1VQP1

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqp100
1N8R2 1YIT1 1VQ5Z 1VQN1 1VQO1 3CCS1 3CCMZ 1VQ4Z 3CD61 1QVGZ 1VQPZ 3CC21 1YJ91 3G4SZ 3CCE1 3I55Z 1KC81 1Q821 1W2BY 3CCL1 1YJNZ 1KD11 1VQKZ 1YI2Z 3G711 1Q862 1Q7Y2 1VQ9Z 1KQSY 3CC4Z 2QA41 3CXCY 3CCR1 3CPWY 1VQM1 3CCJ1 2QEX1 1YJW1 3CMA1 3OW2Y 1K9M1 3I561 1YITZ 1VQL1 3CCQ1 1VQNZ 1VQOZ 3CCSZ 3G6E1 3CD6Z 1K8A1 1NJI1 1W2BZ 3CC2Z 1YJ9Z 1M1K1 3CME1 3CCEZ 1N8R1 1VQ81 1YIJ1 1KQSZ 3CCLZ 3G71Z 1YHQ1 3CXCZ 1M901 1VQ71 3CPWZ 1S721 2QA4Z 3OW2Z 3CCRZ 1VQMZ 3CCJZ 2QEXZ 1YJWZ 1QVGY 3CMAZ 1Q861 1K732 1Q811 3I56Z 3CCQZ 3CCV1 3CC71 2OTL1 3G6EZ 1VQ61 3CCU1 3CMEZ 2OTJ1 1K8A2 1NJI2 1JJ2Y 1VQ8Z 1YIJZ 1VQ51 1KC82 1M1K2 1Q822 1KD12 3CCM1 1VQ41 1YHQZ 1QVFY 1VQ7Z 1VQP1 3G4S1 1S72Z 1M902 3I551 1YJN1 1Q7Y1 1VQK1 1YI21 1VQLZ 1K9M2 1VQ91 3CC41 3CCVZ 3CC7Z 1Q812 2OTLZ 1JJ2Z 1VQ6Z 1K731 3CCUZ 2OTJZ 1QVFZ
chains in the Genus database with same CATH superfamily
1YIT1 1PFTA 3HOYI 3CCMZ 1RQFA 1TWCI 1R9TI 1QVGZ 1VQPZ 3G4SZ 2JIMA 3KIFA 2VPXA 1YUKA 4AYBA 1YI2Z 1Q7Y2 1SIWA 2Q51A 1VLAA 2ZAEB 1QXFA 2VUMI 5IP7I 5IT9b 1N2FA 1TWHI 1VQL1 2VPZA 2JS4A 3G6E1 1Y1VS 3VMIA 1NJI1 3CC2Z 1YJ9Z 3D6WA 1Z02A 3CCEZ 2JIPA 3FQQA 2JA6I 2QR1B 2GU2A 3J80f 1SFOI 2OZKA 3CXCZ 4NBGA 2VPYA 4A3EI 3CPWZ 4RS4A 3OW2Z 2RT9A 2JA8I 1VQMZ 1K732 2QKDA 5C4JI 3CMAZ 3S1NI 4NOZA 1ZB8A 3I56Z 3CCQZ 2QREB 2JMOA 2EGTA 2OTL1 2IZ4A 2DE6A 1Y1WI 4NH1C 4S1TA 2LEXA 2OTJ1 2RPRA 1NJI2 2K3RA 3S1RI 2P3YA 3J80b 1RNIA 1YJN1 2M6NA 2HU9A 2B63I 4MRIA 4NBCA 4NBDA 3VMGA 1VQ91 3CC41 3VMHA 2AYDA 2WB1A 1JJ2Z 3P5JB 1VQ6Z 4RVGA 5C4XI 2VF1A 4NBEA 3GTPI 4A93I 1N8R2 3HOVI 1VQ5Z 1VQO1 3CCS1 1VQ4Z 1RO4A 3CD61 3GTQI 2QRDB 2E2II 4NB8A 3F3FC 3NDIA 3CCL1 1VQKZ 3JAMf 4MONA 4DQYB 1Z03A 3S2DI 4EWCA 2W03A 1Q862 4RVHA 2R93I 1Q16A 2F4MA 3TE5B 3CXCY 3CPWY 1X0TA 2LFUA 1I3QI 1FDIA 1Z01A 2QEX1 3OW2Y 2O53A 3NH5A 3H3VJ 3GTMS 2V8JA 1VQNZ 4CL1A 2NVXI 3KIHA 3IF8A 3RZDI 4HH4A 3IFUA 1K8A1 1W2BZ 3RZOI 1VQ81 1YIJ1 5C3EI 1KQSZ 1WCMI 2RBLA 3G71Z 3D9XA 1VQ71 4QTTA 3JAMb 4E31A 2QA4Z 2R7ZI 3CCRZ 3CCJZ 4E32A 1KRLA 1YJWZ 5D1PA 1JWHC 3VB9A 3BG1B 3CCV1 3MONA 