1KD12

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kd1200
1QVGY 1Q861 1K9M1 1KQSY 3G711 1YI21 1VQKZ 1VQ61 1VQ51 3CMEZ 3CCE1 1W2BZ 1YIT1 1VQPZ 1K732 1K8A1 1Q812 2QEXZ 1M1K2 3CCLZ 1YJWZ 3CD61 3CXCZ 1KQSZ 1N8R1 3G71Z 1VQ4Z 1YI2Z 1M902 1VQ6Z 3CME1 3CCJZ 1VQ5Z 1QVFZ 3I55Z 3G6E1 3CPWY 3CCEZ 1YITZ 1YHQ1 1YJN1 3CCV1 1YJW1 1NJI2 3CXCY 3CD6Z 1VQ41 3CC41 1S721 1Q811 1M1K1 3CCJ1 1QVFY 3G4S1 3I551 3CPWZ 3G6EZ 3CC71 1VQL1 2QA41 1YHQZ 1YJNZ 3CCVZ 1M901 1Q822 3I561 3CCU1 3CC4Z 1KC82 1S72Z 1NJI1 3G4SZ 1YIJ1 1Q7Y2 3CC7Z 1VQLZ 2QA4Z 3CCS1 3I56Z 3CCUZ 1K731 1VQM1 1VQO1 1Q821 1YIJZ 3OW2Z 1KC81 3CCSZ 1VQ9Z 2OTL1 2OTJ1 1VQMZ 1VQOZ 1VQ71 1KD12 3CCR1 3CMA1 3CCMZ 3OW2Y 1YJ91 3CC21 1VQ91 1Q862 1K9M2 1VQN1 2OTLZ 1JJ2Z 3CCQZ 1VQ81 2OTJZ 3CCM1 1VQ7Z 3CMAZ 3CCRZ 1QVGZ 1YJ9Z 1K8A2 1VQK1 3CC2Z 1W2BY 1VQP1 1KD11 1VQNZ 1Q7Y1 1N8R2 3CCQ1 1JJ2Y 2QEX1 1VQ8Z 3CCL1
chains in the Genus database with same CATH superfamily
3G711 2PMZA 3S1MI 1YUAA 1RNIA 1VQ61 2JA5I 4NBFA 3CCE1 2QLVB 1VQPZ 5T6BA 1K732 1KRLA 4QTUA 3NH4A 4CL1A 1YJWZ 3CD61 2P28A 2WB1A 3EEDA 3GTLI 3VB9A 1YI2Z 3S16I 2PK7A 4BBRI 3Q87A 1YITZ 1ZB9A 1YJN1 3KIFA 1NJI2 1TWHI 3HOVI 3J7A4 1M1K1 5D1OB 1VQL1 1YHQZ 4A3BI 3CCVZ 1M901 3I561 1I50I 3I07A 3F3FC 3CC4Z 2E7ZA 1S72Z 2JIQA 1AA6A 3PO3I 2OOYB 2QA4Z 4A3FI 2PM9A 3CCS1 1P9NA 2RIQA 2JIPA 1R9TI 5T67A 5IP9I 4MD8A 1VQO1 2RPRA 1X0TA 3HOWI 1YIJZ 2O53A 2JA6I 2Q4ZA 5IT9b 2F4MA 3GKQA 4MXUA 5A2Qb 2YU9I 1ZH1A 3CMA1 3F3PC 3OW2Y 3FQQA 3S1RI 3CQZI 2NVXI 4MONA 5A2Qf 1Q862 1K9M2 1TWGI 4TNUA 2RHBA 2BJOA 2VUGA 2OTLZ 1VQ81 2QREB 2OTJZ 1I3QI 2AKLA 3GTMS 3J81b 3EERA 3GTPI 1VQK1 1KD11 2DE6A 1VQNZ 1Q7Y1 2M6NA 4NB9A 3HOUI 2Y0SA 4NBEA 2J6AA 2GTIA 2GU2A 1VQ51 4HGYA 1W2BZ 1FDIA 1X3WA 3IR7A 1K8A1 3S17I 5FLMI 1Q812 2QEXZ 4DK1A 3VMHA 3CXCZ 1KQSZ 1N8R1 3U50C 1TWFI 1Q16A 4MD9A 3GTJI 3CME1 1DL6A 1QVFZ 1Y1VI 3H3VJ 1QYPA 2Q51A 5C44I 2W04A 3NH5A 3GTKI 2EGTA 2VPXA 1VQ41 4A3JI 4A3LI 3HKZA 3D2LA 2JIOA 4Y7NI 2LFUA 3IX0A 3G6EZ 3CC71 4MH4A 3JAMb 3S2HI 1Q822 2E9HA 2R7ZI 3FKII 2JUBA 3JAMf 1NJI1 3G4SZ 2JMOA 3LUSA 5FLXf 3CCUZ 2NAPA 4MD7A 5D1PA 1VQM1 2JIMA 