1KD12

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kd1200
3CC71 3CD6Z 1M901 1VQ6Z 1QVFZ 1N8R2 1YJWZ 2QA41 3CCLZ 3CC4Z 3CCJZ 3CCQ1 3G711 1K8A2 1VQ8Z 1YI21 1KC81 2QEXZ 3CCR1 1KD11 1K9M1 3CCV1 3CXCY 3G6EZ 1S72Z 1VQ7Z 1YIJ1 1VQ51 1Q7Y2 1YJ91 1Q812 3CPWZ 2OTL1 1VQNZ 1VQMZ 1VQ61 3CMEZ 1YHQ1 1NJI1 1KQSZ 1YITZ 1YJNZ 3CCL1 1VQP1 3CCJ1 2OTJZ 3CCM1 3I551 3CMAZ 3G4S1 1W2BY 1QVGZ 1VQ41 1VQKZ 1M1K2 1VQL1 1VQOZ 3CCUZ 3CCE1 3CC2Z 1VQ9Z 3CPWY 1Q861 3CCSZ 1JJ2Z 1QVFY 3CC7Z 1KQSY 3I56Z 2QA4Z 3CD61 3OW2Z 1N8R1 1YJW1 3CCQZ 3G71Z 3CC41 1YI2Z 3CCRZ 1K8A1 1Q822 1KC82 1KD12 1VQ81 3CCVZ 1K9M2 2QEX1 1JJ2Y 1K732 3CC21 1YIJZ 3G6E1 1S721 1VQ71 1VQ5Z 3CCS1 3OW2Y 3CXCZ 1YJ9Z 1Q7Y1 3I561 1Q811 2OTLZ 1YHQZ 1VQN1 1M902 1VQM1 3CME1 1NJI2 1QVGY 1VQPZ 1YIT1 3CCMZ 3I55Z 1YJN1 3G4SZ 1VQ4Z 1Q821 2OTJ1 3CMA1 1VQLZ 1M1K1 1VQK1 3CCEZ 1K731 1VQO1 1W2BZ 3CCU1 1VQ91 1Q862
chains in the Genus database with same CATH superfamily
2JNYA 1I3QI 3IR7A 3KIFA 3QWUA 3CD6Z 1N8R2 2VUGA 5T67A 3I4NI 2W03A 1K8A2 4MXUA 4A3BI 3CCR1 3H3VJ 5IP9I 2PK7A 1AA6A 1X3ZA 2JUBA 5C4JI 1LQLA 1VQ51 4Y52I 4A3KI 4RVHA 4BY1I 4MONA 4A93I 2H85A 2OTL1 1VQ61 1YHQ1 3BG0B 5C4XI 4RV9A 4E30A 1TFIA 1YJNZ 5D1OA 3CCL1 1VQP1 4NBDA 3CCM1 3G4S1 1M1K2 5D1PA 4E2ZA 1VLAA 4HH4A 3CC2Z 5IP7I 3CCE1 4A3FI 2Q4ZA 3FQQA 1VQ9Z 3MZLB 1Q861 4BBSI 2IZ4A 3KIHA 3M3YI 4MRIA 2GTIA 3TDHB 1Z02A 3OW2Z 2F4MA 4X6AI 2WB1A 2JA8I 3CQZI 2DE7A 1PFTA 2F4OA 2E2JI 5D1OB 3CCRZ 1VQ81 4NB9A 2J6AA 2QEX1 3TE5B 1JJ2Y 5A2Qf 4A3JI 2JIRA 1K732 3Q87A 2HF1A 2Q51A 1VQ5Z 1TWGI 3CXCZ 1I6HI 2G2KA 3FKII 2OTLZ 3GTPI 1YHQZ 4NBAA 3PO2I 3M4OI 3CME1 3GTOI 1RLYA 1VQPZ 3S16I 3CCMZ 3G4SZ 2OTJ1 5IT9f 3CCEZ 1VQO1 4MD8A 3S1MI 1Y1VS 1Q862 1TWFI 3CC71 1M901 2Y0SA 2RHBA 4NBBA 1QVFZ 3EEDA 2V8IA 5FLMI 4Y7NI 3CCQ1 2AYDA 1VQ8Z 2QEXZ 3HOZI 2E2HI 1FDOA 3CXCY 3HOUI 3IFUA 3MZKB 2YADA 4E31A 4S1TA 3S14I 3HOYI 1YJ91 3S2DI 4A3DI 4A3MI 1Y8CA 3D6WA 4NBHA 2HU9A 3CMEZ 2V3VA 4DK1A 1RO2A 2JS4A 5AN9F 4BY7I 3CCJ1 2OTJZ 1VQ41 3I551 2V8KA 1QVGZ 1VQOZ 3HOXI 2VPZA 3BG1B 3VMGA 3CPWY 3S1NI 1JJ2Z 1QVFY 3CC7Z 3VMIA 1KQSY 3I56Z 2JA5I 2DE6A 2KPIA 2E2II 