1VQP1

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqp100
1JJ2Z 1KQSY 2QEXZ 2QEX1 1Q822 1M1K2 3CPWY 1KD12 1K732 1K8A1 3OW2Y 3G6EZ 3G6E1 1M1K1 1KQSZ 1KD11 1M902 1YIJ1 1YIJZ 3I551 3I55Z 1VQN1 1VQNZ 1S72Z 1S721 3OW2Z 1VQ41 1M901 1VQP1 1VQPZ 3CCJZ 3CCJ1 1YJN1 1YJNZ 3CCMZ 3CCM1 1YHQZ 3CCQZ 3CCQ1 2OTJ1 1YITZ 1K9M2 3I561 3I56Z 3CCL1 3CCLZ 1KC82 3CC2Z 3CC21 3CME1 3CMEZ 3CD6Z 3CD61 1VQKZ 1Q821 1VQK1 1VQ71 3G4S1 3G4SZ 1K731 3CCS1 1QVGZ 1VQ4Z 1VQ91 1VQ9Z 2OTJZ 3CC41 3CC4Z 1VQ51 1VQ5Z 1N8R2 1YJW1 1K9M1 2QA4Z 2QA41 1QVGY 1Q862 1KC81 3CCUZ 1VQ7Z 3CXCY 1Q861 3CC7Z 3CCSZ 3CC71 1NJI1 3CXCZ 1VQ6Z 1VQ61 1YI21 1YI2Z 1K8A2 1Q812 1QVFY 1YJ91 1YJ9Z 1W2BZ 1VQOZ 1VQO1 1YJWZ 1Q811 1VQL1 2OTLZ 1Q7Y2 2OTL1 1N8R1 1QVFZ 3CPWZ 1Q7Y1 1YHQ1 3G71Z 3G711 1VQM1 1VQMZ 3CCV1 3CCVZ 3CCEZ 1JJ2Y 1NJI2 3CMAZ 3CMA1 1YIT1 1W2BY 1VQ8Z 1VQ81 3CCE1 3CCR1 1VQLZ 3CCU1 3CCRZ
chains in the Genus database with same CATH superfamily
1JJ2Z 2RT9A 2QEX1 1Q822 3J81b 5C4XI 2G2KA 2YU9I 1WIIA 1M1K1 4E2WA 4A3GI 1RO4A 1M902 1YIJZ 3F3PC 2JIOA 1NP6A 1VQNZ 1TWGI 3OW2Z 2V8JA 4NB9A 1YJNZ 3GTOI 2GU2A 4NBAA 1FDIA 2OTJ1 2P28A 3I561 4E32A 2WB1A 4TNUA 1S7MA 1Q821 2GTIA 2VPWA 1WZNA 3GKQA 4MD7A 3J80b 1DL6A 5A2Qb 4MONA 3CCS1 2VPZA 4NBHA 2K3RA 4E30A 3BG1B 4BY1I 2QRDB 4A3DI 3CQZI 4NOZA 4DGLA 3S15I 3H3VJ 1VQ91 2PMZA 3KIFA 5IT9b 3HOUI 4NBBA 1ZB8A 3GCFA 4RVGA 3J81f 3PO3I 3NDJA 4HH4A 4RVHA 4DQYB 1I3QI 2E2JI 3ESWA 2JNYA 3HOWI 3HOVI 1VQ7Z 3I4NI 2JIPA 4BXXI 3CC71 3IX0A 2E7ZA 3CXCZ 2JIMA 3FQQA 1KRLA 1VQ61 2VPYA 3GTQI 3IFUA 1YI2Z 2HU9A 1K8A2 2R6MA 4E33A 2Q51A 1Q812 1QVFY 2WAQA 1VQO1 3NH8A 2OTL1 1Q7Y2 5T6BA 4NBEA 3CPWZ 1SFOI 3J80f 3P5JB 1VQMZ 2JA5I 1JJ2Y 1YUKA 4QTTA 3HKZA 1VQ8Z 4NB8A 4NBDA 3CCRZ 3GTJI 5IT9f 5D1OA 1P9NA 2QEXZ 3JAMb 1M1K2 2OZKA 2V45A 4A3BI 1I50I 3S1MI 1K8A1 3OW2Y 3G6E1 4A3FI 1TWHI 2R7ZI 2DE5A 2VUGA 1KD11 4RVDA 1TWFI 4QTUA 3HOYI 2H85A 3S17I 1S721 1VQ41 3F3FC 3CCJ1 4BBSI 3NFZA 3VB9A 1YUAA 3D2LA 2IV2X 2O53A 4A3CI 1Y8CA 4MRIA 1K9M2 1L1OC 2RHBA 3I56Z 2JIQA 3CCL1 5AN9F 1KC82 3M4OI 2E2HI 3CD61 4DK1A 1VQK1 1FDOA 3IF8A 3G4S1 4E31A 4NFRA 4EWCA 5FLXb 