5C3EI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI02
1N2FA 3K7AI 3S2HI 3GTOI 2AKLA 3HOVI 2K5RA 3S17I 3GTMS 1DL6A 2E2JI 2JA6I 1PFTA 3S15I 4BXXI 1X3ZA 3M4OI 1TWFI 3LUSA 5IP9I 4NBAA 4NBFA 1I3QI 2KPIA 4NB9A 1USPA 3EERA 4BBRI 4QTTA 1R9TI 2R7ZI 4NBEA 1RLYA 1Y1VS 3VMIA 2F4MA 3CQZI 1TWHI 2NVXI 4NBDA 3I4MI 1TWGI 2JA5I 1WCMI 4A3EI 3S16I 1TWAI 2JR6A 4A3LI 1LQLA 3S1MI 2PK7A 3I4NI 2R93I 1ZB8A 2YU9I 4NBCA 1L1OC 3FKII 4A93I 2JA8I 3VB9A 4MH4A 4NBBA 4NBHA 3H0GI 1ML8A 5FLMI 4A3BI 1I6HI 3I07A 4XX2A 3PO3S 3RZOI 4A3FI 3S2DI 1TFIA 2JNYA 3S1RI 2F4OA 1USPB 4NOZA 4A3GI 4NB8A 3GTQI 3GTPI 3GTJI 2BJOA 3S14I 4BY7I 3GTGI 2HF1A 2P3YA 1SFOI 3HOXI 1ZB9A 4X6AI 2B63I 3VMHA 5C3EI 3HOZI 4BY1I 4QTUA 1QYPA 3D6WA 3GTMI 5C4JI 5C44I 3GTLI 4A3CI 3RZDI 3ESWA 3PO2I 3GKQA 2J6AA 5CM2M 3HOUI 1TWCI 2NVTI 3HOYI 3S1QI 1VLAA 2E2II 2E2HI 2VUMI 2NVQI 2R92I 3S1NI 4Y7NI 3HOWI 4BBSI 2DE7A 2NVYI 3GCFA 5C4XI 2JS4A 3M3YI 1Y1VI 1I50I 1RO4A 4A3MI 1K83I 4A3DI 3Q87A 3U50C 4Y52I 5IP7I 1Y1WI 2DE6A 4A3II 4NBGA 1YUAA 2RBLA 1WW9A 3GTKI 2JA7I 1X3WA 1NUIA 4A3JI 2DE5A 3PO3I 3H3VJ 3VMGA 4A3KI
chains in the Genus database with same CATH superfamily
3D2LA 3F3FC 3NDJA 3CMEZ 3J80b 3S15I 1M1K2 1X3ZA 4NBFA 3G6E1 4NB9A 3EERA 2W04A 4BBRI 3NH4A 2E7ZA 2WB1A 1R9TI 1QVGZ 4NBEA 3CQZI 1TWHI 2JIRA 4NBDA 1S7MA 4RVGA 3HKZA 1VQO1 4A3LI 2NAPA 3S1MI 2PK7A 3I4NI 1ZB8A 4NBCA 1L1OC 2QEXZ 3CD61 4NBBA 4NBHA 1JJ2Y 1VQMZ 1YJW1 2V8IA 2JNYA 1VQK1 1YUKA 2F4OA 3GTQI 3GTPI 2HU9A 2RPRA 2BJOA 1VQ91 2K3RA 5FLXf 1W2BY 1W2BZ 1SFOI 3HOXI 1ZB9A 1YJN1 3MONA 5C3EI 3HOZI 1VQLZ 1M1K1 4AYBA 1KRLA 1VQ4Z 2OOYB 3GTMI 5T64A 1S721 3PO2I 5IT9b 2J6AA 2NVTI 3T4NB 1Q822 2QA41 2NVQI 4S1TA 4TNUA 1VQL1 1RO2A 1VQ41 1NJI2 4HGYA 1YI21 3CCUZ 1N8R2 4A3MI 1RO0A 4RVFA 2PM9A 3JAMb 3GTKI 3TDHB 2WAQA 4A3KI 5D1OB 1Q812 3CC41 1N2FA 2QREB 3G4S1 3K7AI 1QVFY 3CMA1 1QVFZ 2AKLA 3CCSZ 3HOVI 4E33A 2K5RA 3KIFA 3OW2Y 3OW2Z 4BXXI 2OOXB 1TWFI 2O4HA 1WZNA 3CCJZ 3CC2Z 4NH1C 5FLXb 4QTTA 1Q821 1VQPZ 2NVXI 1VQ6Z 1TWGI 2JA5I 2OTL1 3J7A4 2M6NA 1NJI1 4A3EI 2JR6A 2QKDA 3QWUA 4MXUA 3TE5B 3CCJ1 1N8R1 2R93I 4MH4A 4MD9A 4DQYB 1YHQ1 1VQP1 1Y8CA 2JUBA 5A2Qb 3CCQZ 2IV2X 1I6HI 3PO3S 3RZOI 3CCRZ 