1KD12

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kd1200
3CXCZ 1JJ2Z 3CCMZ 1QVGY 1KD11 3I551 3CCQ1 1W2BY 1Q7Y1 1K731 3CMA1 1KD12 3CC7Z 1VQK1 1S721 3G6EZ 1K732 2OTJZ 3CMEZ 1KQSY 1YIJZ 1VQ4Z 1VQ81 2OTL1 1YHQ1 3CC2Z 1Q811 1Q821 1Q812 3G4SZ 1Q822 1VQOZ 1VQ9Z 1VQ6Z 1YI21 3G711 3OW2Z 1VQ7Z 1NJI1 1VQL1 1KC81 1YJ9Z 1NJI2 3CCL1 3CPWY 1QVGZ 1VQMZ 3CCE1 3CCSZ 1YJN1 1Q7Y2 1KC82 3CMAZ 1VQN1 3CXCY 1JJ2Y 2QEX1 3CCU1 2QA4Z 3CD61 1M1K1 3CCV1 3CC4Z 1M1K2 3CCJ1 3CC71 3CCR1 1VQ5Z 1VQPZ 3G6E1 3CME1 3I55Z 1VQ51 3CCQZ 1YJW1 1VQLZ 1K9M1 1W2BZ 3I561 3CPWZ 1YJNZ 1M901 1VQKZ 1K9M2 1S72Z 1QVFY 1VQNZ 1YIT1 1Q861 1M902 1VQ8Z 1KQSZ 2OTLZ 1YHQZ 1VQ71 1Q862 2QEXZ 3CCUZ 3CCM1 3CD6Z 3CCVZ 1YJ91 1N8R1 3G71Z 1VQM1 1YI2Z 3CCS1 3CCJZ 1N8R2 2OTJ1 3CCRZ 1YIJ1 1VQ41 3CC21 1K8A1 3CCLZ 2QA41 1YJWZ 3CCEZ 3G4S1 1K8A2 3I56Z 1VQO1 1VQ91 1VQ61 3CC41 3OW2Y 1YITZ 1VQP1 1QVFZ
chains in the Genus database with same CATH superfamily
2F4OA 4BBRI 3CCMZ 2G2KA 1KD11 2LEXA 1W2BY 2M6NA 4CL1A 1KD12 5LL6f 1VQK1 2IV2X 3MONA 1DL6A 1VQ81 2OTL1 3M3YI 5IP9I 5D1OB 4MD9A 3G4SZ 2JUBA 3RZDI 2K5RA 5T6BA 2KPIA 3HOXI 4E33A 1NJI1 3IX0A 2KI7B 1KC81 1NJI2 2GU2A 2J6AA 1Z01A 1VQMZ 2E2II 3FQMA 1KC82 2BJOA 4NBCA 1RQFA 1RO0A 2W04A 2QEX1 3I4MI 3GTMS 4NB8A 3J7A4 3CD61 3PO3S 2JIPA 2JNYA 2VPXA 3NH8A 3CCJ1 1I50I 4BY1I 3CC71 3CCR1 1VQ5Z 1VQPZ 4E2ZA 3S1MI 3GTMI 1YUKA 3HOWI 4AYBA 4E30A 3PO3I 1VQLZ 2OOXB 1SIWA 2HU9A 3NH4A 1RNIA 4S1TA 3I561 3PO2I 3S2HI 2Q4ZA 4BXXI 1VQNZ 3JAMb 5FLXf 3CQZI 1VQ71 3VMGA 3CCUZ 3NDJA 2QRDB 1WCMI 5IT9f 2M48A 2P3YA 1AA6A 1YI2Z 3CCS1 1Y1WI 3GTPI 3S1QI 2P28A 2NVYI 3S1RI 1YIJ1 2GTHA 3FQQA 5C4JI 3BG0B 3S14I 1QXFA 4NBAA 2QKDA 1VQ91 1VQ61 1USPB 4A3KI 1Z02A 1PFTA 3IR7A 3HOUI 1VLAA 1QVFZ 3CXCZ 1JJ2Z 1KRLA 3LUSA 2AYDA 1QVGY 4RVHA 3CCQ1 2NVXI 2H85A 1Q7Y1 1TWAI 1K731 2AKLA 2F4MA 1WJ2A 1S721 1K732 4HGYA 1VQ4Z 1Q16A 2V45A 5T64A 1Q821 1Q822 1VQOZ 1RLYA 4NBEA 3TDHB 4BY7I 3OW2Z 5FLMI 3IF8A 3KIHA 3GTLI 3J80f 3D6WA 1YJ9Z 3CPWY 1LQLA 1YJN1 3J81f 3S17I 2VUMI 4MXUA 3FKII 3S15I 3T4NB 3I07A 2QA4Z 1M1K1 3HKZA 2JA6I 1JWHC 3CC4Z 3RZOI 1M1K2 1S7MA 2QREB 5IP7I 