2O4HA 2W03A 2I3CA 3IF8A 2JA7I 2NVTI 3I4MI 3NFZA 2B63I 1VLAA 4NBCA 1N2FA 2VPYA 3MZLB 4AYBA 2M48A 2K5RA 1Z02A 3KIHA 4A3II 1VQ71 2R93I 4A93I 3CC21 3FQMA 3D6WA 1JJ2Z 3PO3S 2F4OA 1RO0A 2HU9A 2JS4A 3CCM1 1TWAI 3CCRZ 4A3KI 1YJ9Z 5IP7I 1USPA 3NDIA 4NBHA 1W2BY 1VQP1 2VUMI 3M4OI 3CCQ1 3VMIA 2R92I 3TDHB 1Z01A 3MZKB 1QVGY 1I6HI 1Q861 1K9M1 1KQSY 2RBLA 4RV9A 1WIIA 4BBSI 4A3EI 1YI21 2H85A 4E33A 2DE7A 3CMEZ 1YIT1 1ZB8A 2V8JA 4BY7I 4HH4A 3S1NI 3CCLZ 1YUKA 3P5JB 2E2HI 4DGLA 3G71Z 1VQ4Z 1JWHC 1S7MA 3NDJA 4A3DI 1WW9A 2DE5A 1VQ6Z 2K3RA 2KPIA 3CCEZ 1Y1WI 1YHQ1 3H0GI 2VF1A 3IFUA 3CCV1 3S14I 1Z03A 3CD6Z 2NVYI 2AYDA 4RVDA 2V8KA 3CC41 1S721 1Q811 3CCJ1 1Y8CA 3I551 4RVHA 3CPWZ 2QA41 1YJNZ 1K83I 4XX2A 2JR6A 1LQLA 2QKDA 1KC82 1YIJ1 2G2KA 1Q7Y2 1VQLZ 1RLYA 1NUIA 4E2XA 3RZOI 5C3EI 3I56Z 1Y1VS 1K731 5LL6f 1Q821 3D9XA 3I4NI 2V8IA 2IZ3A 2OOXB 3OW2Z 1TWCI 4E31A 1USPB 4NOZA 2E2II 5C4XI 3CCSZ 2OTL1 4HGZA 4NFRA 2OTJ1 5FLXb 2JIRA 1VQOZ 1RO2A 3CCMZ 2NVQI 3GTOI 4DQYB 4QTTA 1VQ91 1VQN1 4A3GI 3CCQZ 4RVFA 3CMAZ 4RVGA 4E32A 2QRCB 3RZDI 1NP6A 2QEX1 1VQ8Z 4S1TA 3ESWA 1VQKZ 3T4NB 2GTHA 3BG0B 4NBDA 1ML8A 3M3YI 1M1K2 3VMGA 1M902 3MONA 3CCJZ 1VQ5Z 2QRDB 3HOXI 3I55Z 3G6E1 3BG1B 3CPWY 5C4JI 2E2JI 4NB8A 1YJW1 3HOZI 1PFTA 1QXFA 3CXCY 2V45A 3HOYI 2RT9A 2OZKA 2IV2X 2LEXA 1FDOA 2P3YA 1QVFY 3G4S1 1L1OC 3J80b 4A3MI 3S2DI 2LIYA 4E30A 3CCU1 2ZAEB 3GTQI 3J80f 5IT9f 3TE5B 4EWCA 3CC7Z 1QF8A 3PO2I 1SIWA 3GTMI 1WCMI 1RQFA 2YADA 2VPZA 2V3VA 3QWUA 4Y52I 1WZNA 5D1OA 5AN9F 4A3CI 4RS4A 1KC81 4E2ZA 2WAQA 3S15I 4BY1I 4NBBA 1VQ9Z 2IZ4A 2R6MA 3J81f 2JNYA 1VQMZ 4NBGA 1KD12 3CCR1 2JA8I 2KI7B 1YJ91 1SFOI 4NBAA 3S1QI 3K7AI 2HF1A 4MRIA 5T64A 4E2WA 3GCFA 2VPWA 4BXXI 1VQ7Z 4X6AI 3VTNA 3NH8A 1QVGZ 1TFIA 1K8A2 1X3ZA 1RO4A 4E2YA 3CC2Z 5CM2M 2QR1B 1N8R2 1JJ2Y 1WJ2A 3CCL1 4NH1C 3GTGI
chains in the Genus database with same CATH topology