2JA7I 3GTMS 3T4NB 3PO3S 4NBGA 2P3YA 2QR1B 4XX2A 1YJW1 1Q16A 4MD9A 2OOXB 4E2WA 3CCQZ 2DE5A 3CC41 1S7MA 2AKLA 2M6NA 4NBCA 1TWHI 2LIYA 2VPXA 2GU2A 5C3EI 1S721 4NBFA 3CCS1 1YJ9Z 3J80b 1Q7Y1 4NFRA 2ZAEB 1Q811 2NVXI 3LUSA 2R93I 2R7ZI 3FQMA 1QVGY 2O53A 3GTQI 4E2YA 1ZH1A 3HOVI 1VQ4Z 3I55Z 1Q821 1WCMI 2QKDA 3CMA1 2B63I 1W2BZ 2RPRA 3CCU1 3VMHA 2R6MA 3K7AI 4CL1A 1TWAI 5CM2M 3I4MI 2VUMI 2NVQI 2JA6I 1VQ6Z 2JR6A 1YJWZ 1WZNA 2QA41 4A3II 4HGYA 3NH4A 4QTUA 3CCLZ 3CC4Z 2QREB 1KD11 1YUKA 3GKQA 2VF1A 1S72Z 3ESWA 3NH5A 1Z01A 1Q7Y2 2E7ZA 1Q812 4EWCA 3CPWZ 2IZ3A 1QYPA 2PMZA 1KQSZ 1QF8A 3IX0A 3NDIA 3S1RI 4A3EI 2K5RA 2PM9A 4BBRI 1SFOI 3CMAZ 1W2BY 2OOYB 2JMOA 3MONA 5FLXb 3NFZA 1X0TA 3CCUZ 3F3PC 3GTGI 4A3GI 3NDJA 2BJOA 2QA4Z 1YUAA 1Y1WI 1Y1VI 1P9NA 1SIWA 1WJ2A 2IV2X 2LFUA 1KD12 1X3WA 1TWCI 4BXXI 3D2LA 2E9HA 2I3CA 3CC21 3F3FC 3G6E1 4NBEA 3U50C 2O4HA 1VQ71 1NP6A 3NH8A 3J81b 4RVGA 2QRCB 2NAPA 2JIPA 2RT9A 2WAQA 4NOZA 3J80f 1VQN1 1M902 1VQM1 4E32A 3D9XA 4MD7A 3P5JB 3JAMb 1YIT1 4A3CI 1WIIA 2V45A 2GTHA 3S2HI 1VQK1 3I07A 1K731 2OZKA 4MH4A 1USPA 3S17I 1N2FA 4NH1C 4AYBA 4HGZA 2JIOA 3HOWI 3CCJZ 3VB9A 3G711 2K3RA 3GTMI 1YI21 1KC81 3PO3I 1ZB9A 4DGLA 1K9M1 2VPWA 2NVYI 3CCV1 3G6EZ 3S1QI 3GCFA 1VQ7Z 2KI7B 2QLVB 3HKZA 1YIJ1 1USPB 1RQFA 1FDIA 3EERA 1VQNZ 5LL6f 1VQMZ 4A3LI 2M48A 1KRLA 4QTTA 1NJI1 1YITZ 2V8JA 1ML8A 2P28A 1L1OC 3IF8A 2R92I 1VQKZ 4TNUA 1VQL1 1I50I 3J7A4 3VTNA 4E2XA 3GTJI 5FLXf 4E33A 3CCSZ 2VPYA 4RVFA 1RO4A 2NVTI 2JIQA 3CD61 1N8R1 2RBLA 2RIQA 4RVDA 2LEXA 3G71Z 5A2Qb 3RZDI 1YI2Z 1ZB8A 1K8A1 1Q822 1KC82 3CCVZ 1K9M2 5T6BA 1YIJZ 4RS4A 3GTLI 1JWHC 3OW2Y 1RNIA 1NUIA 2EGTA 4NB8A 3I561 1K83I 3H0GI 3RZOI 2W04A 3J81f 5C44I 1NJI2 3S15I 1WW9A 3GTKI 5IT9b 2JIMA 1YJN1 2YU9I 1RO0A 4DQYB 1QXFA 1VQLZ 3JAMf 1M1K1 2QRDB 1DL6A 1VQ91 1Z03A 1R9TI 5T64A
chains in the Genus database with same CATH topology
