1TFI A;  3EER A;  3I4N I;  2E2I I;  3VMI A;  3S1Q I;  3ESW A;  3GTO I;  1USP A;  1TWG I;  4NBE A;  4BBR I;  4A3C I;  4NB9 A;  1K83 I;  3CQZ I;  3PO3 I;  4BY1 I;  1TWH I;  3GTM I;  2NVX I;  2YU9 I;  3Q87 A;  1SFO I;  2F4O A;  1X3W A;  5IP9 I;  4XX2 A;  1WW9 A;  3K7A I;  2JA6 I;  3VMG A;  1WCM I;  3RZO I;  1RLY A;  1RO4 A;  5C3E I;  4NBA A;  3S14 I; 
#chains in the Genus database with same CATH topology
 2RIQ A;  3PO2 I;  3CD6 1;  3G71 Z;  4QTT A;  5C44 I;  5D1O B;  1N8R 1;  3CC2 Z;  1YJ9 1;  3FKI I;  3IFU A;  2JIQ A;  3GTK I;  1YJN Z;  4HH4 A;  1QVF Y;  3H0G I;  3HOX I;  4CL1 A;  2Q4Z A;  2QLV B;  3VB9 A;  2V8I A;  3BG0 B;  1M1K 1;  3GTP I;  2JUB A;  1NP6 A;  2EGT A;  2JA7 I;  3NDJ A;  5IT9 f;  2JIO A;  1TWA I;  3I4M I;  2OOY B;  1RNI A;  4NH1 C;  3CC7 Z;  1Q86 2;  4BBS I;  1VQ4 Z;  4A3I I;  3G71 1;  4A3L I;  2RT9 A;  4RVH A;  3CC2 1;  1AA6 A;  2VUG A;  3D2L A;  4A3B I;  4A93 I;  3S2H I;  1YI2 1;  3HOZ I;  2V8J A;  4HGZ A;  2I3C A;  1N2F A;  2VPZ A;  3NH8 A;  1S7M A;  3U50 C;  4MD9 A;  4MRI A;  1W2B Y;  1Q81 2;  3HOV I;  1VQ9 Z;  1USP B;  1Y8C A;  2RBL A;  1Q86 1;  2E2H I;  2E7Z A;  3I07 A;  1FDO A;  3MON A;  4NBD A;  3QWU A;  2JS4 A;  3GTQ I;  2R93 I;  4BY7 I;  3CPW Y;  3M4O I;  1WII A;  3CCR 1;  1LQL A;  4TNU A;  3PO3 S;  1VQ7 Z;  4MD8 A;  3TDH B;  1VQK 1;  1TFI A;  3EER A;  2E2I I;  1Q81 1;  1JJ2 Z;  3NDI A;  3VMI A;  4NBE A;  1YIJ Z;  3JAM f;  2GTI A;  3CQZ I;  3CCQ Z;  1K8A 2;  2E9H A;  1QVG Z;  3K7A I;  4MXU A;  2ZAE B;  1VQM Z;  5C3E I;  3NH4 A;  2IZ3 A;  2F4M A;  4RVF A;  2W03 A;  1TWF I;  4A3D I;  1RO2 A;  3CCL 1;  3D6W A;  1VQP Z;  2H85 A;  2VF1 A;  1VQO Z;  2QRE B;  4A3M I;  1VQ5 Z;  2JNY A;  4NBG A;  3KIH A;  1Y1V S;  1VLA A;  5IP7 I;  2QA4 1;  2Y0S A;  2LEX A;  3CCM 1;  2B63 I;  1R9T I;  4A3E I;  4E31 A;  3CCQ 1;  1I50 I;  2O53 A;  2QRC B;  2K3R A;  5D1O A;  3I56 Z;  1VQN Z;  1Q82 2;  3OW2 Y;  2OTL Z;  2PM9 A;  3J81 f;  4A3F I;  2J6A A;  1KC8 2;  4NBH A;  2GU2 A;  3CXC Z;  1I6H I;  1QF8 A;  1ZH1 A;  2JR6 A;  3GTG I;  2JA5 I;  2LIY A;  3S1N I;  2QKD A;  4S1T A;  1Q82 1;  4EWC A;  1Z01 A;  4MH4 A;  1QXF A;  3CME Z;  2KI7 B;  3CCV Z;  3G6E Z;  4E2Z A;  2DE6 A;  4Y52 I;  4HGY A;  3I56 1;  1YIT Z;  3H3V J;  4QTU A;  3I55 Z;  1S72 Z;  2JMO A;  1KD1 2;  