3BG1B 3CME1 4NOZA 4A3GI 1VQNZ 1Q811 3CPWY 3CPWZ 3IR7A 4DGLA 3S14I 2JIOA 2VUGA 2EGTA 4MRIA 1ZH1A 3CCLZ 4X6AI 2Q4ZA 4RVHA 1JJ2Z 2QR1B 3CCMZ 1KC82 5C44I 4A3CI 1K732 4HGZA 3GKQA 2IZ3A 2GTIA 2E2HI 2VUMI 3IF8A 5D1OA 5D1PA 2QEX1 2R92I 3S1NI 1VQM1 1P9NA 2Q51A 2QRCB 3CCM1 3CXCY 2DE7A 1FDOA 2VF1A 3CXCZ 5C4XI 2JS4A 4E31A 1I50I 1AA6A 4A3DI 2AYDA 2VPWA 3J81f 5IP7I 1KQSY 1Z01A 1M902 1QXFA 3CC7Z 4E2ZA 2O53A 2RT9A 2VPXA 3D9XA 1YJ9Z 3GTOI 1VQ5Z 1YITZ 3S17I 1DL6A 2E9HA 2E2JI 1PFTA 2JA6I 3J80f 1KC81 1K731 3LUSA 3MZLB 4NBAA 1I3QI 3CCU1 2R7ZI 3VMIA 1RLYA 1Y1VS 2F4MA 2OTJZ 4NFRA 4EWCA 2V8KA 3CCEZ 3FKII 4A93I 2VPZA 3I56Z 3H0GI 5FLMI 3FQQA 1VQ8Z 4A3BI 5LL6f 1M901 1YIJZ 4A3FI 3S1RI 3CCE1 2LFUA 3NFZA 3CCS1 1USPB 5AN9F 1VQ81 4BY7I 1X0TA 4E2YA 2P3YA 4MD8A 2V45A 3CC21 2QRDB 2B63I 3VMHA 3F3PC 2G2KA 4DK1A 1VQ61 1Q861 4QTUA 1RQFA 2IZ4A 1K8A2 2R6MA 1SIWA 2Y0SA 5CM2M 3HOYI 2E2II 5T6BA 5IT9f 3MZKB 3HOWI 3CCQ1 2NVYI 2GTHA 3M3YI 3G6EZ 3CCR1 1NP6A 1K83I 1VQN1 3U50C 4A3II 1Z03A 2OZKA 1VQOZ 1YUAA 1RNIA 2RBLA 1WW9A 2JIQA 1X3WA 3NH8A 1FDIA 3CCL1 1QVGY 1NUIA 4A3JI 3CD6Z 2DE5A 3PO3I 3JAMf 3VMGA 4HH4A 1Q7Y2 1YJWZ 2M48A 3S2HI 1VQKZ 2JIPA 2ZAEB 3GTMS 4RV9A 1VQ9Z 1K9M2 2RIQA 3M4OI 1KQSZ 5IP9I 1K8A1 2V8JA 2KPIA 1USPA 2PMZA 1YJNZ 4MD7A 3I55Z 3EEDA 1Q16A 1WJ2A 4E2XA 3I4MI 3G71Z 1WCMI 3S16I 1TWAI 1S72Z 1LQLA 2RHBA 3NH5A 3FQMA 4CL1A 3I551 2YU9I 2JA8I 3VB9A 2QA4Z 3CC71 1ML8A 3G711 3I07A 4XX2A 1Q862 1Z02A 5T67A 1KD12 3S2DI 1YI2Z 1TFIA 5A2Qf 3IX0A 1YJ91 1VQ51 1YIT1 3BG0B 4NB8A 1Q7Y1 3GTJI 2QLVB 2I3CA 4E2WA 3GTGI 2HF1A 3VTNA 4MONA 4RS4A 2LEXA 2LIYA 4E30A 3CC4Z 1K9M1 3G4SZ 2W03A 4BY1I 2OTJ1 1QYPA 3D6WA 2YADA 5C4JI 3CMAZ 3GTLI 1VQ7Z 3RZDI 3ESWA 1JWHC 4E32A 3HOUI 1TWCI 2JIMA 3CCVZ 3S1QI 1VLAA 1WIIA 4Y7NI 3I561 4BBSI 4RVDA 3GCFA 1VQ71 1Y1VI 1YIJ1 3J81b 1RO4A 3CCV1 2H85A 3P5JB 3Q87A 4Y52I 2OTLZ 1Y1WI 2DE6A 4NBGA 2KI7B 1KD11 3KIHA 3NDIA 2P28A 2VPYA 2GU2A 3IFUA 2JA7I 2JMOA 1YHQZ 3H3VJ 2V3VA 1QF8A
chains in the Genus database with same CATH topology