2JNYA 1I3QI 3KIFA 3QWUA 3CD6Z 1N8R2 2VUGA 5T67A 3I4NI 2W03A 1K8A2 4MXUA 4A3BI 3CCR1 3H3VJ 5IP9I 2PK7A 1X3ZA 2JUBA 5C4JI 1LQLA 1VQ51 4Y52I 4A3KI 4RVHA 4BY1I 4MONA 4A93I 2H85A 2OTL1 1VQ61 1YHQ1 3BG0B 5C4XI 4RV9A 4E30A 1TFIA 1YJNZ 5D1OA 3CCL1 1VQP1 4NBDA 3CCM1 3G4S1 1M1K2 5D1PA 4E2ZA 1VLAA 4HH4A 3CC2Z 5IP7I 3CCE1 4A3FI 2Q4ZA 3FQQA 1VQ9Z 3MZLB 1Q861 4BBSI 2IZ4A 3KIHA 3M3YI 4MRIA 2GTIA 3TDHB 1Z02A 3OW2Z 2F4MA 4X6AI 2WB1A 2JA8I 3CQZI 2DE7A 1PFTA 2F4OA 2E2JI 5D1OB 3CCRZ 1VQ81 4NB9A 2J6AA 2QEX1 3TE5B 1JJ2Y 5A2Qf 4A3JI 1K732 3Q87A 2HF1A 2Q51A 1VQ5Z 1TWGI 3CXCZ 1I6HI 2G2KA 3FKII 2OTLZ 3GTPI 1YHQZ 4NBAA 3PO2I 3M4OI 3CME1 3GTOI 1RLYA 1VQPZ 3S16I 3CCMZ 3G4SZ 2OTJ1 5IT9f 3CCEZ 1VQO1 4MD8A 3S1MI 1Y1VS 1Q862 1TWFI 3CC71 1M901 2Y0SA 2RHBA 4NBBA 1QVFZ 3EEDA 2V8IA 5FLMI 4Y7NI 3CCQ1 1VQ8Z 2QEXZ 3HOZI 2E2HI 3CXCY 3HOUI 3IFUA 3MZKB 2YADA 4E31A 4S1TA 3S14I 3HOYI 1YJ91 3S2DI 4A3DI 4A3MI 3D6WA 4NBHA 2HU9A 3CMEZ 4DK1A 1RO2A 2JS4A 5AN9F 4BY7I 3CCJ1 2OTJZ 1VQ41 3I551 2V8KA 1QVGZ 1VQOZ 3HOXI 3BG1B 3VMGA 3CPWY 3S1NI 1JJ2Z 1QVFY 3CC7Z 3VMIA 1KQSY 3I56Z 2JA5I 2DE6A 2KPIA 2E2II 2JA7I 3GTMS 3T4NB 3PO3S 4NBGA 2P3YA 2QR1B 4XX2A 1YJW1 4MD9A 2OOXB 4E2WA 3CCQZ 2DE5A 3CC41 1S7MA 2AKLA 2M6NA 4NBCA 1TWHI 2LIYA 2GU2A 5C3EI 1S721 4NBFA 3CCS1 1YJ9Z 3J80b 1Q7Y1 4NFRA 2ZAEB 1Q811 2NVXI 3LUSA 2R93I 2R7ZI 3FQMA 1QVGY 2O53A 3GTQI 4E2YA 1ZH1A 3HOVI 1VQ4Z 3I55Z 1Q821 1WCMI 2QKDA 3CMA1 2B63I 1W2BZ 2RPRA 3CCU1 3VMHA 2R6MA 3K7AI 4CL1A 1TWAI 5CM2M 3I4MI 2VUMI 2NVQI 2JA6I 1VQ6Z 2JR6A 1YJWZ 2QA41 4A3II 4HGYA 3NH4A 4QTUA 3CCLZ 3CC4Z 2QREB 1KD11 1YUKA 3GKQA 2VF1A 1S72Z 3ESWA 3NH5A 1Z01A 1Q7Y2 1Q812 4EWCA 3CPWZ 2IZ3A 1QYPA 2PMZA 1KQSZ 1QF8A 3IX0A 3NDIA 3S1RI 4A3EI 2K5RA 2PM9A 4BBRI 1SFOI 3CMAZ 1W2BY 2OOYB 2JMOA 3MONA 5FLXb 3NFZA 1X0TA 3CCUZ 3F3PC 3GTGI 4A3GI 3NDJA 2BJOA 2QA4Z 1YUAA 1Y1WI 1Y1VI 1P9NA 2LFUA 1KD12 1X3WA 1TWCI 4BXXI 2E9HA 2I3CA 3CC21 3F3FC 3G6E1 4NBEA 3U50C 2O4HA 1VQ71 1NP6A 3NH8A 3J81b 4RVGA 2QRCB 2RT9A 2WAQA 4NOZA 3J80f 1VQN1 1M902 1VQM1 4E32A 3D9XA 4MD7A 3P5JB 3JAMb 1YIT1 4A3CI 1WIIA 2GTHA 3S2HI 1VQK1 3I07A 1K731 2OZKA 4MH4A 1USPA 3S17I 1N2FA 4NH1C 4AYBA 4HGZA 3HOWI 3CCJZ 3VB9A 3G711 2K3RA 3GTMI 1YI21 1KC81 3PO3I 1ZB9A 4DGLA 1K9M1 2NVYI 3CCV1 3G6EZ 3S1QI 3GCFA 1VQ7Z 2KI7B 2QLVB 3HKZA 1YIJ1 1USPB 1RQFA 3EERA 1VQNZ 5LL6f 1VQMZ 4A3LI 2M48A 1KRLA 4QTTA 1NJI1 