3CC71 5FLMI 1NP6A 1AA6A 4RVDA 3IX0A 3HOUI 3M4OI 3CCU1 2V8IA 3HOWI 3CMEZ 1K8A2 4NFRA 1JJ2Y 3NFZA 3CCM1 1YHQZ 3PO2I 1QYPA 2JR6A 1X3WA 1VQP1 4NBAA 2NVQI 3HOZI 3G4S1 1S72Z 3S1MI 3ESWA 2RIQA 4A3MI 1YI21 3U50C 3S1QI 2NAPA 1TWAI 4BY7I 2Y0SA 2DE5A 1LQLA 1FDOA 5T67A 1DL6A 5LL6f 3QWUA 5FLXf 2JIOA 4MH4A 1QVFZ 3Q87A 2KPIA 4RV9A 2NVYI 4A3FI 2JNYA 3CC21 1YJ91 2VPWA 3GTOI 3CCE1 2Q4ZA 3I55Z 1YUAA 1KC81 1Q821 1W2BY 1KD11 3GTKI 4A3DI 1RO0A 4HGZA 3EERA 3GTJI 1KQSY 4QTUA 3IR7A 4MXUA 2J6AA 1VQM1 2R6MA 4DGLA 1WJ2A 3CMA1 1K9M1 1I50I 3VTNA 3I561 1YITZ 2HF1A 5FLXb 3CCQ1 2OOYB 3NH8A 4A3GI 2LIYA 2WAQA 2VUGA 3GTLI 1TWFI 2JIRA 3H0GI 4A3CI 1RO2A 3I4MI 3S2HI 4TNUA 1Q811 4E33A 3S15I 3G6EZ 1VQ61 2BJOA 1ZH1A 3T4NB 3GTGI 5CM2M 2F4OA 2YU9I 1VQ51 4MD7A 3HOXI 4HGYA 3LUSA 1VQ41 1QVFY 2W04A 4A3LI 2RHBA 4NBHA 3J81f 1WIIA 1VQK1 5T6BA 2V45A 4A3KI 4BBSI 5D1OB 4Y7NI 2KI7B 4E2WA 1Q812 4NBBA 2AKLA 2OTLZ 1L1OC 3J7A4 4A3BI 1K731 2G2KA 2OTJZ 3PO3I 3NDJA 1USPB 4MD8A 1VQN1 3K7AI 1Y1VI 3PO3S 2JA5I 2JUBA 1WZNA 1X3ZA 4E2YA 1YJNZ 2IV2X 1ML8A 1NUIA 3G711 2E2JI 3J81b 1VQ9Z 2I3CA 2E9HA 5D1OA 4E30A 3CC4Z 3CQZI 3MZLB 2QA41 3CCR1 2JA7I 1TWGI 5AN9F 3CCJ1 4E2XA 1YJW1 1K83I 4NBFA 3M3YI 3HKZA 3S17I 2PMZA 1USPA 1VQOZ 4X6AI 3S16I 3CCSZ 4A3JI 3CD6Z 3FKII 2K5RA 2P28A 3FQMA 2E2HI 1S7MA 3CME1 1M1K1 2GTHA 1N8R1 1Y8CA 3GCFA 2PK7A 3CCLZ 5A2Qf 1YHQ1 1M901 3MZKB 4MD9A 2OOXB 3D2LA 4DK1A 1S721 3NH4A 3S14I 3F3PC 1ZB9A 2QEXZ 2QRCB 1QVGY 1Q861 1P9NA 4A3II 3I4NI 2R92I 4XX2A 2PM9A 2NVTI 5T64A 1VQ8Z 4Y52I 1YIJZ 2M48A 1I6HI 1KC82 2JIQA 1Q822 1KD12 1M1K2 2E7ZA 2IZ3A 4RVFA 1VQ7Z 2V8KA 5IP9I 5A2Qb 1RLYA 1M902 4BXXI 3GKQA 4BBRI 3I551 3BG0B 1Q7Y1 2V3VA 2O4HA 2QLVB 1VQLZ 1QF8A 2DE7A 1K9M2 1TFIA 2H85A 2YADA 1WW9A 3CCVZ 4E2ZA 3CC7Z 5IT9f 2GTIA 3TDHB 4NB9A 5C44I 3CCUZ 4BY1I 3GTMI 3EEDA 3I07A
chains in the Genus database with same CATH topology
