2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
4RS4A 2GTHA 2RHBA 2H85A 2OZKA 2GTIA 4S1TA
chains in the Genus database with same CATH superfamily
1C7IA 1GUDA 4B34A 1S2NA 3W4IA 2NTNA 8OHMA 4ZT6A 2PS1A 2OEPA 2BONA 1PJ8A 2GLTA 2XX3A 3C5EA 1Y4DE 4DA6A 3N8GA 3PT9A 5DGCA 4FFVA 1UIMA 4IG9A 4MOWA 4P1ZA 4QGAA 1B1CA 4U6QA 4B6FA 4C7JA 5KHAA 2VK4A 3ZK8A 5AM3A 4DGQA 4MRRA 2XODA 3CB4A 2O8BB 3U2QA 3TS1A 1V6SA 1E1CA 3BTUA 2QT1A 3URKA 3OZAA 1QIKA 1R0CA 2KBEA 4W99A 2AT1A 4XE5A 1G2QA 2QREB 1NHWA 4G0ZA 5DJ5A 4IMPA 3U26A 3ZXYA 1AKNA 3G6KA 1QF8A 1NGSA 4O4HA 1NLFA 5JASA 1DC6A 2WZDA 2Y77A 1OFIA 2CNWA 1QYIA 2C9CA 3CWCA 3M3HA 3TWOA 4A82A 1J99A 1NWCA 4EYSA 3O38A 4KQXA 3EFOB 4GWKA 3W5BA 3ILXA 4N8DA 5LDHA 1HDYA 3IDZA 3UWPA 4FSDA 3NEPX 4PPQA 2VJLA 3NANA 4IHQA 1WHTA 1DKPA 4F2WA 3PZRA 1N5RA 4IO1A 3ZDYB 4D2IA 3EVBA 4KO4S 2OAQ1 1XAGA 4E6PA 3OIFA 4O0MA 5TS3A 4XFJA 4PZDA 1P2GA 1UWKA 3O8QA 2PIDA 4TRNA 3ZHYA 1CNEA 4JB2A 1DBQA 1I3QI 1QDEA 1ENOA 3T4UA 5KNDH 2JJMA 3A6HA 2EKQA 3M6IA 2PJZA 2WJAA 2XZDA 4W9NA 4OB7A 1TVMA 4LXHA 2OYCA 5L7TA 1QVWA 1K1EA 4LDQA 2HMUA 1L5HA 4ND7A 3TEMA 4AMVA 5C51B 1Q1EA 1W0JA 2CMDA 4INZA 4O5OA 1U6KA 2C29D 3MCAA 3WGJA 3V7FA 4RWEA 1EB8A 3UV7A 1TKRA 3HA7A 1EP1B 3MS7A 4GPIB 3W5AA 2O0HA 4G5OA 2HYDA 2IELA 2W6ID 5IAKA 2NV0A 3UQYS 4JWTA 4CM7A 3FFTA 4E6EA 4M1EA 3C5VA 4DRXB 2D3WA 2ZSAA 4R5MA 3CS3A 2REBA 3LUAA 3T9BA 3TTUA 1P7ZA 3RC7A 2ZREA 4QM6A 1O9HA 3QE0A 10MHA 1H8ED 4RY2A 2B4RO 4N3BA 3SQMA 2FSFA 4D0NA 1KSJA 5IG2A 5L7WA 1W85B 3DDOA 4WBNA 1SVWA 5JE8A 1Y0BA 3B6IA 4QVIA 1XJQA 4HH0A 5JVDA 1Z7YA 4EOGA 5JALA 2ZIEA 3PTAA 4KR3A 3C6XA 3G02A 3KCQA 1I2AA 3KJHA 4OQPA 1RRMA 4G97A 4GKAA 4D9JA 1C30A 1G5PA 3FE2A 2BI4A 2JLAA 2PMCA 3EIHA 3MJVA 3II6X 3O8OA 1AHPA 1RXCA 3HG7A 3VKHA 3V2GA 1Q0HA 1JIIA 2BFMA 1SA0B 2FWNA 1VMEA 2GKGA 2O06A 4O2BA 3THRA 3V4FA 3CRMA 5ITZB 2PUDA 7AT1A 3P0HA 3AI7A 5ISMA 1PL8A 1N8R2 3STUA 3T4XA 3U44A 1NMQA 1GN9A 2Z5VA 3PB3A 1WW3A 1E59A 1JHRA 1R0WA 3IV9A 2AEEA 3EXG2 4MAAA 3NEJA 1O9BA 3BL6A 3PX3A 4EHBA 3LIPA 1EWRA 3RHSA 4RJKA 1GCIA 3C3CA 4L0DA 4C6SA 1ESZA 3GOQA 3O0DA 1QVZA 3AOEC 4J4BA 1CQWA 2OOSA 1SUPA 4IQGA 1HEYA 1P62B 3WGIA 2ZJYA 4Z1MA 5H16A 1EMDA 3BX1A 5CHYA 3SYNA 2BGRA 3HUEA 2IKQA 4CIWA 2G0TA 4LXTA 4FFRA 3UV3A 4MS3B 5AVJA 2YWGA 1KOFA 2SHKA 4E2XA 3WBBA 5BW5A 1SU7A 4W6QA 3GLGA 3UUWA 4H60A 5A6SA 3ZTYA 5EUMA 2IOYA 3HVRA 1Z4IA 2CXQA 4EQZA 1F0YA 2B2CA 2ZXEA 4D26A 2Q2OA 4CTJA 4DY6A 3VA7A 1LF5A 1YJAA 3ODGA 3H86A 2RGNC 5A5GA 1SKAA 2MR6A 4RIGA 3TDNA 2QTWB 2X86A 5ENZA 5A2Qf 3BMQB 3BQMB 3CLHA 4RVDA 4RK7A 1JFFB 4HFJA 4I5FA 3I4NI 1GDTA 1QO0A 1GTZA 4R9SA 2CZQA 1C8KA 2AW3A 2IYTA 3QQ5A 1S2OA 3QLEA 2CFRA 3CF2A 1YITZ 3COWA 1GGNA 2VJNA 3ZW7A 1II8B 3T7IA 9ATCA 2XBUA 3O5AA 4Y6RA 1KETA 2CFSA 2HPHA 5DH9A 1TUBA 2G8LA 3ND5A 3LFHA 4PNEA 2J59A 3OVMA 3THSA 1ZL0A 2V7GA 4ZQEA 4MLZA 3TSAA 4BBRI 5EPUA 3W6PA 4ND1A 1P4JA 2HA0A 5AK0A 3LT0A 3IKTA 2FFJA 2I87A 1T5HX 4QU0A 1SBIA 1VPVA 2JI8A 3FD8A 2NAFA 3VH1A 1CY0A 1EUCA 2I55A 4PVDA 1YJXA 2QGFA 2XNSA 4S1TA 4PSUA 1UBHS 2AVNA 2VPWA 4IUCS 1DHRA 2F8LA 2WU8A 2ZRHA 4EYGA 3FG9A 3O84A 2PGIA 3COZA 4IH4A 3FGZA 4Q9IA 1FIUA 1J2EA 2X8AA 2C3MA 4EWCA 5I9MA 4I50B 3C1UA 1W5TA 3JQDA 4X0EA 4UULA 2Q07A 3ROXA 3JAMf 4CLXA 4OM7A 1ETUA 4BTVA 4CFSA 2GLUA 1YZYA 4BFXA 3KQNA 4KBFA 3U3OA 1PT5A 2GXQA 3AX6A 4URFA 3ZHQA 3WX0A 3RFUA 1UUFA 1RCFA 4O3MA 3WLSA 1WMBA 3CM0A 4ANFA 1GZ7A 3GGSA 4KKXB 1JR4A 3WL6A 4YP5A 2DLCX 3MEQA 1ZU5A 2Z4TA 4IHJF 4MUKA 2JIMA 1PJBA 4FGUA 2KQUA 3IX7A 4EKYA 1SHKA 3EEIA 3RC8A 5G1PA 2X8JB 2IHZA 5IC6A 1E2JA 3WGHA 4DRZA 1VDZA 2IWHA 3OO1A 1SUDA 2BFBB 1EFHA 4RPKA 1YB4A 3LX6A 3SQNA 2BF7A 4KQCA 4BVBA 3DVLA 5HK8A 3WHKA 1EIWA 3HDJA 1A71A 4ZT4A 2HOQA 4Y7DA 1RMQA 1GPH1 1F6DA 3AIKA 1US8B 3UVEA 1CR0A 3D5TA 2QDKA 4R41A 1DAIA 3FROA 4JAVC 3CVOA 5K3DA 3W6UA 3HV2A 1SVMA 4HGNA 4G1EB 1UDRA 2Y0SA 3HV0A 3AR8A 3NBFA 1L1RA 1IMOA 1LW7A 1NY5A 3OBIA 4QPDA 5EVJA 4ZVSA 1J70A 2H1IA 3KNZA 1EXDA 1ESMA 4BMSA 5HS6A 3HB0A 5DF1A 2CVOA 2XRYA 1TKCA 5CIWA 5C53B 1P72A 1YCFA 2G08A 1BN7A 3L9WA 4RPHA 1XZJA 2POCA 2V59A 4RULA 5B1HA 1QFYA 2ZSHA 1BHSA 1JLHA 1KI3A 2R00C 1WXDA 4Q16A 4UMDA 1C7EA 4TKVA 2A1TS 2WW8A 3OOJA 4HF7A 1OXBB 1DKOA 3RU3A 3CMCO 3QEMB 3HJUA 1WBJB 2HNKA 1UT5A 4J94A 4J7AA 1RAAA 4BE9A 1B8PA 4BPBA 3KQSA 4AZTA 3K0SA 4BNMA 2QK4A 4ZICA 4ZHQB 1RDFA 2D62A 1YJW1 5BV7A 1YD7A 3B82A 5G4KB 3ESQA 1OA1A 3KHSA 4OQMA 5EMKA 2C3PA 3LHKA 1PZMA 3L3BA 1XCOA 1OLUA 2Q3EA 3K6KA 2PRYA 4G5RA 3DS8A 2AZTA 5I9LA 3K70C 4YR7A 2K7ZA 1WUIS 1UBOS 5CR9A 1RS0A 3OE5A 3AHDA 2GWHA 3CCUZ 4ZK6A 1ESDA 1G8PA 1ZJ5A 3U50C 3OPQA 4KFCA 5AHWA 5JYBA 3JQAD 3CT4A 4RENA 1PD0A 2OHHA 3RRZA 3IHTA 4IZ6A 1CHDA 3TOZA 3V8VA 4CM8B 1U99A 4U1RA 4EYKA 2P9JA 4MUAA 3ZZMA 1QB7A 1S3IA 1Z2CA 3ISTA 2FCAA 2WT8A 1VKRA 3DD1A 3ROKA 1FU8A 4JIGA 1R00A 4M0FA 3DAPA 2ZPTX 1Y63A 4ZEVA 1S8OA 5EYPA 4LXGA 4LSZA 1ZP6A 3RYHA 4NMLA 1Q74A 1TM3E 1MX5A 2QP4A 3V4SA 5BSMA 5C1BA 3S5JA 1IJKA 1CUAA 1RABA 