5AN9F 4RVDA 4NBGA 1ZB9A 4QTTA 3F3PC 3GTKI 2OZKA 3NH5A 4NBHA 3I55Z 1K9M1 4MONA 4NBFA 2RIQA 3VTNA 4A3EI 1M901 1K9M2 1X3WA 4RVFA 1YIT1 2PMZA 3P5JB 1M902 3GCFA 2Q51A 1KQSZ 2E2JI 4Y52I 1YHQZ 1NP6A 2I3CA 2QEXZ 5T67A 3GTQI 3D9XA 3CD6Z 1ML8A 1NUIA 1RO4A 3G71Z 1VQM1 3CCJZ 2OTJ1 3CCRZ 1Y8CA 4A3JI 3CC21 3CCLZ 3NDIA 2O53A 3CCEZ 1QF8A 4E32A 3S16I 3I56Z 5A2Qf 1Y1VS 2VF1A 2O4HA 2JR6A 2NVTI 1VQ51 1VQP1 4A3FI 4BBSI 2IZ4A 2DE6A 3MZKB 2R7ZI 1Y1VI 1FDIA 3CMA1 3JAMf 3G6EZ 3CMEZ 4A3LI 3Q87A 1YIJZ 4NBBA 2JIOA 1Q811 3GTJI 4RV9A 1Q812 3VMHA 4E2WA 2VPYA 1VQ9Z 2QLVB 1VQ6Z 1YI21 4A3MI 1TWFI 1ZB8A 4MH4A 2PM9A 3NFZA 1QVGZ 1Q7Y2 2DE5A 3VB9A 1FDOA 2VPWA 3QWUA 3CXCY 1JJ2Y 4E2XA 1YUAA 3M4OI 3CCV1 2V8KA 2JIMA 4QTUA 2QR1B 4RS4A 2JMOA 3HOZI 4NOZA 5D1OA 3I4NI 1K83I 2LFUA 2JIQA 3HOYI 1TWGI 4DQYB 1P9NA 4EWCA 1YJW1 2R6MA 1W2BZ 2VUGA 3CPWZ 2RT9A 3EEDA 1YJNZ 1VQKZ 3TE5B 3H0GI 1WIIA 4A3II 2K3RA 4MD7A 1Q861 1VQ8Z 2OTLZ 2JS4A 4A3CI 1Q862 1WZNA 2OOYB 3CCM1 3ESWA 3VMIA 2DE7A 2Y0SA 3KIFA 1YJ91 4DK1A 1N8R1 2R93I 3H3VJ 2VPZA 1N8R2 3GTOI 2W03A 4DGLA 4NH1C 2B63I 4MD8A 2HF1A 1K8A1 4X6AI 2E9HA 2QA41 2IZ3A 1L1OC 4HH4A 3G4S1 1K8A2 2YADA 4XX2A 3S2DI 4NB9A 3CC41 1ZH1A 3K7AI 2RBLA 1YITZ 1X0TA 2V3VA 3I551 3F3FC 5C3EI 5CM2M 4MRIA 2WAQA 3CC7Z 4A3BI 2OTJZ 1TWHI 3GKQA 1KQSY 4NFRA 2RPRA 1YHQ1 3IFUA 3BG1B 3CC2Z 2NAPA 2JA7I 1TWCI 1X3ZA 3G711 4A3DI 1VQ7Z 2NVQI 3D2LA 5A2Qb 1USPA 4HGZA 2V8IA 2JA5I 1VQL1 2RHBA 4Y7NI 3CCL1 4RVGA 5FLXb 3EERA 3CCE1 3CCSZ 2JIRA 3CMAZ 1N2FA 5IT9b 1VQN1 3HOVI 1SFOI 3CCU1 2EGTA 1R9TI 4E31A 2WB1A 5C44I 2ZAEB 3U50C 3G6E1 2E7ZA 2YU9I 3CME1 2E2HI 2LIYA 3CCQZ 1TFIA 2QRCB 2V8JA 1I6HI 1S72Z 3GTGI 1QVFY 4A3GI 5D1PA 3CCVZ 3MZLB 3S1NI 4NBDA 2JA8I 4A93I 1VQ41 2PK7A 4TNUA 1Z03A 5C4XI 1QYPA 1YJWZ 2R92I 4E2YA 1WW9A 3J80b 1VQO1 3OW2Y 2GTIA 3J81b 1I3QI 1RO2A
chains in the Genus database with same CATH topology