1YIT1 1PFTA 3HOYI 3CCMZ 1RQFA 1TWCI 1R9TI 1QVGZ 1VQPZ 3G4SZ 3KIFA 1YUKA 4AYBA 1YI2Z 1Q7Y2 2Q51A 1VLAA 2ZAEB 2VUMI 5IP7I 5IT9b 1N2FA 1TWHI 1VQL1 2JS4A 3G6E1 1Y1VS 3VMIA 1NJI1 3CC2Z 1YJ9Z 3D6WA 1Z02A 3CCEZ 3FQQA 2JA6I 2QR1B 2GU2A 3J80f 1SFOI 2OZKA 3CXCZ 4NBGA 4A3EI 3CPWZ 4RS4A 3OW2Z 2RT9A 2JA8I 1VQMZ 1K732 2QKDA 5C4JI 3CMAZ 3S1NI 4NOZA 1ZB8A 3I56Z 3CCQZ 2QREB 2JMOA 2EGTA 2OTL1 2IZ4A 2DE6A 1Y1WI 4NH1C 4S1TA 2OTJ1 2RPRA 1NJI2 2K3RA 3S1RI 2P3YA 3J80b 1RNIA 1YJN1 2M6NA 2HU9A 2B63I 4MRIA 4NBCA 4NBDA 3VMGA 1VQ91 3CC41 3VMHA 2WB1A 1JJ2Z 3P5JB 1VQ6Z 4RVGA 5C4XI 2VF1A 4NBEA 3GTPI 4A93I 1N8R2 3HOVI 1VQ5Z 1VQO1 3CCS1 1VQ4Z 1RO4A 3CD61 3GTQI 2QRDB 2E2II 4NB8A 3F3FC 3NDIA 3CCL1 1VQKZ 3JAMf 4MONA 4DQYB 1Z03A 3S2DI 4EWCA 2W03A 1Q862 4RVHA 2R93I 2F4MA 3TE5B 3CXCY 3CPWY 1X0TA 2LFUA 1I3QI 1Z01A 2QEX1 3OW2Y 2O53A 3NH5A 3H3VJ 3GTMS 2V8JA 1VQNZ 4CL1A 2NVXI 3KIHA 3IF8A 3RZDI 4HH4A 3IFUA 1K8A1 1W2BZ 3RZOI 1VQ81 1YIJ1 5C3EI 1KQSZ 1WCMI 2RBLA 3G71Z 3D9XA 1VQ71 4QTTA 3JAMb 4E31A 2QA4Z 2R7ZI 3CCRZ 3CCJZ 4E32A 1KRLA 1YJWZ 5D1PA 1JWHC 3VB9A 3BG1B 3CCV1 3MONA 3CC71 5FLMI 1NP6A 4RVDA 3IX0A 3HOUI 3M4OI 3CCU1 2V8IA 3HOWI 3CMEZ 1K8A2 4NFRA 1JJ2Y 3NFZA 3CCM1 1YHQZ 3PO2I 1QYPA 2JR6A 1X3WA 1VQP1 4NBAA 2NVQI 3HOZI 3G4S1 1S72Z 3S1MI 3ESWA 2RIQA 4A3MI 1YI21 3U50C 3S1QI 1TWAI 4BY7I 2Y0SA 2DE5A 1LQLA 5T67A 1DL6A 5LL6f 3QWUA 5FLXf 4MH4A 1QVFZ 3Q87A 2KPIA 4RV9A 2NVYI 4A3FI 2JNYA 3CC21 1YJ91 3GTOI 3CCE1 2Q4ZA 3I55Z 1YUAA 1KC81 1Q821 1W2BY 1KD11 3GTKI 4A3DI 1RO0A 4HGZA 3EERA 3GTJI 1KQSY 4QTUA 4MXUA 2J6AA 1VQM1 2R6MA 4DGLA 3CMA1 1K9M1 1I50I 3VTNA 3I561 1YITZ 2HF1A 5FLXb 3CCQ1 2OOYB 3NH8A 4A3GI 2LIYA 2WAQA 2VUGA 3GTLI 1TWFI 3H0GI 4A3CI 1RO2A 3I4MI 3S2HI 4TNUA 1Q811 4E33A 3S15I 3G6EZ 1VQ61 2BJOA 1ZH1A 3T4NB 3GTGI 5CM2M 2F4OA 2YU9I 1VQ51 4MD7A 3HOXI 4HGYA 3LUSA 1VQ41 1QVFY 2W04A 4A3LI 2RHBA 4NBHA 3J81f 1WIIA 1VQK1 5T6BA 4A3KI 4BBSI 5D1OB 4Y7NI 2KI7B 4E2WA 1Q812 4NBBA 2AKLA 2OTLZ 1L1OC 3J7A4 4A3BI 1K731 2G2KA 2OTJZ 3PO3I 3NDJA 1USPB 4MD8A 1VQN1 3K7AI 1Y1VI 3PO3S 2JA5I 2JUBA 1X3ZA 4E2YA 1YJNZ 1ML8A 1NUIA 3G711 2E2JI 3J81b 1VQ9Z 2I3CA 2E9HA 5D1OA 4E30A 3CC4Z 3CQZI 3MZLB 2QA41 3CCR1 2JA7I 1TWGI 5AN9F 3CCJ1 4E2XA 1YJW1 1K83I 4NBFA 3M3YI 3HKZA 3S17I 2PMZA 1USPA 1VQOZ 4X6AI 3S16I 3CCSZ 4A3JI 3CD6Z 3FKII 2K5RA 2P28A 3FQMA 2E2HI 1S7MA 3CME1 1M1K1 2GTHA 1N8R1 3GCFA 2PK7A 