3CLRC 1H2ZA 1FFXA 1L8XA 1PK7A 1VIYA 1A9RA 1XTPA 2I0FA 3DEJA 3DR3A 3MB8A 1N6LA 3OU6A 4YPFA 1DXYA 5T57A 2ZSBA 1EI9A 3O1JC 4GG1A 3E23A 4QFDA 3L41A 4ZTZB 3T5PA 1TMKA 2BD0A 3T34A 3UXMA 4UNRA 5B30A 1FXSA 1K5PA 3STTA 3L7KA 3EMVA 4EYEA 1MIOA 2BBOA 4QREA 4LVCA 3ES9A 2Q1YA 3HADA 4MVJA 2QORA 3PR2B 4KREA 4I6JA 3KZXA 3NH5A 2WYHA 1I3OA 2GILA 3R5XA 1WHSA 4G3XA 3UZUA 3B3AA 3TNDA 3VI3B 1TK2A 3LWNA 1Z5OA 1PV1A 3HY3A 4YPVA 3LBAA 1SG9A 4FYXA 1HPLA 3EZFA 1IM8A 2XUGA 2PKXA 3PYLA 4MGKR 1KMMA 4DDTA 2EL9A 1B2RA 5IVDA 3AC0A 3BXXA 4JITA 1SFRA 2HJWA 2PO7A 3LO5A 4J0IA 4B6SA 4WH0A 1FZQA 3IT3A 2EKDA 1E2IA 4D3DA 4D42A 4ECAA 3HYRA 2G6BA 2NO4A 1L8AA 3NS7A 4GP9A 1I14A 1VPDA 2A35A 1L7MA 2HSZA 1M67A 4FYHA 1FFDA 4Z4IA 1ZVKA 3LLMA 1AXEA 3L6OO 3RWBA 3DZHA 4HGYA 3G5TA 1M33A 3JATA 4RPJA 4CTMA 5LD2B 1XKTA 3UJ9A 3D4PA 3IELA 3KWMA 4X1YB 2RGBA 3B85A 4QLOA 4RV4A 1OBHA 4YJ2F 1CZKA 3FMFA 4EK9A 1MPTA 4QATA 1NF2A 3R09A 3TVYA 3WIBA 3L2OB 4DQKA 1JPUA 2KI5A 2JMOA 5DW3A 4DBLC 3NBMA 3RT9A 4MCJA 4JP1A 3T9AA 5C80A 3V8EA 3S1RI 4JJEA 4BX3A 4D9FA 2BH2A 2JJQA 3C7CB 1BXKA 5CVCA 2BGNA 3C2QA 1SVUA 1ZCBA 2YV5A 4Q82A 3LRTA 2VF7A 1OTHA 4WJKB 3ZHBA 1X1SA 4F85A 4C7XA 4ZEOA 3ICQB 1OBFO 1DOZA 1PUXA 1WPQA 4PYKA 4TOIA 3GEGA 3OT4A 2HPAA 3MIZA 3MGCA 4JKOA 4S2EA 5DMHA 2I91A 1DMRA 1H0HA 1SU8A 4J1TC 1YS9A 2PZKA 1QG2A 3OTQA 4CKXA 1SH7A 2XEDA 1NW8A 1AQYA 1HFJA 1OROA 1AGYA 1HG1A 1P0FA 1PJ2A 3QWFA 1T91A 2JCBA 2W2OA 4FVTA 4X20A 2R6AA 4HQFA 5LXTA 1T5TA 2CXXA 2DF8A 2CMHA 2J3EA 3EGIA 3F9CA 3M6UA 1KI2A 3RB8A 1EAMA 5DBIA 5SV2A 2R1VA 1X15A 4CDNA 3N3AC 1M7GA 1UJNA 4TSKA 4F6RA 5JO9A 1YE5A 4V0OA 5TMEA 3BERA 5AJUA 3OCYA 1CC1S 3LP6A 2AC7A 2EAUA 5FTNA 3I2YX 1R0LA 2EVWX 2GZ3A 3KKKA 1X74A 3Q6MA 4WCVA 2CNNA 3RVKA 5AQ1A 3IPLA 2UUPA 1RVDA 2I3ZA 3O2JA 1FQOA 3AESB 3I01A 4LS3A 2FF7A 4KTVE 3MQFA 2OG1A 3GCGA 2VYND 3MWDA 4MARA 2V8IA 4AN1A 5K0FA 2JI4A 2GAIA 3U1TA 3VRHA 5AM2A 1T4GA 1I1OA 3UHPA 1TDJA 1J6UA 3OQPA 3S1SA 1NVUQ 3SP1A 2I1VB 3PEWA 3LHIA 3QTTA 1F51E 3K3PA 4FOPA 4WKCA 3JD2A 4YROA 3L0SA 1EEXB 1RQXA 1RRFA 3IAS1 4RPIA 4OYHA 4U9IS 3ZE7A 2QMHA 1XRMA 2DWPA 3I37X 2IY9A 4FR5A 3H5RA 4TSFA 4WASA 4BVHA 3OWXA 4UM9B 1U0FA 2BLNA 1IWOA 2GHRA 2MMCA 5HRUA 2J07A 4TXLA 2OCKA 3DJFA 4KQ1A 1SK8A 1M2OA 4N7MA 1K8YB 3NOQA 2VSXA 3JY6A 1YBHA 3IUSA 2R8EA 4H7IA 1N2FA 1KKUA 1YOVB 4ILKA 3PC7A 3PVCA 4CM4A 3NETA 1QV9A 2OO3A 2AJBA 3AKDA 5CYGA 2XIJA 1X14A 5IPFA 1E92A 4UAJA 1GA1A 4NULA 3UPUA 1YS1X 1WSDA 2IYPA 3CW9A 4AAYA 3QPUA 5K2MA 1TAUA 2J4FA 4TX1A 1BFKA 3TL3A 3VPXA 1W5BA 3ZHZA 1V7PC 4DCGA 4FNAA 1Z5NA 2YASA 3RSSA 4EX7A 1CT9A 3GUZA 3I39X 1HL3A 2ID8A 5CJJA 4ZO8A 1R8SA 4RZQA 3C5HA 4CUZA 2ZWMA 1CJMA 2J0UA 4HDRA 3KE8A 4AMGA 3RVNA 4M37A 1PFYA 5M3BA 4ZREA 4TTIA 3AEKA 3FR7A 4PR0A 4PYJA 3GMDA 3LK7A 1RXEA 4MCHA 4S0ZA 5CX1B 4IIVA 4EF5A 4N49A 4B3JA 1HI9A 2NUBA 3CLKA 2FQWA 2W00A 4OHUA 4IIEA 4OHZA 4HN2A 2JFVA 2NXJA 3P1JA 2QZJA 4RF2A 3GLRA 2HO5A 3GBVA 3TTSA 1URPA 4BP9A 2Y27A 2GFQA 1F8YA 1YH3A 3NH6A 3RJTA 5LN1A 1AS2A 1BGVA 4HGZA 2OBMA 3FA2A 4UFOA 4ERNA 4ON9A 3ROMA 1JKFA 4URWR 5G0SA 5A4MS 4LHWA 3D0QA 3IAM6 3RIEA 1NJSA 3VNRA 5JUWA 4AI6A 4J03A 2HJSA 3NHWA 1FTYA 2ODTX 1D0SA 2WTEA 4H1HA 3C8ZA 2CXNA 3CC7Z 1BJTA 3RFCA 3ZCUA 1Y8QA 1AMOA 3ZU3A 4MZXA 5I48A 1A7AA 2HADA 3KIHA 3V2HA 4B47A 2B2XA 1KQOA 3DBVO 4I19A 4J0QA 4RK4A 4ZVTA 5DCWA 3ZDEA 3G2OA 4B82A 4YRCA 2PXXA 4Q4HB 3VPDA 2XDQB 1T1EA 1BNCA 2GPNA 2GFHA 3BFPA 3E1KA 4D3XA 2MYNA 1GR1A 5IT9b 3AOEA 3KAQA 4QM7A 3AUKA 1IDN1 2UU9B 3WLHA 4TKMA 4YUAA 2DQKA 3MERA 3RUCA 3VR5H 1BROA 1J00A 4TLAA 2L82A 2QV0A 1CSEE 4C14A 5JJCA 4JENA 1EVJA 2O2SA 1P8JA 2FK7A 1DKRA 1KO1A 2XUZA 5HKAA 4M6WA 3I4MI 1DKUA 1BEZA 1M76A 3BF8A 3N28A 3B38A 1ETHA 3HVKA 5H81A 1QLHA 5KBYA 4YMTA 2WPDD 5L8VA 2E4ZA 1K7CA 3GRZA 3MCTA 3UTDA 2I2WA 2QM0A 4XWTA 2Q45A 4M1YA 2RGNA 3GUUA 4GEKA 4TN5A 4CQMA 4GXQA 5B1YA 4QBFA 1BHJA 1OYYA 1NTOA 4PX3A 2XUFA 3OPVA 1KZYC 2QE7A 2QXUA 1USGA 3AHCA 1X1BA 4FKMA 3JQGA 4UJ3A 4I6GA 2XNDD 3K9CA 5HOQA 2D3TA 1QVRA 2DETA 2R4UA 2Z1DA 1O0CA 1T2UA 3F5FA 3UK6A 1W94A 2VHZA 3QX3A 1N3BA 2DKOA 3K8QA 2PT9A 4O6VA 3QRWA 1LDYA 2SKEA 2YC4C 4UUNA 1CTQA 4UHKA 5F7OA 2P2GA 4WXPA 1YJN1 1RHKA 2BZ0A 5A03A 1JEJA 2YWCA 1SRRA 2BMEA 1DIOB 1XYVA 1T36B 3MT8A 3OX2A 3IVXA 1E9FA 3OLYA 5EZ6B 4Z54A 4PICA 2QZ9A 1D6NA 2R1ZA 2IU3A 4CL0A 5LOVA 2H2FA 4Y1GA 3NO4A 4CEHB 5ECYA 4M9SA 2WP0A 2D7JA 2V6MA 4ICIA 5DHFA 1CQXA 3AETB 3P2EA 4DMUB 1TAQA 2GGSA 2H54A 2Q6IA 2CMGA 1DUVG 1LVHA 4TQGA 3F78A 3BB1A 1KO7A 2E4AA 3DTTA 4WNCA 2VK2A 1U7XA 1I01A 1QAMA 3D3KA 3FW1A 4LK3A 5CB4B 4N8SA 1SIWA 2I6XA 2LPMA 1UBEA 1WO8A 3HXPA 1QHHB 3LLUA 3KJZA 3A11A 3JWJA 4YJ3A 5P8WA 5AHXA 4IBOA 1OLOA 1NUSA 4FSXA 4HN4B 4XGQA 3ZDQA 3TOCA 2C5BA 1TF7A 2B99A 2ZIVB 3IRVA 4LC0A 4N0PA 4PCVA 3WGOA 1DJPA 2J08A 3X1ZA 3TLKA 1GCOA 3GRCA 3I76A 4QYWA 2ECFA 2AOTA 2JFOA 3HDYA 1KHTA 3DNMA 4TZ6A 3N2KB 3AFNA 1P44A 4UKDA 2C7PA 5CP8A 1D03A 1LBQA 1W36C 2PGNA 1GSHA 4R6XA 3QMVA 2GN1A 2ZSFA 3DNPA 4RMNA 