1Y1VI 5C3EI 1VQ9Z 4HGZA 2ZAEB 3PO3S 3CC41 4NBGA 1VQ51 4RV9A 2NVXI 4E2XA 3BG0B 2JR6A 4AYBA 3JAMf 1K9M1 2QA41 4A3MI 4MH4A 3I4MI 2PK7A 1QVGY 1USPA 1VQLZ 1KC81 3D9XA 3CXCY 1Q861 3CC7Z 2J6AA 1Z01A 2AKLA 1TWCI 2E9HA 3EERA 1VQ6Z 2RBLA 3KIHA 2JA6I 5CM2M 2E2II 1YJ91 1W2BZ 1VQOZ 1YJWZ 3H0GI 3MZLB 2OTLZ 3T4NB 2V8KA 3S1NI 1X3ZA 2W03A 3S2HI 2LEXA 5FLXf 2QLVB 3MZKB 3GTMI 4MD8A 2NVQI 2LFUA 3U50C 1KD12 1K732 2Q4ZA 3G6EZ 1KQSZ 2K5RA 3I551 3S1RI 1S72Z 4RVFA 1VQP1 3CCJZ 4Y7NI 3CCM1 1YHQZ 4RS4A 3CCQ1 2KPIA 2RPRA 3RZOI 4XX2A 3GTKI 4Y52I 1YITZ 3S14I 1WCMI 3VMIA 3CCLZ 5C44I 3J7A4 2NVYI 3CC21 3VTNA 1QF8A 3CME1 2R92I 3CD6Z 1VQKZ 1VQ71 2YADA 1Z02A 3G4SZ 1K731 4BY7I 1Y1VS 4CL1A 2AYDA 2P3YA 1Q16A 1WW9A 2QREB 2F4OA 2IZ3A 1TFIA 5LL6f 3VMGA 2PM9A 2OTJZ 3CC4Z 1VQ5Z 4A3JI 5IP7I 5D1OB 1WJ2A 2QA4Z 3PO2I 3FKII 1Q862 1NUIA 1Y1WI 2JMOA 4S1TA 3CCSZ 5IP9I 2OOYB 3LUSA 3S1QI 5T64A 1YJ9Z 2F4MA 1R9TI 3K7AI 4A3II 3NH4A 2NVTI 2O4HA 2V8IA 3G711 4E2YA 3IR7A 3CCV1 3GTMS 3M3YI 3CMA1 4A3KI 2EGTA 2B63I 3TDHB 3CCE1 2W04A 1NJI1 3CCU1 1VLAA 1VQL1 1KQSY 3MONA 4E2ZA 2JS4A 3CPWY 1I6HI 1RLYA 2HF1A 1USPB 1YIJ1 3I55Z 1VQN1 2JIRA 2GTHA 1M901 1VQPZ 1Z03A 1YJN1 3CCMZ 2QR1B 2JUBA 1RNIA 3CCQZ 1N2FA 2IZ4A 4BBRI 1K83I 1TWAI 4A3LI 2R93I 1ML8A 2VUMI 3S16I 2DE7A 4X6AI 1X0TA 4MXUA 2M6NA 2KI7B 2I3CA 4HGYA 3CC2Z 2V3VA 3CMEZ 2VPXA 4NH1C 3GTGI 3HOXI 1QVGZ 3TE5B 1VQ4Z 4NBFA 2OOXB 3FQMA 1QXFA 1RO0A 2LIYA 1N8R2 3QWUA 1YJW1 1AA6A 1X3WA 2JA8I 5D1PA 2QKDA 2QRCB 1ZH1A 5A2Qf 2BJOA 3GTPI 2DE6A 3VMHA 3HOZI 4MD9A 2Y0SA 1SIWA 1YI21 2VF1A 1PFTA 3NH5A 3Q87A 4NBCA 1Q811 1ZB9A 3RZDI 3I07A 1N8R1 1QVFZ 1QYPA 1Q7Y1 1RO2A 2NAPA 3NDIA 1YHQ1 5FLMI 3G71Z 3GTLI 3S2DI 1VQM1 4A3EI 3CCVZ 2RIQA 1NJI2 2M48A 3CMAZ 3D6WA 5T67A 1JWHC 5C4JI 1LQLA 1YIT1 1W2BY 1VQ81 4A93I 3EEDA 2JA7I 3CCEZ 1RQFA 3CCUZ 3CCR1
chains in the Genus database with same CATH topology
