5C3EI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c3eI02
4NB8A 4Y7NI 3RZOI 3Q87A 2HF1A 4A3GI 3S1MI 5FLMI 3PO3S 3PO3I 1N2FA 2NVXI 3K7AI 3S15I 4BBRI 3GTPI 1Y1WI 2BJOA 5C3EI 4A3BI 3VB9A 3EERA 4MH4A 2R7ZI 3HOXI 2JS4A 1R9TI 2F4OA 2JA6I 3PO2I 3HOVI 1ZB8A 3S2DI 4QTTA 2J6AA 2JA5I 1ZB9A 3I4MI 1I3QI 2DE6A 2AKLA 3M3YI 1VLAA 1QYPA 1WCMI 4A3MI 3LUSA 1TWCI 2JA8I 2E2HI 3H0GI 3GKQA 2JA7I 3GTMS 3S16I 2PK7A 3RZDI 2NVTI 5IP7I 4A3II 4NBHA 3GTMI 3GCFA 1RLYA 4NB9A 4XX2A 2E2JI 1RO4A 4BBSI 3CQZI 3GTQI 3GTJI 2E2II 4NBAA 1DL6A 2RBLA 1ML8A 5CM2M 3I4NI 4QTUA 4NBGA 1PFTA 4A3FI 2YU9I 2R92I 1TWFI 2JR6A 2KPIA 2R93I 3H3VJ 1YUAA 3ESWA 3GTLI 1NUIA 4A3LI 2NVYI 2P3YA 1TWHI 1LQLA 3VMGA 3FKII 3S1RI 4NBEA 1I6HI 4NOZA 1TFIA 5C4JI 3GTKI 1SFOI 2DE5A 2VUMI 3HOUI 4A3JI 3M4OI 1USPA 3GTOI 3GTGI 1Y1VS 2K5RA 1X3WA 1Y1VI 3S14I 3VMHA 2JNYA 4NBBA 3D6WA 3I07A 5C4XI 3U50C 3HOZI 2F4MA 4NBDA 4NBFA 4BXXI 5C44I 3VMIA 1I50I 4BY1I 3S1QI 1TWAI 2DE7A 1L1OC 4NBCA 4A93I 3HOWI 4A3DI 2NVQI 4BY7I 4Y52I 1USPB 3S17I 3HOYI 4A3CI 3S1NI 1WW9A 1TWGI 4A3KI 4A3EI 2B63I 1K83I 4X6AI 5IP9I 3S2HI 1X3ZA
chains in the Genus database with same CATH superfamily
4CL1A 2JIQA 3NH8A 3Q87A 3I55Z 3CCL1 3S1MI 2JIRA 1YIT1 5T67A 1Q822 1VQP1 2YADA 1QVFZ 2VPXA 1NJI1 3G6E1 5C3EI 3VB9A 4MH4A 3HOXI 2JS4A 1YHQZ 3CC2Z 2JA6I 1K8A2 1ZB8A 4RVGA 2JA5I 1VQ91 1YJN1 1VLAA 3I551 3CMEZ 3H0GI 3GKQA 1RQFA 5T6BA 2R6MA 2OOYB 1KD11 3CXCY 3G71Z 4XX2A 4NB9A 3F3PC 2VUGA 4DQYB 3CQZI 1YJWZ 2RHBA 2E2II 1YHQ1 1FDIA 3CC21 2RBLA 1K9M2 3KIHA 3I4NI 5FLXb 1NJI2 3MONA 2KPIA 4MD9A 2R93I 3CME1 3ESWA 5FLXf 1QVGZ 1KQSZ 1I6HI 3G711 1VQ4Z 1VQ71 3GTKI 2OTJZ 1YJW1 3IFUA 2QKDA 3KIFA 2H85A 4E31A 1YI2Z 1RNIA 2VUMI 2IZ4A 1VQ8Z 3D2LA 3GTOI 1RO2A 1KD12 2K5RA 1W2BY 1X3WA 2JNYA 3D6WA 3F3FC 3NH4A 2F4MA 4NBDA 1VQ41 1Q811 2OTJ1 3J7A4 1YI21 3S1QI 2DE7A 4DK1A 5D1OA 1VQ81 3MZLB 3CC4Z 2NVQI 4Y52I 1USPB 3S17I 3S1NI 5IT9f 4A3KI 4A3EI 1ZH1A 2WAQA 2PM9A 1N8R1 2B63I 2Q4ZA 2JIMA 5FLMI 3CC41 4RVFA 3PO3I 2JUBA 3K7AI 1VQNZ 2RT9A 1K8A1 3CC7Z 4BBRI 2BJOA 1M1K2 3EERA 2RPRA 1S72Z 5AN9F 2LFUA 3CPWY 3OW2Z 3M3YI 2JA8I 1JJ2Y 2E2HI 2E7ZA 1N8R2 3RZDI 3CCS1 3EEDA 2V45A 4NBHA 1VQN1 3GCFA 3GTMI 1K9M1 