4XQEA 1GQFA 3LCUA 4LRWA 3TZLA 1MO5A 3E8MA 2NIPA 2GA9A 4YLEA 5F52A 1FNCA 1FDIA 1YS6A 4J7CA 1UINA 4WGFA 5EMJA 1G38A 5ALVA 1V45E 1DADA 3LT1A 3AMVA 3ZOZA 4BASA 4CF4A 3DEAA 4MQMA 1KFJB 4RSGA 2RCNA 4Q21A 3S1MI 2IYVA 4NZ9A 4M3NA 4O59O 4R7ZA 3VOAA 1Y1LA 4EENA 4RABA 4R71A 3G2MA 1F4VA 2B8TA 3TRJA 5JW6A 3BGVA 2VWQA 1E3EA 5F98A 1SCBA 1AXGA 4WKBA 1JE0A 1P4SA 3QKIA 4UE2A 2AYXA 1GCUA 3D3QA 4BECA 3IH5A 4LHXA 1IC6A 3OY2A 4YTEA 5K6AC 1DFIA 4R81A 3AM3A 3SYLA 3ZUPA 2OXEA 2WDZA 2PL3A 2WTXA 4A0FA 1P2FA 2K5UA 3A04A 5CNIA 1GZ5A 3QF4B 3BTSA 4ZODA 1QE5A 2X3UA 3RV3A 3EN0A 2CD9A 2EFHB 1NBHA 1IVNA 3EW7A 2LUOA 4U7JA 4QNNA 1XELA 2ETXA 3DB1A 3IPYA 3MPOA 1MIHA 4CGYA 3O75A 4IWNA 1VJ1A 1F4LA 2CLEB 5KYUB 2B8EA 2PT5A 3M49A 4LNHA 4YCBA 1FTSA 3VVBA 1Q1NA 4DA8A 1U1IA 2IHVA 3BXEA 3EEFA 4B35A 4D8UA 4CKWA 5KYWA 1AH2A 5J2UF 3AFGA 2GT1A 5EE5B 4MWTA 3IQEA 3QIVA 4QEKA 3MUOA 1LDNA 2QG9A 5CFZA 1KYXA 3G0GA 3OH8A 5HTOA 1IWBB 3IEPA 4OKNA 3VX3A 1PJAA 2ZOSA 3JRXA 1J2UA 2WV9A 3TDMA 1C80A 3BL8A 2XGOA 4R0VA 1OJLA 2DQSA 2O1WA 1C5KA 3LHDA 3SYTA 3QFFA 4I55B 4Q19A 4DM7A 4DLZA 2X22A 4PTLA 1LCIA 2UXDB 1VG0B 1GLGA 1VZ2A 2XNKA 3OEED 3TZEA 4M0CA 2W48A 1PJLA 2FSSA 5FI3A 1XMPA 1D07A 1KYWA 2GM3A 3AZPA 4BL5A 5L4NA 4TWAA 4PAQA 3PUVA 3RK4A 4WJLA 2VYFA 4HI0E 2VJMA 3UHOA 1DRWA 5ADHA 2QX7A 3OHSX 4XZ3A 3CVUA 3UMMA 1TA4A 1WW9A 4UCWA 1UBRS 4UU7A 1QGED 4Q7MB 4V2UA 4PU0A 3CPJB 3U0BA 2IS4A 4OJYA 5FXMA 1RLOA 3DZ8A 1RYFA 5AKKA 1L5LA 5T6BA 2EIHA 1EDDA 4Q7EA 4C4OA 3OIDA 3LI2A 1XN4A 4RQTA 3WJ2A 1I5RA 2C03A 2Q9CA 4UTRA 4ZYLA 1CEQA 1WQ4A 2QRDB 2HFKA 4LDNA 3GWGA 1V95A 1RM4A 1DIAA 1LK0A 1OXXK 2O9JA 1HURA 1GZUA 3C3WA 3G13A 1AZTA 3QLTA 3OLXA 3RNLA 3VR6A 2UZAA 4MPRA 4TNUA 3QU7A 1V6CA 4L6CA 1WU8A 3NASA 1JEQA 3QEKA 4YJGB 3GKQA 3JD0A 5B3AA 1MR3F 4BC0A 3R9WA 3SK0A 1C1HA 2NM0A 4NTZA 1GZHB 5IVKA 2ZYAA 1NUHA 3IB3A 1F2TB 1UPUA 3C3YA 2PX2A 1TVCA 1JB1A 3SPXA 4BN5A 1P2SA 5JHGB 1DXOA 3RYIA 5JRZA 1UM9A 5KNBA 1U1GA 4F4HA 4YV2A 4XYBA 5F9FA 3SMQA 3WQHA 4MW7A 3WYDA 1QYCA 5AOCA 3ZHTA 4BO0A 6ABPA 3K0FA 3S2FA 5FPKA 1CB7A 3PQ4A 2CGEA 4LXYA 4BB9A 5LU9A 5KNDD 3O4IA 5KDOA 5CCBA 4WV3A 3GJ3A 5TB5A 1CY6A 5CB0A 1A72A 2VEDA 2XMPA 2OQVA 4AMBA 2CJFA 2RK6A 2W2QA 2HW8A 3WA7A 1E2FA 4HDNA 2D2VA 2JATA 4KUGA 3ONNA 3THOA 3IIIA 1ILWA 3ZLTA 3H83A 2FUG1 5C8YA 3GA5A 2BJHA 1IOZA 1IXZA 5D87A 2OXTA 3JXEA 1HEUA 3UAXA 1R64A 2W90A 5ICSA 4J3NA 3D31A 2A0FA 4HPWA 1SXQA 1V8DA 4PZ0A 2A1TR 4WK0B 3M4ZA 1YQGA 2GLXA 3CCBA 1QH1A 1ISPA 1XVVA 1TWFI 1G8YA 1XRSB 5AW6A 3OP4A 5K0CA 3NH9A 4C08A 1LI5A 2A5DA 1F2DA 3CCRZ 2H7XA 3EH2A 3IQXA 4WN9A 1H6CA 5KPJA 4PCUA 4LWPA 3DBRB 3E7WA 2WWYA 4O63O 2GJSA 4IMIB 5B7NA 1G63A 2FV8A 3HC7A 4N0MA 1JZTA 2COKA 3LF2A 4H6VA 3OM8A 4B9EA 1JN0A 5F2EA 5FCDA 4BNUA 2JGDB 4HYEA 5AI8A 1JI3A 1PSWA 3DXZA 3DMPA 4BFVA 3WLFA 2PGJA 5HZMA 3RYCB 1D0IA 5I7VA 3WKBA 3HU3A 1NMSA 5B55A 5DNCA 2PO5A 3H2YA 4ENVA 4E12A 4BNDB 1OT5A 4TLBA 1GN8A 1Q862 1Q0UA 1X3LA 2BJVA 4K9LA 1MFZA 1W52X 2J09A 1J8DA 4MRAA 4A3MI 2XWPA 4QJIA 4QUBA 4CQNA 3R3ZA 1NBMD 4RHUA 1IHYA 4D79A 4KMRA 3REGA 3CLSC 4ACBA 3DMHA 3MOIA 2J4CA 1U3FA 4DA7A 1UDBA 4KE8A 4DQ0A 4EJSB 1Z0IA 4DJ5X 1IULA 2HUNA 5JZ9A 3NDIA 4CL1A 4PZZA 2Q9AA 3EGVA 1SIBE 2JGKA 2FWAA 5BV2P 2YYYA 1RQRA 4L0MA 2IGTA 1JI0A 4HNRA 1PE0A 2VHXA 3PC8C 3WP1B 2NSLA 1KI8A 3KSZO 1HFWA 1AHIA 1EDZA 2QUAA 4BJ6A 4YRLA 2Y0EA 2J5QA 3HLKA 3JARB 1BDMA 2PWZA 3FHCB 2ZE5A 4ZA2A 4IIJF 1HLDA 3KAKA 2IS1A 3HXLA 4H1UA 5C3UA 4G4IA 4GZMA 4Q24A 4PQEA 4YDHB 2GEBA 2WK1A 2YJTD 1DCMA 1IQ0A 2FPMA 2VYCA 3TGWA 1BC5A 1ZUNB 4DPKA 2NVUA 2RHCA 1EDOA 5CDYA 1MPXA 1ODTC 2UXBB 1JLRA 5JSKA 3KHTA 3O9VA 2KJQA 4M60A 3EC2A 1KYYA 3HRHA 3M1YA 4OFZA 3VSBA 2BGTA 4L0QA 4PG5A 3U80A 4A5SA 4C0WA 1H1DA 3ULKA 4CFYA 4OV6B 2X13A 1ICIA 2IPOA 3CTMA 4KAJA 4BKUA 7GPBA 2AJLI 2XHZA 1EHCA 3U60B 4IZOA 2PUFA 4BCDA 1E7SA 2CK3A 2Z6AA 5DI3A 1X0XA 3PFFA 4JL8A 1ADBA 1NNLA 1UJMA 1EFLA 2JAPA 4HRVA 3VSAA 2GEJA 2YXNA 3GVIA 4IFEA 4RL4A 4AY4A 4DG9A 1PP4A 2YWDA 1NG1A 1P7WA 3DZIA 4IDFA 4JP3A 1Q0PA 4HUQA 4L15A 2C5LA 2BI7A 2P6NA 2XUAA 3AO0B 4IV5A 3GD7A 4QQ8A 4N5LA 1KD11 3FPJA 2CLOB 2ZYRA 1ACJA 3FSRA 2FW1A 2P6PA 4I9HA 1MOQA 1YNOA 3RHZA 4HPJB 2NPFA 3S68A 3UCEA 1QF6A 2AXEA 1WCXA 2E7ZA 1DVRA 3NWEA 2XDWA 2H8KA 3HS3A 3RR2A 4AX8A 3KSUA 2XA1A 1BSVA 2BMVA 4JYPA 1ANKA 4UQPA 4EIWA 2PUBA 3O1IC 2AI3A 4A0RA 4FGKA 1VLQA 1QE0A 2OO7A 3LRXA 1U9JA 2Z3WA 1RJFA 1T8UA 4OHWA 4XI9A 3TMAA 1KMHA 2JIBA 3NATA 4ADSG 4QTUB 3ZIDA 3W2IA 5KJ6A 1M1K1 1KI1A 1T3LA 1P18A 3IAFA 5EP1A 4YHHB 3GGOA 3KKMA 4DAEA 1SPXA 3DHNA 4N0QA 3KE9A 1QC5A 1GQ2A 4GP7A 1KL7A 3FDFA 2IOHA 4ITUA 4QUKA 4DEXA 4Y9UA 4ZRDA 3VBEA 1H2RS 2PR7A 1E4OA 1DIRA 2Q3LA 2JJ1D 3HMKA 1TF5A 1E2MA 2EQ5A 3MJSA 3OHMA 4J0FA 4TVKA 3HSSA 3HBAA 3DT8A 2R5NA 2C1EA 3GG2A 4RMJA 5AKYA 1Z5VA 2IYZA 2I2FA 2PXCA 4UUOA 5AI4A 2C95A 3RIGA 2V65A 3HNRA 1JSRA 4PS1A 4R8KA 4QA9A 1NC3A 1RAFA 3A3OA 4A1OA 2JHCA 1X92A 5DK6A 4I1YA 4NYJQ 3A2KA 1L9XA 1P61B 2O3JA 3H5IA 5HTKA 3KPYA 