3F3FC 3NDJA 3CMEZ 3J80b 3S15I 1M1K2 1X3ZA 4NBFA 3G6E1 4NB9A 3EERA 2W04A 4BBRI 3NH4A 2WB1A 1R9TI 1QVGZ 4NBEA 3CQZI 1TWHI 4NBDA 1S7MA 4RVGA 3HKZA 1VQO1 4A3LI 3S1MI 2PK7A 3I4NI 1ZB8A 4NBCA 1L1OC 2QEXZ 3CD61 4NBBA 4NBHA 1JJ2Y 1VQMZ 1YJW1 2V8IA 2JNYA 1VQK1 1YUKA 2F4OA 3GTQI 3GTPI 2HU9A 2RPRA 2BJOA 1VQ91 2K3RA 5FLXf 1W2BY 1W2BZ 1SFOI 3HOXI 1ZB9A 1YJN1 3MONA 5C3EI 3HOZI 1VQLZ 1M1K1 4AYBA 1KRLA 1VQ4Z 2OOYB 3GTMI 5T64A 1S721 3PO2I 5IT9b 2J6AA 2NVTI 3T4NB 1Q822 2QA41 2NVQI 4S1TA 4TNUA 1VQL1 1RO2A 1VQ41 1NJI2 4HGYA 1YI21 3CCUZ 1N8R2 4A3MI 1RO0A 4RVFA 2PM9A 3JAMb 3GTKI 3TDHB 2WAQA 4A3KI 5D1OB 1Q812 3CC41 1N2FA 2QREB 3G4S1 3K7AI 1QVFY 3CMA1 1QVFZ 2AKLA 3CCSZ 3HOVI 4E33A 2K5RA 3KIFA 3OW2Y 3OW2Z 4BXXI 2OOXB 1TWFI 2O4HA 3CCJZ 3CC2Z 4NH1C 5FLXb 4QTTA 1Q821 1VQPZ 2NVXI 1VQ6Z 1TWGI 2JA5I 2OTL1 3J7A4 2M6NA 1NJI1 4A3EI 2JR6A 2QKDA 3QWUA 4MXUA 3TE5B 3CCJ1 1N8R1 2R93I 4MH4A 4MD9A 4DQYB 1YHQ1 1VQP1 2JUBA 5A2Qb 3CCQZ 1I6HI 3PO3S 3RZOI 3CCRZ 3BG1B 3CME1 4NOZA 4A3GI 1VQNZ 1Q811 3CPWY 3CPWZ 4DGLA 3S14I 2VUGA 2EGTA 4MRIA 1ZH1A 3CCLZ 4X6AI 2Q4ZA 4RVHA 1JJ2Z 2QR1B 3CCMZ 1KC82 5C44I 4A3CI 1K732 4HGZA 3GKQA 2IZ3A 2GTIA 2E2HI 2VUMI 3IF8A 5D1OA 5D1PA 2QEX1 2R92I 3S1NI 1VQM1 1P9NA 2Q51A 2QRCB 3CCM1 3CXCY 2DE7A 3CXCZ 2VF1A 5C4XI 2JS4A 4E31A 1I50I 4A3DI 3J81f 5IP7I 1KQSY 1Z01A 1M902 3CC7Z 4E2ZA 2O53A 2RT9A 3D9XA 1YJ9Z 3GTOI 1VQ5Z 1YITZ 3S17I 1DL6A 2E9HA 2E2JI 1PFTA 2JA6I 3J80f 1KC81 1K731 3LUSA 3MZLB 4NBAA 1I3QI 3CCU1 2R7ZI 3VMIA 1RLYA 1Y1VS 2F4MA 2OTJZ 4NFRA 4EWCA 2V8KA 3CCEZ 3FKII 4A93I 3I56Z 3H0GI 5FLMI 3FQQA 1VQ8Z 4A3BI 5LL6f 1M901 1YIJZ 4A3FI 3S1RI 3CCE1 2LFUA 3NFZA 3CCS1 1USPB 5AN9F 1VQ81 4BY7I 1X0TA 4E2YA 2P3YA 4MD8A 3CC21 2QRDB 2B63I 3VMHA 3F3PC 2G2KA 4DK1A 1VQ61 1Q861 4QTUA 1RQFA 2IZ4A 1K8A2 2R6MA 2Y0SA 5CM2M 3HOYI 2E2II 5T6BA 5IT9f 3MZKB 3HOWI 3CCQ1 2NVYI 2GTHA 3M3YI 3G6EZ 3CCR1 1NP6A 1K83I 1VQN1 3U50C 4A3II 1Z03A 2OZKA 1VQOZ 1YUAA 1RNIA 2RBLA 1WW9A 1X3WA 3NH8A 3CCL1 1QVGY 1NUIA 4A3JI 3CD6Z 2DE5A 3PO3I 3JAMf 3VMGA 4HH4A 1Q7Y2 1YJWZ 2M48A 3S2HI 1VQKZ 2ZAEB 3GTMS 4RV9A 1VQ9Z 1K9M2 2RIQA 3M4OI 1KQSZ 5IP9I 1K8A1 2V8JA 2KPIA 1USPA 2PMZA 1YJNZ 4MD7A 3I55Z 3EEDA 4E2XA 3I4MI 3G71Z 1WCMI 3S16I 1TWAI 1S72Z 1LQLA 2RHBA 3NH5A 3FQMA 4CL1A 3I551 2YU9I 2JA8I 3VB9A 2QA4Z 3CC71 1ML8A 3G711 3I07A 4XX2A 1Q862 1Z02A 5T67A 1KD12 3S2DI 1YI2Z 1TFIA 