1YITZ 2V8JA 1ML8A 2P28A 1L1OC 3IF8A 2R92I 1VQKZ 4TNUA 1VQL1 1I50I 3J7A4 3VTNA 4E2XA 3GTJI 5FLXf 4E33A 3CCSZ 4RVFA 1RO4A 2NVTI 3CD61 1N8R1 2RBLA 2RIQA 4RVDA 3G71Z 5A2Qb 3RZDI 1YI2Z 1ZB8A 1K8A1 1Q822 1KC82 3CCVZ 1K9M2 5T6BA 1YIJZ 4RS4A 3GTLI 1JWHC 3OW2Y 1RNIA 1NUIA 2EGTA 4NB8A 3I561 1K83I 3H0GI 3RZOI 2W04A 3J81f 5C44I 1NJI2 3S15I 1WW9A 3GTKI 5IT9b 1YJN1 2YU9I 1RO0A 4DQYB 1VQLZ 3JAMf 1M1K1 2QRDB 1DL6A 1VQ91 1Z03A 1R9TI 5T64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 1;  3CD6 Z;  1M90 1;  1VQ6 Z;  1QVF Z;  1N8R 2;  1YJW Z;  2QA4 1;  3CCL Z;  3CC4 Z;  3CCJ Z;  3CCQ 1;  3G71 1;  1K8A 2;  1VQ8 Z;  1YI2 1;  1KC8 1;  2QEX Z;  3CCR 1;  1KD1 1;  1K9M 1;  3CCV 1;  3CXC Y;  3G6E Z;  1S72 Z;  1VQ7 Z;  1YIJ 1;  1VQ5 1;  1Q7Y 2;  1YJ9 1;  1Q81 2;  3CPW Z;  2OTL 1;  1VQN Z;  1VQM Z;  1VQ6 1;  3CME Z;  1YHQ 1;  1NJI 1;  1KQS Z;  1YIT Z;  1YJN Z;  3CCL 1;  1VQP 1;  3CCJ 1;  2OTJ Z;  3CCM 1;  3I55 1;  3CMA Z;  3G4S 1;  1W2B Y;  1QVG Z;  1VQ4 1;  1VQK Z;  1M1K 2;  1VQL 1;  1VQO Z;  3CCU Z;  3CCE 1;  3CC2 Z;  1VQ9 Z;  3CPW Y;  1Q86 1;  3CCS Z;  1JJ2 Z;  1QVF Y;  3CC7 Z;  1KQS Y;  3I56 Z;  2QA4 Z;  3CD6 1;  3OW2 Z;  1N8R 1;  1YJW 1;  3CCQ Z;  3G71 Z;  3CC4 1;  1YI2 Z;  3CCR Z;  1K8A 1;  1Q82 2;  1KC8 2;  1KD1 2;  1VQ8 1;  3CCV Z;  1K9M 2;  2QEX 1;  1JJ2 Y;  1K73 2;  3CC2 1;  1YIJ Z;  3G6E 1;  1S72 1;  1VQ7 1;  1VQ5 Z;  3CCS 1;  3OW2 Y;  3CXC Z;  1YJ9 Z;  1Q7Y 1;  3I56 1;  1Q81 1;  2OTL Z;  1YHQ Z;  1VQN 1;  1M90 2;  1VQM 1;  3CME 1;  1NJI 2;  1QVG Y;  1VQP Z;  1YIT 1;  3CCM Z;  3I55 Z;  1YJN 1;  3G4S Z;  1VQ4 Z;  1Q82 1;  2OTJ 1;  3CMA 1;  1VQL Z;  1M1K 1;  1VQK 1;  3CCE Z;  1K73 1;  1VQO 1;  1W2B Z;  3CCU 1;  1VQ9 1;  1Q86 2; 
#chains in the Genus database with same CATH topology
 2JNY A;  1I3Q I;  3IR7 A;  3KIF A;  3QWU A;  3CD6 Z;  1N8R 2;  2VUG A;  5T67 A;  3I4N I;  2W03 A;  1K8A 2;  4MXU A;  4A3B I;  3CCR 1;  3H3V J;  5IP9 I;  2PK7 A;  1AA6 A;  1X3Z A;  2JUB A;  5C4J I;  1LQL A;  1VQ5 1;  4Y52 I;  4A3K I;  4RVH A;  4BY1 I;  4MON A;  4A93 I;  2H85 A;  2OTL 1;  1VQ6 1;  1YHQ 1;  3BG0 B;  