2F4OA 4BBRI 3CCMZ 2G2KA 1KD11 1W2BY 2M6NA 4CL1A 1KD12 5LL6f 1VQK1 3MONA 1DL6A 1VQ81 2OTL1 3M3YI 5IP9I 5D1OB 4MD9A 3G4SZ 2JUBA 3RZDI 2K5RA 5T6BA 2KPIA 3HOXI 4E33A 1NJI1 3IX0A 2KI7B 1KC81 1NJI2 2GU2A 2J6AA 1Z01A 1VQMZ 2E2II 3FQMA 1KC82 2BJOA 4NBCA 1RQFA 1RO0A 2W04A 2QEX1 3I4MI 3GTMS 4NB8A 3J7A4 3CD61 3PO3S 2JNYA 3NH8A 3CCJ1 1I50I 4BY1I 3CC71 3CCR1 1VQ5Z 1VQPZ 4E2ZA 3S1MI 3GTMI 1YUKA 3HOWI 4AYBA 4E30A 3PO3I 1VQLZ 2OOXB 2HU9A 3NH4A 1RNIA 4S1TA 3I561 3PO2I 3S2HI 2Q4ZA 4BXXI 1VQNZ 3JAMb 5FLXf 3CQZI 1VQ71 3VMGA 3CCUZ 3NDJA 2QRDB 1WCMI 5IT9f 2M48A 2P3YA 1YI2Z 3CCS1 1Y1WI 3GTPI 3S1QI 2P28A 2NVYI 3S1RI 1YIJ1 2GTHA 3FQQA 5C4JI 3BG0B 3S14I 4NBAA 2QKDA 1VQ91 1VQ61 1USPB 4A3KI 1Z02A 1PFTA 3HOUI 1VLAA 1QVFZ 3CXCZ 1JJ2Z 1KRLA 3LUSA 1QVGY 4RVHA 3CCQ1 2NVXI 2H85A 1Q7Y1 1TWAI 1K731 2AKLA 2F4MA 1S721 1K732 4HGYA 1VQ4Z 5T64A 1Q821 1Q822 1VQOZ 1RLYA 4NBEA 3TDHB 4BY7I 3OW2Z 5FLMI 3IF8A 3KIHA 3GTLI 3J80f 3D6WA 1YJ9Z 3CPWY 1LQLA 1YJN1 3J81f 3S17I 2VUMI 4MXUA 3FKII 3S15I 3T4NB 3I07A 2QA4Z 1M1K1 3HKZA 2JA6I 1JWHC 3CC4Z 3RZOI 1M1K2 1S7MA 2QREB 5IP7I 5AN9F 4RVDA 4NBGA 1ZB9A 4QTTA 3F3PC 3GTKI 2OZKA 3NH5A 4NBHA 3I55Z 1K9M1 4MONA 4NBFA 2RIQA 3VTNA 4A3EI 1M901 1K9M2 1X3WA 4RVFA 1YIT1 2PMZA 3P5JB 1M902 3GCFA 2Q51A 1KQSZ 2E2JI 4Y52I 1YHQZ 1NP6A 2I3CA 2QEXZ 5T67A 3GTQI 3D9XA 3CD6Z 1ML8A 1NUIA 1RO4A 3G71Z 1VQM1 3CCJZ 2OTJ1 3CCRZ 4A3JI 3CC21 3CCLZ 3NDIA 2O53A 3CCEZ 1QF8A 4E32A 3S16I 3I56Z 5A2Qf 1Y1VS 2VF1A 2O4HA 2JR6A 2NVTI 1VQ51 1VQP1 4A3FI 4BBSI 2IZ4A 2DE6A 3MZKB 2R7ZI 1Y1VI 3CMA1 3JAMf 3G6EZ 3CMEZ 4A3LI 3Q87A 1YIJZ 4NBBA 1Q811 3GTJI 4RV9A 1Q812 3VMHA 4E2WA 1VQ9Z 1VQ6Z 2QLVB 1YI21 4A3MI 1TWFI 1ZB8A 4MH4A 2PM9A 3NFZA 1QVGZ 1Q7Y2 2DE5A 3VB9A 3QWUA 3CXCY 1JJ2Y 4E2XA 1YUAA 3M4OI 3CCV1 2V8KA 4QTUA 2QR1B 4RS4A 2JMOA 3HOZI 4NOZA 5D1OA 3I4NI 1K83I 2LFUA 3HOYI 1TWGI 4DQYB 1P9NA 4EWCA 1YJW1 2R6MA 1W2BZ 2VUGA 3CPWZ 2RT9A 3EEDA 1YJNZ 1VQKZ 3TE5B 3H0GI 1WIIA 4A3II 2K3RA 4MD7A 1Q861 1VQ8Z 2OTLZ 2JS4A 4A3CI 1Q862 2OOYB 3CCM1 3ESWA 3VMIA 2DE7A 2Y0SA 3KIFA 1YJ91 4DK1A 1N8R1 2R93I 3H3VJ 1N8R2 3GTOI 2W03A 4DGLA 4NH1C 2B63I 4MD8A 2HF1A 1K8A1 4X6AI 2E9HA 2QA41 2IZ3A 1L1OC 4HH4A 3G4S1 1K8A2 2YADA 4XX2A 3S2DI 4NB9A 3CC41 1ZH1A 3K7AI 2RBLA 1YITZ 1X0TA 3I551 3F3FC 5C3EI 5CM2M 4MRIA 2WAQA 3CC7Z 4A3BI 2OTJZ 1TWHI 3GKQA 1KQSY 4NFRA 2RPRA 1YHQ1 3IFUA 3BG1B 3CC2Z 2JA7I 1TWCI 