4A3J I;  3CCS Z;  1ZB8 A;  5T6B A;  4RS4 A;  4NOZ A;  1TWC I;  3GTJ I;  1YJN 1;  2W04 A;  3I4N I;  2AYD A;  3S1Q I;  3ESW A;  3GTO I;  1USP A;  1TWG I;  4A3C I;  5FLX b;  1K83 I;  2WB1 A;  3CCU Z;  4BY1 I;  1TWH I;  3GTM I;  3CC4 Z;  4E32 A;  4AYB A;  3Q87 A;  5IP9 I;  3MZK B;  2LFU A;  3CME 1;  1QVF Z;  1RO4 A;  3BG1 B;  3CC7 1;  3CCV 1;  3G6E 1;  1WZN A;  1VQ8 Z;  4DK1 A;  1VQ4 1;  3P5J B;  1X0T A;  1YIT 1;  2JIR A;  2RPR A;  1S72 1;  1K73 2;  3F3F C;  3LUS A;  1ML8 A;  2NVY I;  3FQM A;  3M3Y I;  4E33 A;  1X3Z A;  3KIF A;  1Z03 A;  1KQS Y;  5C4J I;  2HU9 A;  5CM2 M;  1VQ9 1;  1L1O C;  1NJI 2;  1Y1W I;  4E30 A;  4E2W A;  3EED A;  2JIP A;  3CCJ Z;  1NUI A;  3RZD I;  1K73 1;  4RVG A;  1Z02 A;  3D9X A;  1VQ8 1;  1W2B Z;  4NBB A;  2HF1 A;  5LL6 f;  4RV9 A;  1VQ7 1;  1M90 2;  1K9M 2;  3GKQ A;  1K8A 1;  1YJ9 Z;  2M6N A;  3NH5 A;  1NJI 1;  2PK7 A;  1YIJ 1;  3S1M I;  3CPW Z;  3CCE Z;  2OOX B;  5FLX f;  2PMZ A;  2R7Z I;  2QEX Z;  1VQM 1;  2VPY A;  3CCJ 1;  1K9M 1;  1QYP A;  3HOU I;  1YUK A;  2RHB A;  5A2Q b;  1VQP 1;  3S16 I;  4MON A;  2R6M A;  1VQO 1;  3IF8 A;  5AN9 F;  1VQ5 1;  1YI2 Z;  2OZK A;  3JAM b;  1VQ6 Z;  2NVX I;  2YU9 I;  1RQF A;  1KC8 1;  2F4O A;  3CCE 1;  4XX2 A;  1VQN 1;  1WW9 A;  1RO0 A;  1VQL Z;  3RZO I;  3J80 b;  2NAP A;  2QEX 1;  2QR1 B;  3PO3 I;  1JJ2 Y;  2OTL 1;  4RVD A;  2DE7 A;  1M1K 2;  1PFT A;  3HOY I;  3S17 I;  3HOW I;  1KRL A;  2VPW A;  2K5R A;  3CCR Z;  3IR7 A;  3NFZ A;  1QVG Y;  4X6A I;  1YJW Z;  1VQK Z;  3MZL B;  3OW2 Z;  4DQY B;  1Q16 A;  4NBC A;  1KD1 1;  2GTH A;  3S1R I;  2VUM I;  1ZB9 A;  3VMH A;  2IZ4 A;  5C4X I;  2YAD A;  1VQ6 1;  2KPI A;  2QRD B;  5D1P A;  4MD7 A;  5FLM I;  1SIW A;  3TE5 B;  4E2X A;  4Y7N I;  2V45 A;  3I55 1;  2JA8 I;  1VQL 1;  3CCS 1;  1Q7Y 2;  1I3Q I;  4A3K I;  3IX0 A;  2E2J I;  1WJ2 A;  3G4S Z;  1DL6 A;  2P28 A;  3CMA Z;  3J81 b;  1Y1V I;  2WAQ A;  4A3G I;  3HKZ A;  2NVQ I;  2OTJ Z;  3CCL Z;  5A2Q f;  2R92 I;  2AKL A;  1YHQ Z;  1P9N A;  2P3Y A;  2NVT I;  1FDI A;  3GCF A;  1YJW 1;  4NFR A;  3CCU 1;  3CC4 1;  4NB8 A;  2V8K A;  4BXX I;  4NBF A;  3S15 I;  2BJO A;  2QA4 Z;  1Q7Y 1;  5IT9 b;  3CCM Z;  3J7A 4;  4DGL A;  3CXC Y;  3S2D I;  2VPX A;  2DE5 A;  3CD6 Z;  3GTL I;  3T4N B;  3GTM S;  2G2K A;  5T64 A;  3J80 f;  5T67 A;  3G4S 1;  3CMA 1;  2Q51 A;  2IV2 X;  3VTN A;  1YUA A;  1JWH C;  2OTJ 1;  1N8R 2;  2O4H A;  4BBR I;  1YHQ 1;  4NB9 A;  2JIM A;  2V3V A;  1SFO I;  3F3P C;  1M90 1;  1X3W A;  3FQQ A;  2JA6 I;  3VMG A;  1WCM I;  1RLY A;  2M48 A;  1KQS Z;  4NBA A;  4E2Y A;  3S14 I; 