2QRCB 1YIJZ 1RLYA 5LL6f 1RO4A 3GTJI 3NH5A 4NBAA 3CXCZ 2V8JA 4QTUA 4NBGA 1PFTA 2V8IA 2IV2X 1QF8A 2V3VA 3GTLI 1NUIA 2QRDB 1LQLA 3VMGA 1YUKA 2KI7B 2VPYA 1YIJ1 2PMZA 4NOZA 3NFZA 2GTHA 1AA6A 2M48A 4A3JI 3M4OI 3CCVZ 3GTGI 3NDJA 1X0TA 4NFRA 1M902 1Y1VI 2O4HA 5C4XI 1QVFY 4BXXI 3VMIA 1QXFA 1L1OC 3CCMZ 2QREB 2O53A 2QA4Z 2OOXB 2QR1B 3HOYI 4A3CI 1WW9A 4E32A 1S7MA 1K83I 4X6AI 1X3ZA 4Y7NI 3P5JB 2IZ3A 4A3GI 2VPZA 3CCM1 2QA41 3PO3S 1M1K1 5D1OB 1N2FA 2AYDA 3CCQZ 5IT9b 2VF1A 4A3BI 2R7ZI 4RVHA 1R9TI 1NP6A 3PO2I 3I56Z 3S2DI 4QTTA 2EGTA 1YJ9Z 1ZB9A 1I3QI 2DE6A 1VQOZ 3J81b 1KRLA 3LUSA 3CPWZ 3GTMS 3S16I 3J81f 5IP7I 4A3II 3CCQ1 4MD8A 3NDIA 2WB1A 1Z01A 1VQKZ 1K731 1ML8A 4MXUA 1FDOA 1YJ91 2E9HA 4AYBA 1TWFI 1Y8CA 3H3VJ 4RVDA 1YUAA 1Q861 4A3LI 2NVYI 2P3YA 1TWHI 1KC82 1Z03A 3BG0B 3VTNA 2I3CA 1TFIA 5C4JI 1SFOI 1YITZ 2DE5A 1VQK1 3CC71 2JIOA 1VQPZ 1M901 3FQQA 3HOUI 1SIWA 4RV9A 3MZKB 3CD6Z 3J80b 1Y1VS 1VQLZ 2QEXZ 2Y0SA 1S721 3CMAZ 1Z02A 4NBBA 3QWUA 1K732 3J80f 3FQMA 3I07A 1YJNZ 2VPWA 3U50C 3HOZI 4NBFA 4EWCA 5C44I 2LIYA 4BY1I 2ZAEB 1Q862 4NBCA 3CCUZ 3HOWI 5T64A 3CD61 4BY7I 1VQL1 4MRIA 2QEX1 3CCRZ 3CMA1 3OW2Y 2NAPA 1WJ2A 5IP9I 4HGZA 4E2XA 2GTIA 1W2BZ 3S2HI 4NB8A 2GU2A 4TNUA 1Q7Y2 3RZOI 2HF1A 3CCU1 1VQ7Z 2NVXI 3CCR1 3S15I 3CCV1 3GTPI 1Y1WI 2W03A 2F4OA 3HOVI 3CCEZ 2J6AA 3BG1B 3I4MI 4NH1C 5A2Qb 2AKLA 3IF8A 1QYPA 1WCMI 4A3MI 3CCJZ 3G4SZ 1TWCI 2P28A 2JA7I 2PK7A 3TDHB 1VQ6Z 5A2Qf 2NVTI 4E33A 1Q16A 2E2JI 4BBSI 3GTQI 1VQMZ 4HGYA 1DL6A 3T4NB 5CM2M 1WZNA 3IR7A 3CCE1 1WIIA 3HKZA 2YU9I 2R92I 4A3FI 3IX0A 4E30A 1KC81 2JR6A 4MD7A 1QVGY 3CCJ1 1RO0A 3G4S1 1KQSY 3D9XA 2OTLZ 4RS4A 2K3RA 1VQ61 3FKII 3S1RI 4NBEA 1VQM1 2QLVB 1JJ2Z 1VQ5Z 4E2ZA 4E2YA 1USPA 2G2KA 2LEXA 3I561 3S14I 3VMHA 2JMOA 1VQO1 4S1TA 2JIPA 2OTL1 4DGLA 1Q821 1P9NA 2Q51A 4MONA 2HU9A 2V8KA 3JAMb 1JWHC 1I50I 1TWAI 3CCSZ 3CCLZ 2M6NA 3JAMf 1VQ51 1Q812 4A93I 4A3DI 4E2WA 4HH4A 5D1PA 2OZKA 3TE5B 2W04A 3G6EZ 2RIQA 1TWGI 1Q7Y1 1VQ9Z
chains in the Genus database with same CATH topology