3G711 2PMZA 3S1MI 1YUAA 1RNIA 1VQ61 2JA5I 4NBFA 3CCE1 2QLVB 1VQPZ 5T6BA 1K732 1KRLA 4QTUA 3NH4A 4CL1A 1YJWZ 3CD61 2P28A 2WB1A 3EEDA 3GTLI 3VB9A 1YI2Z 3S16I 2PK7A 4BBRI 3Q87A 1YITZ 1ZB9A 1YJN1 3KIFA 1NJI2 1TWHI 3HOVI 3J7A4 1M1K1 5D1OB 1VQL1 1YHQZ 4A3BI 3CCVZ 1M901 3I561 1I50I 3I07A 3F3FC 3CC4Z 1S72Z 3PO3I 2OOYB 2QA4Z 4A3FI 2PM9A 3CCS1 1P9NA 2RIQA 1R9TI 5T67A 5IP9I 4MD8A 1VQO1 2RPRA 1X0TA 3HOWI 1YIJZ 2O53A 2JA6I 2Q4ZA 5IT9b 2F4MA 3GKQA 4MXUA 5A2Qb 2YU9I 1ZH1A 3CMA1 3F3PC 3OW2Y 3FQQA 3S1RI 3CQZI 2NVXI 4MONA 5A2Qf 1Q862 1K9M2 1TWGI 4TNUA 2RHBA 2BJOA 2VUGA 2OTLZ 1VQ81 2QREB 2OTJZ 1I3QI 2AKLA 3GTMS 3J81b 3EERA 3GTPI 1VQK1 1KD11 2DE6A 1VQNZ 1Q7Y1 2M6NA 4NB9A 3HOUI 2Y0SA 4NBEA 2J6AA 2GTIA 2GU2A 1VQ51 4HGYA 1W2BZ 1X3WA 1K8A1 3S17I 5FLMI 1Q812 2QEXZ 4DK1A 3VMHA 3CXCZ 1KQSZ 1N8R1 3U50C 1TWFI 4MD9A 3GTJI 3CME1 1DL6A 1QVFZ 1Y1VI 3H3VJ 1QYPA 2Q51A 5C44I 2W04A 3NH5A 3GTKI 2EGTA 1VQ41 4A3JI 4A3LI 3HKZA 4Y7NI 2LFUA 3IX0A 3G6EZ 3CC71 4MH4A 3JAMb 3S2HI 1Q822 2E9HA 2R7ZI 3FKII 2JUBA 3JAMf 1NJI1 3G4SZ 2JMOA 3LUSA 5FLXf 3CCUZ 4MD7A 5D1PA 1VQM1 2O4HA 2W03A 2I3CA 3IF8A 2JA7I 2NVTI 3I4MI 3NFZA 2B63I 1VLAA 4NBCA 1N2FA 3MZLB 4AYBA 2M48A 2K5RA 1Z02A 3KIHA 4A3II 1VQ71 2R93I 4A93I 3CC21 3FQMA 3D6WA 1JJ2Z 3PO3S 2F4OA 1RO0A 2HU9A 2JS4A 3CCM1 1TWAI 3CCRZ 4A3KI 1YJ9Z 5IP7I 1USPA 3NDIA 4NBHA 1W2BY 1VQP1 2VUMI 3M4OI 3CCQ1 3VMIA 2R92I 3TDHB 1Z01A 3MZKB 1QVGY 1I6HI 1Q861 1K9M1 1KQSY 2RBLA 4RV9A 1WIIA 4BBSI 4A3EI 1YI21 2H85A 4E33A 2DE7A 3CMEZ 1YIT1 1ZB8A 2V8JA 4BY7I 4HH4A 3S1NI 3CCLZ 1YUKA 3P5JB 2E2HI 4DGLA 3G71Z 1VQ4Z 1JWHC 1S7MA 3NDJA 4A3DI 1WW9A 2DE5A 1VQ6Z 2K3RA 2KPIA 3CCEZ 1Y1WI 1YHQ1 3H0GI 2VF1A 3IFUA 3CCV1 3S14I 1Z03A 3CD6Z 2NVYI 4RVDA 2V8KA 3CC41 1S721 1Q811 3CCJ1 3I551 4RVHA 3CPWZ 2QA41 1YJNZ 1K83I 4XX2A 2JR6A 1LQLA 2QKDA 1KC82 1YIJ1 2G2KA 1Q7Y2 1VQLZ 1RLYA 1NUIA 4E2XA 3RZOI 5C3EI 3I56Z 1Y1VS 1K731 5LL6f 1Q821 3D9XA 3I4NI 2V8IA 2IZ3A 2OOXB 3OW2Z 1TWCI 4E31A 1USPB 4NOZA 2E2II 5C4XI 3CCSZ 2OTL1 4HGZA 4NFRA 2OTJ1 5FLXb 1VQOZ 1RO2A 3CCMZ 2NVQI 3GTOI 1VQ91 4QTTA 4DQYB 1VQN1 4A3GI 3CCQZ 4RVFA 3CMAZ 4RVGA 4E32A 2QRCB 3RZDI 1NP6A 2QEX1 1VQ8Z 4S1TA 3ESWA 1VQKZ 3T4NB 2GTHA 3BG0B 4NBDA 1ML8A 3M3YI 1M1K2 3VMGA 1M902 3MONA 3CCJZ 1VQ5Z 2QRDB 3HOXI 3I55Z 3G6E1 3BG1B 3CPWY 5C4JI 2E2JI 4NB8A 1YJW1 3HOZI 1PFTA 3CXCY 3HOYI 2RT9A 2OZKA 2P3YA 1QVFY 3G4S1 