5A2Qf 3IX0A 1YJ91 1VQ51 1YIT1 3BG0B 4NB8A 1Q7Y1 3GTJI 2QLVB 2I3CA 4E2WA 3GTGI 2HF1A 3VTNA 4MONA 4RS4A 2LIYA 4E30A 3CC4Z 1K9M1 3G4SZ 2W03A 4BY1I 2OTJ1 1QYPA 3D6WA 2YADA 5C4JI 3CMAZ 3GTLI 1VQ7Z 3RZDI 3ESWA 1JWHC 4E32A 3HOUI 1TWCI 3CCVZ 3S1QI 1VLAA 1WIIA 4Y7NI 3I561 4BBSI 4RVDA 3GCFA 1VQ71 1Y1VI 1YIJ1 3J81b 1RO4A 3CCV1 2H85A 3P5JB 3Q87A 4Y52I 2OTLZ 1Y1WI 2DE6A 4NBGA 2KI7B 1KD11 3KIHA 3NDIA 2P28A 2GU2A 3IFUA 2JA7I 2JMOA 1YHQZ 3H3VJ 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  3K7A I;  3S2H I;  3GTO I;  2AKL A;  3HOV I;  2K5R A;  3S17 I;  3GTM S;  1DL6 A;  2E2J I;  2JA6 I;  1PFT A;  3S15 I;  4BXX I;  1X3Z A;  3M4O I;  1TWF I;  3LUS A;  5IP9 I;  4NBA A;  4NBF A;  1I3Q I;  2KPI A;  4NB9 A;  1USP A;  3EER A;  4BBR I;  4QTT A;  1R9T I;  2R7Z I;  4NBE A;  1RLY A;  1Y1V S;  3VMI A;  2F4M A;  3CQZ I;  1TWH I;  2NVX I;  4NBD A;  3I4M I;  1TWG I;  2JA5 I;  1WCM I;  4A3E I;  3S16 I;  1TWA I;  2JR6 A;  4A3L I;  1LQL A;  3S1M I;  2PK7 A;  3I4N I;  2R93 I;  1ZB8 A;  2YU9 I;  4NBC A;  1L1O C;  3FKI I;  4A93 I;  2JA8 I;  3VB9 A;  4MH4 A;  4NBB A;  4NBH A;  3H0G I;  1ML8 A;  5FLM I;  4A3B I;  1I6H I;  3I07 A;  4XX2 A;  3PO3 S;  3RZO I;  4A3F I;  3S2D I;  1TFI A;  2JNY A;  3S1R I;  2F4O A;  1USP B;  4NOZ A;  4A3G I;  4NB8 A;  3GTQ I;  3GTP I;  3GTJ I;  2BJO A;  3S14 I;  4BY7 I;  3GTG I;  2HF1 A;  2P3Y A;  1SFO I;  3HOX I;  1ZB9 A;  4X6A I;  2B63 I;  3VMH A;  5C3E I;  3HOZ I;  4BY1 I;  4QTU A;  1QYP A;  3D6W A;  3GTM I;  5C4J I;  5C44 I;  3GTL I;  4A3C I;  3RZD I;  3ESW A;  3PO2 I;  3GKQ A;  2J6A A;  5CM2 M;  3HOU I;  1TWC I;  2NVT I;  3HOY I;  3S1Q I;  1VLA A;  2E2I I;  2E2H I;  2VUM I;  2NVQ I;  2R92 I;  3S1N I;  4Y7N I;  3HOW I;  4BBS I;  2DE7 A;  2NVY I;  3GCF A;  5C4X I;  2JS4 A;  3M3Y I;  1Y1V I;  1I50 I;  1RO4 A;  4A3M I;  1K83 I;  4A3D I;  3Q87 A;  3U50 C;  4Y52 I;  5IP7 I;  1Y1W I;  2DE6 A;  4A3I I;  4NBG A;  1YUA A;  2RBL A;  1WW9 A;  3GTK I;  2JA7 I;  1X3W A;  1NUI A;  4A3J I;  2DE5 A;  3PO3 I;  3H3V J;  3VMG A;  4A3K I; 
#chains in the Genus database with same CATH topology