1X3ZA 3G711 4A3DI 1VQ7Z 2NVQI 5A2Qb 1USPA 4HGZA 2V8IA 2JA5I 1VQL1 2RHBA 4Y7NI 3CCL1 4RVGA 5FLXb 3EERA 3CCE1 3CCSZ 3CMAZ 1N2FA 5IT9b 1VQN1 3HOVI 1SFOI 3CCU1 2EGTA 1R9TI 4E31A 2WB1A 5C44I 2ZAEB 3U50C 3G6E1 2YU9I 3CME1 2E2HI 2LIYA 3CCQZ 1TFIA 2QRCB 2V8JA 1I6HI 1S72Z 3GTGI 1QVFY 4A3GI 5D1PA 3CCVZ 3MZLB 3S1NI 4NBDA 2JA8I 4A93I 1VQ41 2PK7A 4TNUA 1Z03A 5C4XI 1QYPA 1YJWZ 2R92I 4E2YA 1WW9A 3J80b 1VQO1 3OW2Y 2GTIA 3J81b 1I3QI 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC Z;  1JJ2 Z;  3CCM Z;  1QVG Y;  1KD1 1;  3I55 1;  3CCQ 1;  1W2B Y;  1Q7Y 1;  1K73 1;  3CMA 1;  1KD1 2;  3CC7 Z;  1VQK 1;  1S72 1;  3G6E Z;  1K73 2;  2OTJ Z;  3CME Z;  1KQS Y;  1YIJ Z;  1VQ4 Z;  1VQ8 1;  2OTL 1;  1YHQ 1;  3CC2 Z;  1Q81 1;  1Q82 1;  1Q81 2;  3G4S Z;  1Q82 2;  1VQO Z;  1VQ9 Z;  1VQ6 Z;  1YI2 1;  3G71 1;  3OW2 Z;  1VQ7 Z;  1NJI 1;  1VQL 1;  1KC8 1;  1YJ9 Z;  1NJI 2;  3CCL 1;  3CPW Y;  1QVG Z;  1VQM Z;  3CCE 1;  3CCS Z;  1YJN 1;  1Q7Y 2;  1KC8 2;  3CMA Z;  1VQN 1;  3CXC Y;  1JJ2 Y;  2QEX 1;  3CCU 1;  2QA4 Z;  3CD6 1;  1M1K 1;  3CCV 1;  3CC4 Z;  1M1K 2;  3CCJ 1;  3CC7 1;  3CCR 1;  1VQ5 Z;  1VQP Z;  3G6E 1;  3CME 1;  3I55 Z;  1VQ5 1;  3CCQ Z;  1YJW 1;  1VQL Z;  1K9M 1;  1W2B Z;  3I56 1;  3CPW Z;  1YJN Z;  1M90 1;  1VQK Z;  1K9M 2;  1S72 Z;  1QVF Y;  1VQN Z;  1YIT 1;  1Q86 1;  1M90 2;  1VQ8 Z;  1KQS Z;  2OTL Z;  1YHQ Z;  1VQ7 1;  1Q86 2;  2QEX Z;  3CCU Z;  3CCM 1;  3CD6 Z;  3CCV Z;  1YJ9 1;  1N8R 1;  3G71 Z;  1VQM 1;  1YI2 Z;  3CCS 1;  3CCJ Z;  1N8R 2;  2OTJ 1;  3CCR Z;  1YIJ 1;  1VQ4 1;  3CC2 1;  1K8A 1;  3CCL Z;  2QA4 1;  1YJW Z;  3CCE Z;  3G4S 1;  1K8A 2;  3I56 Z;  1VQO 1;  1VQ9 1;  1VQ6 1;  3CC4 1;  3OW2 Y;  1YIT Z;  1VQP 1;  1QVF Z; 
#chains in the Genus database with same CATH topology
 2F4O A;  4BBR I;  3CCM Z;  2G2K A;  1KD1 1;  2LEX A;  1W2B Y;  2M6N A;  4CL1 A;  1KD1 2;  5LL6 f;  1VQK 1;  2IV2 X;  3MON A;  1DL6 A;  1VQ8 1;  2OTL 1;  3M3Y I;  5IP9 I;  5D1O B;  4MD9 A;  3G4S Z;  2JUB A;  3RZD I;  2K5R A;  5T6B A;  2KPI A;  3HOX I;  4E33 A;  1NJI 1;  3IX0 A;  2KI7 B;  1KC8 1;  1NJI 2;  2GU2 A;  