1JJ2Z 2RT9A 2QEX1 1Q822 3J81b 5C4XI 2G2KA 2YU9I 1WIIA 1M1K1 4E2WA 4A3GI 1RO4A 1M902 1YIJZ 3F3PC 1NP6A 1VQNZ 1TWGI 3OW2Z 2V8JA 4NB9A 1YJNZ 3GTOI 2GU2A 4NBAA 2OTJ1 2P28A 3I561 4E32A 2WB1A 4TNUA 1S7MA 1Q821 2GTIA 3GKQA 4MD7A 3J80b 1DL6A 5A2Qb 4MONA 3CCS1 4NBHA 2K3RA 4E30A 3BG1B 4BY1I 2QRDB 4A3DI 3CQZI 4NOZA 4DGLA 3S15I 3H3VJ 1VQ91 2PMZA 3KIFA 5IT9b 3HOUI 4NBBA 1ZB8A 3GCFA 4RVGA 3J81f 3PO3I 3NDJA 4HH4A 4RVHA 4DQYB 1I3QI 2E2JI 3ESWA 2JNYA 3HOWI 3HOVI 1VQ7Z 3I4NI 4BXXI 3CC71 3IX0A 3CXCZ 3FQQA 1KRLA 1VQ61 3GTQI 3IFUA 1YI2Z 2HU9A 1K8A2 2R6MA 4E33A 2Q51A 1Q812 1QVFY 2WAQA 1VQO1 3NH8A 2OTL1 1Q7Y2 5T6BA 4NBEA 3CPWZ 1SFOI 3J80f 3P5JB 1VQMZ 2JA5I 1JJ2Y 1YUKA 4QTTA 3HKZA 1VQ8Z 4NB8A 4NBDA 3CCRZ 3GTJI 5IT9f 5D1OA 1P9NA 2QEXZ 3JAMb 1M1K2 2OZKA 4A3BI 1I50I 3S1MI 1K8A1 3OW2Y 3G6E1 4A3FI 1TWHI 2R7ZI 2DE5A 2VUGA 1KD11 4RVDA 1TWFI 4QTUA 3HOYI 2H85A 3S17I 1S721 1VQ41 3F3FC 3CCJ1 4BBSI 3NFZA 3VB9A 1YUAA 2O53A 4A3CI 4MRIA 1K9M2 1L1OC 2RHBA 3I56Z 3CCL1 5AN9F 1KC82 3M4OI 2E2HI 3CD61 4DK1A 1VQK1 3IF8A 3G4S1 4E31A 4NFRA 4EWCA 5FLXb 1Y1VI 5C3EI 1VQ9Z 4HGZA 2ZAEB 3PO3S 3CC41 4NBGA 1VQ51 4RV9A 2NVXI 4E2XA 3BG0B 2JR6A 4AYBA 3JAMf 1K9M1 2QA41 4A3MI 4MH4A 3I4MI 2PK7A 1QVGY 1USPA 1VQLZ 1KC81 3D9XA 3CXCY 1Q861 3CC7Z 2J6AA 1Z01A 2AKLA 1TWCI 2E9HA 3EERA 1VQ6Z 2RBLA 3KIHA 2JA6I 5CM2M 2E2II 1YJ91 1W2BZ 1VQOZ 1YJWZ 3H0GI 3MZLB 2OTLZ 3T4NB 2V8KA 3S1NI 1X3ZA 2W03A 3S2HI 5FLXf 2QLVB 3MZKB 3GTMI 4MD8A 2NVQI 2LFUA 3U50C 1KD12 1K732 2Q4ZA 3G6EZ 1KQSZ 2K5RA 3I551 3S1RI 1S72Z 1VQP1 4RVFA 3CCJZ 4Y7NI 3CCM1 1YHQZ 4RS4A 3CCQ1 2KPIA 2RPRA 3RZOI 4XX2A 3GTKI 4Y52I 1YITZ 3S14I 1WCMI 3VMIA 3CCLZ 5C44I 3J7A4 2NVYI 3CC21 3VTNA 1QF8A 3CME1 2R92I 3CD6Z 1VQKZ 1VQ71 2YADA 1Z02A 3G4SZ 1K731 4BY7I 1Y1VS 4CL1A 2P3YA 1WW9A 2QREB 2F4OA 2IZ3A 1TFIA 5LL6f 3VMGA 2PM9A 2OTJZ 3CC4Z 1VQ5Z 4A3JI 5IP7I 5D1OB 2QA4Z 3PO2I 3FKII 1Q862 1NUIA 1Y1WI 2JMOA 4S1TA 3CCSZ 5IP9I 2OOYB 3LUSA 3S1QI 5T64A 1YJ9Z 2F4MA 1R9TI 3K7AI 4A3II 3NH4A 2NVTI 2O4HA 2V8IA 3G711 4E2YA 3CCV1 3GTMS 3M3YI 3CMA1 4A3KI 2EGTA 2B63I 3TDHB 3CCE1 2W04A 1NJI1 3CCU1 1VLAA 1VQL1 1KQSY 3MONA 4E2ZA 2JS4A 3CPWY 1I6HI 1RLYA 2HF1A 1USPB 1YIJ1 3I55Z 1VQN1 2GTHA 1M901 1VQPZ 1Z03A 1YJN1 3CCMZ 2QR1B 2JUBA 1RNIA 3CCQZ 1N2FA 2IZ4A 4BBRI 1K83I 1TWAI 4A3LI 2R93I 1ML8A 2VUMI 3S16I 2DE7A 4X6AI 1X0TA 4MXUA 2M6NA 2KI7B 2I3CA 4HGYA 3CC2Z 3CMEZ 