 3D2L A;  3F3F C;  3NDJ A;  3CME Z;  3J80 b;  3S15 I;  1M1K 2;  1X3Z A;  4NBF A;  3G6E 1;  4NB9 A;  3EER A;  2W04 A;  4BBR I;  3NH4 A;  2E7Z A;  2WB1 A;  1R9T I;  1QVG Z;  4NBE A;  3CQZ I;  1TWH I;  2JIR A;  4NBD A;  1S7M A;  4RVG A;  3HKZ A;  1VQO 1;  4A3L I;  2NAP A;  3S1M I;  2PK7 A;  3I4N I;  1ZB8 A;  4NBC A;  1L1O C;  2QEX Z;  3CD6 1;  4NBB A;  4NBH A;  1JJ2 Y;  1VQM Z;  1YJW 1;  2V8I A;  2JNY A;  1VQK 1;  1YUK A;  2F4O A;  3GTQ I;  3GTP I;  2HU9 A;  2RPR A;  2BJO A;  1VQ9 1;  2K3R A;  5FLX f;  1W2B Y;  1W2B Z;  1SFO I;  3HOX I;  1ZB9 A;  1YJN 1;  3MON A;  5C3E I;  3HOZ I;  1VQL Z;  1M1K 1;  4AYB A;  1KRL A;  1VQ4 Z;  2OOY B;  3GTM I;  5T64 A;  1S72 1;  3PO2 I;  5IT9 b;  2J6A A;  2NVT I;  3T4N B;  1Q82 2;  2QA4 1;  2NVQ I;  4S1T A;  4TNU A;  1VQL 1;  1RO2 A;  1VQ4 1;  1NJI 2;  4HGY A;  1YI2 1;  3CCU Z;  1N8R 2;  4A3M I;  1RO0 A;  4RVF A;  2PM9 A;  3JAM b;  3GTK I;  3TDH B;  2WAQ A;  4A3K I;  5D1O B;  1Q81 2;  3CC4 1;  1N2F A;  2QRE B;  3G4S 1;  3K7A I;  1QVF Y;  3CMA 1;  1QVF Z;  2AKL A;  3CCS Z;  3HOV I;  4E33 A;  2K5R A;  3KIF A;  3OW2 Y;  3OW2 Z;  4BXX I;  2OOX B;  1TWF I;  2O4H A;  1WZN A;  3CCJ Z;  3CC2 Z;  4NH1 C;  5FLX b;  4QTT A;  1Q82 1;  1VQP Z;  2NVX I;  1VQ6 Z;  1TWG I;  2JA5 I;  2OTL 1;  3J7A 4;  2M6N A;  1NJI 1;  4A3E I;  2JR6 A;  2QKD A;  3QWU A;  4MXU A;  3TE5 B;  3CCJ 1;  1N8R 1;  2R93 I;  4MH4 A;  4MD9 A;  4DQY B;  1YHQ 1;  1VQP 1;  1Y8C A;  2JUB A;  5A2Q b;  3CCQ Z;  2IV2 X;  1I6H I;  3PO3 S;  3RZO I;  3CCR Z;  3BG1 B;  3CME 1;  4NOZ A;  4A3G I;  1VQN Z;  1Q81 1;  3CPW Y;  3CPW Z;  3IR7 A;  4DGL A;  3S14 I;  2JIO A;  2VUG A;  2EGT A;  4MRI A;  1ZH1 A;  3CCL Z;  4X6A I;  2Q4Z A;  4RVH A;  1JJ2 Z;  2QR1 B;  3CCM Z;  1KC8 2;  5C44 I;  4A3C I;  1K73 2;  4HGZ A;  3GKQ A;  2IZ3 A;  2GTI A;  2E2H I;  2VUM I;  3IF8 A;  5D1O A;  5D1P A;  2QEX 1;  2R92 I;  3S1N I;  1VQM 1;  1P9N A;  2Q51 A;  2QRC B;  3CCM 1;  3CXC Y;  2DE7 A;  1FDO A;  2VF1 A;  3CXC Z;  5C4X I;  2JS4 A;  4E31 A;  1I50 I;  1AA6 A;  4A3D I;  2AYD A;  2VPW A;  3J81 f;  5IP7 I;  1KQS Y;  1Z01 A;  1M90 2;  1QXF A;  3CC7 Z;  4E2Z A;  2O53 A;  2RT9 A;  2VPX A;  3D9X A;  1YJ9 Z;  3GTO I;  1VQ5 Z;  1YIT Z;  3S17 I;  1DL6 A;  2E9H A;  