1L1OC 3J80b 4A3MI 3S2DI 2LIYA 4E30A 3CCU1 2ZAEB 3GTQI 3J80f 5IT9f 3TE5B 4EWCA 3CC7Z 1QF8A 3PO2I 3GTMI 1WCMI 1RQFA 2YADA 3QWUA 4Y52I 5D1OA 5AN9F 4A3CI 4RS4A 1KC81 4E2ZA 2WAQA 3S15I 4BY1I 4NBBA 1VQ9Z 2IZ4A 2R6MA 3J81f 2JNYA 1VQMZ 4NBGA 1KD12 3CCR1 2JA8I 2KI7B 1YJ91 1SFOI 4NBAA 3S1QI 3K7AI 2HF1A 4MRIA 5T64A 4E2WA 3GCFA 4BXXI 1VQ7Z 4X6AI 3VTNA 3NH8A 1QVGZ 1TFIA 1K8A2 1X3ZA 1RO4A 4E2YA 3CC2Z 5CM2M 2QR1B 1N8R2 1JJ2Y 3CCL1 4NH1C 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Y;  1Q86 1;  1K9M 1;  1KQS Y;  3G71 1;  1YI2 1;  1VQK Z;  1VQ6 1;  1VQ5 1;  3CME Z;  3CCE 1;  1W2B Z;  1YIT 1;  1VQP Z;  1K73 2;  1K8A 1;  1Q81 2;  2QEX Z;  1M1K 2;  3CCL Z;  1YJW Z;  3CD6 1;  3CXC Z;  1KQS Z;  1N8R 1;  3G71 Z;  1VQ4 Z;  1YI2 Z;  1M90 2;  1VQ6 Z;  3CME 1;  3CCJ Z;  1VQ5 Z;  1QVF Z;  3I55 Z;  3G6E 1;  3CPW Y;  3CCE Z;  1YIT Z;  1YHQ 1;  1YJN 1;  3CCV 1;  1YJW 1;  1NJI 2;  3CXC Y;  3CD6 Z;  1VQ4 1;  3CC4 1;  1S72 1;  1Q81 1;  1M1K 1;  3CCJ 1;  1QVF Y;  3G4S 1;  3I55 1;  3CPW Z;  3G6E Z;  3CC7 1;  1VQL 1;  2QA4 1;  1YHQ Z;  1YJN Z;  3CCV Z;  1M90 1;  1Q82 2;  3I56 1;  3CCU 1;  3CC4 Z;  1KC8 2;  1S72 Z;  1NJI 1;  3G4S Z;  1YIJ 1;  1Q7Y 2;  3CC7 Z;  1VQL Z;  2QA4 Z;  3CCS 1;  3I56 Z;  3CCU Z;  1K73 1;  1VQM 1;  1VQO 1;  1Q82 1;  1YIJ Z;  3OW2 Z;  1KC8 1;  3CCS Z;  1VQ9 Z;  2OTL 1;  2OTJ 1;  1VQM Z;  1VQO Z;  1VQ7 1;  1KD1 2;  3CCR 1;  3CMA 1;  3CCM Z;  3OW2 Y;  1YJ9 1;  3CC2 1;  1VQ9 1;  1Q86 2;  1K9M 2;  1VQN 1;  2OTL Z;  1JJ2 Z;  3CCQ Z;  1VQ8 1;  2OTJ Z;  3CCM 1;  1VQ7 Z;  3CMA Z;  3CCR Z;  1QVG Z;  1YJ9 Z;  1K8A 2;  1VQK 1;  3CC2 Z;  1W2B Y;  1VQP 1;  1KD1 1;  1VQN Z;  1Q7Y 1;  1N8R 2;  3CCQ 1;  1JJ2 Y;  2QEX 1;  1VQ8 Z;  3CCL 1; 
#chains in the Genus database with same CATH topology
 3G71 1;  2PMZ A;  3S1M I;  1YUA A;  1RNI A;  1VQ6 1;  2JA5 I;  4NBF A;  3CCE 1;  2QLV B;  1VQP Z;  5T6B A;  1K73 2;  1KRL A;  4QTU A;  3NH4 A;  4CL1 A;  1YJW Z;  3CD6 1;  2P28 A;  2WB1 A;  3EED A;  3GTL I;  3VB9 A;  1YI2 Z;  3S16 I;  2PK7 A;  4BBR I;  3Q87 A;  1YIT Z;  1ZB9 A;  1YJN 1;  3KIF A;  1NJI 2;  1TWH I;  