2J0VA 4AYWA 2AH5A 1Q77A 1T4MA 3ZWDA 2J9FA 4H15A 1C4XA 1XRJA 2WHQA 1B8OA 1B43A 3L8EA 4XWOA 3OQJA 3UXEA 4A26A 2PD4A 4C6TA 4BRZA 2WZQA 5TIIA 1FJXA 4NCXA 4FP9A 3WIUA 4EMSA 2PNFA 1TEHA 2G9UA 3T1NA 3EXEA 1P0CA 1Y8AA 2XCRB 1E3QA 1L7NA 3S7ZA 2OMKA 2PLWA 4LVNA 5D2CA 4CMBA 2XR1A 2C4VA 3S2DI 3G88A 2REOA 3KB6A 4G9BA 1A7UA 3V7WA 5KVSA 1VSVA 2Q9BA 2O8VA 4F5DA 1W4CA 3SN6A 3CVWA 4B7AA 2GD2A 2I03A 1KS2A 5ERGB 4C7VA 5CIQA 4R8RA 4K40A 1KFKB 1Y8RA 2FMIA 2IU6A 2NU9A 2VUTA 3LQ4A 3PUKA 4O4LB 3CEJA 2PS9A 2V8OA 1JPNA 3OBBA 1M7HA 2H31A 2X4LA 3OIGA 4M1TA 2H1RA 4ZCPA 3RUDA 1NR1A 3EDRA 3K5HA 3NP9A 5F73A 4X66B 3C15C 1L4MA 4I4TF 4U2KA 4OH7A 1DAOA 1OWMA 4R4JA 1AE1A 1SZPA 5ENVA 1YQDA 1GLNA 1V71A 4HKTA 4I9UA 2VUGA 1UXJA 2E2JI 3WJAA 3KYJB 2QU7A 2ZJ5A 1FDVA 3DHYA 3PE6A 2GK7A 4MVYA 4F3KA 1AU9A 1SRQA 1V5EA 2HK6A 1E20A 3J80A 3DL0A 4RELA 1KIAA 5DWQA 1MAAA 1ZVJA 2WI8A 4L4RA 1XPRA 3PHJA 2W2LA 1J2JA 1JBKA 2R3SA 3O73A 4P80A 1J1IA 4Q0MA 5LMNB 1NAIA 4G84A 4RESA 5I9TA 3CFYA 3R1IA 3RWMB 2WM2A 1AIPA 1N2IA 1G3QA 1T15A 2YN4A 1CUWA 1MUUA 1NQAO 3EISA 3G6WA 3QY0A 4X60A 4EARA 5CLIA 1NG9A 1B14A 1FNBA 1Y7TA 1GL7A 2E5WA 3H2SA 4M7RA 5JR3A 4M9XA 3W05A 1QIFA 2DJ5A 1UFQA 4XCVA 1I6LA 1PVOA 2R66A 1FDWA 1RZRA 4KBYA 4JVMA 2WJVA 1HL7A 4IR7A 1YJ8A 3D0OA 3LNTA 4EG5A 3R23A 5FRDA 3K1AB 2C1XA 1TL7C 4NG4A 2CBXA 3U3KA 1W6RA 4CR7A 1WX1A 2OZVA 3TZHA 5K4HA 1PZNA 3AUSA 2PJUA 4LOIA 4DREA 4Y18A 1YQEA 1UK7A 4Z8XA 3I62A 1ZGBA 2YV1A 3L8CA 3ADDA 3LYLA 1W49A 3UJ6A 4X45A 3S70A 3LPMA 1S5PA 1H1TA 2WEKA 2RMKA 2WMOB 1COWA 3CT6A 1ZGJA 4KQ6A 1BXZA 1RW4A 1W9HA 2C54A 1EX7A 4JC8A 5BNTA 3GJ4A 1S02A 4YRPA 2NSDA 4W5NA 4H16A 5EKUA 3ZIAD 2DFDA 6AT1A 4LRQA 3S1QI 1P3DA 1C3OA 1YB5A 2WF9A 4GMHA 2AR9A 4NPCA 5TY0A 4WFIA 3ZE1B 3E5RA 1JXMA 4LDJA 4PZAA 3WBFA 4D0GA 2X1VA 1GUBA 2F1KA 1VBKA 4AJKA 5K6AA 3G5LA 3WB2A 3W7VA 3DLHA 4I08A 3L6RA 1NBME 2WF7A 4JLSA 5KYKA 4W7HA 3P9RA 4MVJI 3W79A 4M89A 1T5SA 1L1FA 1IPHA 1TUEA 1C8VB 2JA5I 4UEKA 4QWWA 3HCEA 1XTZA 1AKEA 1SUWA 2ZYIA 4IFIA 4KXMA 1U94A 1PWEA 2D74A 4OP1A 4J75A 4ARSA 5ICCA 2WQ6A 4URUR 3EC1A 3JQBC 3QQPA 3VMIA 3MGGA 3ZE8A 1ZC3A 1PKXA 2VN8A 2O0MA 6REQB 2AHOA 3K96A 1EJ6A 4OLJA 2GJKA 2P2CA 1IN4A 3H87A 3NC0C 3UFBA 1AG9A 1DEKA 1HYHA 1N77A 4XYGA 3CME1 3MWLA 4GVXA 4DLKA 4BKRA 1NW4A 3QEAZ 3ZWCA 4EVQA 4EI2A 3ZHVA 2PU7A 4DJTA 1QKKA 1KVRA 2C77A 2IYWA 3LK6A 3WXBA 4MLCA 4LTMA 1RNLA 1UBTS 2O3TA 1JEYA 1TQDA 1QU2A 2XZPA 3L1IA 3OCWA 2QAGA 2Q3BA 3SM3A 1USKA 1OZGA 1YDMA 2C3UA 4FDAA 4LZZA 4P08A 2PPLA 4YFVA 5G1NA 2GRUA 2OXRA 2WF5A 1I8TA 1I7LA 3H5WA 4D99A 2IHYA 2IXGA 2LIPA 4ZO6A 3TSCA 4CLDA 1JSZA 2G2KA 1F0PA 1SBHA 2BZSA 4MTCA 4P5EA 2HA7A 2AEMA 2OCPA 1FTWA 3AUJB 3OM0A 2LEXA 1YR1A 3MCVA 1LJUA 3X2EA 3R4VA 3E35A 4DCSA 3KQUA 3CCE1 1XK6A 3EXHA 4V1CI 4C5CA 1CS4C 5AVXA 2QMYA 4NOJA 3RC2A 5DBGA 2JLSA 1RR6A 3FRHA 1Y48E 2E48A 2H2DA 3WE7A 1JBEA 4HGPA 5T5QA 4QTYA 1KMCA 3CX6A 4OU5A 4W9RA 4NU5A 1T4CA 2X5OA 1QH9A 4MW5A 1GAXA 3LBYA 1GUYA 3BJRA 1SHUX 1EFTA 4G5GA 3H2BA 3WB0A 4KFUA 4A7PA 3N2GB 1Y1QA 1WUYA 4TL6A 2QTVB 3NDJA 4IF4A 1A9QA 1PNTA 1QMGA 2HSWA 1QGUB 5CM2M 2CLDX 2PZ8A 1YR2A 4HYQA 3RS5A 5T64A 3DC2A 1C1DB 4WKNA 1X80A 3U37A 2QVYX 1BZYA 1MB4A 1E79D 2FEKA 1N75A 3ZDCA 1YHYA 2C4MA 2QRLA 4MV6A 4ZO4A 5D3QA 3S27A 4DQXA 2B63I 1V47A 1LNZA 4R69A 1NQWA 5GTDA 3OZCA 3Q0EA 3VC2A 2YTZA 1A88A 3DVQX 2JGJA 4HQOA 4AN0A 2BVNA 2GBLC 4ZEXA 3T9EA 4ND3A 3COVA 4LY6A 1TEZA 1VJ0A 3EVCA 1JR2A 1RLUA 2XCSB 2XTZA 5KCMA 1E3TA 3S0JA 3ZC3A 1YIJ1 2Q2NA 1M9NA 1U7WA 4AQYB 4JLBA 2OESA 2BR4A 3PICA 2HHHB 4FE4A 1T6BY 4LJ6A 4PQFA 1VL0A 3A26A 3WIEA 3FN4A 2BGLA 4BNHA 4Q37A 2BCGY 4I3GA 3GJRA 3ICCA 1XTVA 3IUJA 1I0LA 1A3CA 4O0LA 2AR0A 3I8OA 3IOEA 3UHAA 2ANBA 3SBDA 1AGRA 3Q7SA 1PEAA 3CC8A 2YIMA 2Q3MA 5GONB 2IY7A 2WWWA 5DU2A 4M1ZA 2CLIB 4ZJYA 2YOHA 4XWGA 1JEOA 3M6VA 3RE1A 1VQPZ 1S3SA 1A7JA 2LKDA 4J3JA 3BEOA 1QM5A 5I7EA 5MN6A 4FQ8A 3ML1A 4D41A 2EFJA 4GNRA 2OLEA 3F6SA 3MT9A 1FRQA 3OZBA 4TMWA 3SHWA 2ZBGA 3WHPA 3QM1A 3QPBA 2OXFA 2HY7A 2R11A 3AF3A 3EGEA 3RF6A 2WWTA 3NBKA 1QR6A 3FJOA 2ZBUA 2ISCA 3TZKA 4N40A 1DOAA 3K9GA 4AJNA 3S2EA 2VTBA 2LIYA 1D4OA 3EA5A 3OZIA 4EGJA 2SCUA 3G49A 3QYFA 3T4EA 2DBQA 2DU8A 3G0DA 3AWDA 5F2NA 4JYZA 3ZDBA 2EL7A 4FBMA 5JU6A 3A2NA 1Y3FE 1ZOSA 4DIBA 2F55A 2QX6A 1E1RA 4WL0A 4RA9A 4LF4B 2GPSA 4P4TA 3TR6A 4F4CA 1IBCA 1NTRA 4JA0A 3BAFA 2WSSA 3QLVA 1NOIA 4H1VA 5KKAA 2FHPA 2QR5A 1JNYA 1EFVB 1JEEA 1XA3A 1NQTA 2FX2A 3PWTA 3NORA 4K6CA 1G8GA 3W4KA 3ZXSA 4BQFA 1NXPA 4EB6B 4EYOA 2YMPA 4IOLA 5JWOA 3RRNA 2JAXA 4PLCA 1ZD1A 1BXGA 3PCRB 1TWAI 3ABOB 1LA2A 5E1OA 1C3EA 3R8CA 1A76A 3AHJA 4IGAA 3SZLA 3WB9A 4DNOA 4MR8B 1HMYA 2O8DA 4QFBA 1AD2A 4B6GA 4DCCA 4KPYA 3D6UA 2YY6A 2JGRA 2NUPA 4FEAA 4RL6A 1U9ZA 2XYPA 3WGUA 1W0CA 4BX8A 3HJNA 2I4MA 3JSAA 3M9XA 3AEYA 3BCHA 2GEVA 3QBDA 4Q9JA 5BWMA 3ESAA 4F0JA 1WXXA 3JZIA 4MUMA 2IPMA 2Q4TA 4E1AA 4MYSA 1RYDA 4X84A 5CPFA 2IHTA 4WCFB 3K6SA 4QUEA 3K7AI 4DLNA 3THXA 4YRTA 5I9IA 4BWVA 1NVTA 1FJ2A 