4CL1A 3NH8A 3Q87A 3I55Z 3CCL1 3S1MI 1YIT1 5T67A 1Q822 1VQP1 2YADA 1QVFZ 1NJI1 3G6E1 5C3EI 3VB9A 4MH4A 3HOXI 2JS4A 1YHQZ 3CC2Z 2JA6I 1K8A2 1ZB8A 4RVGA 2JA5I 1VQ91 1YJN1 1VLAA 3I551 3CMEZ 3H0GI 3GKQA 1RQFA 5T6BA 2R6MA 2OOYB 1KD11 3CXCY 3G71Z 4XX2A 4NB9A 3F3PC 2VUGA 4DQYB 3CQZI 1YJWZ 2RHBA 2E2II 1YHQ1 3CC21 2RBLA 1K9M2 3KIHA 3I4NI 5FLXb 1NJI2 3MONA 2KPIA 4MD9A 2R93I 3CME1 3ESWA 5FLXf 1QVGZ 1KQSZ 1I6HI 3G711 1VQ4Z 1VQ71 3GTKI 2OTJZ 1YJW1 3IFUA 2QKDA 3KIFA 2H85A 4E31A 1YI2Z 1RNIA 2VUMI 2IZ4A 1VQ8Z 3GTOI 1RO2A 1KD12 2K5RA 1W2BY 1X3WA 2JNYA 3D6WA 3F3FC 3NH4A 2F4MA 4NBDA 1VQ41 1Q811 2OTJ1 3J7A4 1YI21 3S1QI 2DE7A 4DK1A 5D1OA 1VQ81 3MZLB 3CC4Z 2NVQI 4Y52I 1USPB 3S17I 3S1NI 5IT9f 4A3KI 4A3EI 1ZH1A 2WAQA 2PM9A 1N8R1 2B63I 2Q4ZA 5FLMI 3CC41 4RVFA 3PO3I 2JUBA 3K7AI 1VQNZ 2RT9A 1K8A1 3CC7Z 4BBRI 2BJOA 1M1K2 3EERA 2RPRA 1S72Z 5AN9F 2LFUA 3CPWY 3OW2Z 3M3YI 2JA8I 1JJ2Y 2E2HI 1N8R2 3RZDI 3CCS1 3EEDA 1VQN1 4NBHA 3GTMI 3GCFA 1K9M1 2QRCB 1YIJZ 1RLYA 5LL6f 1RO4A 3GTJI 3NH5A 4NBAA 2V8JA 3CXCZ 4QTUA 4NBGA 1PFTA 2V8IA 1QF8A 3GTLI 1NUIA 2QRDB 1LQLA 3VMGA 1YUKA 2KI7B 1YIJ1 2PMZA 4NOZA 3NFZA 2GTHA 2M48A 4A3JI 3M4OI 3CCVZ 3GTGI 3NDJA 1X0TA 4NFRA 1M902 1Y1VI 2O4HA 5C4XI 1QVFY 4BXXI 3VMIA 1L1OC 3CCMZ 2QREB 2O53A 2QA4Z 2OOXB 2QR1B 3HOYI 4A3CI 1WW9A 4E32A 1S7MA 1K83I 4X6AI 1X3ZA 4Y7NI 3P5JB 2IZ3A 4A3GI 3CCM1 2QA41 3PO3S 1M1K1 5D1OB 1N2FA 3CCQZ 5IT9b 2VF1A 4A3BI 2R7ZI 4RVHA 1R9TI 1NP6A 3PO2I 3I56Z 3S2DI 4QTTA 2EGTA 1YJ9Z 1ZB9A 1I3QI 2DE6A 1VQOZ 3J81b 1KRLA 3LUSA 3CPWZ 3GTMS 3S16I 3J81f 5IP7I 4A3II 3CCQ1 4MD8A 3NDIA 2WB1A 1Z01A 1VQKZ 1K731 1ML8A 4MXUA 1YJ91 2E9HA 4AYBA 1TWFI 3H3VJ 4RVDA 1YUAA 1Q861 4A3LI 2NVYI 2P3YA 1TWHI 1KC82 1Z03A 3BG0B 3VTNA 2I3CA 1TFIA 5C4JI 1SFOI 1YITZ 2DE5A 1VQK1 3CC71 1VQPZ 1M901 3FQQA 3HOUI 4RV9A 3MZKB 3CD6Z 3J80b 1Y1VS 1VQLZ 2QEXZ 2Y0SA 1S721 3CMAZ 1Z02A 4NBBA 3QWUA 1K732 3J80f 3FQMA 3I07A 1YJNZ 3U50C 3HOZI 4NBFA 4EWCA 5C44I 2LIYA 4BY1I 2ZAEB 1Q862 4NBCA 3CCUZ 3HOWI 5T64A 3CD61 4BY7I 1VQL1 4MRIA 2QEX1 3CCRZ 3CMA1 3OW2Y 5IP9I 4HGZA 4E2XA 2GTIA 1W2BZ 3S2HI 4NB8A 2GU2A 4TNUA 1Q7Y2 3RZOI 2HF1A 3CCU1 1VQ7Z 2NVXI 3CCR1 3S15I 3CCV1 3GTPI 1Y1WI 2W03A 2F4OA 3HOVI 3CCEZ 2J6AA 3BG1B 3I4MI 4NH1C 5A2Qb 2AKLA 3IF8A 1QYPA 1WCMI 4A3MI 3CCJZ 3G4SZ 1TWCI 2P28A 2JA7I 2PK7A 3TDHB 1VQ6Z 5A2Qf 2NVTI 4E33A 2E2JI 4BBSI 3GTQI 1VQMZ 