3HOV I;  3J7A 4;  1M1K 1;  5D1O B;  1VQL 1;  1YHQ Z;  4A3B I;  3CCV Z;  1M90 1;  3I56 1;  1I50 I;  3I07 A;  3F3F C;  3CC4 Z;  2E7Z A;  1S72 Z;  2JIQ A;  1AA6 A;  3PO3 I;  2OOY B;  2QA4 Z;  4A3F I;  2PM9 A;  3CCS 1;  1P9N A;  2RIQ A;  2JIP A;  1R9T I;  5T67 A;  5IP9 I;  4MD8 A;  1VQO 1;  2RPR A;  1X0T A;  3HOW I;  1YIJ Z;  2O53 A;  2JA6 I;  2Q4Z A;  5IT9 b;  2F4M A;  3GKQ A;  4MXU A;  5A2Q b;  2YU9 I;  1ZH1 A;  3CMA 1;  3F3P C;  3OW2 Y;  3FQQ A;  3S1R I;  3CQZ I;  2NVX I;  4MON A;  5A2Q f;  1Q86 2;  1K9M 2;  1TWG I;  4TNU A;  2RHB A;  2BJO A;  2VUG A;  2OTL Z;  1VQ8 1;  2QRE B;  2OTJ Z;  1I3Q I;  2AKL A;  3GTM S;  3J81 b;  3EER A;  3GTP I;  1VQK 1;  1KD1 1;  2DE6 A;  1VQN Z;  1Q7Y 1;  2M6N A;  4NB9 A;  3HOU I;  2Y0S A;  4NBE A;  2J6A A;  2GTI A;  2GU2 A;  1VQ5 1;  4HGY A;  1W2B Z;  1FDI A;  1X3W A;  3IR7 A;  1K8A 1;  3S17 I;  5FLM I;  1Q81 2;  2QEX Z;  4DK1 A;  3VMH A;  3CXC Z;  1KQS Z;  1N8R 1;  3U50 C;  1TWF I;  1Q16 A;  4MD9 A;  3GTJ I;  3CME 1;  1DL6 A;  1QVF Z;  1Y1V I;  3H3V J;  1QYP A;  2Q51 A;  5C44 I;  2W04 A;  3NH5 A;  3GTK I;  2EGT A;  2VPX A;  1VQ4 1;  4A3J I;  4A3L I;  3HKZ A;  3D2L A;  2JIO A;  4Y7N I;  2LFU A;  3IX0 A;  3G6E Z;  3CC7 1;  4MH4 A;  3JAM b;  3S2H I;  1Q82 2;  2E9H A;  2R7Z I;  3FKI I;  2JUB A;  3JAM f;  1NJI 1;  3G4S Z;  2JMO A;  3LUS A;  5FLX f;  3CCU Z;  2NAP A;  4MD7 A;  5D1P A;  1VQM 1;  2JIM A;  2O4H A;  2W03 A;  2I3C A;  3IF8 A;  2JA7 I;  2NVT I;  3I4M I;  3NFZ A;  2B63 I;  1VLA A;  4NBC A;  1N2F A;  2VPY A;  3MZL B;  4AYB A;  2M48 A;  2K5R A;  1Z02 A;  3KIH A;  4A3I I;  1VQ7 1;  2R93 I;  4A93 I;  3CC2 1;  3FQM A;  3D6W A;  1JJ2 Z;  3PO3 S;  2F4O A;  1RO0 A;  2HU9 A;  2JS4 A;  3CCM 1;  1TWA I;  3CCR Z;  4A3K I;  1YJ9 Z;  5IP7 I;  1USP A;  3NDI A;  4NBH A;  1W2B Y;  1VQP 1;  2VUM I;  3M4O I;  3CCQ 1;  3VMI A;  2R92 I;  3TDH B;  1Z01 A;  3MZK B;  1QVG Y;  1I6H I;  1Q86 1;  1K9M 1;  1KQS Y;  2RBL A;  4RV9 A;  1WII A;  4BBS I;  4A3E I;  1YI2 1;  2H85 A;  4E33 A;  2DE7 A;  3CME Z;  1YIT 1;  1ZB8 A;  2V8J A;  4BY7 I;  4HH4 A;  3S1N I;  3CCL Z;  1YUK A;  