2J6A A;  1Z01 A;  1VQM Z;  2E2I I;  3FQM A;  1KC8 2;  2BJO A;  4NBC A;  1RQF A;  1RO0 A;  2W04 A;  2QEX 1;  3I4M I;  3GTM S;  4NB8 A;  3J7A 4;  3CD6 1;  3PO3 S;  2JIP A;  2JNY A;  2VPX A;  3NH8 A;  3CCJ 1;  1I50 I;  4BY1 I;  3CC7 1;  3CCR 1;  1VQ5 Z;  1VQP Z;  4E2Z A;  3S1M I;  3GTM I;  1YUK A;  3HOW I;  4AYB A;  4E30 A;  3PO3 I;  1VQL Z;  2OOX B;  1SIW A;  2HU9 A;  3NH4 A;  1RNI A;  4S1T A;  3I56 1;  3PO2 I;  3S2H I;  2Q4Z A;  4BXX I;  1VQN Z;  3JAM b;  5FLX f;  3CQZ I;  1VQ7 1;  3VMG A;  3CCU Z;  3NDJ A;  2QRD B;  1WCM I;  5IT9 f;  2M48 A;  2P3Y A;  1AA6 A;  1YI2 Z;  3CCS 1;  1Y1W I;  3GTP I;  3S1Q I;  2P28 A;  2NVY I;  3S1R I;  1YIJ 1;  2GTH A;  3FQQ A;  5C4J I;  3BG0 B;  3S14 I;  1QXF A;  4NBA A;  2QKD A;  1VQ9 1;  1VQ6 1;  1USP B;  4A3K I;  1Z02 A;  1PFT A;  3IR7 A;  3HOU I;  1VLA A;  1QVF Z;  3CXC Z;  1JJ2 Z;  1KRL A;  3LUS A;  2AYD A;  1QVG Y;  4RVH A;  3CCQ 1;  2NVX I;  2H85 A;  1Q7Y 1;  1TWA I;  1K73 1;  2AKL A;  2F4M A;  1WJ2 A;  1S72 1;  1K73 2;  4HGY A;  1VQ4 Z;  1Q16 A;  2V45 A;  5T64 A;  1Q82 1;  1Q82 2;  1VQO Z;  1RLY A;  4NBE A;  3TDH B;  4BY7 I;  3OW2 Z;  5FLM I;  3IF8 A;  3KIH A;  3GTL I;  3J80 f;  3D6W A;  1YJ9 Z;  3CPW Y;  1LQL A;  1YJN 1;  3J81 f;  3S17 I;  2VUM I;  4MXU A;  3FKI I;  3S15 I;  3T4N B;  3I07 A;  2QA4 Z;  1M1K 1;  3HKZ A;  2JA6 I;  1JWH C;  3CC4 Z;  3RZO I;  1M1K 2;  1S7M A;  2QRE B;  5IP7 I;  5AN9 F;  4RVD A;  4NBG A;  1ZB9 A;  4QTT A;  3F3P C;  3GTK I;  2OZK A;  3NH5 A;  4NBH A;  3I55 Z;  1K9M 1;  4MON A;  4NBF A;  2RIQ A;  3VTN A;  4A3E I;  1M90 1;  1K9M 2;  1X3W A;  4RVF A;  1YIT 1;  2PMZ A;  3P5J B;  1M90 2;  3GCF A;  2Q51 A;  1KQS Z;  2E2J I;  4Y52 I;  1YHQ Z;  1NP6 A;  2I3C A;  2QEX Z;  5T67 A;  3GTQ I;  3D9X A;  3CD6 Z;  1ML8 A;  1NUI A;  1RO4 A;  3G71 Z;  1VQM 1;  3CCJ Z;  2OTJ 1;  3CCR Z;  1Y8C A;  4A3J I;  3CC2 1;  3CCL Z;  3NDI A;  2O53 A;  3CCE Z;  1QF8 A;  4E32 A;  3S16 I;  3I56 Z;  5A2Q f;  1Y1V S;  2VF1 A;  2O4H A;  2JR6 A;  2NVT I;  1VQ5 1;  1VQP 1;  4A3F I;  4BBS I;  2IZ4 A;  2DE6 A;  3MZK B;  2R7Z I;  1Y1V I;  1FDI A;  3CMA 1;  