4HGYA 1DL6A 3T4NB 5CM2M 3CCE1 1WIIA 3HKZA 2YU9I 2R92I 4A3FI 3IX0A 4E30A 1KC81 2JR6A 4MD7A 1QVGY 3CCJ1 1RO0A 3G4S1 1KQSY 3D9XA 2OTLZ 4RS4A 2K3RA 1VQ61 3FKII 3S1RI 4NBEA 1VQM1 2QLVB 1JJ2Z 1VQ5Z 4E2ZA 4E2YA 1USPA 2G2KA 3I561 3S14I 3VMHA 2JMOA 1VQO1 4S1TA 2OTL1 4DGLA 1Q821 1P9NA 2Q51A 4MONA 2HU9A 2V8KA 3JAMb 1JWHC 1I50I 1TWAI 3CCSZ 3CCLZ 1VQ51 2M6NA 3JAMf 1Q812 4A93I 4A3DI 4E2WA 4HH4A 5D1PA 2OZKA 3TE5B 2W04A 3G6EZ 2RIQA 1TWGI 1Q7Y1 1VQ9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB8 A;  4Y7N I;  3RZO I;  3Q87 A;  2HF1 A;  4A3G I;  3S1M I;  5FLM I;  3PO3 S;  3PO3 I;  1N2F A;  2NVX I;  3K7A I;  3S15 I;  4BBR I;  3GTP I;  1Y1W I;  2BJO A;  5C3E I;  4A3B I;  3VB9 A;  3EER A;  4MH4 A;  2R7Z I;  3HOX I;  2JS4 A;  1R9T I;  2F4O A;  2JA6 I;  3PO2 I;  3HOV I;  1ZB8 A;  3S2D I;  4QTT A;  2J6A A;  2JA5 I;  1ZB9 A;  3I4M I;  1I3Q I;  2DE6 A;  2AKL A;  3M3Y I;  1VLA A;  1QYP A;  1WCM I;  4A3M I;  3LUS A;  1TWC I;  2JA8 I;  2E2H I;  3H0G I;  3GKQ A;  2JA7 I;  3GTM S;  3S16 I;  2PK7 A;  3RZD I;  2NVT I;  5IP7 I;  4A3I I;  4NBH A;  3GTM I;  3GCF A;  1RLY A;  4NB9 A;  4XX2 A;  2E2J I;  1RO4 A;  4BBS I;  3CQZ I;  3GTQ I;  3GTJ I;  2E2I I;  4NBA A;  1DL6 A;  2RBL A;  1ML8 A;  5CM2 M;  3I4N I;  4QTU A;  4NBG A;  1PFT A;  4A3F I;  2YU9 I;  2R92 I;  1TWF I;  2JR6 A;  2KPI A;  2R93 I;  3H3V J;  1YUA A;  3ESW A;  3GTL I;  1NUI A;  4A3L I;  2NVY I;  2P3Y A;  1TWH I;  1LQL A;  3VMG A;  3FKI I;  3S1R I;  4NBE A;  1I6H I;  4NOZ A;  1TFI A;  5C4J I;  3GTK I;  1SFO I;  2DE5 A;  2VUM I;  3HOU I;  4A3J I;  3M4O I;  1USP A;  3GTO I;  3GTG I;  1Y1V S;  2K5R A;  1X3W A;  1Y1V I;  3S14 I;  3VMH A;  2JNY A;  4NBB A;  3D6W A;  3I07 A;  5C4X I;  3U50 C;  3HOZ I;  2F4M A;  4NBD A;  4NBF A;  4BXX I;  5C44 I;  3VMI A;  1I50 I;  4BY1 I;  3S1Q I;  1TWA I;  2DE7 A;  1L1O C;  4NBC A;  4A93 I;  3HOW I;  4A3D I;  2NVQ I;  4BY7 I;  4Y52 I;  1USP B;  3S17 I;  3HOY I;  4A3C I;  3S1N I;  1WW9 A;  1TWG I;  4A3K I;  4A3E I;  2B63 I;  1K83 I;  4X6A I;  5IP9 I;  3S2H I;  1X3Z A; 
#chains in the Genus database with same CATH topology