3P5J B;  2E2H I;  4DGL A;  3G71 Z;  1VQ4 Z;  1JWH C;  1S7M A;  3NDJ A;  4A3D I;  1WW9 A;  2DE5 A;  1VQ6 Z;  2K3R A;  2KPI A;  3CCE Z;  1Y1W I;  1YHQ 1;  3H0G I;  2VF1 A;  3IFU A;  3CCV 1;  3S14 I;  1Z03 A;  3CD6 Z;  2NVY I;  2AYD A;  4RVD A;  2V8K A;  3CC4 1;  1S72 1;  1Q81 1;  3CCJ 1;  1Y8C A;  3I55 1;  4RVH A;  3CPW Z;  2QA4 1;  1YJN Z;  1K83 I;  4XX2 A;  2JR6 A;  1LQL A;  2QKD A;  1KC8 2;  1YIJ 1;  2G2K A;  1Q7Y 2;  1VQL Z;  1RLY A;  1NUI A;  4E2X A;  3RZO I;  5C3E I;  3I56 Z;  1Y1V S;  1K73 1;  5LL6 f;  1Q82 1;  3D9X A;  3I4N I;  2V8I A;  2IZ3 A;  2OOX B;  3OW2 Z;  1TWC I;  4E31 A;  1USP B;  4NOZ A;  2E2I I;  5C4X I;  3CCS Z;  2OTL 1;  4HGZ A;  4NFR A;  2OTJ 1;  5FLX b;  2JIR A;  1VQO Z;  1RO2 A;  3CCM Z;  2NVQ I;  3GTO I;  4DQY B;  4QTT A;  1VQ9 1;  1VQN 1;  4A3G I;  3CCQ Z;  4RVF A;  3CMA Z;  4RVG A;  4E32 A;  2QRC B;  3RZD I;  1NP6 A;  2QEX 1;  1VQ8 Z;  4S1T A;  3ESW A;  1VQK Z;  3T4N B;  2GTH A;  3BG0 B;  4NBD A;  1ML8 A;  3M3Y I;  1M1K 2;  3VMG A;  1M90 2;  3MON A;  3CCJ Z;  1VQ5 Z;  2QRD B;  3HOX I;  3I55 Z;  3G6E 1;  3BG1 B;  3CPW Y;  5C4J I;  2E2J I;  4NB8 A;  1YJW 1;  3HOZ I;  1PFT A;  1QXF A;  3CXC Y;  2V45 A;  3HOY I;  2RT9 A;  2OZK A;  2IV2 X;  2LEX A;  1FDO A;  2P3Y A;  1QVF Y;  3G4S 1;  1L1O C;  3J80 b;  4A3M I;  3S2D I;  2LIY A;  4E30 A;  3CCU 1;  2ZAE B;  3GTQ I;  3J80 f;  5IT9 f;  3TE5 B;  4EWC A;  3CC7 Z;  1QF8 A;  3PO2 I;  1SIW A;  3GTM I;  1WCM I;  1RQF A;  2YAD A;  2VPZ A;  2V3V A;  3QWU A;  4Y52 I;  1WZN A;  5D1O A;  5AN9 F;  4A3C I;  4RS4 A;  1KC8 1;  4E2Z A;  2WAQ A;  3S15 I;  4BY1 I;  4NBB A;  1VQ9 Z;  2IZ4 A;  2R6M A;  3J81 f;  2JNY A;  1VQM Z;  4NBG A;  1KD1 2;  3CCR 1;  2JA8 I;  2KI7 B;  1YJ9 1;  1SFO I;  4NBA A;  3S1Q I;  3K7A I;  2HF1 A;  4MRI A;  5T64 A;  4E2W A;  3GCF A;  2VPW A;  4BXX I;  1VQ7 Z;  4X6A I;  3VTN A;  3NH8 A;  1QVG Z;  1TFI A;  1K8A 2;  1X3Z A;  1RO4 A;  4E2Y A;  3CC2 Z;  5CM2 M;  2QR1 B;  1N8R 2;  1JJ2 Y;  1WJ2 A;  3CCL 1;  4NH1 C;  3GTG I; 
#chains in the Genus database with same CATH homology