4NH1C 3GTGI 3HOXI 1QVGZ 3TE5B 1VQ4Z 4NBFA 2OOXB 3FQMA 1RO0A 2LIYA 1N8R2 3QWUA 1YJW1 1X3WA 2JA8I 5D1PA 2QKDA 2QRCB 1ZH1A 5A2Qf 2BJOA 3GTPI 2DE6A 3VMHA 3HOZI 4MD9A 2Y0SA 1YI21 2VF1A 1PFTA 3NH5A 3Q87A 4NBCA 1Q811 1ZB9A 3RZDI 3I07A 1N8R1 1QVFZ 1QYPA 1Q7Y1 1RO2A 3NDIA 1YHQ1 5FLMI 3G71Z 3GTLI 3S2DI 1VQM1 4A3EI 3CCVZ 2RIQA 1NJI2 2M48A 3CMAZ 3D6WA 5T67A 1JWHC 5C4JI 1LQLA 1YIT1 1W2BY 1VQ81 4A93I 3EEDA 2JA7I 3CCEZ 1RQFA 3CCUZ 3CCR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Z;  1KQS Y;  2QEX Z;  2QEX 1;  1Q82 2;  1M1K 2;  3CPW Y;  1KD1 2;  1K73 2;  1K8A 1;  3OW2 Y;  3G6E Z;  3G6E 1;  1M1K 1;  1KQS Z;  1KD1 1;  1M90 2;  1YIJ 1;  1YIJ Z;  3I55 1;  3I55 Z;  1VQN 1;  1VQN Z;  1S72 Z;  1S72 1;  3OW2 Z;  1VQ4 1;  1M90 1;  1VQP 1;  1VQP Z;  3CCJ Z;  3CCJ 1;  1YJN 1;  1YJN Z;  3CCM Z;  3CCM 1;  1YHQ Z;  3CCQ Z;  3CCQ 1;  2OTJ 1;  1YIT Z;  1K9M 2;  3I56 1;  3I56 Z;  3CCL 1;  3CCL Z;  1KC8 2;  3CC2 Z;  3CC2 1;  3CME 1;  3CME Z;  3CD6 Z;  3CD6 1;  1VQK Z;  1Q82 1;  1VQK 1;  1VQ7 1;  3G4S 1;  3G4S Z;  1K73 1;  3CCS 1;  1QVG Z;  1VQ4 Z;  1VQ9 1;  1VQ9 Z;  2OTJ Z;  3CC4 1;  3CC4 Z;  1VQ5 1;  1VQ5 Z;  1N8R 2;  1YJW 1;  1K9M 1;  2QA4 Z;  2QA4 1;  1QVG Y;  1Q86 2;  1KC8 1;  3CCU Z;  1VQ7 Z;  3CXC Y;  1Q86 1;  3CC7 Z;  3CCS Z;  3CC7 1;  1NJI 1;  3CXC Z;  1VQ6 Z;  1VQ6 1;  1YI2 1;  1YI2 Z;  1K8A 2;  1Q81 2;  1QVF Y;  1YJ9 1;  1YJ9 Z;  1W2B Z;  1VQO Z;  1VQO 1;  1YJW Z;  1Q81 1;  1VQL 1;  2OTL Z;  1Q7Y 2;  2OTL 1;  1N8R 1;  1QVF Z;  3CPW Z;  1Q7Y 1;  1YHQ 1;  3G71 Z;  3G71 1;  1VQM 1;  1VQM Z;  3CCV 1;  3CCV Z;  3CCE Z;  1JJ2 Y;  1NJI 2;  3CMA Z;  3CMA 1;  1YIT 1;  1W2B Y;  1VQ8 Z;  1VQ8 1;  3CCE 1;  3CCR 1;  1VQL Z;  3CCU 1;  3CCR Z; 
#chains in the Genus database with same CATH topology
 1JJ2 Z;  2RT9 A;  2QEX 1;  1Q82 2;  3J81 b;  5C4X I;  2G2K A;  2YU9 I;  1WII A;  1M1K 1;  4E2W A;  4A3G I;  1RO4 A;  1M90 2;  1YIJ Z;  3F3P C;  2JIO A;  1NP6 A;  1VQN Z;  1TWG I;  3OW2 Z;  2V8J A;  4NB9 A;  1YJN Z;  3GTO I;  2GU2 A;  4NBA A;  1FDI A;  2OTJ 1;  2P28 A;  3I56 1;  4E32 A;  2WB1 A;  4TNU A;  1S7M A;  1Q82 