3M0EA 2MR5A 4CNBA 2XB2A 4ETIA 2A30A 4JMPA 3R3SA 4TXHA 2NP7A 1VECA 3O9MA 2Q3JA 2EFGA 1Y1PA 3ANYB 1VQM1 3JZMA 1I50I 3LCCA 5LWQA 1VMIA 1N7HA 1S2LA 4HS4A 3HFSA 3KEQA 4YQEA 2W70A 1PTJC 3MQ4A 4ZEMA 3W6ZA 2H4JA 5HSGA 4GQBA 2BF4A 2G70A 4HNAA 2ZRFA 4CMHA 4ZT5A 3SF8A 3ZQJA 4D7AA 2BFDA 3P0IA 4GL2A 2VK1A 2HZBA 4WVFA 1U1DA 3UG6A 3OQMA 4ZI3A 4ZZ3A 3X1JA 1SIUA 1DXHA 4NBAA 3D2CA 3QPCA 1MEJA 3TFOA 2NQ2C 2H4YA 3RIHA 5FPQA 2AZDA 1M54A 3HO1A 4R1TA 5BV1A 1XLWA 1FDUA 1FDOA 5CYOA 1GYPA 2XUJA 4AX4A 2PT7A 4DV5B 1BMFD 1WMAA 2FUEA 3FF4A 1BU5A 2B0JA 1LLUA 2EBWA 4QXAA 3NGXA 3E1GA 1U3WA 5FAXA 1XD2A 2X2OA 3GH3A 4CU5A 1OILA 5LP6A 3WL7A 3ZV4A 4B2IA 2YFKA 4AG3A 1BVRA 2W6ZA 2ZYDA 1Y5RA 1YI1A 3GZ4A 4XCXA 5EJAA 4DNQA 2O8FA 2O6HA 5DHAA 1I1HA 1THTA 3DA8A 4K6MA 5AOVA 2I1LA 3A4LA 4PF1A 5JXIA 1TTPB 1R0SA 2Q6OA 3HHEA 4YMGA 1LTKA 3D2AA 2BEVB 2HFJA 5CG2A 1JDNA 3HA3A 3OM9A 1T3GA 4IIDA 1HYQA 4IICA 3QE4A 1CUHA 4Y6GB 5DV9A 3VUFA 5KJFA 3RRXA 3O95A 4MS1A 2QM7A 5F2KA 1DL5A 2Z0MA 2HSJA 3VMHA 1UKEA 3EEQA 5H3HA 1HNNA 4LGCA 2F4OA 1L3IA 1QNFA 3P20A 5E9JA 1YC2A 2OHGA 4Y1RA 3UEOA 3WO0A 5KTOA 4XX2A 2I3GA 3DO5A 1QZXA 3KKOA 1OFUX 3AUUA 2BWJA 1FA9A 3PO3I 2VRCA 4LZWA 4KITB 2H4WA 1QK4A 4PR3A 1W59A 3NBZC 1D1QA 4B4UA 2ONKA 4L57A 3X1MA 1QP0A 1V3VA 3BRSA 2E4YA 3C87A 3QE3A 1LUAA 4XLTA 5EQTA 1T6ZA 4JLWA 2ORED 3UUGA 3BSWA 1BX0A 4G5HA 2UYHA 3NBXX 1CUXA 1XMJA 3AR5A 2V6FA 4NOLA 5DNUA 1V1RA 1VLVA 2JFUA 3NRCA 4I9FA 2C0QA 2IOQA 2X58A 5CM2Z 2OPHA 4BB0A 2QOEA 1XTQA 2NUAB 1YK0A 3UK1A 4LNAA 2VQ3A 1UKVY 1EXWA 1GV1A 5I4BA 1QCDA 1EIZA 5JH7A 4BQEA 4JCCA 4YFYA 5E7IA 1UIRA 4NONA 2FFQA 5LQSA 5JMTA 3HGQA 4DUZB 1G9SA 3GTMS 3TI7A 4DQUA 1WRBA 2UVQA 2JPDA 3B78A 2IQ5A 2RT9A 3RRMA 2C5AA 4EGFA 4YUZA 5TC4A 3NJRA 1E2DA 1IHPA 3WYFA 5LDDC 4B3TB 4MJLA 3FOBA 3TW8B 4EG6A 1GVHA 2QLMA 4NBSA 5BQ5A 4EW1A 3AI1A 2RAUA 2YXDA 1IY1A 3QENA 1NSTA 2C9OA 4G09A 3RJ9A 3JSXA 4HDMA 2IE0A 2VA8A 3ED1A 3MGKA 4FMBB 2FSVC 4EO4A 4FFLA 3ZY4A 2QMQA 5HBGA 4P7FA 1NBEA 2WJYA 5BW8A 4DV3B 2IOFK 5KMGA 1IXSB 2BFWA 3DFFA 1TT7A 3FPFA 3LOUA 1QQAA 4B79A 1EA5A 4X64B 4M49A 5HZKA 3CC41 4QKQA 1DX9A 3GROA 5T7BA 3WOVA 4DM4A 3FDJA 4Z4FA 4EUEA 1C7ZA 3VYVA 1XROA 3ZBUA 3JVDA 1CEYA 4JEIA 2O2XA 4PRLA 2OTJZ 4DR7B 5HJEA 1QB8A 5FA6A 1RC1A 1DKNA 1RO4A 2P77A 1ZXLA 2YN2A 4NI5A 4PTZA 5CA0B 5E3HA 3MMSA 1T9CA 4KHPB 3CTPA 1CZLA 1PT8A 3KPWA 2FN3A 4LBZA 4R0MA 5JS6A 3CQ9A 5G02A 3V55A 5DM1A 3UK7A 1CUFA 1D1PA 1ZM4A 3FYUB 1ECFA 3B1JA 3R3JA 4C43A 1ZVQA 1NFFA 1WV0A 4IQ8A 3WO1A 3BXZA 3KHUA 3B1KA 4MV0A 5I7SA 3PLAE 1KRHA 4X7BA 3ISVA 1YSCA 5A2Qb 2Q4BA 3OESA 4RVUA 1MZPA 1JQEA 3OTHA 1PT9A 4FOSA 4EZBA 3SIXA 5C8XA 8GPBA 3KUCA 4OTZA 3GA0A 1XZCA 2J85A 2PH7A 4AVYA 1FP4B 1L4BA 4AL4A 4FFMA 2FR1A 2F9FA 4OSOA 2DPXA 4R5HA 4Y2QA 1U5BB 3O8CA 2QN7A 5A7HA 1L5VA 2MSDB 4G0MA 3HB4X 3PKIA 3GRYA 3M6WA 2GJ8A 3EF3A 3GVHA 4YCDA 1SC4A 3V1YA 3KSMA 3TXXA 1MDBA 2OZKA 1GPLA 3CRQA 3GRPA 3IQDB 1Q7BA 3ZKWB 3SZUA 4KN9S 4DLYA 1F48A 4HSGA 3IS3A 2ZGVA 2ZQYA 3V1TC 1K9SA 4G1VA 5I8PA 1IN7A 4BDTA 1E1YA 1ZJZA 5DTEA 3VNAA 1WW8A 4AQDA 4DSUA 4DHWA 5KSPA 3EGXA 2C9MA 2A9FA 3L01A 4NBEA 1JR3E 1U2EA 2IEYA 3OEHA 5JISA 1Q2XA 3DVSX 4D25A 4IIUA 1FRFS 3TBFA 1WZUA 3V34A 3TG2A 2QTMA 2DFPA 1W0KA 3IHKA 3HHPA 1EU1A 2V4MA 3EEOA 1QLWA 3RFVA 4RPLA 4B2YA 1MP0A 3KQPA 1EGVB 1Q1QA 1WPXA 4XFKA 5IEJA 2EX4A 2GXAA 1UMBA 3IJ5A 3JAMb 3CN9A 1KAHA 1CS0B 1E6MA 2BGJA 5BQOA 4ARVA 4PIVA 1T4DA 4YMIA 2HLPA 1VQ41 2NVBA 1V96A 2PH1A 2VWHA 4A27A 4BX2A 2C2GA 4FFBA 2JBAA 4QTTA 1SCIA 3RVOA 1UOEA 2C88A 5DSZA 3VR2A 2GF9A 2I6GA 5AQEA 2WKSA 3TQHA 4W4TA 1QVGY 3GTGI 1N7IA 3I2IA 4H18A 4EZIA 1V4VA 3QVGA 2C97A 3JQBA 3JVVA 3PEFA 3DOIA 1TFRA 1T8PA 2AOVA 1QYDA 5IJXA 4AJJA 1PZFA 1VRVA 3MZ0A 5LYJA 2GZRA 1GNQA 3C3JA 3UTCA 5C37A 2NSHA 2BMFA 2OR3A 4NCHA 4J8PA 1WULS 2BAGA 4WLEA 1IOWA 1J1UA 2I6UA 2H1SA 1HDCA 4FLFA 4NAHA 1X7XA 1NBOA 4XEUA 1YFLA 1ID1A 2C04A 1K8QA 4HQLA 1QF9A 4JEHA 1FMCA 1M73E 5T67A 1GGHA 4LRXA 4O4IA 3WWDA 1X42A 1HYEA 3QNUA 5HJ7A 1J56A 1RAHA 5MN5A 9MHTA 2ZS8A 4M8NE 3BK2A 2V9PA 4MJ7A 2PZEA 4CG1A 3AV3A 2QVCA 3I2KA 4UZFA 1CLEA 2X4IA 1IEQA 4X1YA 5GWXA 2B2NA 5I8ZA 3R0JA 2V45A 3BWYA 5ARDA 4QIHA 4EAAA 4BE4A 4F4IA 4RFLA 4IDHA 3Q40A 2CNBA 3HYNA 3HCBA 1A8SA 1RE0A 1U7DA 2DH5A 2NSYA 5DOVA 3GEIA 3HWRA 4N03A 2GZAA 3I09A 1U3DA 4O4HF 3VYRB 1DG3A 1UMDB 3E5MA 3LYUA 4NRDA 4TS3A 3SICE 3Q6NA 1U28C 1SB9A 3NVMB 2QD3A 4GSLA 3HABA 4KE6A 3ZV7A 4D0RA 2DB3A 3PIDA 5FI0B 4E4TA 1R4NB 1P3Y1 2YWXA 4F84A 5H68A 1RKUA 2A4MA 2VPZA 1GGJA 3QKRB 3BGSA 3OJEA 2N0SA 2RSLA 1V26A 4I1UA 3WGNA 3DOOA 1RHUA 2ZUWA 2V9ZA 2PL9A 4F93B 1Z0DA 2WDPA 3MJ4A 2G8NA 4NJMB 2UUAB 1O2DA 4DBZA 3LAWA 2GEKA 2EJTA 1CR2A 2NZWA 2V6IA 1WKCA 1UBFA 3CNEA 4XIFA 4FYVA 3AVUA 3GAFA 1KA9H 3PGVA 5C4GB 2OL4A 1S721 4OK6A 1DDOA 1JFRA 4DLBA 3RREA 4RNCA 3HJCA 5ILGA 1KEEA 2OGTA 2PY6A 2I9KA 4EJSC 4PG4A 4FD3A 5LMZA 5KQMA 3AP2A 1T3ZA 3PF8A 4FU0A 1MABA 4KQ2A 3VSDA 1N6HA 1V3TA 1YK1A 1P1RA 2JEYA 4LPSA 2OZLA 1Z4QA 