5C4X I;  4RV9 A;  4E30 A;  1TFI A;  1YJN Z;  5D1O A;  3CCL 1;  1VQP 1;  4NBD A;  3CCM 1;  3G4S 1;  1M1K 2;  5D1P A;  4E2Z A;  1VLA A;  4HH4 A;  3CC2 Z;  5IP7 I;  3CCE 1;  4A3F I;  2Q4Z A;  3FQQ A;  1VQ9 Z;  3MZL B;  1Q86 1;  4BBS I;  2IZ4 A;  3KIH A;  3M3Y I;  4MRI A;  2GTI A;  3TDH B;  1Z02 A;  3OW2 Z;  2F4M A;  4X6A I;  2WB1 A;  2JA8 I;  3CQZ I;  2DE7 A;  1PFT A;  2F4O A;  2E2J I;  5D1O B;  3CCR Z;  1VQ8 1;  4NB9 A;  2J6A A;  2QEX 1;  3TE5 B;  1JJ2 Y;  5A2Q f;  4A3J I;  2JIR A;  1K73 2;  3Q87 A;  2HF1 A;  2Q51 A;  1VQ5 Z;  1TWG I;  3CXC Z;  1I6H I;  2G2K A;  3FKI I;  2OTL Z;  3GTP I;  1YHQ Z;  4NBA A;  3PO2 I;  3M4O I;  3CME 1;  3GTO I;  1RLY A;  1VQP Z;  3S16 I;  3CCM Z;  3G4S Z;  2OTJ 1;  5IT9 f;  3CCE Z;  1VQO 1;  4MD8 A;  3S1M I;  1Y1V S;  1Q86 2;  1TWF I;  3CC7 1;  1M90 1;  2Y0S A;  2RHB A;  4NBB A;  1QVF Z;  3EED A;  2V8I A;  5FLM I;  4Y7N I;  3CCQ 1;  2AYD A;  1VQ8 Z;  2QEX Z;  3HOZ I;  2E2H I;  1FDO A;  3CXC Y;  3HOU I;  3IFU A;  3MZK B;  2YAD A;  4E31 A;  4S1T A;  3S14 I;  3HOY I;  1YJ9 1;  3S2D I;  4A3D I;  4A3M I;  1Y8C A;  3D6W A;  4NBH A;  2HU9 A;  3CME Z;  2V3V A;  4DK1 A;  1RO2 A;  2JS4 A;  5AN9 F;  4BY7 I;  3CCJ 1;  2OTJ Z;  1VQ4 1;  3I55 1;  2V8K A;  1QVG Z;  1VQO Z;  3HOX I;  2VPZ A;  3BG1 B;  3VMG A;  3CPW Y;  3S1N I;  1JJ2 Z;  1QVF Y;  3CC7 Z;  3VMI A;  1KQS Y;  3I56 Z;  2JA5 I;  2DE6 A;  2KPI A;  2E2I I;  2JA7 I;  3GTM S;  3T4N B;  3PO3 S;  4NBG A;  2P3Y A;  2QR1 B;  4XX2 A;  1YJW 1;  1Q16 A;  4MD9 A;  2OOX B;  4E2W A;  3CCQ Z;  2DE5 A;  3CC4 1;  1S7M A;  2AKL A;  2M6N A;  4NBC A;  1TWH I;  2LIY A;  2VPX A;  2GU2 A;  5C3E I;  1S72 1;  4NBF A;  3CCS 1;  1YJ9 Z;  3J80 b;  1Q7Y 1;  4NFR A;  2ZAE B;  1Q81 1;  2NVX I;  3LUS A;  2R93 I;  2R7Z I;  3FQM A;  1QVG Y;  2O53 A;  3GTQ I;  4E2Y A;  1ZH1 A;  3HOV I;  1VQ4 Z;  3I55 Z;  1Q82 1;  1WCM I;  2QKD A;  3CMA 1;  2B63 I;  1W2B Z;  2RPR A;  3CCU 1;  3VMH A;  2R6M A;  3K7A I;  4CL1 A;  1TWA I;  5CM2 M;  3I4M I;  2VUM I;  2NVQ I;  2JA6 I;  1VQ6 Z;  2JR6 A;  1YJW Z;  1WZN A;  2QA4 1;  4A3I I;  4HGY A;  3NH4 A;  4QTU A;  