 4CL1 A;  2JIQ A;  3NH8 A;  3Q87 A;  3I55 Z;  3CCL 1;  3S1M I;  2JIR A;  1YIT 1;  5T67 A;  1Q82 2;  1VQP 1;  2YAD A;  1QVF Z;  2VPX A;  1NJI 1;  3G6E 1;  5C3E I;  3VB9 A;  4MH4 A;  3HOX I;  2JS4 A;  1YHQ Z;  3CC2 Z;  2JA6 I;  1K8A 2;  1ZB8 A;  4RVG A;  2JA5 I;  1VQ9 1;  1YJN 1;  1VLA A;  3I55 1;  3CME Z;  3H0G I;  3GKQ A;  1RQF A;  5T6B A;  2R6M A;  2OOY B;  1KD1 1;  3CXC Y;  3G71 Z;  4XX2 A;  4NB9 A;  3F3P C;  2VUG A;  4DQY B;  3CQZ I;  1YJW Z;  2RHB A;  2E2I I;  1YHQ 1;  1FDI A;  3CC2 1;  2RBL A;  1K9M 2;  3KIH A;  3I4N I;  5FLX b;  1NJI 2;  3MON A;  2KPI A;  4MD9 A;  2R93 I;  3CME 1;  3ESW A;  5FLX f;  1QVG Z;  1KQS Z;  1I6H I;  3G71 1;  1VQ4 Z;  1VQ7 1;  3GTK I;  2OTJ Z;  1YJW 1;  3IFU A;  2QKD A;  3KIF A;  2H85 A;  4E31 A;  1YI2 Z;  1RNI A;  2VUM I;  2IZ4 A;  1VQ8 Z;  3D2L A;  3GTO I;  1RO2 A;  1KD1 2;  2K5R A;  1W2B Y;  1X3W A;  2JNY A;  3D6W A;  3F3F C;  3NH4 A;  2F4M A;  4NBD A;  1VQ4 1;  1Q81 1;  2OTJ 1;  3J7A 4;  1YI2 1;  3S1Q I;  2DE7 A;  4DK1 A;  5D1O A;  1VQ8 1;  3MZL B;  3CC4 Z;  2NVQ I;  4Y52 I;  1USP B;  3S17 I;  3S1N I;  5IT9 f;  4A3K I;  4A3E I;  1ZH1 A;  2WAQ A;  2PM9 A;  1N8R 1;  2B63 I;  2Q4Z A;  2JIM A;  5FLM I;  3CC4 1;  4RVF A;  3PO3 I;  2JUB A;  3K7A I;  1VQN Z;  2RT9 A;  1K8A 1;  3CC7 Z;  4BBR I;  2BJO A;  1M1K 2;  3EER A;  2RPR A;  1S72 Z;  5AN9 F;  2LFU A;  3CPW Y;  3OW2 Z;  3M3Y I;  2JA8 I;  1JJ2 Y;  2E2H I;  2E7Z A;  1N8R 2;  3RZD I;  3CCS 1;  3EED A;  2V45 A;  4NBH A;  1VQN 1;  3GCF A;  3GTM I;  1K9M 1;  2QRC B;  1YIJ Z;  1RLY A;  5LL6 f;  1RO4 A;  3GTJ I;  3NH5 A;  4NBA A;  3CXC Z;  2V8J A;  4QTU A;  4NBG A;  1PFT A;  2V8I A;  2IV2 X;  1QF8 A;  2V3V A;  3GTL I;  1NUI A;  2QRD B;  1LQL A;  3VMG A;  1YUK A;  2KI7 B;  2VPY A;  1YIJ 1;  2PMZ A;  4NOZ A;  3NFZ A;  2GTH A;  1AA6 A;  2M48 A;  4A3J I;  3M4O I;  3CCV Z;  3GTG I;  3NDJ A;  1X0T A;  4NFR A;  1M90 2;  1Y1V I;  2O4H A;  5C4X I;  1QVF Y;  4BXX I;  3VMI A;  1QXF A;  1L1O C;  3CCM Z;  2QRE B;  2O53 A;  2QA4 Z;  2OOX B;  2QR1 B;  3HOY I;  4A3C I;  1WW9 A;  4E32 A;  1S7M A;  1K83 I;  4X6A I;  1X3Z A;  4Y7N I;  3P5J B;  2IZ3 A;  4A3G I;  2VPZ A;  3CCM 1;  2QA4 1;  3PO3 S;  1M1K 1;  5D1O B;  1N2F A;  2AYD A;  3CCQ Z;  5IT9 b;  