3JAM f;  3G6E Z;  3CME Z;  4A3L I;  3Q87 A;  1YIJ Z;  4NBB A;  2JIO A;  1Q81 1;  3GTJ I;  4RV9 A;  1Q81 2;  3VMH A;  4E2W A;  2VPY A;  1VQ9 Z;  2QLV B;  1VQ6 Z;  1YI2 1;  4A3M I;  1TWF I;  1ZB8 A;  4MH4 A;  2PM9 A;  3NFZ A;  1QVG Z;  1Q7Y 2;  2DE5 A;  3VB9 A;  1FDO A;  2VPW A;  3QWU A;  3CXC Y;  1JJ2 Y;  4E2X A;  1YUA A;  3M4O I;  3CCV 1;  2V8K A;  2JIM A;  4QTU A;  2QR1 B;  4RS4 A;  2JMO A;  3HOZ I;  4NOZ A;  5D1O A;  3I4N I;  1K83 I;  2LFU A;  2JIQ A;  3HOY I;  1TWG I;  4DQY B;  1P9N A;  4EWC A;  1YJW 1;  2R6M A;  1W2B Z;  2VUG A;  3CPW Z;  2RT9 A;  3EED A;  1YJN Z;  1VQK Z;  3TE5 B;  3H0G I;  1WII A;  4A3I I;  2K3R A;  4MD7 A;  1Q86 1;  1VQ8 Z;  2OTL Z;  2JS4 A;  4A3C I;  1Q86 2;  1WZN A;  2OOY B;  3CCM 1;  3ESW A;  3VMI A;  2DE7 A;  2Y0S A;  3KIF A;  1YJ9 1;  4DK1 A;  1N8R 1;  2R93 I;  3H3V J;  2VPZ A;  1N8R 2;  3GTO I;  2W03 A;  4DGL A;  4NH1 C;  2B63 I;  4MD8 A;  2HF1 A;  1K8A 1;  4X6A I;  2E9H A;  2QA4 1;  2IZ3 A;  1L1O C;  4HH4 A;  3G4S 1;  1K8A 2;  2YAD A;  4XX2 A;  3S2D I;  4NB9 A;  3CC4 1;  1ZH1 A;  3K7A I;  2RBL A;  1YIT Z;  1X0T A;  2V3V A;  3I55 1;  3F3F C;  5C3E I;  5CM2 M;  4MRI A;  2WAQ A;  3CC7 Z;  4A3B I;  2OTJ Z;  1TWH I;  3GKQ A;  1KQS Y;  4NFR A;  2RPR A;  1YHQ 1;  3IFU A;  3BG1 B;  3CC2 Z;  2NAP A;  2JA7 I;  1TWC I;  1X3Z A;  3G71 1;  4A3D I;  1VQ7 Z;  2NVQ I;  3D2L A;  5A2Q b;  1USP A;  4HGZ A;  2V8I A;  2JA5 I;  1VQL 1;  2RHB A;  4Y7N I;  3CCL 1;  4RVG A;  5FLX b;  3EER A;  3CCE 1;  3CCS Z;  2JIR A;  3CMA Z;  1N2F A;  5IT9 b;  1VQN 1;  3HOV I;  1SFO I;  3CCU 1;  2EGT A;  1R9T I;  4E31 A;  2WB1 A;  5C44 I;  2ZAE B;  3U50 C;  3G6E 1;  2E7Z A;  2YU9 I;  3CME 1;  2E2H I;  2LIY A;  3CCQ Z;  1TFI A;  2QRC B;  2V8J A;  1I6H I;  1S72 Z;  3GTG I;  1QVF Y;  4A3G I;  5D1P A;  3CCV Z;  3MZL B;  3S1N I;  4NBD A;  2JA8 I;  4A93 I;  1VQ4 1;  2PK7 A;  4TNU A;  1Z03 A;  5C4X I;  1QYP A;  1YJW Z;  2R92 I;  4E2Y A;  1WW9 A;  3J80 b;  1VQO 1;  3OW2 Y;  2GTI A;  3J81 b;  1I3Q I;  1RO2 A; 
#chains in the Genus database with same CATH homology