#chains in the Genus database with same CATH homology
 2RIQ A;  3PO2 I;  3CD6 1;  3G71 Z;  4QTT A;  5C44 I;  5D1O B;  1N8R 1;  3CC2 Z;  1YJ9 1;  3FKI I;  3IFU A;  3GTK I;  1YJN Z;  4HH4 A;  1QVF Y;  3H0G I;  3HOX I;  4CL1 A;  2Q4Z A;  2QLV B;  3VB9 A;  2V8I A;  3BG0 B;  1M1K 1;  3GTP I;  2JUB A;  1NP6 A;  2EGT A;  2JA7 I;  3NDJ A;  5IT9 f;  1TWA I;  3I4M I;  2OOY B;  1RNI A;  4NH1 C;  3CC7 Z;  1Q86 2;  4BBS I;  1VQ4 Z;  4A3I I;  3G71 1;  4A3L I;  2RT9 A;  4RVH A;  3CC2 1;  2VUG A;  4A3B I;  4A93 I;  3S2H I;  1YI2 1;  3HOZ I;  2V8J A;  4HGZ A;  2I3C A;  1N2F A;  3NH8 A;  1S7M A;  3U50 C;  4MD9 A;  4MRI A;  1W2B Y;  1Q81 2;  3HOV I;  1VQ9 Z;  1USP B;  2RBL A;  1Q86 1;  2E2H I;  3I07 A;  3MON A;  4NBD A;  3QWU A;  2JS4 A;  3GTQ I;  2R93 I;  4BY7 I;  3CPW Y;  3M4O I;  1WII A;  3CCR 1;  1LQL A;  4TNU A;  3PO3 S;  1VQ7 Z;  4MD8 A;  3TDH B;  1VQK 1;  1TFI A;  3EER A;  2E2I I;  1Q81 1;  1JJ2 Z;  3NDI A;  3VMI A;  4NBE A;  1YIJ Z;  3JAM f;  2GTI A;  3CQZ I;  3CCQ Z;  1K8A 2;  2E9H A;  1QVG Z;  3K7A I;  4MXU A;  2ZAE B;  1VQM Z;  5C3E I;  3NH4 A;  2IZ3 A;  2F4M A;  4RVF A;  2W03 A;  1TWF I;  4A3D I;  1RO2 A;  3CCL 1;  3D6W A;  1VQP Z;  2H85 A;  2VF1 A;  1VQO Z;  2QRE B;  4A3M I;  1VQ5 Z;  2JNY A;  4NBG A;  3KIH A;  1Y1V S;  1VLA A;  5IP7 I;  2QA4 1;  2Y0S A;  3CCM 1;  2B63 I;  1R9T I;  4A3E I;  4E31 A;  3CCQ 1;  1I50 I;  2O53 A;  2QRC B;  2K3R A;  5D1O A;  3I56 Z;  1VQN Z;  1Q82 2;  3OW2 Y;  2OTL Z;  2PM9 A;  3J81 f;  4A3F I;  2J6A A;  1KC8 2;  4NBH A;  2GU2 A;  3CXC Z;  1I6H I;  1QF8 A;  1ZH1 A;  2JR6 A;  3GTG I;  2JA5 I;  2LIY A;  3S1N I;  2QKD A;  4S1T A;  1Q82 1;  4EWC A;  1Z01 A;  4MH4 A;  3CME Z;  2KI7 B;  3CCV Z;  3G6E Z;  4E2Z A;  2DE6 A;  4Y52 I;  4HGY A;  3I56 1;  1YIT Z;  3H3V J;  4QTU A;  3I55 Z;  1S72 Z;  2JMO A;  1KD1 2;  4A3J I;  3CCS Z;  1ZB8 A;  5T6B A;  4RS4 A;  4NOZ A;  1TWC I;  3GTJ I;  1YJN 1;  2W04 A;  3I4N I;  3S1Q I;  3ESW A;  3GTO I;  1USP A;  1TWG I;  4A3C I;  5FLX b;  1K83 