4B83A 3MZKB 1ORHA 2ZJ8A 4TROA 1PJRA 2FZ5A 2P27A 3O94A 2HEGA 1WY7A 1O95D 2NZJA 5JJKA 4WA7A 5ELXA 3EVFA 1BFDA 1KOJA 4YP6A 3GCZA 3AZQA 1KU6A 3P9ZA 2VCYA 4E2FA 4F46A 1S3FA 5CA1B 3SWWA 3QYPA 4JNCA 4MQFB 4WBNF 1Y7HA 5DYWA 4L6AA 3LPAA 4QASA 3ZWMA 5F9HA 4ZOLA 2V5VA 2HT6A 3AIIA 4JI0B 2W4MA 5JVDF 6GPBA 1QNLA 3FZQA 3I8SA 4L27A 2V6GA 3VR4H 2YFQA 1IB0A 1YQ9A 4KW7A 4HEA1 4U7TB 1T0IA 5BQFA 1P1IA 1B8VA 1HK7A 2PKWA 3AF4A 2VTEA 4H7KA 4YGYA 2I99A 1G8JA 4NEQA 2OOXB 4KUHA 1QRDA 2RK3A 3N2LA 2KYRA 4ID3A 1VSTA 4PNHA 1CUDA 1S4MA 4Z0HO 3HCNA 4N6OA 4MD7A 5A4JA 4NBLA 3R5KA 1XAJA 5IJ0A 1J24A 5CDGA 3DLTA 3KUXA 3CX7A 2TRSB 4CUKA 2PZJA 2DPGA 2PKCA 3HEMA 3IIEA 1Z35A 3EAFA 4JY7A 1PSZA 1F2UB 1WU7A 3REQB 5HM6A 5LNK1 3CVVA 1LX7A 3CKKA 1ONSA 1YE3A 2AI2A 3L1VA 3OZXA 4TWIA 4LSGA 3V97A 1YDEA 2HWYA 1FLDA 1DNPA 1KP2A 1R0KA 3NTUA 2VRBA 3CXRA 1BOFA 2I76A 3SZ3A 4DSOA 2ZKLA 3PDIA 3E61A 1DT5A 1T8WA 3HVHA 1CUYA 2XRMA 1Y1TA 2YYAA 3NLLA 3P4YA 5EMNA 2PUWA 1PFQA 5TQ2B 3BJIC 3QXCA 3Q7PA 4QRHA 3T3GA 2VG8A 5B2EA 4IJUA 4R1PA 3NKLA 3GNSA 2FPPB 4UW9A 4WK2B 5IT0A 4LJRA 4F21A 1ORRA 2JAOA 1ORIA 2WVHA 5TPZD 1DJQA 1V5WA 2J3QA 1I0IA 4FDMA 3UGTA 2J48A 3HKBB 5JI3E 3DFIA 1S89A 2QI9F 2C7RA 4C2BA 5KYGA 3VGJA 2LNDA 2BZ1A 1T9KA 2LD4A 1FSSA 1RKVA 3CH4B 3WKAA 5I47A 1VKJA 3NVAA 1B26A 1OY1A 2WILA 3CISA 2VOEA 1ZD9A 5F77A 4BXOB 5K8TA 4TVBA 1PR3A 3BIXA 3NBAA 4TL9A 3BS4A 4EA6A 1L9KA 4KWHA 3HU1A 5D7NA 3NHBA 4K6KA 3GG9A 4WQMA 4W1PA 4AXBA 4F86A 2GN8A 1T3TA 3HGTA 3P0JA 4NCIA 5AW0A 3DTVB 4D8VA 2FW9A 3ZNOA 3V8QA 1JH9A 3S55A 4OXQA 2GZDA 4DE5A 1GILA 3L92A 2AG0A 5JZVA 4C4XA 1EFKA 3ADCA 4NMXB 1N34B 2BHRA 2IZ5A 1J5XA 3AEXA 3O4GA 4HB2A 3UMCA 2I3BA 3RUEA 1JEAA 5IBRA 4DC1A 5BVHB 1VQ51 1ZNWA 4BTLA 2Y99A 2O23A 3N6RA 1ONOA 1I5EA 2H11A 2XIQA 2R92I 4RTQA 2VLIA 3TXAA 4JR2A 5FOSA 3TCXB 3QU5A 4QEZA 3LL7A 3O2SB 4Q1FA 3G6E1 1L7OA 3HVJA 5GAJA 5CDFA 1DAHA 3ER6A 3IUBA 4KK4A 5G2OA 1KARA 4ZI7B 4LUCA 1G18A 2A9RA 2VTDA 4IXNA 2DKNA 5MF6A 4C3UA 3GU3A 3R74A 4WI1A 5CFNA 5CGZA 3L7NA 1T10A 5CLQA 2IV2X 2JB9A 4OB8A 4OQXA 1ZIPA 1RWWA 3D1JA 1K92A 2Q28A 3PQ8A 2XKJE 4JOBA 3PSHA 1PV2A 2Z4RA 4BRSA 2XTAA 3NMUF 2EF1A 3EARA 2JAUA 1E1NA 2F3UA 2Z58A 4ER6A 4EVSA 5EHIA 2X4DA 2G88A 2B1QA 4B3BA 3PEYA 3C6ZA 5B1DA 4B6RA 3RNOA 4B3MB 3LUJA 5JAPA 3SNKA 4DS3A 4DWJA 5EIEA 1K2WA 5CLHA 5HKBA 4DIEA 3PENA 2QUHA 5B53A 1BD4A 4BTEA 3ILSA 3R24A 2QYSA 4H7HA 5JD6A 2JFYA 3LY5A 2GNPA 3Q10A 5J63A 3ZBPA 4B4WA 4Z1OA 3UFXA 3DCIA 5HUHA 3SZMA 1Y1KE 1T36A 2YY7A 3I2JA 3D1LA 5LUBA 5KOHB 1K6MA 3COPA 5JS2A 2WIFA 4MP8A 3LXXA 2R6FA 2RKWA 4R1OA 1PS9A 3JVUA 1L4HA 1PKEA 1I4TD 3NALA 4UQLA 1O94A 2C3YA 4L8GA 1HE3A 3DAFA 2WM9B 3QI7A 2P5TB 4G1BA 5JEDA 3D3EA 1AGXA 1QXSA 1E99A 2ILVA 3CSDA 4FGSA 3G1TA 4ZZ0A 5LQCA 4NE9A 3T7TA 2GBPA 2AJDA 5LZ2A 5JDIC 3R3YA 3AY7A 3CF0A 2EZ8A 2A9PA 1LLFA 4LZOA 3I61A 1A9SA 1S2IA 5E2IA 1E4EB 1N1EA 3W90A 5DCLA 3CWQA 5EEHA 2K7FA 1D2EA 1ADJA 3DVAA 1K5DA 1Z17A 5AI5A 2J31A 2XSZA 4NBRA 4KYVA 3KJEA 2CUZA 3GI1A 3HJBA 3KFXA 2CKDA 1MB3A 3B52X 2GCOB 2APJA 2Q5FA 3KLBA 3EXFA 3KEOA 4IZHA 1EDBA 2MJLA 3JQQA 2FQ1A 1K6JA 2OKCA 3LPDA 4E7PA 3IEMA 4PHGA 1Z0AA 1NKVA 4UAGA 4E11A 3BPSA 1K8A2 4TMXA 2R1UA 4AKTA 2UVPB 3VC3A 2ZYUX 1YBMA 2O3RA 3EASA 3FZNA 2VXYA 4R2WA 4S3MA 4ARUA 4X3PA 1GPMA 3V2IA 1FY2A 1K8XB 2Q5QA 2QTBA 2LDBA 3UANA 1KY5A 2XZTA 1JG6A 1P2BA 3L1UA 1ESEA 1I13A 1T35A 3FVWA 3TQOA 2ZR0A 3QA3E 2ESRA 1L5ZA 3T35A 4DMRA 4DR6B 4RA6B 2DTEA 1VIMA 3VUEA 2B94A 1O5OA 5L6LB 4M0UA 5KINB 2RE8A 1E94E 2P5UA 4YRQA 2GD6A 2H65A 3OA0A 4GQAA 3NHYA 3IBCA 4OL0A 3RT1A 2XW6A 3SM9A 5CT4A 1K97A 3OZTA 2RHMA 4KO8A 1M6VA 2ADMA 3M5PA 1E9RA 3BIWA 5LC1A 3PE3A 4XUEA 1J06A 5JAQA 1YR8A 2XKBA 4BNNA 1RKXA 3ESBA 1AC5A 4H9GA 5KOJA 1NAHA 2QUIA 3JQFA 3VU9B 3TPZA 1GQOA 2RGEA 3BMCA 3AERB 1F8XA 4L1KA 4IJQA 5EMMA 2PKQO 1KDRA 1U1CA 4OXKA 2EJVA 4FOOA 4PZEA 4FCVA 1PDVA 1H6DA 4RHXA 4A8JA 1C3VA 1TT5B 4HH4A 2WUEA 1VKOA 1IN5A 1R4MB 3WLLA 3B6EA 4MVJF 4BZXA 3F6EX 4Z7OB 4RGVA 1B41A 1YDWA 2IPAB 2W6IA 3KXDA 3P5SA 2HTEA 2QP3A 3QOFA 3O21A 3A1CA 4MLPA 5THXA 4BGVA 5DX0A 2X4GA 1VLAA 3G4SZ 2AQHA 4TLMB 3PTLA 1OTYA 1ZPDA 4GRAA 4KTTE 1J0CA 1QIMA 1T8TA 1H8EA 3MN1A 4MR7B 4BC1A 3NXSA 4KZKA 1LPSA 2OG2A 3RVDA 4H7JA 1IG0A 4O33A 4QQNA 1NXXA 1QVGZ 3IIKA 2YXBA 4PANA 1KC82 4QYIA 4RXUA 1KP9A 1YASA 5EXSA 1KK2A 1M34E 4KPEC 5FOXA 5B58T 3FMPB 5DSXA 1WVMA 1L5NA 2VF5X 2B1RA 2W2MA 2NVTI 5HBRA 4YAIA 2PSFA 4OKSA 3UM9A 5KAPA 4D4GA 3UJ3X 2V1UA 1TM1E 1XA4A 4M0EA 1E2KA 3RM3A 2W8BB 2I2DA 4FHEA 2GFIA 4V3CA 1ZH8A 3Q2KA 1FE8A 3NIDB 4GLOA 4KXWA 4NS1A 3TLGA 4GI3A 5JSHA 4HP8A 5ES3A 5JSZA 2AUTA 3TJMA 5F7XA 2C98A 4A9AA 1Z34A 3IXQA 1O8BA 4MYUA 5A5DA 1IAQA 1KYZA 2VEOA 1MOZA 3OZVA 1M7BA 3IBTA 4RE6A 1M2FA 4WHMA 2NVWA 5MN4A 3PD0A 1G66A 4ARCA 1UQUA 3MAJA 1PDWA 5U1PA 3T1OA 1W93A 1OASA 2H2AA 5EPOA 1E5TA 2NX2A 3A06A 2G07A 3A9UA 4GDMA 4QSMA 3N39C 1JQDA 5J4KA 5K0TA 5BMVB 1I4DD 2FPKA 1U02A 2NO7A 1A4RA 1UL1X 1QP8A 1ZN8A 4CMIB 5B58C 1RI5A 3O74A 