 2F4O A;  4BBR I;  3CCM Z;  2G2K A;  1KD1 1;  1W2B Y;  2M6N A;  4CL1 A;  1KD1 2;  5LL6 f;  1VQK 1;  3MON A;  1DL6 A;  1VQ8 1;  2OTL 1;  3M3Y I;  5IP9 I;  5D1O B;  4MD9 A;  3G4S Z;  2JUB A;  3RZD I;  2K5R A;  5T6B A;  2KPI A;  3HOX I;  4E33 A;  1NJI 1;  3IX0 A;  2KI7 B;  1KC8 1;  1NJI 2;  2GU2 A;  2J6A A;  1Z01 A;  1VQM Z;  2E2I I;  3FQM A;  1KC8 2;  2BJO A;  4NBC A;  1RQF A;  1RO0 A;  2W04 A;  2QEX 1;  3I4M I;  3GTM S;  4NB8 A;  3J7A 4;  3CD6 1;  3PO3 S;  2JNY A;  3NH8 A;  3CCJ 1;  1I50 I;  4BY1 I;  3CC7 1;  3CCR 1;  1VQ5 Z;  1VQP Z;  4E2Z A;  3S1M I;  3GTM I;  1YUK A;  3HOW I;  4AYB A;  4E30 A;  3PO3 I;  1VQL Z;  2OOX B;  2HU9 A;  3NH4 A;  1RNI A;  4S1T A;  3I56 1;  3PO2 I;  3S2H I;  2Q4Z A;  4BXX I;  1VQN Z;  3JAM b;  5FLX f;  3CQZ I;  1VQ7 1;  3VMG A;  3CCU Z;  3NDJ A;  2QRD B;  1WCM I;  5IT9 f;  2M48 A;  2P3Y A;  1YI2 Z;  3CCS 1;  1Y1W I;  3GTP I;  3S1Q I;  2P28 A;  2NVY I;  3S1R I;  1YIJ 1;  2GTH A;  3FQQ A;  5C4J I;  3BG0 B;  3S14 I;  4NBA A;  2QKD A;  1VQ9 1;  1VQ6 1;  1USP B;  4A3K I;  1Z02 A;  1PFT A;  3HOU I;  1VLA A;  1QVF Z;  3CXC Z;  1JJ2 Z;  1KRL A;  3LUS A;  1QVG Y;  4RVH A;  3CCQ 1;  2NVX I;  2H85 A;  1Q7Y 1;  1TWA I;  1K73 1;  2AKL A;  2F4M A;  1S72 1;  1K73 2;  4HGY A;  1VQ4 Z;  5T64 A;  1Q82 1;  1Q82 2;  1VQO Z;  1RLY A;  4NBE A;  3TDH B;  4BY7 I;  3OW2 Z;  5FLM I;  3IF8 A;  3KIH A;  3GTL I;  3J80 f;  3D6W A;  1YJ9 Z;  3CPW Y;  1LQL A;  1YJN 1;  3J81 f;  3S17 I;  2VUM I;  4MXU A;  3FKI I;  3S15 I;  3T4N B;  3I07 A;  2QA4 Z;  1M1K 1;  3HKZ A;  2JA6 I;  1JWH C;  3CC4 Z;  3RZO I;  1M1K 2;  1S7M A;  2QRE B;  5IP7 I;  5AN9 F;  4RVD A;  4NBG A;  1ZB9 A;  4QTT A;  3F3P C;  3GTK I;  2OZK A;  3NH5 A;  4NBH A;  3I55 Z;  1K9M 1;  4MON A;  4NBF A;  2RIQ A;  3VTN A;  4A3E I;  1M90 1;  1K9M 2;  1X3W A;  4RVF A;  1YIT 1;  2PMZ A;  3P5J B;  1M90 2;  3GCF A;  2Q51 A;  1KQS Z;  2E2J I;  4Y52 I;  1YHQ Z;  1NP6 A;  2I3C A;  2QEX Z;  5T67 A;  3GTQ I;  3D9X A;  3CD6 Z;  1ML8 A;  1NUI A;  1RO4 A;  3G71 Z;  1VQM 1;  3CCJ Z;  2OTJ 1;  3CCR Z;  4A3J I;  3CC2 1;  3CCL Z;  3NDI A;  2O53 A;  3CCE Z;  1QF8 A;  4E32 A;  