3CCLZ 5A2Qf 1YHQ1 1M901 3MZKB 4MD9A 2OOXB 4DK1A 1S721 3NH4A 3S14I 3F3PC 1ZB9A 2QEXZ 2QRCB 1QVGY 1Q861 1P9NA 4A3II 3I4NI 2R92I 4XX2A 2PM9A 2NVTI 5T64A 1VQ8Z 4Y52I 1YIJZ 2M48A 1I6HI 1KC82 1M1K2 1Q822 1KD12 2IZ3A 4RVFA 1VQ7Z 2V8KA 5IP9I 5A2Qb 1RLYA 1M902 4BXXI 3GKQA 4BBRI 3I551 3BG0B 1Q7Y1 2O4HA 2QLVB 1VQLZ 1QF8A 2DE7A 1K9M2 1TFIA 2H85A 2YADA 1WW9A 3CCVZ 4E2ZA 3CC7Z 5IT9f 2GTIA 3TDHB 4NB9A 5C44I 3CCUZ 4BY1I 3GTMI 3EEDA 3I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  1YIT 1;  1VQ5 Z;  1VQN 1;  1VQO 1;  3CCS 1;  3CCM Z;  1VQ4 Z;  3CD6 1;  1QVG Z;  1VQP Z;  3CC2 1;  1YJ9 1;  3G4S Z;  3CCE 1;  3I55 Z;  1KC8 1;  1Q82 1;  1W2B Y;  3CCL 1;  1YJN Z;  1KD1 1;  1VQK Z;  1YI2 Z;  3G71 1;  1Q86 2;  1Q7Y 2;  1VQ9 Z;  1KQS Y;  3CC4 Z;  2QA4 1;  3CXC Y;  3CCR 1;  3CPW Y;  1VQM 1;  3CCJ 1;  2QEX 1;  1YJW 1;  3CMA 1;  3OW2 Y;  1K9M 1;  3I56 1;  1YIT Z;  1VQL 1;  3CCQ 1;  1VQN Z;  1VQO Z;  3CCS Z;  3G6E 1;  3CD6 Z;  1K8A 1;  1NJI 1;  1W2B Z;  3CC2 Z;  1YJ9 Z;  1M1K 1;  3CME 1;  3CCE Z;  1N8R 1;  1VQ8 1;  1YIJ 1;  1KQS Z;  3CCL Z;  3G71 Z;  1YHQ 1;  3CXC Z;  1M90 1;  1VQ7 1;  3CPW Z;  1S72 1;  2QA4 Z;  3OW2 Z;  3CCR Z;  1VQM Z;  3CCJ Z;  2QEX Z;  1YJW Z;  1QVG Y;  3CMA Z;  1Q86 1;  1K73 2;  1Q81 1;  3I56 Z;  3CCQ Z;  3CCV 1;  3CC7 1;  2OTL 1;  3G6E Z;  1VQ6 1;  3CCU 1;  3CME Z;  2OTJ 1;  1K8A 2;  1NJI 2;  1JJ2 Y;  1VQ8 Z;  1YIJ Z;  1VQ5 1;  1KC8 2;  1M1K 2;  1Q82 2;  1KD1 2;  3CCM 1;  1VQ4 1;  1YHQ Z;  1QVF Y;  1VQ7 Z;  1VQP 1;  3G4S 1;  1S72 Z;  1M90 2;  3I55 1;  1YJN 1;  1Q7Y 1;  1VQK 1;  1YI2 1;  1VQL Z;  1K9M 2;  1VQ9 1;  3CC4 1;  3CCV Z;  3CC7 Z;  1Q81 2;  2OTL Z;  1JJ2 Z;  1VQ6 Z;  1K73 1;  3CCU Z;  2OTJ Z;  1QVF Z; 
#chains in the Genus database with same CATH topology
 1YIT 1;  1PFT A;  3HOY I;  3CCM Z;  1RQF A;  1TWC I;  1R9T I;  1QVG Z;  1VQP Z;  3G4S Z;  2JIM A;  3KIF A;  2VPX A;  1YUK A;  4AYB A;  1YI2 Z;  1Q7Y 2;  1SIW A;  2Q51 A;  1VLA A;  2ZAE B;  1QXF A;  2VUM I;  5IP7 I;  5IT9 b;  1N2F A;  1TWH I;  1VQL 1;  2VPZ A;  2JS4 A;  3G6E 1;  1Y1V S;  3VMI A;  1NJI 1;  3CC2 Z;  1YJ9 