2VF1 A;  4A3B I;  2R7Z I;  4RVH A;  1R9T I;  1NP6 A;  3PO2 I;  3I56 Z;  3S2D I;  4QTT A;  2EGT A;  1YJ9 Z;  1ZB9 A;  1I3Q I;  2DE6 A;  1VQO Z;  3J81 b;  1KRL A;  3LUS A;  3CPW Z;  3GTM S;  3S16 I;  3J81 f;  5IP7 I;  4A3I I;  3CCQ 1;  4MD8 A;  3NDI A;  2WB1 A;  1Z01 A;  1VQK Z;  1K73 1;  1ML8 A;  4MXU A;  1FDO A;  1YJ9 1;  2E9H A;  4AYB A;  1TWF I;  1Y8C A;  3H3V J;  4RVD A;  1YUA A;  1Q86 1;  4A3L I;  2NVY I;  2P3Y A;  1TWH I;  1KC8 2;  1Z03 A;  3BG0 B;  3VTN A;  2I3C A;  1TFI A;  5C4J I;  1SFO I;  1YIT Z;  2DE5 A;  1VQK 1;  3CC7 1;  2JIO A;  1VQP Z;  1M90 1;  3FQQ A;  3HOU I;  1SIW A;  4RV9 A;  3MZK B;  3CD6 Z;  3J80 b;  1Y1V S;  1VQL Z;  2QEX Z;  2Y0S A;  1S72 1;  3CMA Z;  1Z02 A;  4NBB A;  3QWU A;  1K73 2;  3J80 f;  3FQM A;  3I07 A;  1YJN Z;  2VPW A;  3U50 C;  3HOZ I;  4NBF A;  4EWC A;  5C44 I;  2LIY A;  4BY1 I;  2ZAE B;  1Q86 2;  4NBC A;  3CCU Z;  3HOW I;  5T64 A;  3CD6 1;  4BY7 I;  1VQL 1;  4MRI A;  2QEX 1;  3CCR Z;  3CMA 1;  3OW2 Y;  2NAP A;  1WJ2 A;  5IP9 I;  4HGZ A;  4E2X A;  2GTI A;  1W2B Z;  3S2H I;  4NB8 A;  2GU2 A;  4TNU A;  1Q7Y 2;  3RZO I;  2HF1 A;  3CCU 1;  1VQ7 Z;  2NVX I;  3CCR 1;  3S15 I;  3CCV 1;  3GTP I;  1Y1W I;  2W03 A;  2F4O A;  3HOV I;  3CCE Z;  2J6A A;  3BG1 B;  3I4M I;  4NH1 C;  5A2Q b;  2AKL A;  3IF8 A;  1QYP A;  1WCM I;  4A3M I;  3CCJ Z;  3G4S Z;  1TWC I;  2P28 A;  2JA7 I;  2PK7 A;  3TDH B;  1VQ6 Z;  5A2Q f;  2NVT I;  4E33 A;  1Q16 A;  2E2J I;  4BBS I;  3GTQ I;  1VQM Z;  4HGY A;  1DL6 A;  3T4N B;  5CM2 M;  1WZN A;  3IR7 A;  3CCE 1;  1WII A;  3HKZ A;  2YU9 I;  2R92 I;  4A3F I;  3IX0 A;  4E30 A;  1KC8 1;  2JR6 A;  4MD7 A;  1QVG Y;  3CCJ 1;  1RO0 A;  3G4S 1;  1KQS Y;  3D9X A;  2OTL Z;  4RS4 A;  2K3R A;  1VQ6 1;  3FKI I;  3S1R I;  4NBE A;  1VQM 1;  2QLV B;  1JJ2 Z;  1VQ5 Z;  4E2Z A;  4E2Y A;  1USP A;  2G2K A;  2LEX A;  3I56 1;  3S14 I;  3VMH A;  2JMO A;  1VQO 1;  4S1T A;  2JIP A;  2OTL 1;  4DGL A;  1Q82 1;  1P9N A;  2Q51 A;  4MON A;  2HU9 A;  2V8K A;  3JAM b;  1JWH C;  1I50 I;  1TWA I;  3CCS Z;  3CCL Z;  2M6N A;  3JAM f;  1VQ5 1;  1Q81 2;  4A93 I;  4A3D I;  4E2W A;  4HH4 A;  5D1P A;  2OZK A;  3TE5 B;  2W04 A;  3G6E Z;  2RIQ A;  1TWG I;  1Q7Y 1;  1VQ9 Z; 