3CCL Z;  3CC4 Z;  2QRE B;  1KD1 1;  1YUK A;  3GKQ A;  2VF1 A;  1S72 Z;  3ESW A;  3NH5 A;  1Z01 A;  1Q7Y 2;  2E7Z A;  1Q81 2;  4EWC A;  3CPW Z;  2IZ3 A;  1QYP A;  2PMZ A;  1KQS Z;  1QF8 A;  3IX0 A;  3NDI A;  3S1R I;  4A3E I;  2K5R A;  2PM9 A;  4BBR I;  1SFO I;  3CMA Z;  1W2B Y;  2OOY B;  2JMO A;  3MON A;  5FLX b;  3NFZ A;  1X0T A;  3CCU Z;  3F3P C;  3GTG I;  4A3G I;  3NDJ A;  2BJO A;  2QA4 Z;  1YUA A;  1Y1W I;  1Y1V I;  1P9N A;  1SIW A;  1WJ2 A;  2IV2 X;  2LFU A;  1KD1 2;  1X3W A;  1TWC I;  4BXX I;  3D2L A;  2E9H A;  2I3C A;  3CC2 1;  3F3F C;  3G6E 1;  4NBE A;  3U50 C;  2O4H A;  1VQ7 1;  1NP6 A;  3NH8 A;  3J81 b;  4RVG A;  2QRC B;  2NAP A;  2JIP A;  2RT9 A;  2WAQ A;  4NOZ A;  3J80 f;  1VQN 1;  1M90 2;  1VQM 1;  4E32 A;  3D9X A;  4MD7 A;  3P5J B;  3JAM b;  1YIT 1;  4A3C I;  1WII A;  2V45 A;  2GTH A;  3S2H I;  1VQK 1;  3I07 A;  1K73 1;  2OZK A;  4MH4 A;  1USP A;  3S17 I;  1N2F A;  4NH1 C;  4AYB A;  4HGZ A;  2JIO A;  3HOW I;  3CCJ Z;  3VB9 A;  3G71 1;  2K3R A;  3GTM I;  1YI2 1;  1KC8 1;  3PO3 I;  1ZB9 A;  4DGL A;  1K9M 1;  2VPW A;  2NVY I;  3CCV 1;  3G6E Z;  3S1Q I;  3GCF A;  1VQ7 Z;  2KI7 B;  2QLV B;  3HKZ A;  1YIJ 1;  1USP B;  1RQF A;  1FDI A;  3EER A;  1VQN Z;  5LL6 f;  1VQM Z;  4A3L I;  2M48 A;  1KRL A;  4QTT A;  1NJI 1;  1YIT Z;  2V8J A;  1ML8 A;  2P28 A;  1L1O C;  3IF8 A;  2R92 I;  1VQK Z;  4TNU A;  1VQL 1;  1I50 I;  3J7A 4;  3VTN A;  4E2X A;  3GTJ I;  5FLX f;  4E33 A;  3CCS Z;  2VPY A;  4RVF A;  1RO4 A;  2NVT I;  2JIQ A;  3CD6 1;  1N8R 1;  2RBL A;  2RIQ A;  4RVD A;  2LEX A;  3G71 Z;  5A2Q b;  3RZD I;  1YI2 Z;  1ZB8 A;  1K8A 1;  1Q82 2;  1KC8 2;  3CCV Z;  1K9M 2;  5T6B A;  1YIJ Z;  4RS4 A;  3GTL I;  1JWH C;  3OW2 Y;  1RNI A;  1NUI A;  2EGT A;  4NB8 A;  3I56 1;  1K83 I;  3H0G I;  3RZO I;  2W04 A;  3J81 f;  5C44 I;  1NJI 2;  3S15 I;  1WW9 A;  3GTK I;  5IT9 b;  2JIM A;  1YJN 1;  2YU9 I;  1RO0 A;  4DQY B;  1QXF A;  1VQL Z;  3JAM f;  1M1K 1;  2QRD B;  1DL6 A;  1VQ9 1;  1Z03 A;  1R9T I;  5T64 A; 
#chains in the Genus database with same CATH homology