Z;  3D6W A;  1Z02 A;  3CCE Z;  2JIP A;  3FQQ A;  2JA6 I;  2QR1 B;  2GU2 A;  3J80 f;  1SFO I;  2OZK A;  3CXC Z;  4NBG A;  2VPY A;  4A3E I;  3CPW Z;  4RS4 A;  3OW2 Z;  2RT9 A;  2JA8 I;  1VQM Z;  1K73 2;  2QKD A;  5C4J I;  3CMA Z;  3S1N I;  4NOZ A;  1ZB8 A;  3I56 Z;  3CCQ Z;  2QRE B;  2JMO A;  2EGT A;  2OTL 1;  2IZ4 A;  2DE6 A;  1Y1W I;  4NH1 C;  4S1T A;  2LEX A;  2OTJ 1;  2RPR A;  1NJI 2;  2K3R A;  3S1R I;  2P3Y A;  3J80 b;  1RNI A;  1YJN 1;  2M6N A;  2HU9 A;  2B63 I;  4MRI A;  4NBC A;  4NBD A;  3VMG A;  1VQ9 1;  3CC4 1;  3VMH A;  2AYD A;  2WB1 A;  1JJ2 Z;  3P5J B;  1VQ6 Z;  4RVG A;  5C4X I;  2VF1 A;  4NBE A;  3GTP I;  4A93 I;  1N8R 2;  3HOV I;  1VQ5 Z;  1VQO 1;  3CCS 1;  1VQ4 Z;  1RO4 A;  3CD6 1;  3GTQ I;  2QRD B;  2E2I I;  4NB8 A;  3F3F C;  3NDI A;  3CCL 1;  1VQK Z;  3JAM f;  4MON A;  4DQY B;  1Z03 A;  3S2D I;  4EWC A;  2W03 A;  1Q86 2;  4RVH A;  2R93 I;  1Q16 A;  2F4M A;  3TE5 B;  3CXC Y;  3CPW Y;  1X0T A;  2LFU A;  1I3Q I;  1FDI A;  1Z01 A;  2QEX 1;  3OW2 Y;  2O53 A;  3NH5 A;  3H3V J;  3GTM S;  2V8J A;  1VQN Z;  4CL1 A;  2NVX I;  3KIH A;  3IF8 A;  3RZD I;  4HH4 A;  3IFU A;  1K8A 1;  1W2B Z;  3RZO I;  1VQ8 1;  1YIJ 1;  5C3E I;  1KQS Z;  1WCM I;  2RBL A;  3G71 Z;  3D9X A;  1VQ7 1;  4QTT A;  3JAM b;  4E31 A;  2QA4 Z;  2R7Z I;  3CCR Z;  3CCJ Z;  4E32 A;  1KRL A;  1YJW Z;  5D1P A;  1JWH C;  3VB9 A;  3BG1 B;  3CCV 1;  3MON A;  3CC7 1;  5FLM I;  1NP6 A;  1AA6 A;  4RVD A;  3IX0 A;  3HOU I;  3M4O I;  3CCU 1;  2V8I A;  3HOW I;  3CME Z;  1K8A 2;  4NFR A;  1JJ2 Y;  3NFZ A;  3CCM 1;  1YHQ Z;  3PO2 I;  1QYP A;  2JR6 A;  1X3W A;  1VQP 1;  4NBA A;  2NVQ I;  3HOZ I;  3G4S 1;  1S72 Z;  3S1M I;  3ESW A;  2RIQ A;  4A3M I;  1YI2 1;  3U50 C;  3S1Q I;  2NAP A;  1TWA I;  4BY7 I;  2Y0S A;  2DE5 A;  1LQL A;  1FDO A;  5T67 A;  1DL6 A;  5LL6 f;  3QWU A;  5FLX f;  2JIO A;  4MH4 A;  1QVF Z;  3Q87 A;  2KPI A;  4RV9 A;  2NVY I;  4A3F I;  2JNY A;  3CC2 1;  1YJ9 1;  2VPW A;  3GTO I;  3CCE 1;  2Q4Z A;  3I55 Z;  1YUA A;  1KC8 1;  1Q82 1;  1W2B Y;  1KD1 1;  3GTK I;  4A3D I;  1RO0 A;  4HGZ A;  3EER A;  3GTJ I;  