#chains in the Genus database with same CATH homology
 4CL1 A;  3NH8 A;  3Q87 A;  3I55 Z;  3CCL 1;  3S1M I;  1YIT 1;  5T67 A;  1Q82 2;  1VQP 1;  2YAD A;  1QVF Z;  1NJI 1;  3G6E 1;  5C3E I;  3VB9 A;  4MH4 A;  3HOX I;  2JS4 A;  1YHQ Z;  3CC2 Z;  2JA6 I;  1K8A 2;  1ZB8 A;  4RVG A;  2JA5 I;  1VQ9 1;  1YJN 1;  1VLA A;  3I55 1;  3CME Z;  3H0G I;  3GKQ A;  1RQF A;  5T6B A;  2R6M A;  2OOY B;  1KD1 1;  3CXC Y;  3G71 Z;  4XX2 A;  4NB9 A;  3F3P C;  2VUG A;  4DQY B;  3CQZ I;  1YJW Z;  2RHB A;  2E2I I;  1YHQ 1;  3CC2 1;  2RBL A;  1K9M 2;  3KIH A;  3I4N I;  5FLX b;  1NJI 2;  3MON A;  2KPI A;  4MD9 A;  2R93 I;  3CME 1;  3ESW A;  5FLX f;  1QVG Z;  1KQS Z;  1I6H I;  3G71 1;  1VQ4 Z;  1VQ7 1;  3GTK I;  2OTJ Z;  1YJW 1;  3IFU A;  2QKD A;  3KIF A;  2H85 A;  4E31 A;  1YI2 Z;  1RNI A;  2VUM I;  2IZ4 A;  1VQ8 Z;  3GTO I;  1RO2 A;  1KD1 2;  2K5R A;  1W2B Y;  1X3W A;  2JNY A;  3D6W A;  3F3F C;  3NH4 A;  2F4M A;  4NBD A;  1VQ4 1;  1Q81 1;  2OTJ 1;  3J7A 4;  1YI2 1;  3S1Q I;  2DE7 A;  4DK1 A;  5D1O A;  1VQ8 1;  3MZL B;  3CC4 Z;  2NVQ I;  4Y52 I;  1USP B;  3S17 I;  3S1N I;  5IT9 f;  4A3K I;  4A3E I;  1ZH1 A;  2WAQ A;  2PM9 A;  1N8R 1;  2B63 I;  2Q4Z A;  5FLM I;  3CC4 1;  4RVF A;  3PO3 I;  2JUB A;  3K7A I;  1VQN Z;  2RT9 A;  1K8A 1;  3CC7 Z;  4BBR I;  2BJO A;  1M1K 2;  3EER A;  2RPR A;  1S72 Z;  5AN9 F;  2LFU A;  3CPW Y;  3OW2 Z;  3M3Y I;  2JA8 I;  1JJ2 Y;  2E2H I;  1N8R 2;  3RZD I;  3CCS 1;  3EED A;  1VQN 1;  4NBH A;  3GTM I;  3GCF A;  1K9M 1;  2QRC B;  1YIJ Z;  1RLY A;  5LL6 f;  1RO4 A;  3GTJ I;  3NH5 A;  4NBA A;  2V8J A;  3CXC Z;  4QTU A;  4NBG A;  1PFT A;  2V8I A;  1QF8 A;  3GTL I;  1NUI A;  2QRD B;  1LQL A;  3VMG A;  1YUK A;  2KI7 B;  1YIJ 1;  2PMZ A;  4NOZ A;  3NFZ A;  2GTH A;  2M48 A;  4A3J I;  3M4O I;  3CCV Z;  3GTG I;  3NDJ A;  1X0T A;  4NFR A;  1M90 2;  1Y1V I;  2O4H A;  5C4X I;  1QVF Y;  4BXX I;  3VMI A;  1L1O C;  3CCM Z;  2QRE B;  2O53 A;  2QA4 Z;  2OOX B;  2QR1 B;  3HOY I;  4A3C I;  1WW9 A;  4E32 A;  1S7M A;  1K83 I;  4X6A I;  1X3Z A;  4Y7N I;  3P5J B;  2IZ3 A;  4A3G I;  3CCM 1;  2QA4 1;  3PO3 S;  1M1K 1;  5D1O B;  1N2F