1;  2GTI A;  2VPW A;  1WZN A;  3GKQ A;  4MD7 A;  3J80 b;  1DL6 A;  5A2Q b;  4MON A;  3CCS 1;  2VPZ A;  4NBH A;  2K3R A;  4E30 A;  3BG1 B;  4BY1 I;  2QRD B;  4A3D I;  3CQZ I;  4NOZ A;  4DGL A;  3S15 I;  3H3V J;  1VQ9 1;  2PMZ A;  3KIF A;  5IT9 b;  3HOU I;  4NBB A;  1ZB8 A;  3GCF A;  4RVG A;  3J81 f;  3PO3 I;  3NDJ A;  4HH4 A;  4RVH A;  4DQY B;  1I3Q I;  2E2J I;  3ESW A;  2JNY A;  3HOW I;  3HOV I;  1VQ7 Z;  3I4N I;  2JIP A;  4BXX I;  3CC7 1;  3IX0 A;  2E7Z A;  3CXC Z;  2JIM A;  3FQQ A;  1KRL A;  1VQ6 1;  2VPY A;  3GTQ I;  3IFU A;  1YI2 Z;  2HU9 A;  1K8A 2;  2R6M A;  4E33 A;  2Q51 A;  1Q81 2;  1QVF Y;  2WAQ A;  1VQO 1;  3NH8 A;  2OTL 1;  1Q7Y 2;  5T6B A;  4NBE A;  3CPW Z;  1SFO I;  3J80 f;  3P5J B;  1VQM Z;  2JA5 I;  1JJ2 Y;  1YUK A;  4QTT A;  3HKZ A;  1VQ8 Z;  4NB8 A;  4NBD A;  3CCR Z;  3GTJ I;  5IT9 f;  5D1O A;  1P9N A;  2QEX Z;  3JAM b;  1M1K 2;  2OZK A;  2V45 A;  4A3B I;  1I50 I;  3S1M I;  1K8A 1;  3OW2 Y;  3G6E 1;  4A3F I;  1TWH I;  2R7Z I;  2DE5 A;  2VUG A;  1KD1 1;  4RVD A;  1TWF I;  4QTU A;  3HOY I;  2H85 A;  3S17 I;  1S72 1;  1VQ4 1;  3F3F C;  3CCJ 1;  4BBS I;  3NFZ A;  3VB9 A;  1YUA A;  3D2L A;  2IV2 X;  2O53 A;  4A3C I;  1Y8C A;  4MRI A;  1K9M 2;  1L1O C;  2RHB A;  3I56 Z;  2JIQ A;  3CCL 1;  5AN9 F;  1KC8 2;  3M4O I;  2E2H I;  3CD6 1;  4DK1 A;  1VQK 1;  1FDO A;  3IF8 A;  3G4S 1;  4E31 A;  4NFR A;  4EWC A;  5FLX b;  1Y1V I;  5C3E I;  1VQ9 Z;  4HGZ A;  2ZAE B;  3PO3 S;  3CC4 1;  4NBG A;  1VQ5 1;  4RV9 A;  2NVX I;  4E2X A;  3BG0 B;  2JR6 A;  4AYB A;  3JAM f;  1K9M 1;  2QA4 1;  4A3M I;  4MH4 A;  3I4M I;  2PK7 A;  1QVG Y;  1USP A;  1VQL Z;  1KC8 1;  3D9X A;  3CXC Y;  1Q86 1;  3CC7 Z;  2J6A A;  1Z01 A;  2AKL A;  1TWC I;  2E9H A;  3EER A;  1VQ6 Z;  2RBL A;  3KIH A;  2JA6 I;  5CM2 M;  2E2I I;  1YJ9 1;  1W2B Z;  1VQO Z;  1YJW Z;  3H0G I;  3MZL B;  2OTL Z;  3T4N B;  2V8K A;  3S1N I;  1X3Z A;  2W03 A;  3S2H I;  2LEX A;  5FLX f;  2QLV B;  3MZK B;  3GTM I;  4MD8 A;  2NVQ I;  2LFU A;  3U50 C;  1KD1 2;  1K73 2;  2Q4Z A;  3G6E Z;  1KQS Z;  2K5R A;  3I55 1;  3S1R I;  1S72 Z;  4RVF A;  