1KQS Y;  4QTU A;  3IR7 A;  4MXU A;  2J6A A;  1VQM 1;  2R6M A;  4DGL A;  1WJ2 A;  3CMA 1;  1K9M 1;  1I50 I;  3VTN A;  3I56 1;  1YIT Z;  2HF1 A;  5FLX b;  3CCQ 1;  2OOY B;  3NH8 A;  4A3G I;  2LIY A;  2WAQ A;  2VUG A;  3GTL I;  1TWF I;  2JIR A;  3H0G I;  4A3C I;  1RO2 A;  3I4M I;  3S2H I;  4TNU A;  1Q81 1;  4E33 A;  3S15 I;  3G6E Z;  1VQ6 1;  2BJO A;  1ZH1 A;  3T4N B;  3GTG I;  5CM2 M;  2F4O A;  2YU9 I;  1VQ5 1;  4MD7 A;  3HOX I;  4HGY A;  3LUS A;  1VQ4 1;  1QVF Y;  2W04 A;  4A3L I;  2RHB A;  4NBH A;  3J81 f;  1WII A;  1VQK 1;  5T6B A;  2V45 A;  4A3K I;  4BBS I;  5D1O B;  4Y7N I;  2KI7 B;  4E2W A;  1Q81 2;  4NBB A;  2AKL A;  2OTL Z;  1L1O C;  3J7A 4;  4A3B I;  1K73 1;  2G2K A;  2OTJ Z;  3PO3 I;  3NDJ A;  1USP B;  4MD8 A;  1VQN 1;  3K7A I;  1Y1V I;  3PO3 S;  2JA5 I;  2JUB A;  1WZN A;  1X3Z A;  4E2Y A;  1YJN Z;  2IV2 X;  1ML8 A;  1NUI A;  3G71 1;  2E2J I;  3J81 b;  1VQ9 Z;  2I3C A;  2E9H A;  5D1O A;  4E30 A;  3CC4 Z;  3CQZ I;  3MZL B;  2QA4 1;  3CCR 1;  2JA7 I;  1TWG I;  5AN9 F;  3CCJ 1;  4E2X A;  1YJW 1;  1K83 I;  4NBF A;  3M3Y I;  3HKZ A;  3S17 I;  2PMZ A;  1USP A;  1VQO Z;  4X6A I;  3S16 I;  3CCS Z;  4A3J I;  3CD6 Z;  3FKI I;  2K5R A;  2P28 A;  3FQM A;  2E2H I;  1S7M A;  3CME 1;  1M1K 1;  2GTH A;  1N8R 1;  1Y8C A;  3GCF A;  2PK7 A;  3CCL Z;  5A2Q f;  1YHQ 1;  1M90 1;  3MZK B;  4MD9 A;  2OOX B;  3D2L A;  4DK1 A;  1S72 1;  3NH4 A;  3S14 I;  3F3P C;  1ZB9 A;  2QEX Z;  2QRC B;  1QVG Y;  1Q86 1;  1P9N A;  4A3I I;  3I4N I;  2R92 I;  4XX2 A;  2PM9 A;  2NVT I;  5T64 A;  1VQ8 Z;  4Y52 I;  1YIJ Z;  2M48 A;  1I6H I;  1KC8 2;  2JIQ A;  1Q82 2;  1KD1 2;  1M1K 2;  2E7Z A;  2IZ3 A;  4RVF A;  1VQ7 Z;  2V8K A;  5IP9 I;  5A2Q b;  1RLY A;  1M90 2;  4BXX I;  3GKQ A;  4BBR I;  3I55 1;  3BG0 B;  1Q7Y 1;  2V3V A;  2O4H A;  2QLV B;  1VQL Z;  1QF8 A;  2DE7 A;  1K9M 2;  1TFI A;  2H85 A;  2YAD A;  1WW9 A;  3CCV Z;  4E2Z A;  3CC7 Z;  5IT9 f;  2GTI A;  3TDH B;  4NB9 A;  5C44 I;  3CCU Z;  4BY1 I;  3GTM I;  3EED A;  3I07 A; 
#chains in the Genus database with same CATH homology