4E21A 2PH5A 3KOZA 3W7BA 3GFVA 1YI21 1BE1A 2HNAA 5I45A 5E6SB 1EQAA 1QBGA 2Z04A 1N2HA 5FV4A 3VPCA 5C0OE 2B30A 3CYFA 3U3MA 4YQFA 5CEJA 2FUNB 4Q4LA 1Z3IX 3B48A 4QG7A 4ZXFA 1K8RA 2B5WA 3M82A 5IHXA 4YR9A 5JCJD 1N9GA 2JS7A 2YWBA 1J0DA 5ALLA 2RHLA 5LXTF 3ASYA 3ROFA 4CNQA 1P9RA 1RYHA 1ZA2A 3HL0A 2HK8A 4AUNA 4U2DA 3Q7IA 3DQZA 2ZBRA 3H75A 3A1DA 3QE2A 1R50A 4R7TA 2OHFA 3CCFA 1EJBA 1BWPA 3D59A 3TTTA 4WE3A 2VQ6A 3UT0A 4TV9B 3O91A 4IDNA 2FOLA 1UEIA 3MWKA 3IDSA 3ZWYA 1KXJA 3IKLA 4UHBA 1OV6A 4BJ5A 5JAIA 3A05A 3BRQA 5EKDA 1NM5A 1L8LA 1O5TA 3I6ZA 3IHWA 1ISMA 1XCBA 1MN6A 1CDOA 1K731 1Z4OA 2EFEB 2ZIWB 4KQFA 3RRJA 3UICA 2VS1A 3OQ6A 1FLAA 2HDHA 4LV8B 1VIAA 1ZEJA 4Q03A 5IVHA 1FDTA 1VQOZ 3IBFA 3JVEA 1G8MA 4M9UA 1Z07A 2C2MA 1UC8A 1GPKA 4YREA 3I12A 1USPB 1P29A 5IJ9A 5KNCA 1KGDA 3FUTA 4E07A 5MFPA 4FDVA 2QA4Z 1DBRA 1W76A 3IOYA 4K46A 2HF1A 4RUKA 1EA7A 5IARA 3RK0A 4YRMA 1N7JA 3WWCA 1HBJA 5ALRA 4M9RA 3EIOA 4IIHA 2VKQA 1Q20A 1UXKA 1EHIA 3I1IA 1L5FA 5THKA 3TQFA 2J0QA 1NJI1 4MRIA 1SC3A 2PBZA 4IX9A 2JANA 2WAAA 4O5AA 1FPMA 5IKEA 2R85A 1Q57A 1Z3CA 4ND8A 1XKLA 4IHAA 2QKDA 3SVLA 4LX0A 4DCJA 1QP7A 2VZ9A 2WE7A 3H5VA 1BIFA 4L28A 5DM4A 5CXUA 4JN6B 1Q50A 2GF0A 5F7JA 4E5UA 4NV3A 5SYAA 2VQSA 2W2XA 2P9CA 5CT8A 3AJ9A 4KR0A 3I72A 4KN8A 3RAEC 3M4JA 4URHA 2GYVA 5T4EA 2ZLBA 2Z4SA 3GFBA 1AZWA 1DRUA 4TQUS 3VMMA 4Q3KA 3LSYA 1UAAA 3VH4A 1NNSA 3IPAA 2DULA 1XGKA 1CZRA 1NR7A 4M21A 2V8JA 3S99A 2XRFA 3GP5A 3IR5A 3FB1A 4E5DA 4YNBA 4BX0A 5AJWA 4ZGGA 2PV0A 2FUG6 1NJ5A 3FWNA 1OIWA 3T3HA 3UYLA 4B09A 1V1MB 1GG2A 3GQBA 3GLHE 3H0GI 1S2DA 1DU4A 2ZUUA 3ICWA 4F60A 5HP4A 4XJSA 3Q3HA 2YS7A 1H3NA 2BE9A 3ET5A 3VR0A 5FT9A 5GM1A 1ZK3A 1IATA 5G41A 2FEPA 3P32A 1R9TI 5DRTA 1PNRA 2QG4A 2WRZA 4NLLA 3PL1A 4B81A 1B4DA 3MONA 2E4VA 3QKTA 3BWCA 3G2QA 1PUIA 3NHZA 3QPVA 3JYPA 2X2EA 5ALFA 3WIDA 3S2GA 2HQBA 1NF8A 5K03A 2G72A 2WD8A 2WFAA 4NDAA 4MA5A 1CUVA 4HQ0A 1YQXA 3H9QA 3TTWA 4YPOA 4RK6A 4YMHA 4YCMA 2IC5A 1N2XA 1TLLA 2CW5A 5DNAA 5KUTA 3C85A 3CMAZ 4HRYA 1C50A 3BRCA 3SFTA 5A5EA 2LWIA 5LQJA 2VNJA 3HVUA 1W2HA 2ZBEA 5IXSA 3MWFA 2WFLA 3HSYA 1P45A 5J58A 1T0PA 2J30A 2ZWAA 2Q0XA 3MWGA 3PFGA 1ZISA 2QJWA 2W58A 3DYVA 2HH9A 2QRZA 4MQEB 4KE7A 1W48A 3ZJ5A 2VAPA 2PMZA 2E6KA 1ZH0A 3AL2A 5J9FA 1ZJYA 4HWRA 4U7PB 2WZCA 2XMZA 2GHQA 4PO3X 1AKVA 5FOTA 4B7ZA 1IM5A 4EABA 5CDSA 1PEYA 1VM6A 3TNLA 1L5KA 2J9YB 3NIGB 4HAYA 4QOJA 5ELLA 3C3KA 5B36A 2Z3VA 2JCYA 4KQMA 3PC3A 3FFWA 3S7TA 4BFUA 2ZAEB 3IP6A 1B0AA 5IAEA 3TMYA 1XTUA 1WAMA 1VB5A 4P3YA 2HDOA 4RD0A 2E3JA 3GCFA 3JQAA 5ICGA 2N3ZA 5SZHB 1NI3A 1AK9A 4BLRA 2A5YB 1CW2B 4MWCA 5K8IA 4NENA 3LOQA 1J8QA 1XKQA 3L05A 4A3KI 3B7WA 2A88A 1RT9A 1LSSA 3JW8A 4OBWA 621PA 5H9WA 5DNYB 1V8ZA 4Z9BA 2VXBA 1Q7CA 2HF2A 2OCYC 2X5NA 4TUYA 4WZBE 4CI9A 1MJFA 3A6PC 3AW8A 1KDZA 4A3CI 4A2QA 3IRUA 2WHYA 4TV8F 3SBEA 4INAA 4ABTA 2G1JA 1XZBA 1WDWB 3H5TA 2W6OA 4LI3X 3GGGA 4GBMA 4R98A 4YWHA 5JPCA 3AKEA 4LF8B 2JBWA 2ZZNA 4LE2A 4CRWB 1Q11A 1JAIA 1YACA 5EUBA 2RJ3A 1SXPA 2FEXA 3VNUA 3A0UA 3V3KA 4CL8A 2YZGA 3EWNA 1JIKA 1T2CA 3ZNQA 1KVUA 3IMCA 3V8BA 5LOVF 1INLA 1X86B 1NPYA 1TYZA 3HKCB 4KN5A 5EESA 3JAWA 3K70D 3GUVA 1TM2A 1ZIYA 3H7AA 1C4WA 1UJBA 2OFWA 3RU7A 2W71A 2G1KA 3GARA 1W25A 4DDUA 1KMQA 2BSQA 4BNZA 3CZAA 1ECJA 3LZDA 4XX1A 5C1OA 1G8AA 1TFUA 4EL0A 2JHAA 3SBXA 4P81A 3DE2X 3OLQA 4EQ6A 2J7PD 3D6JA 3C0KA 8ATCA 1VQN1 3ZW9A 1UBJS 5B7PA 3HCDA 3EMDA 4MJ3A 3VM6A 5DTQA 3DHVA 3JRNA 2QQ0A 2XH8A 4K2AA 3RBVA 4GZ3A 4FUTA 2PTHA 5AM4A 4YMVA 4EY7A 4KLAA 5LVAA 4Y2SA 3BWVA 3AF5A 4GHWA 2BFEA 2OCGA 3HB9A 3EZ2A 5BOSB 2BW0A 5HIIA 5I9SA 1L8OA 1ARZA 4Y8VA 5JSFA 2GCEA 1E7QA 3A14A 3DZFA 2C59A 3HYCA 3OPYA 4INJA 4TQAA 4X92A 4A73A 3C7KA 2JDID 3O6VA 1ZBDA 5LUAA 3DBHB 3ZY2A 1FC0A 4B8YA 1JSLA 4PG7A 1DV1A 1IONA 1NVXQ 4GKBA 4LCEA 2RHGB 1ECGA 2F2TA 3FGOA 3G9ZA 4FN4A 4O4LA 1E1DA 2YQ4A 3IBYA 5JSYA 2QRUA 3E18A 2NTVA 1X70A 3EGDA 1F17A 1JJFA 1HOTA 1Q84A 1SVLA 2VDWA 1JFVA 3OE7A 2B92A 1U0JA 4FFSA 2RDMA 1Q1BA 1U0BB 4BU1A 3U3ZA 3IE1A 3WWEA 3HR4A 3N87A 3KVYA 1ZYUA 2GYWA 2VDKB 2OP1A 5L9AA 4PAWA 1OU0A 2PWAA 1JQJC 2JFGA 5IM4A 3O7MA 1C8LA 1VQ81 1IK4A 4LJ8A 4FFWA 3COSA 1II9A 3FYUC 3ZTTA 2RHHA 3S44A 3OTOB 2BHTA 4CMCA 1EBUA 2EGHA 3E48A 2IUEA 3EXIB 4BJHB 1XSEA 2HCBA 1DQZA 2O2JA 3VJKA 4EI8A 5K3OA 1XZEA 2O1EA 221PA 3MG9A 1ZD4A 2OILA 2IP2A 1M2EA 1T2EA 1B15A 2VJBA 1QONA 4ZO7A 3EK2A 4JQCA 1F06A 4KHZA 1ISGA 1MZVA 4N1AA 1C9KA 4WDQA 3GT0A 4JWKA 5K7SA 2ZM5A 3B6ZA 1NVMB 4L9AA 3AP1A 4WXMA 3KEGA 3WKDA 5KTRA 1NXWA 2JK0A 3P9NA 5EC8A 1B74A 4N5DA 5EZYA 2BR5A 3AVPA 1X7WB 1VLJA 1I3LA 2MU1A 3G711 1VXOA 1NMXA 1M8PA 1YJCA 4BAGA 5A4DA 2YZMA 1JVNA 1Z8HA 5DN6D 5H83A 1PR0A 3FPBA 1VRCA 4F6LA 1CQJB 5KNBH 5FBRB 4FEGA 2YWJA 2NVXI 2BGKA 3E9MA 2GPWA 3H3JA 2YWEA 1G8FA 3FNGA 4LZNA 2ZBPA 4PVCA 3F8WA 4BNKA 4M8SA 5D7BA 1M0SA 1Q92A 2ISSD 3EUAA 5HA5A 2NW6A 5BUZA 4A6DA 1AVTA 1PU2A 1ZMRA 2YXPX 3C41J 3H9GA 3LWZA 1QV7A 5M29A 3GLFE 3Q88A 3BD8A 4A0HA 1ECLA 1M34B 5ESRA 1YQTA 