2E2J I;  1PFT A;  2JA6 I;  3J80 f;  1KC8 1;  1K73 1;  3LUS A;  3MZL B;  4NBA A;  1I3Q I;  3CCU 1;  2R7Z I;  3VMI A;  1RLY A;  1Y1V S;  2F4M A;  2OTJ Z;  4NFR A;  4EWC A;  2V8K A;  3CCE Z;  3FKI I;  4A93 I;  2VPZ A;  3I56 Z;  3H0G I;  5FLM I;  3FQQ A;  1VQ8 Z;  4A3B I;  5LL6 f;  1M90 1;  1YIJ Z;  4A3F I;  3S1R I;  3CCE 1;  2LFU A;  3NFZ A;  3CCS 1;  1USP B;  5AN9 F;  1VQ8 1;  4BY7 I;  1X0T A;  4E2Y A;  2P3Y A;  4MD8 A;  2V45 A;  3CC2 1;  2QRD B;  2B63 I;  3VMH A;  3F3P C;  2G2K A;  4DK1 A;  1VQ6 1;  1Q86 1;  4QTU A;  1RQF A;  2IZ4 A;  1K8A 2;  2R6M A;  1SIW A;  2Y0S A;  5CM2 M;  3HOY I;  2E2I I;  5T6B A;  5IT9 f;  3MZK B;  3HOW I;  3CCQ 1;  2NVY I;  2GTH A;  3M3Y I;  3G6E Z;  3CCR 1;  1NP6 A;  1K83 I;  1VQN 1;  3U50 C;  4A3I I;  1Z03 A;  2OZK A;  1VQO Z;  1YUA A;  1RNI A;  2RBL A;  1WW9 A;  2JIQ A;  1X3W A;  3NH8 A;  1FDI A;  3CCL 1;  1QVG Y;  1NUI A;  4A3J I;  3CD6 Z;  2DE5 A;  3PO3 I;  3JAM f;  3VMG A;  4HH4 A;  1Q7Y 2;  1YJW Z;  2M48 A;  3S2H I;  1VQK Z;  2JIP A;  2ZAE B;  3GTM S;  4RV9 A;  1VQ9 Z;  1K9M 2;  2RIQ A;  3M4O I;  1KQS Z;  5IP9 I;  1K8A 1;  2V8J A;  2KPI A;  1USP A;  2PMZ A;  1YJN Z;  4MD7 A;  3I55 Z;  3EED A;  1Q16 A;  1WJ2 A;  4E2X A;  3I4M I;  3G71 Z;  1WCM I;  3S16 I;  1TWA I;  1S72 Z;  1LQL A;  2RHB A;  3NH5 A;  3FQM A;  4CL1 A;  3I55 1;  2YU9 I;  2JA8 I;  3VB9 A;  2QA4 Z;  3CC7 1;  1ML8 A;  3G71 1;  3I07 A;  4XX2 A;  1Q86 2;  1Z02 A;  5T67 A;  1KD1 2;  3S2D I;  1YI2 Z;  1TFI A;  5A2Q f;  3IX0 A;  1YJ9 1;  1VQ5 1;  1YIT 1;  3BG0 B;  4NB8 A;  1Q7Y 1;  3GTJ I;  2QLV B;  2I3C A;  4E2W A;  3GTG I;  2HF1 A;  3VTN A;  4MON A;  4RS4 A;  2LEX A;  2LIY A;  4E30 A;  3CC4 Z;  1K9M 1;  3G4S Z;  2W03 A;  4BY1 I;  2OTJ 1;  1QYP A;  3D6W A;  2YAD A;  5C4J I;  3CMA Z;  3GTL I;  1VQ7 Z;  3RZD I;  3ESW A;  1JWH C;  4E32 A;  3HOU I;  1TWC I;  2JIM A;  3CCV Z;  3S1Q I;  1VLA A;  1WII A;  4Y7N I;  3I56 1;  4BBS I;  4RVD A;  3GCF A;  1VQ7 1;  1Y1V I;  1YIJ 1;  3J81 b;  1RO4 A;  3CCV 1;  2H85 A;  3P5J B;  3Q87 A;  4Y52 I;  2OTL Z;  1Y1W I;  2DE6 A;  4NBG A;  2KI7 B;  1KD1 1;  3KIH A;  3NDI A;  2P28 A;  2VPY A;  2GU2 A;  3IFU A;  2JA7 I;  2JMO A;  1YHQ Z;  3H3V J;  2V3V A;  1QF8 A; 