 1YIT 1;  1PFT A;  3HOY I;  3CCM Z;  1RQF A;  1TWC I;  1R9T I;  1QVG Z;  1VQP Z;  3G4S Z;  3KIF A;  1YUK A;  4AYB A;  1YI2 Z;  1Q7Y 2;  2Q51 A;  1VLA A;  2ZAE B;  2VUM I;  5IP7 I;  5IT9 b;  1N2F A;  1TWH I;  1VQL 1;  2JS4 A;  3G6E 1;  1Y1V S;  3VMI A;  1NJI 1;  3CC2 Z;  1YJ9 Z;  3D6W A;  1Z02 A;  3CCE Z;  3FQQ A;  2JA6 I;  2QR1 B;  2GU2 A;  3J80 f;  1SFO I;  2OZK A;  3CXC Z;  4NBG A;  4A3E I;  3CPW Z;  4RS4 A;  3OW2 Z;  2RT9 A;  2JA8 I;  1VQM Z;  1K73 2;  2QKD A;  5C4J I;  3CMA Z;  3S1N I;  4NOZ A;  1ZB8 A;  3I56 Z;  3CCQ Z;  2QRE B;  2JMO A;  2EGT A;  2OTL 1;  2IZ4 A;  2DE6 A;  1Y1W I;  4NH1 C;  4S1T A;  2OTJ 1;  2RPR A;  1NJI 2;  2K3R A;  3S1R I;  2P3Y A;  3J80 b;  1RNI A;  1YJN 1;  2M6N A;  2HU9 A;  2B63 I;  4MRI A;  4NBC A;  4NBD A;  3VMG A;  1VQ9 1;  3CC4 1;  3VMH A;  2WB1 A;  1JJ2 Z;  3P5J B;  1VQ6 Z;  4RVG A;  5C4X I;  2VF1 A;  4NBE A;  3GTP I;  4A93 I;  1N8R 2;  3HOV I;  1VQ5 Z;  1VQO 1;  3CCS 1;  1VQ4 Z;  1RO4 A;  3CD6 1;  3GTQ I;  2QRD B;  2E2I I;  4NB8 A;  3F3F C;  3NDI A;  3CCL 1;  1VQK Z;  3JAM f;  4MON A;  4DQY B;  1Z03 A;  3S2D I;  4EWC A;  2W03 A;  1Q86 2;  4RVH A;  2R93 I;  2F4M A;  3TE5 B;  3CXC Y;  3CPW Y;  1X0T A;  2LFU A;  1I3Q I;  1Z01 A;  2QEX 1;  3OW2 Y;  2O53 A;  3NH5 A;  3H3V J;  3GTM S;  2V8J A;  1VQN Z;  4CL1 A;  2NVX I;  3KIH A;  3IF8 A;  3RZD I;  4HH4 A;  3IFU A;  1K8A 1;  1W2B Z;  3RZO I;  1VQ8 1;  1YIJ 1;  5C3E I;  1KQS Z;  1WCM I;  2RBL A;  3G71 Z;  3D9X A;  1VQ7 1;  4QTT A;  3JAM b;  4E31 A;  2QA4 Z;  2R7Z I;  3CCR Z;  3CCJ Z;  4E32 A;  1KRL A;  1YJW Z;  5D1P A;  1JWH C;  3VB9 A;  3BG1 B;  3CCV 1;  3MON A;  3CC7 1;  5FLM I;  1NP6 A;  4RVD A;  3IX0 A;  3HOU I;  3M4O I;  3CCU 1;  2V8I A;  3HOW I;  3CME Z;  1K8A 2;  4NFR A;  1JJ2 Y;  3NFZ A;  3CCM 1;  1YHQ Z;  3PO2 I;  1QYP A;  2JR6 A;  1X3W A;  1VQP 1;  4NBA A;  2NVQ I;  3HOZ I;  3G4S 1;  1S72 Z;  3S1M I;  3ESW A;  2RIQ A;  4A3M I;  1YI2 1;  3U50 C;  3S1Q I;  1TWA I;  4BY7 I;  2Y0S A;  2DE5 A;  1LQL A;  5T67 A;  1DL6 A;  5LL6 f;  3QWU A;  5FLX f;  4MH4 A;  1QVF Z;  3Q87 A;  2KPI A;  4RV9 A;  2NVY I;  4A3F I;  2JNY A;  3CC2 1;  1YJ9 