 3G71 1;  2PMZ A;  3S1M I;  1YUA A;  1RNI A;  1VQ6 1;  2JA5 I;  4NBF A;  3CCE 1;  2QLV B;  1VQP Z;  5T6B A;  1K73 2;  1KRL A;  4QTU A;  3NH4 A;  4CL1 A;  1YJW Z;  3CD6 1;  2P28 A;  2WB1 A;  3EED A;  3GTL I;  3VB9 A;  1YI2 Z;  3S16 I;  2PK7 A;  4BBR I;  3Q87 A;  1YIT Z;  1ZB9 A;  1YJN 1;  3KIF A;  1NJI 2;  1TWH I;  3HOV I;  3J7A 4;  1M1K 1;  5D1O B;  1VQL 1;  1YHQ Z;  4A3B I;  3CCV Z;  1M90 1;  3I56 1;  1I50 I;  3I07 A;  3F3F C;  3CC4 Z;  1S72 Z;  3PO3 I;  2OOY B;  2QA4 Z;  4A3F I;  2PM9 A;  3CCS 1;  1P9N A;  2RIQ A;  1R9T I;  5T67 A;  5IP9 I;  4MD8 A;  1VQO 1;  2RPR A;  1X0T A;  3HOW I;  1YIJ Z;  2O53 A;  2JA6 I;  2Q4Z A;  5IT9 b;  2F4M A;  3GKQ A;  4MXU A;  5A2Q b;  2YU9 I;  1ZH1 A;  3CMA 1;  3F3P C;  3OW2 Y;  3FQQ A;  3S1R I;  3CQZ I;  2NVX I;  4MON A;  5A2Q f;  1Q86 2;  1K9M 2;  1TWG I;  4TNU A;  2RHB A;  2BJO A;  2VUG A;  2OTL Z;  1VQ8 1;  2QRE B;  2OTJ Z;  1I3Q I;  2AKL A;  3GTM S;  3J81 b;  3EER A;  3GTP I;  1VQK 1;  1KD1 1;  2DE6 A;  1VQN Z;  1Q7Y 1;  2M6N A;  4NB9 A;  3HOU I;  2Y0S A;  4NBE A;  2J6A A;  2GTI A;  2GU2 A;  1VQ5 1;  4HGY A;  1W2B Z;  1X3W A;  1K8A 1;  3S17 I;  5FLM I;  1Q81 2;  2QEX Z;  4DK1 A;  3VMH A;  3CXC Z;  1KQS Z;  1N8R 1;  3U50 C;  1TWF I;  4MD9 A;  3GTJ I;  3CME 1;  1DL6 A;  1QVF Z;  1Y1V I;  3H3V J;  1QYP A;  2Q51 A;  5C44 I;  2W04 A;  3NH5 A;  3GTK I;  2EGT A;  1VQ4 1;  4A3J I;  4A3L I;  3HKZ A;  4Y7N I;  2LFU A;  3IX0 A;  3G6E Z;  3CC7 1;  4MH4 A;  3JAM b;  3S2H I;  1Q82 2;  2E9H A;  2R7Z I;  3FKI I;  2JUB A;  3JAM f;  1NJI 1;  3G4S Z;  2JMO A;  3LUS A;  5FLX f;  3CCU Z;  4MD7 A;  5D1P A;  1VQM 1;  2O4H A;  2W03 A;  2I3C A;  3IF8 A;  2JA7 I;  2NVT I;  3I4M I;  3NFZ A;  2B63 I;  1VLA A;  4NBC A;  1N2F A;  3MZL B;  4AYB A;  2M48 A;  2K5R A;  1Z02 A;  3KIH A;  4A3I I;  1VQ7 1;  2R93 I;  4A93 I;  3CC2 1;  3FQM A;  3D6W A;  1JJ2 Z;  3PO3 S;  2F4O A;  1RO0 A;  2HU9 A;  2JS4 A;  3CCM 1;  1TWA I;  3CCR Z;  4A3K I;  1YJ9 Z;  5IP7 I;  1USP A;  3NDI A;  4NBH A;  1W2B Y;  1VQP 1;  2VUM I;  3M4O I;  3CCQ 1;  3VMI A;  2R92 I;  3TDH B;  1Z01 A;  3MZK B;  1QVG Y;  1I6H I;  1Q86 1;  1K9M 1;  