#chains in the Genus database with same CATH homology
 3F3F C;  3NDJ A;  3CME Z;  3J80 b;  3S15 I;  1M1K 2;  1X3Z A;  4NBF A;  3G6E 1;  4NB9 A;  3EER A;  2W04 A;  4BBR I;  3NH4 A;  2WB1 A;  1R9T I;  1QVG Z;  4NBE A;  3CQZ I;  1TWH I;  4NBD A;  1S7M A;  4RVG A;  3HKZ A;  1VQO 1;  4A3L I;  3S1M I;  2PK7 A;  3I4N I;  1ZB8 A;  4NBC A;  1L1O C;  2QEX Z;  3CD6 1;  4NBB A;  4NBH A;  1JJ2 Y;  1VQM Z;  1YJW 1;  2V8I A;  2JNY A;  1VQK 1;  1YUK A;  2F4O A;  3GTQ I;  3GTP I;  2HU9 A;  2RPR A;  2BJO A;  1VQ9 1;  2K3R A;  5FLX f;  1W2B Y;  1W2B Z;  1SFO I;  3HOX I;  1ZB9 A;  1YJN 1;  3MON A;  5C3E I;  3HOZ I;  1VQL Z;  1M1K 1;  4AYB A;  1KRL A;  1VQ4 Z;  2OOY B;  3GTM I;  5T64 A;  1S72 1;  3PO2 I;  5IT9 b;  2J6A A;  2NVT I;  3T4N B;  1Q82 2;  2QA4 1;  2NVQ I;  4S1T A;  4TNU A;  1VQL 1;  1RO2 A;  1VQ4 1;  1NJI 2;  4HGY A;  1YI2 1;  3CCU Z;  1N8R 2;  4A3M I;  1RO0 A;  4RVF A;  2PM9 A;  3JAM b;  3GTK I;  3TDH B;  2WAQ A;  4A3K I;  5D1O B;  1Q81 2;  3CC4 1;  1N2F A;  2QRE B;  3G4S 1;  3K7A I;  1QVF Y;  3CMA 1;  1QVF Z;  2AKL A;  3CCS Z;  3HOV I;  4E33 A;  2K5R A;  3KIF A;  3OW2 Y;  3OW2 Z;  4BXX I;  2OOX B;  1TWF I;  2O4H A;  3CCJ Z;  3CC2 Z;  4NH1 C;  5FLX b;  4QTT A;  1Q82 1;  1VQP Z;  2NVX I;  1VQ6 Z;  1TWG I;  2JA5 I;  2OTL 1;  3J7A 4;  2M6N A;  1NJI 1;  4A3E I;  2JR6 A;  2QKD A;  3QWU A;  4MXU A;  3TE5 B;  3CCJ 1;  1N8R 1;  2R93 I;  4MH4 A;  4MD9 A;  4DQY B;  1YHQ 1;  1VQP 1;  2JUB A;  5A2Q b;  3CCQ Z;  1I6H I;  3PO3 S;  3RZO I;  3CCR Z;  3BG1 B;  3CME 1;  4NOZ A;  4A3G I;  1VQN Z;  1Q81 1;  3CPW Y;  3CPW Z;  4DGL A;  3S14 I;  2VUG A;  2EGT A;  4MRI A;  1ZH1 A;  3CCL Z;  4X6A I;  2Q4Z A;  4RVH A;  1JJ2 Z;  2QR1 B;  3CCM Z;  1KC8 2;  5C44 I;  4A3C I;  1K73 2;  4HGZ A;  3GKQ A;  2IZ3 A;  2GTI A;  2E2H I;  2VUM I;  3IF8 A;  5D1O A;  5D1P A;  2QEX 1;  2R92 I;  3S1N I;  1VQM 1;  1P9N A;  2Q51 A;  2QRC B;  3CCM 1;  3CXC Y;  2DE7 A;  3CXC Z;  2VF1 A;  5C4X I;  2JS4 A;  4E31 A;  1I50 I;  4A3D I;  3J81 f;  5IP7 I;  1KQS Y;  1Z01 A;  1M90 2;  3CC7 Z;  4E2Z A;  2O53 A;  2RT9 A;  3D9X A;  1YJ9 Z;  3GTO I;  1VQ5 Z;  1YIT Z;  3S17 