1;  3GTO I;  3CCE 1;  2Q4Z A;  3I55 Z;  1YUA A;  1KC8 1;  1Q82 1;  1W2B Y;  1KD1 1;  3GTK I;  4A3D I;  1RO0 A;  4HGZ A;  3EER A;  3GTJ I;  1KQS Y;  4QTU A;  4MXU A;  2J6A A;  1VQM 1;  2R6M A;  4DGL A;  3CMA 1;  1K9M 1;  1I50 I;  3VTN A;  3I56 1;  1YIT Z;  2HF1 A;  5FLX b;  3CCQ 1;  2OOY B;  3NH8 A;  4A3G I;  2LIY A;  2WAQ A;  2VUG A;  3GTL I;  1TWF I;  3H0G I;  4A3C I;  1RO2 A;  3I4M I;  3S2H I;  4TNU A;  1Q81 1;  4E33 A;  3S15 I;  3G6E Z;  1VQ6 1;  2BJO A;  1ZH1 A;  3T4N B;  3GTG I;  5CM2 M;  2F4O A;  2YU9 I;  1VQ5 1;  4MD7 A;  3HOX I;  4HGY A;  3LUS A;  1VQ4 1;  1QVF Y;  2W04 A;  4A3L I;  2RHB A;  4NBH A;  3J81 f;  1WII A;  1VQK 1;  5T6B A;  4A3K I;  4BBS I;  5D1O B;  4Y7N I;  2KI7 B;  4E2W A;  1Q81 2;  4NBB A;  2AKL A;  2OTL Z;  1L1O C;  3J7A 4;  4A3B I;  1K73 1;  2G2K A;  2OTJ Z;  3PO3 I;  3NDJ A;  1USP B;  4MD8 A;  1VQN 1;  3K7A I;  1Y1V I;  3PO3 S;  2JA5 I;  2JUB A;  1X3Z A;  4E2Y A;  1YJN Z;  1ML8 A;  1NUI A;  3G71 1;  2E2J I;  3J81 b;  1VQ9 Z;  2I3C A;  2E9H A;  5D1O A;  4E30 A;  3CC4 Z;  3CQZ I;  3MZL B;  2QA4 1;  3CCR 1;  2JA7 I;  1TWG I;  5AN9 F;  3CCJ 1;  4E2X A;  1YJW 1;  1K83 I;  4NBF A;  3M3Y I;  3HKZ A;  3S17 I;  2PMZ A;  1USP A;  1VQO Z;  4X6A I;  3S16 I;  3CCS Z;  4A3J I;  3CD6 Z;  3FKI I;  2K5R A;  2P28 A;  3FQM A;  2E2H I;  1S7M A;  3CME 1;  1M1K 1;  2GTH A;  1N8R 1;  3GCF A;  2PK7 A;  3CCL Z;  5A2Q f;  1YHQ 1;  1M90 1;  3MZK B;  4MD9 A;  2OOX B;  4DK1 A;  1S72 1;  3NH4 A;  3S14 I;  3F3P C;  1ZB9 A;  2QEX Z;  2QRC B;  1QVG Y;  1Q86 1;  1P9N A;  4A3I I;  3I4N I;  2R92 I;  4XX2 A;  2PM9 A;  2NVT I;  5T64 A;  1VQ8 Z;  4Y52 I;  1YIJ Z;  2M48 A;  1I6H I;  1KC8 2;  1M1K 2;  1Q82 2;  1KD1 2;  2IZ3 A;  4RVF A;  1VQ7 Z;  2V8K A;  5IP9 I;  5A2Q b;  1RLY A;  1M90 2;  4BXX I;  3GKQ A;  4BBR I;  3I55 1;  3BG0 B;  1Q7Y 1;  2O4H A;  2QLV B;  1VQL Z;  1QF8 A;  2DE7 A;  1K9M 2;  1TFI A;  2H85 A;  2YAD A;  1WW9 A;  3CCV Z;  4E2Z A;  3CC7 Z;  5IT9 f;  2GTI A;  3TDH B;  4NB9 A;  5C44 I;  3CCU Z;  4BY1 I;  3GTM I;  3EED A;  3I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...