1KQS Y;  2RBL A;  4RV9 A;  1WII A;  4BBS I;  4A3E I;  1YI2 1;  2H85 A;  4E33 A;  2DE7 A;  3CME Z;  1YIT 1;  1ZB8 A;  2V8J A;  4BY7 I;  4HH4 A;  3S1N I;  3CCL Z;  1YUK A;  3P5J B;  2E2H I;  4DGL A;  3G71 Z;  1VQ4 Z;  1JWH C;  1S7M A;  3NDJ A;  4A3D I;  1WW9 A;  2DE5 A;  1VQ6 Z;  2K3R A;  2KPI A;  3CCE Z;  1Y1W I;  1YHQ 1;  3H0G I;  2VF1 A;  3IFU A;  3CCV 1;  3S14 I;  1Z03 A;  3CD6 Z;  2NVY I;  4RVD A;  2V8K A;  3CC4 1;  1S72 1;  1Q81 1;  3CCJ 1;  3I55 1;  4RVH A;  3CPW Z;  2QA4 1;  1YJN Z;  1K83 I;  4XX2 A;  2JR6 A;  1LQL A;  2QKD A;  1KC8 2;  1YIJ 1;  2G2K A;  1Q7Y 2;  1VQL Z;  1RLY A;  1NUI A;  4E2X A;  3RZO I;  5C3E I;  3I56 Z;  1Y1V S;  1K73 1;  5LL6 f;  1Q82 1;  3D9X A;  3I4N I;  2V8I A;  2IZ3 A;  2OOX B;  3OW2 Z;  1TWC I;  4E31 A;  1USP B;  4NOZ A;  2E2I I;  5C4X I;  3CCS Z;  2OTL 1;  4HGZ A;  4NFR A;  2OTJ 1;  5FLX b;  1VQO Z;  1RO2 A;  3CCM Z;  2NVQ I;  3GTO I;  1VQ9 1;  4QTT A;  4DQY B;  1VQN 1;  4A3G I;  3CCQ Z;  4RVF A;  3CMA Z;  4RVG A;  4E32 A;  2QRC B;  3RZD I;  1NP6 A;  2QEX 1;  1VQ8 Z;  4S1T A;  3ESW A;  1VQK Z;  3T4N B;  2GTH A;  3BG0 B;  4NBD A;  1ML8 A;  3M3Y I;  1M1K 2;  3VMG A;  1M90 2;  3MON A;  3CCJ Z;  1VQ5 Z;  2QRD B;  3HOX I;  3I55 Z;  3G6E 1;  3BG1 B;  3CPW Y;  5C4J I;  2E2J I;  4NB8 A;  1YJW 1;  3HOZ I;  1PFT A;  3CXC Y;  3HOY I;  2RT9 A;  2OZK A;  2P3Y A;  1QVF Y;  3G4S 1;  1L1O C;  3J80 b;  4A3M I;  3S2D I;  2LIY A;  4E30 A;  3CCU 1;  2ZAE B;  3GTQ I;  3J80 f;  5IT9 f;  3TE5 B;  4EWC A;  3CC7 Z;  1QF8 A;  3PO2 I;  3GTM I;  1WCM I;  1RQF A;  2YAD A;  3QWU A;  4Y52 I;  5D1O A;  5AN9 F;  4A3C I;  4RS4 A;  1KC8 1;  4E2Z A;  2WAQ A;  3S15 I;  4BY1 I;  4NBB A;  1VQ9 Z;  2IZ4 A;  2R6M A;  3J81 f;  2JNY A;  1VQM Z;  4NBG A;  1KD1 2;  3CCR 1;  2JA8 I;  2KI7 B;  1YJ9 1;  1SFO I;  4NBA A;  3S1Q I;  3K7A I;  2HF1 A;  4MRI A;  5T64 A;  4E2W A;  3GCF A;  4BXX I;  1VQ7 Z;  4X6A I;  3VTN A;  3NH8 A;  1QVG Z;  1TFI A;  1K8A 2;  1X3Z A;  1RO4 A;  4E2Y A;  3CC2 Z;  5CM2 M;  2QR1 B;  1N8R 2;  1JJ2 Y;  3CCL 1;  4NH1 C;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...