1VQP 1;  3CCJ Z;  4Y7N I;  3CCM 1;  1YHQ Z;  4RS4 A;  3CCQ 1;  2KPI A;  2RPR A;  3RZO I;  4XX2 A;  3GTK I;  4Y52 I;  1YIT Z;  3S14 I;  1WCM I;  3VMI A;  3CCL Z;  5C44 I;  3J7A 4;  2NVY I;  3CC2 1;  3VTN A;  1QF8 A;  3CME 1;  2R92 I;  3CD6 Z;  1VQK Z;  1VQ7 1;  2YAD A;  1Z02 A;  3G4S Z;  1K73 1;  4BY7 I;  1Y1V S;  4CL1 A;  2AYD A;  2P3Y A;  1Q16 A;  1WW9 A;  2QRE B;  2F4O A;  2IZ3 A;  1TFI A;  5LL6 f;  3VMG A;  2PM9 A;  2OTJ Z;  3CC4 Z;  1VQ5 Z;  4A3J I;  5IP7 I;  5D1O B;  1WJ2 A;  2QA4 Z;  3PO2 I;  3FKI I;  1Q86 2;  1NUI A;  1Y1W I;  2JMO A;  4S1T A;  3CCS Z;  5IP9 I;  2OOY B;  3LUS A;  3S1Q I;  5T64 A;  1YJ9 Z;  2F4M A;  1R9T I;  3K7A I;  4A3I I;  3NH4 A;  2NVT I;  2O4H A;  2V8I A;  3G71 1;  4E2Y A;  3IR7 A;  3CCV 1;  3GTM S;  3M3Y I;  3CMA 1;  4A3K I;  2EGT A;  2B63 I;  3TDH B;  3CCE 1;  2W04 A;  1NJI 1;  3CCU 1;  1VLA A;  1VQL 1;  1KQS Y;  3MON A;  4E2Z A;  2JS4 A;  3CPW Y;  1I6H I;  1RLY A;  2HF1 A;  1USP B;  1YIJ 1;  3I55 Z;  1VQN 1;  2JIR A;  2GTH A;  1M90 1;  1VQP Z;  1Z03 A;  1YJN 1;  3CCM Z;  2QR1 B;  2JUB A;  1RNI A;  3CCQ Z;  1N2F A;  2IZ4 A;  4BBR I;  1K83 I;  1TWA I;  4A3L I;  2R93 I;  1ML8 A;  2VUM I;  3S16 I;  2DE7 A;  4X6A I;  1X0T A;  4MXU A;  2M6N A;  2KI7 B;  2I3C A;  4HGY A;  3CC2 Z;  2V3V A;  3CME Z;  2VPX A;  4NH1 C;  3GTG I;  3HOX I;  1QVG Z;  3TE5 B;  1VQ4 Z;  4NBF A;  2OOX B;  3FQM A;  1QXF A;  1RO0 A;  2LIY A;  1N8R 2;  3QWU A;  1YJW 1;  1AA6 A;  1X3W A;  2JA8 I;  5D1P A;  2QKD A;  2QRC B;  1ZH1 A;  5A2Q f;  2BJO A;  3GTP I;  2DE6 A;  3VMH A;  3HOZ I;  4MD9 A;  2Y0S A;  1SIW A;  1YI2 1;  2VF1 A;  1PFT A;  3NH5 A;  3Q87 A;  4NBC A;  1Q81 1;  1ZB9 A;  3RZD I;  3I07 A;  1N8R 1;  1QVF Z;  1QYP A;  1Q7Y 1;  1RO2 A;  2NAP A;  3NDI A;  1YHQ 1;  5FLM I;  3G71 Z;  3GTL I;  3S2D I;  1VQM 1;  4A3E I;  3CCV Z;  2RIQ A;  1NJI 2;  2M48 A;  3CMA Z;  3D6W A;  5T67 A;  1JWH C;  5C4J I;  1LQL A;  1YIT 1;  1W2B Y;  1VQ8 1;  4A93 I;  3EED A;  2JA7 I;  3CCE Z;  1RQF A;  3CCU Z;  3CCR 1; 
#chains in the Genus database with same CATH homology