A;  3CCQ Z;  5IT9 b;  2VF1 A;  4A3B I;  2R7Z I;  4RVH A;  1R9T I;  1NP6 A;  3PO2 I;  3I56 Z;  3S2D I;  4QTT A;  2EGT A;  1YJ9 Z;  1ZB9 A;  1I3Q I;  2DE6 A;  1VQO Z;  3J81 b;  1KRL A;  3LUS A;  3CPW Z;  3GTM S;  3S16 I;  3J81 f;  5IP7 I;  4A3I I;  3CCQ 1;  4MD8 A;  3NDI A;  2WB1 A;  1Z01 A;  1VQK Z;  1K73 1;  1ML8 A;  4MXU A;  1YJ9 1;  2E9H A;  4AYB A;  1TWF I;  3H3V J;  4RVD A;  1YUA A;  1Q86 1;  4A3L I;  2NVY I;  2P3Y A;  1TWH I;  1KC8 2;  1Z03 A;  3BG0 B;  3VTN A;  2I3C A;  1TFI A;  5C4J I;  1SFO I;  1YIT Z;  2DE5 A;  1VQK 1;  3CC7 1;  1VQP Z;  1M90 1;  3FQQ A;  3HOU I;  4RV9 A;  3MZK B;  3CD6 Z;  3J80 b;  1Y1V S;  1VQL Z;  2QEX Z;  2Y0S A;  1S72 1;  3CMA Z;  1Z02 A;  4NBB A;  3QWU A;  1K73 2;  3J80 f;  3FQM A;  3I07 A;  1YJN Z;  3U50 C;  3HOZ I;  4NBF A;  4EWC A;  5C44 I;  2LIY A;  4BY1 I;  2ZAE B;  1Q86 2;  4NBC A;  3CCU Z;  3HOW I;  5T64 A;  3CD6 1;  4BY7 I;  1VQL 1;  4MRI A;  2QEX 1;  3CCR Z;  3CMA 1;  3OW2 Y;  5IP9 I;  4HGZ A;  4E2X A;  2GTI A;  1W2B Z;  3S2H I;  4NB8 A;  2GU2 A;  4TNU A;  1Q7Y 2;  3RZO I;  2HF1 A;  3CCU 1;  1VQ7 Z;  2NVX I;  3CCR 1;  3S15 I;  3CCV 1;  3GTP I;  1Y1W I;  2W03 A;  2F4O A;  3HOV I;  3CCE Z;  2J6A A;  3BG1 B;  3I4M I;  4NH1 C;  5A2Q b;  2AKL A;  3IF8 A;  1QYP A;  1WCM I;  4A3M I;  3CCJ Z;  3G4S Z;  1TWC I;  2P28 A;  2JA7 I;  2PK7 A;  3TDH B;  1VQ6 Z;  5A2Q f;  2NVT I;  4E33 A;  2E2J I;  4BBS I;  3GTQ I;  1VQM Z;  4HGY A;  1DL6 A;  3T4N B;  5CM2 M;  3CCE 1;  1WII A;  3HKZ A;  2YU9 I;  2R92 I;  4A3F I;  3IX0 A;  4E30 A;  1KC8 1;  2JR6 A;  4MD7 A;  1QVG Y;  3CCJ 1;  1RO0 A;  3G4S 1;  1KQS Y;  3D9X A;  2OTL Z;  4RS4 A;  2K3R A;  1VQ6 1;  3FKI I;  3S1R I;  4NBE A;  1VQM 1;  2QLV B;  1JJ2 Z;  1VQ5 Z;  4E2Z A;  4E2Y A;  1USP A;  2G2K A;  3I56 1;  3S14 I;  3VMH A;  2JMO A;  1VQO 1;  4S1T A;  2OTL 1;  4DGL A;  1Q82 1;  1P9N A;  2Q51 A;  4MON A;  2HU9 A;  2V8K A;  3JAM b;  1JWH C;  1I50 I;  1TWA I;  3CCS Z;  3CCL Z;  1VQ5 1;  2M6N A;  3JAM f;  1Q81 2;  4A93 I;  4A3D I;  4E2W A;  4HH4 A;  5D1P A;  2OZK A;  3TE5 B;  2W04 A;  3G6E Z;  2RIQ A;  1TWG I;  1Q7Y 1;  1VQ9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...