 2JNY A;  1I3Q I;  3KIF A;  3QWU A;  3CD6 Z;  1N8R 2;  2VUG A;  5T67 A;  3I4N I;  2W03 A;  1K8A 2;  4MXU A;  4A3B I;  3CCR 1;  3H3V J;  5IP9 I;  2PK7 A;  1X3Z A;  2JUB A;  5C4J I;  1LQL A;  1VQ5 1;  4Y52 I;  4A3K I;  4RVH A;  4BY1 I;  4MON A;  4A93 I;  2H85 A;  2OTL 1;  1VQ6 1;  1YHQ 1;  3BG0 B;  5C4X I;  4RV9 A;  4E30 A;  1TFI A;  1YJN Z;  5D1O A;  3CCL 1;  1VQP 1;  4NBD A;  3CCM 1;  3G4S 1;  1M1K 2;  5D1P A;  4E2Z A;  1VLA A;  4HH4 A;  3CC2 Z;  5IP7 I;  3CCE 1;  4A3F I;  2Q4Z A;  3FQQ A;  1VQ9 Z;  3MZL B;  1Q86 1;  4BBS I;  2IZ4 A;  3KIH A;  3M3Y I;  4MRI A;  2GTI A;  3TDH B;  1Z02 A;  3OW2 Z;  2F4M A;  4X6A I;  2WB1 A;  2JA8 I;  3CQZ I;  2DE7 A;  1PFT A;  2F4O A;  2E2J I;  5D1O B;  3CCR Z;  1VQ8 1;  4NB9 A;  2J6A A;  2QEX 1;  3TE5 B;  1JJ2 Y;  5A2Q f;  4A3J I;  1K73 2;  3Q87 A;  2HF1 A;  2Q51 A;  1VQ5 Z;  1TWG I;  3CXC Z;  1I6H I;  2G2K A;  3FKI I;  2OTL Z;  3GTP I;  1YHQ Z;  4NBA A;  3PO2 I;  3M4O I;  3CME 1;  3GTO I;  1RLY A;  1VQP Z;  3S16 I;  3CCM Z;  3G4S Z;  2OTJ 1;  5IT9 f;  3CCE Z;  1VQO 1;  4MD8 A;  3S1M I;  1Y1V S;  1Q86 2;  1TWF I;  3CC7 1;  1M90 1;  2Y0S A;  2RHB A;  4NBB A;  1QVF Z;  3EED A;  2V8I A;  5FLM I;  4Y7N I;  3CCQ 1;  1VQ8 Z;  2QEX Z;  3HOZ I;  2E2H I;  3CXC Y;  3HOU I;  3IFU A;  3MZK B;  2YAD A;  4E31 A;  4S1T A;  3S14 I;  3HOY I;  1YJ9 1;  3S2D I;  4A3D I;  4A3M I;  3D6W A;  4NBH A;  2HU9 A;  3CME Z;  4DK1 A;  1RO2 A;  2JS4 A;  5AN9 F;  4BY7 I;  3CCJ 1;  2OTJ Z;  1VQ4 1;  3I55 1;  2V8K A;  1QVG Z;  1VQO Z;  3HOX I;  3BG1 B;  3VMG A;  3CPW Y;  3S1N I;  1JJ2 Z;  1QVF Y;  3CC7 Z;  3VMI A;  1KQS Y;  3I56 Z;  2JA5 I;  2DE6 A;  2KPI A;  2E2I I;  2JA7 I;  3GTM S;  3T4N B;  3PO3 S;  4NBG A;  2P3Y A;  2QR1 B;  4XX2 A;  1YJW 1;  4MD9 A;  2OOX B;  4E2W A;  3CCQ Z;  2DE5 A;  3CC4 1;  1S7M A;  2AKL A;  2M6N A;  4NBC A;  1TWH I;  2LIY A;  2GU2 A;  5C3E I;  1S72 1;  4NBF A;  3CCS 1;  1YJ9 Z;  3J80 b;  1Q7Y 1;  4NFR A;  2ZAE B;  1Q81 1;  2NVX I;  3LUS A;  2R93 I;  2R7Z I;  3FQM A;  1QVG Y;  2O53 A;  3GTQ I;  4E2Y A;  1ZH1 A;  3HOV I;  1VQ4 Z;  3I55 Z;  1Q82 1;  1WCM I;  2QKD A;  3CMA 1;  2B63 I;  1W2B Z;  