I;  2WB1 A;  3CCU Z;  4BY1 I;  1TWH I;  3GTM I;  3CC4 Z;  4E32 A;  4AYB A;  3Q87 A;  5IP9 I;  3MZK B;  2LFU A;  3CME 1;  1QVF Z;  1RO4 A;  3BG1 B;  3CC7 1;  3CCV 1;  3G6E 1;  1VQ8 Z;  4DK1 A;  1VQ4 1;  3P5J B;  1X0T A;  1YIT 1;  2RPR A;  1S72 1;  1K73 2;  3F3F C;  3LUS A;  1ML8 A;  2NVY I;  3FQM A;  3M3Y I;  4E33 A;  1X3Z A;  3KIF A;  1Z03 A;  1KQS Y;  5C4J I;  2HU9 A;  5CM2 M;  1VQ9 1;  1L1O C;  1NJI 2;  1Y1W I;  4E30 A;  4E2W A;  3EED A;  3CCJ Z;  1NUI A;  3RZD I;  1K73 1;  4RVG A;  1Z02 A;  3D9X A;  1VQ8 1;  1W2B Z;  4NBB A;  2HF1 A;  5LL6 f;  4RV9 A;  1VQ7 1;  1M90 2;  1K9M 2;  3GKQ A;  1K8A 1;  1YJ9 Z;  2M6N A;  3NH5 A;  1NJI 1;  2PK7 A;  1YIJ 1;  3S1M I;  3CPW Z;  3CCE Z;  2OOX B;  5FLX f;  2PMZ A;  2R7Z I;  2QEX Z;  1VQM 1;  3CCJ 1;  1K9M 1;  1QYP A;  3HOU I;  1YUK A;  2RHB A;  5A2Q b;  1VQP 1;  3S16 I;  4MON A;  2R6M A;  1VQO 1;  3IF8 A;  5AN9 F;  1VQ5 1;  1YI2 Z;  2OZK A;  3JAM b;  1VQ6 Z;  2NVX I;  2YU9 I;  1RQF A;  1KC8 1;  2F4O A;  3CCE 1;  4XX2 A;  1VQN 1;  1WW9 A;  1RO0 A;  1VQL Z;  3RZO I;  3J80 b;  2QEX 1;  2QR1 B;  3PO3 I;  1JJ2 Y;  2OTL 1;  4RVD A;  2DE7 A;  1M1K 2;  1PFT A;  3HOY I;  3S17 I;  3HOW I;  1KRL A;  2K5R A;  3CCR Z;  1QVG Y;  3NFZ A;  4X6A I;  1YJW Z;  1VQK Z;  3MZL B;  3OW2 Z;  4DQY B;  4NBC A;  1KD1 1;  2GTH A;  3S1R I;  2VUM I;  1ZB9 A;  3VMH A;  2IZ4 A;  5C4X I;  2YAD A;  1VQ6 1;  2KPI A;  2QRD B;  5D1P A;  4MD7 A;  5FLM I;  3TE5 B;  4E2X A;  4Y7N I;  3I55 1;  2JA8 I;  1VQL 1;  3CCS 1;  1Q7Y 2;  1I3Q I;  4A3K I;  3IX0 A;  2E2J I;  3G4S Z;  1DL6 A;  2P28 A;  3CMA Z;  3J81 b;  1Y1V I;  2WAQ A;  4A3G I;  3HKZ A;  2NVQ I;  2OTJ Z;  3CCL Z;  5A2Q f;  2R92 I;  2AKL A;  1YHQ Z;  1P9N A;  2P3Y A;  2NVT I;  3GCF A;  1YJW 1;  4NFR A;  3CCU 1;  3CC4 1;  4NB8 A;  2V8K A;  4BXX I;  4NBF A;  3S15 I;  2BJO A;  2QA4 Z;  1Q7Y 1;  5IT9 b;  3CCM Z;  3J7A 4;  4DGL A;  3CXC Y;  3S2D I;  2DE5 A;  3CD6 Z;  3GTL I;  3T4N B;  3GTM S;  2G2K A;  5T64 A;  3J80 f;  5T67 A;  3G4S 1;  3CMA 1;  2Q51 A;  3VTN A;  1YUA A;  1JWH C;  2OTJ 1;  1N8R 2;  2O4H A;  4BBR I;  1YHQ 1;  4NB9 A;  1SFO I;  3F3P C;  1M90 1;  1X3W A;  3FQQ A;  2JA6 I;  3VMG A;  1WCM I;  1RLY A;  2M48 A;  1KQS Z;  4NBA A;  4E2Y A;  3S14 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...