3S16 I;  3I56 Z;  5A2Q f;  1Y1V S;  2VF1 A;  2O4H A;  2JR6 A;  2NVT I;  1VQ5 1;  1VQP 1;  4A3F I;  4BBS I;  2IZ4 A;  2DE6 A;  3MZK B;  2R7Z I;  1Y1V I;  3CMA 1;  3JAM f;  3G6E Z;  3CME Z;  4A3L I;  3Q87 A;  1YIJ Z;  4NBB A;  1Q81 1;  3GTJ I;  4RV9 A;  1Q81 2;  3VMH A;  4E2W A;  1VQ9 Z;  1VQ6 Z;  2QLV B;  1YI2 1;  4A3M I;  1TWF I;  1ZB8 A;  4MH4 A;  2PM9 A;  3NFZ A;  1QVG Z;  1Q7Y 2;  2DE5 A;  3VB9 A;  3QWU A;  3CXC Y;  1JJ2 Y;  4E2X A;  1YUA A;  3M4O I;  3CCV 1;  2V8K A;  4QTU A;  2QR1 B;  4RS4 A;  2JMO A;  3HOZ I;  4NOZ A;  5D1O A;  3I4N I;  1K83 I;  2LFU A;  3HOY I;  1TWG I;  4DQY B;  1P9N A;  4EWC A;  1YJW 1;  2R6M A;  1W2B Z;  2VUG A;  3CPW Z;  2RT9 A;  3EED A;  1YJN Z;  1VQK Z;  3TE5 B;  3H0G I;  1WII A;  4A3I I;  2K3R A;  4MD7 A;  1Q86 1;  1VQ8 Z;  2OTL Z;  2JS4 A;  4A3C I;  1Q86 2;  2OOY B;  3CCM 1;  3ESW A;  3VMI A;  2DE7 A;  2Y0S A;  3KIF A;  1YJ9 1;  4DK1 A;  1N8R 1;  2R93 I;  3H3V J;  1N8R 2;  3GTO I;  2W03 A;  4DGL A;  4NH1 C;  2B63 I;  4MD8 A;  2HF1 A;  1K8A 1;  4X6A I;  2E9H A;  2QA4 1;  2IZ3 A;  1L1O C;  4HH4 A;  3G4S 1;  1K8A 2;  2YAD A;  4XX2 A;  3S2D I;  4NB9 A;  3CC4 1;  1ZH1 A;  3K7A I;  2RBL A;  1YIT Z;  1X0T A;  3I55 1;  3F3F C;  5C3E I;  5CM2 M;  4MRI A;  2WAQ A;  3CC7 Z;  4A3B I;  2OTJ Z;  1TWH I;  3GKQ A;  1KQS Y;  4NFR A;  2RPR A;  1YHQ 1;  3IFU A;  3BG1 B;  3CC2 Z;  2JA7 I;  1TWC I;  1X3Z A;  3G71 1;  4A3D I;  1VQ7 Z;  2NVQ I;  5A2Q b;  1USP A;  4HGZ A;  2V8I A;  2JA5 I;  1VQL 1;  2RHB A;  4Y7N I;  3CCL 1;  4RVG A;  5FLX b;  3EER A;  3CCE 1;  3CCS Z;  3CMA Z;  1N2F A;  5IT9 b;  1VQN 1;  3HOV I;  1SFO I;  3CCU 1;  2EGT A;  1R9T I;  4E31 A;  2WB1 A;  5C44 I;  2ZAE B;  3U50 C;  3G6E 1;  2YU9 I;  3CME 1;  2E2H I;  2LIY A;  3CCQ Z;  1TFI A;  2QRC B;  2V8J A;  1I6H I;  1S72 Z;  3GTG I;  1QVF Y;  4A3G I;  5D1P A;  3CCV Z;  3MZL B;  3S1N I;  4NBD A;  2JA8 I;  4A93 I;  1VQ4 1;  2PK7 A;  4TNU A;  1Z03 A;  5C4X I;  1QYP A;  1YJW Z;  2R92 I;  4E2Y A;  1WW9 A;  3J80 b;  1VQO 1;  3OW2 Y;  2GTI A;  3J81 b;  1I3Q I;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...