 1JJ2 Z;  2RT9 A;  2QEX 1;  1Q82 2;  3J81 b;  5C4X I;  2G2K A;  2YU9 I;  1WII A;  1M1K 1;  4E2W A;  4A3G I;  1RO4 A;  1M90 2;  1YIJ Z;  3F3P C;  1NP6 A;  1VQN Z;  1TWG I;  3OW2 Z;  2V8J A;  4NB9 A;  1YJN Z;  3GTO I;  2GU2 A;  4NBA A;  2OTJ 1;  2P28 A;  3I56 1;  4E32 A;  2WB1 A;  4TNU A;  1S7M A;  1Q82 1;  2GTI A;  3GKQ A;  4MD7 A;  3J80 b;  1DL6 A;  5A2Q b;  4MON A;  3CCS 1;  4NBH A;  2K3R A;  4E30 A;  3BG1 B;  4BY1 I;  2QRD B;  4A3D I;  3CQZ I;  4NOZ A;  4DGL A;  3S15 I;  3H3V J;  1VQ9 1;  2PMZ A;  3KIF A;  5IT9 b;  3HOU I;  4NBB A;  1ZB8 A;  3GCF A;  4RVG A;  3J81 f;  3PO3 I;  3NDJ A;  4HH4 A;  4RVH A;  4DQY B;  1I3Q I;  2E2J I;  3ESW A;  2JNY A;  3HOW I;  3HOV I;  1VQ7 Z;  3I4N I;  4BXX I;  3CC7 1;  3IX0 A;  3CXC Z;  3FQQ A;  1KRL A;  1VQ6 1;  3GTQ I;  3IFU A;  1YI2 Z;  2HU9 A;  1K8A 2;  2R6M A;  4E33 A;  2Q51 A;  1Q81 2;  1QVF Y;  2WAQ A;  1VQO 1;  3NH8 A;  2OTL 1;  1Q7Y 2;  5T6B A;  4NBE A;  3CPW Z;  1SFO I;  3J80 f;  3P5J B;  1VQM Z;  2JA5 I;  1JJ2 Y;  1YUK A;  4QTT A;  3HKZ A;  1VQ8 Z;  4NB8 A;  4NBD A;  3CCR Z;  3GTJ I;  5IT9 f;  5D1O A;  1P9N A;  2QEX Z;  3JAM b;  1M1K 2;  2OZK A;  4A3B I;  1I50 I;  3S1M I;  1K8A 1;  3OW2 Y;  3G6E 1;  4A3F I;  1TWH I;  2R7Z I;  2DE5 A;  2VUG A;  1KD1 1;  4RVD A;  1TWF I;  4QTU A;  3HOY I;  2H85 A;  3S17 I;  1S72 1;  1VQ4 1;  3F3F C;  3CCJ 1;  4BBS I;  3NFZ A;  3VB9 A;  1YUA A;  2O53 A;  4A3C I;  4MRI A;  1K9M 2;  1L1O C;  2RHB A;  3I56 Z;  3CCL 1;  5AN9 F;  1KC8 2;  3M4O I;  2E2H I;  3CD6 1;  4DK1 A;  1VQK 1;  3IF8 A;  3G4S 1;  4E31 A;  4NFR A;  4EWC A;  5FLX b;  1Y1V I;  5C3E I;  1VQ9 Z;  4HGZ A;  2ZAE B;  3PO3 S;  3CC4 1;  4NBG A;  1VQ5 1;  4RV9 A;  2NVX I;  4E2X A;  3BG0 B;  2JR6 A;  4AYB A;  3JAM f;  1K9M 1;  2QA4 1;  4A3M I;  4MH4 A;  3I4M I;  2PK7 A;  1QVG Y;  1USP A;  1VQL Z;  1KC8 1;  3D9X A;  3CXC Y;  1Q86 1;  3CC7 Z;  2J6A A;  1Z01 A;  2AKL A;  1TWC I;  2E9H A;  3EER A;  1VQ6 Z;  2RBL A;  3KIH A;  2JA6 I;  5CM2 M;  2E2I I;  1YJ9 1;  1W2B Z;  1VQO Z;  1YJW Z;  3H0G I;  3MZL B;  2OTL Z;  3T4N B;  2V8K A;  3S1N I;  1X3Z A;  2W03 A;  3S2H I;  5FLX f;  2QLV B;  3MZK B;  