2RPR A;  3CCU 1;  3VMH A;  2R6M A;  3K7A I;  4CL1 A;  1TWA I;  5CM2 M;  3I4M I;  2VUM I;  2NVQ I;  2JA6 I;  1VQ6 Z;  2JR6 A;  1YJW Z;  2QA4 1;  4A3I I;  4HGY A;  3NH4 A;  4QTU A;  3CCL Z;  3CC4 Z;  2QRE B;  1KD1 1;  1YUK A;  3GKQ A;  2VF1 A;  1S72 Z;  3ESW A;  3NH5 A;  1Z01 A;  1Q7Y 2;  1Q81 2;  4EWC A;  3CPW Z;  2IZ3 A;  1QYP A;  2PMZ A;  1KQS Z;  1QF8 A;  3IX0 A;  3NDI A;  3S1R I;  4A3E I;  2K5R A;  2PM9 A;  4BBR I;  1SFO I;  3CMA Z;  1W2B Y;  2OOY B;  2JMO A;  3MON A;  5FLX b;  3NFZ A;  1X0T A;  3CCU Z;  3F3P C;  3GTG I;  4A3G I;  3NDJ A;  2BJO A;  2QA4 Z;  1YUA A;  1Y1W I;  1Y1V I;  1P9N A;  2LFU A;  1KD1 2;  1X3W A;  1TWC I;  4BXX I;  2E9H A;  2I3C A;  3CC2 1;  3F3F C;  3G6E 1;  4NBE A;  3U50 C;  2O4H A;  1VQ7 1;  1NP6 A;  3NH8 A;  3J81 b;  4RVG A;  2QRC B;  2RT9 A;  2WAQ A;  4NOZ A;  3J80 f;  1VQN 1;  1M90 2;  1VQM 1;  4E32 A;  3D9X A;  4MD7 A;  3P5J B;  3JAM b;  1YIT 1;  4A3C I;  1WII A;  2GTH A;  3S2H I;  1VQK 1;  3I07 A;  1K73 1;  2OZK A;  4MH4 A;  1USP A;  3S17 I;  1N2F A;  4NH1 C;  4AYB A;  4HGZ A;  3HOW I;  3CCJ Z;  3VB9 A;  3G71 1;  2K3R A;  3GTM I;  1YI2 1;  1KC8 1;  3PO3 I;  1ZB9 A;  4DGL A;  1K9M 1;  2NVY I;  3CCV 1;  3G6E Z;  3S1Q I;  3GCF A;  1VQ7 Z;  2KI7 B;  2QLV B;  3HKZ A;  1YIJ 1;  1USP B;  1RQF A;  3EER A;  1VQN Z;  5LL6 f;  1VQM Z;  4A3L I;  2M48 A;  1KRL A;  4QTT A;  1NJI 1;  1YIT Z;  2V8J A;  1ML8 A;  2P28 A;  1L1O C;  3IF8 A;  2R92 I;  1VQK Z;  4TNU A;  1VQL 1;  1I50 I;  3J7A 4;  3VTN A;  4E2X A;  3GTJ I;  5FLX f;  4E33 A;  3CCS Z;  4RVF A;  1RO4 A;  2NVT I;  3CD6 1;  1N8R 1;  2RBL A;  2RIQ A;  4RVD A;  3G71 Z;  5A2Q b;  3RZD I;  1YI2 Z;  1ZB8 A;  1K8A 1;  1Q82 2;  1KC8 2;  3CCV Z;  1K9M 2;  5T6B A;  1YIJ Z;  4RS4 A;  3GTL I;  1JWH C;  3OW2 Y;  1RNI A;  1NUI A;  2EGT A;  4NB8 A;  3I56 1;  1K83 I;  3H0G I;  3RZO I;  2W04 A;  3J81 f;  5C44 I;  1NJI 2;  3S15 I;  1WW9 A;  3GTK I;  5IT9 b;  1YJN 1;  2YU9 I;  1RO0 A;  4DQY B;  1VQL Z;  3JAM f;  1M1K 1;  2QRD B;  1DL6 A;  1VQ9 1;  1Z03 A;  1R9T I;  5T64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...