I;  1DL6 A;  2E9H A;  2E2J I;  1PFT A;  2JA6 I;  3J80 f;  1KC8 1;  1K73 1;  3LUS A;  3MZL B;  4NBA A;  1I3Q I;  3CCU 1;  2R7Z I;  3VMI A;  1RLY A;  1Y1V S;  2F4M A;  2OTJ Z;  4NFR A;  4EWC A;  2V8K A;  3CCE Z;  3FKI I;  4A93 I;  3I56 Z;  3H0G I;  5FLM I;  3FQQ A;  1VQ8 Z;  4A3B I;  5LL6 f;  1M90 1;  1YIJ Z;  4A3F I;  3S1R I;  3CCE 1;  2LFU A;  3NFZ A;  3CCS 1;  1USP B;  5AN9 F;  1VQ8 1;  4BY7 I;  1X0T A;  4E2Y A;  2P3Y A;  4MD8 A;  3CC2 1;  2QRD B;  2B63 I;  3VMH A;  3F3P C;  2G2K A;  4DK1 A;  1VQ6 1;  1Q86 1;  4QTU A;  1RQF A;  2IZ4 A;  1K8A 2;  2R6M A;  2Y0S A;  5CM2 M;  3HOY I;  2E2I I;  5T6B A;  5IT9 f;  3MZK B;  3HOW I;  3CCQ 1;  2NVY I;  2GTH A;  3M3Y I;  3G6E Z;  3CCR 1;  1NP6 A;  1K83 I;  1VQN 1;  3U50 C;  4A3I I;  1Z03 A;  2OZK A;  1VQO Z;  1YUA A;  1RNI A;  2RBL A;  1WW9 A;  1X3W A;  3NH8 A;  3CCL 1;  1QVG Y;  1NUI A;  4A3J I;  3CD6 Z;  2DE5 A;  3PO3 I;  3JAM f;  3VMG A;  4HH4 A;  1Q7Y 2;  1YJW Z;  2M48 A;  3S2H I;  1VQK Z;  2ZAE B;  3GTM S;  4RV9 A;  1VQ9 Z;  1K9M 2;  2RIQ A;  3M4O I;  1KQS Z;  5IP9 I;  1K8A 1;  2V8J A;  2KPI A;  1USP A;  2PMZ A;  1YJN Z;  4MD7 A;  3I55 Z;  3EED A;  4E2X A;  3I4M I;  3G71 Z;  1WCM I;  3S16 I;  1TWA I;  1S72 Z;  1LQL A;  2RHB A;  3NH5 A;  3FQM A;  4CL1 A;  3I55 1;  2YU9 I;  2JA8 I;  3VB9 A;  2QA4 Z;  3CC7 1;  1ML8 A;  3G71 1;  3I07 A;  4XX2 A;  1Q86 2;  1Z02 A;  5T67 A;  1KD1 2;  3S2D I;  1YI2 Z;  1TFI A;  5A2Q f;  3IX0 A;  1YJ9 1;  1VQ5 1;  1YIT 1;  3BG0 B;  4NB8 A;  1Q7Y 1;  3GTJ I;  2QLV B;  2I3C A;  4E2W A;  3GTG I;  2HF1 A;  3VTN A;  4MON A;  4RS4 A;  2LIY A;  4E30 A;  3CC4 Z;  1K9M 1;  3G4S Z;  2W03 A;  4BY1 I;  2OTJ 1;  1QYP A;  3D6W A;  2YAD A;  5C4J I;  3CMA Z;  3GTL I;  1VQ7 Z;  3RZD I;  3ESW A;  1JWH C;  4E32 A;  3HOU I;  1TWC I;  3CCV Z;  3S1Q I;  1VLA A;  1WII A;  4Y7N I;  3I56 1;  4BBS I;  4RVD A;  3GCF A;  1VQ7 1;  1Y1V I;  1YIJ 1;  3J81 b;  1RO4 A;  3CCV 1;  2H85 A;  3P5J B;  3Q87 A;  4Y52 I;  2OTL Z;  1Y1W I;  2DE6 A;  4NBG A;  2KI7 B;  1KD1 1;  3KIH A;  3NDI A;  2P28 A;  2GU2 A;  3IFU A;  2JA7 I;  2JMO A;  1YHQ Z;  3H3V J;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...