3GTM I;  4MD8 A;  2NVQ I;  2LFU A;  3U50 C;  1KD1 2;  1K73 2;  2Q4Z A;  3G6E Z;  1KQS Z;  2K5R A;  3I55 1;  3S1R I;  1S72 Z;  1VQP 1;  4RVF A;  3CCJ Z;  4Y7N I;  3CCM 1;  1YHQ Z;  4RS4 A;  3CCQ 1;  2KPI A;  2RPR A;  3RZO I;  4XX2 A;  3GTK I;  4Y52 I;  1YIT Z;  3S14 I;  1WCM I;  3VMI A;  3CCL Z;  5C44 I;  3J7A 4;  2NVY I;  3CC2 1;  3VTN A;  1QF8 A;  3CME 1;  2R92 I;  3CD6 Z;  1VQK Z;  1VQ7 1;  2YAD A;  1Z02 A;  3G4S Z;  1K73 1;  4BY7 I;  1Y1V S;  4CL1 A;  2P3Y A;  1WW9 A;  2QRE B;  2F4O A;  2IZ3 A;  1TFI A;  5LL6 f;  3VMG A;  2PM9 A;  2OTJ Z;  3CC4 Z;  1VQ5 Z;  4A3J I;  5IP7 I;  5D1O B;  2QA4 Z;  3PO2 I;  3FKI I;  1Q86 2;  1NUI A;  1Y1W I;  2JMO A;  4S1T A;  3CCS Z;  5IP9 I;  2OOY B;  3LUS A;  3S1Q I;  5T64 A;  1YJ9 Z;  2F4M A;  1R9T I;  3K7A I;  4A3I I;  3NH4 A;  2NVT I;  2O4H A;  2V8I A;  3G71 1;  4E2Y A;  3CCV 1;  3GTM S;  3M3Y I;  3CMA 1;  4A3K I;  2EGT A;  2B63 I;  3TDH B;  3CCE 1;  2W04 A;  1NJI 1;  3CCU 1;  1VLA A;  1VQL 1;  1KQS Y;  3MON A;  4E2Z A;  2JS4 A;  3CPW Y;  1I6H I;  1RLY A;  2HF1 A;  1USP B;  1YIJ 1;  3I55 Z;  1VQN 1;  2GTH A;  1M90 1;  1VQP Z;  1Z03 A;  1YJN 1;  3CCM Z;  2QR1 B;  2JUB A;  1RNI A;  3CCQ Z;  1N2F A;  2IZ4 A;  4BBR I;  1K83 I;  1TWA I;  4A3L I;  2R93 I;  1ML8 A;  2VUM I;  3S16 I;  2DE7 A;  4X6A I;  1X0T A;  4MXU A;  2M6N A;  2KI7 B;  2I3C A;  4HGY A;  3CC2 Z;  3CME Z;  4NH1 C;  3GTG I;  3HOX I;  1QVG Z;  3TE5 B;  1VQ4 Z;  4NBF A;  2OOX B;  3FQM A;  1RO0 A;  2LIY A;  1N8R 2;  3QWU A;  1YJW 1;  1X3W A;  2JA8 I;  5D1P A;  2QKD A;  2QRC B;  1ZH1 A;  5A2Q f;  2BJO A;  3GTP I;  2DE6 A;  3VMH A;  3HOZ I;  4MD9 A;  2Y0S A;  1YI2 1;  2VF1 A;  1PFT A;  3NH5 A;  3Q87 A;  4NBC A;  1Q81 1;  1ZB9 A;  3RZD I;  3I07 A;  1N8R 1;  1QVF Z;  1QYP A;  1Q7Y 1;  1RO2 A;  3NDI A;  1YHQ 1;  5FLM I;  3G71 Z;  3GTL I;  3S2D I;  1VQM 1;  4A3E I;  3CCV Z;  2RIQ A;  1NJI 2;  2M48 A;  3CMA Z;  3D6W A;  5T67 A;  1JWH C;  5C4J I;  1LQL A;  1YIT 1;  1W2B Y;  1VQ8 1;  4A93 I;  3EED A;  2JA7 I;  3CCE Z;  1RQF A;  3CCU Z;  3CCR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...