3GXBA 3KQYA 4IHJB 2CL0X 5CXSA 4ZPJA 3SQOA 1S0UA 2SNIE 3GJSA 2DGDA 4M0DA 4YJKA 5CFOA 4LA4A 3ONEA 5ITSA 1H9CA 3UJHA 2AXQA 1EGQA 4WUTA 1QP4A 4WCDA 1FYWA 3B8HA 3UOAB 3I6MA 4OQNA 3PNKA 4K6GA 1FW8A 1XEXA 2OD2A 1TYAE 1BE0A 3EOAI 4M88A 4L5AA 3KVVA 4CWAA 2ODNA 1FTNA 1T2FA 1Z83A 2D0DA 2ERCA 4FFDA 1I94B 2AG1A 3WFIA 4DCMA 4DL9A 3LUGA 3ZWNA 3TUZC 1S8FA 1XC7A 1JKJA 3E81A 4DK1A 3CEAA 2J3HA 3T1YB 2PZBA 4WFQA 4CPDA 5LQRA 4YMSA 2HR1A 4F6CA 2YYSA 2F59A 1V3QE 1OAOC 2GN0A 3F3SA 3PUYA 4UXHA 1DG9A 1GYQA 1J0EA 1W4ZA 4HT3B 1Q6ZA 3E58A 4QDXA 3A0RB 4R9VA 1CY4A 2C0CA 3GLKA 1MAVA 3FJ1A 5CT5A 4H6XA 3M3PA 1RTKA 1VLMA 4HDCA 1G291 3NDPA 2NO5A 1P39A 1V35A 4G67A 3DPSA 4QFMA 4RVSA 5K6RA 4WOBA 2ZRJA 5AUNB 5AUPB 2V5AA 5EERA 1UM8A 4QDKA 2V96A 1SU6A 4NSNA 3U4AA 1TZCA 2YMLA 1NNEA 4JV5B 2P0EA 2A67A 5IM5A 4OYLA 1X9HA 2P5SA 1UXGA 1ZN2A 3PNPA 3SR4A 2ZI5A 4CBVA 1XFAA 3O90A 3R5SA 2WM8A 2ATCA 3RUIA 2WUDA 1IIBA 4GNKA 4MI9A 3OFND 5HQ3B 3IEUA 1QYRA 5BSWA 3HCRA 1J8VA 5TGZA 1BQ3A 4PBTA 5K4AA 5TPWB 3CWZA 4D02A 4I1PA 1X38A 4BRUA 1BEEA 2W2KA 3JWEA 2FYTA 3LUPA 5C8YF 1YF3A 4MEJA 3NHSA 2DY1A 1W75A 2KI7B 2Q0SA 1SUBA 4MKRA 5DSTA 4QGSA 1PI3A 3KELA 4RKRA 4FC6A 1FK8A 1OF1A 4AG5A 3WGTA 3KT6A 1OLSB 2VBIA 3CGWA 4LJ7A 1VL2A 4M1OA 4F2GA 2QNIA 3KXPA 4PRZA 1IHDA 3PEUA 4P3XA 4X93A 1RPJA 4XPZA 4HS9A 1C9MA 2VNAA 1SUFA 2O4CA 3AEUA 4OG2A 5BY2A 4OI1A 3H7IA 3H05A 4O8ZA 4ENUA 3VR4D 4L3VA 3RVSA 3VC7A 1ZH4A 1WCIB 4UREA 4WK6A 5CYPA 2QJOA 2XZOA 5CCEA 3EPHA 1IJFA 3MQ2A 4XIJA 1H42A 2VDNB 1IBMB 4OSPA 5B1IA 1L7RA 3U1VA 3IR7A 2CVQA 1AUQA 4DANA 2VAMA 4TYQA 2PGLA 4ZN6A 1BFUA 3HJRA 1FMTA 1HLGA 1TVEA 1O96A 2YOFA 5D85A 3ZK7A 3G2IA 1QGDA 4KNWA 4OH1A 1VFPA 1E7MA 4G81A 1J2RA 4IFBA 3GVPA 2GO7A 2XNDA 3HXTA 3A6DA 3PCTA 2XUKA 4ESVA 1H8HD 2V7WA 4KE9A 1XEFA 2G06A 3CRW1 1JH8A 1H69A 3OQIB 4X8HA 4NB8A 1Z0ZA 1ZUD1 2PUVA 5LJIA 2EQAA 3R3WA 4C4RA 1H4VB 2DJIA 4TTAA 4RU1A 5FYDA 4UFNA 1SVIA 1MTOA 1SCJA 1TZ2A 5FNVF 2PLAA 4F8JA 5CFRA 2C4KA 4RBNA 4NV0A 2CNOA 2W98A 4URVR 3OIVA 4CN8A 4XQGA 3RFXA 2VXCA 4H1TA 3K0EA 1GLVA 3QFRA 3RD5A 4CMEA 4RDCA 1F7UA 1JE1A 3GLHB 1TUIA 3OT1A 4RCZA 5AO9A 5IC5A 5TLSA 3W3AA 2P65A 4MRPA 1ZD8A 1OT3A 4XTCS 2ZYSA 3VKUA 5JFTA 4WTOA 4FS8A 2X2PA 3PGA1 1WSAA 2A6PA 3EA0A 3FTCA 2LE0A 1RXSA 2PBRA 5CBPB 4CF3A 4EFDA 5FLXf 1FQKA 1XWWA 1Q19A 2HLDA 4N9WA 1RWKA 1G20A 2QLTA 2ZB2A 1D2MA 2G0AA 4PYLA 1FS6A 2OLJA 2PKRA 4YJ2B 2EZ9A 4L2IA 3I5MA 4UOEA 1WQ1R 5IDVA 4J29A 3TSOA 4QELA 1FQJA 5AW7A 2FPOA 2FPIB 2X7XA 4GR4A 2G4VA 3ZYCA 2FMFA 4XQCA 4YRAA 3PEEA 2JIZA 3DGFC 1I4LD 1T9ZA 1GAWA 2WV7A 3QGMA 1EFAA 3FCOA 3ORYA 3A9CA 4IJKA 1POWA 5M34A 4ISCA 4CDGA 3FOZA 2EX1A 2IYOA 3F9IA 3E82A 4A36A 4JLMA 1IUOA 5AWFC 3SEZA 1U2GC 1E6KA 4AU1A 3U4QA 1N2CE 4I2NA 5BN3B 3J7A4 1P33A 3HRKA 2FXIA 2FSIA 2RHDA 5J23A 1VJ5A 2XYHA 4J7XA 4WESB 3KQHA 1IDOA 2BRUA 4BV3A 1PTKA 2XUOA 4HTFA 4JDPA 1ZD2P 3OX1A 4A0QA 2GNAA 3Q9UA 2D1SA 2W6JD 1SD2A 2I4RA 3E9YA 4C22A 3I4FA 4Z99A 4IIXA 5KU1A 5BQPA 3NDBB 4MGZR 1VCOA 2GN2A 1VGQA 1K2VN 5CX4A 3EIWA 1IBRA 2CCKA 4P32A 4RTNA 3U61B 4CM1A 2IT1A 3NAQA 3GVCA 5LPNA 4DXHA 3KTAA 1FX0A 3DEKA 4MONA 2R48A 5KWEA 1NYQA 3C3EA 4AJ4A 1IU9A 3ZLJA 1VKHA 4JQOA 4DCPA 1PJQA 2B8JA 2RIRA 3HU2A 3NHUA 4JJGA 3SMVA 5CVTA 1SCQA 1WXWA 2D06A 2Q7OE 4QU5A 4WZBB 3V4LA 2V7QD 4C0JA 3CINA 2I3DA 1NZJA 4RPGA 5E9WA 1LTHR 3IA2A 2XGSA 4N3AA 4PW0A 4DBVO 1GPWB 4K9KA 4P35A 3FSGD 1NQVA 4JI1B 3F4KA 3PIRA 3PFIA 3CRZA 4HWGA 1Z22A 4RY0A 4DAOA 1B6SA 3EPJA 2Q4RA 3LKZA 1XG5A 5AVRA 4M9QA 2Z8YM 3R76A 1NN0A 4GM4A 1ZM9A 2B1JA 3B3JA 2O4HA 4AS3A 3FAKA 1J7KA 5AESA 4QOFA 1YJBA 1CCWA 4ZDKA 1LQTA 2A5JA 1BEUB 2PS3A 1TYDE 3V1UA 1N25A 2TMGA 4IW3B 3RSGA 1Z25A 4PINA 4AC9A 2EV9A 4HZGA 1Z56C 4KK3A 4Y9TA 4BNLA 4AY5A 2CXPA 3DKVA 4CR6A 4S0XA 1JG3A 5DE3A 5H80A 5BYKA 2HA5A 5IP5A 4DA0A 2AFIA 4ZV9A 2ZJ4A 3WYNA 2IHJA 3REOA 2M48A 3PHLA 1EZZA 3ONDA 1DINA 4GKVA 1DBSA 4NU6A 1KQSY 3O4JA 1M2GA 4AO6A 4F38A 3VU8A 4FEYA 3CH5A 2PTGA 2QWXA 1Q1AA 2VKTA 3MJFA 3U0VA 1NVVR 3A1UA 4YV1A 1K3UB 1Z63A 4PBRA 3O47A 1K98A 3OZSA 1XQWA 4WN3A 1TVKB 4NBGA 2ECKA 4XGIA 5HKLA 3NOXA 1VQ91 3A6ZA 3PFNA 4UOQA 4HTAA 1HSZA 2QSYA 3KDSE 4GGMX 4MDFA 1Z6AA 4KKVA 1UBUS 5DULA 1NWHA 2PQ0A 3V5NA 2O2HA 3AY0A 2D1TA 2G76A 3E3OA 4Y6OA 4FMDF 4KIUA 4UAVA 3UBMA 5AI0A 3L43A 2B8NA 3KIFA 4OFWA 1K7EB 5E1BA 4KGVA 3RSOA 5KVAA 5KC8A 5H3CA 2YHSA 4GSYA 1C41A 4H7EA 3RC9A 4ER7A 2DFVA 2NUAA 3Q1KA 3ZEIA 2XXAA 4GLFA 3KKNA 5LLSA 1YR6A 2Y1KA 3M6XA 3VMGA 2V0CA 1G5QA 3N74A 4I7EA 2R1TA 3GJZA 4L7QA 4MVJH 3K6JA 1QXFA 1VP3A 2YJ4A 3RUHA 1M6HA 3B6JA 1NSFA 3VR3D 4DUGD 4HDSA 5EMHA 2DWOA 3QVJA 4QTXA 3U16A 3MXOA 1JXAA 2BKVA 3Q6IA 3ZCVA 4F9FA 3O3NB 4A23A 4D9EA 3FWKA 3IUEA 2YBEA 4UVEA 5FADA 5HIMA 2HI0A 5JD4A 3HWSA 1SBZA 4U7GA 3H8WA 1JU4A 1U0TA 1Z5PA 2PSSA 2FMXA 5C1IA 3ZBQA 3NUQA 1O97D 1L1QA 4PHHA 3F5MA 3HYLA 4CCYA 1T25A 5FPYA 4W9MC 4Q05A 2W0MA 3IPCA 4UM5A 3WADA 4EUNA 4F1WA 1E3DA 3EBLA 3NM6B 3JAKA 3OTGA 4YIKA 1TGVA 3JPYA 3SX4A 2AOXA 1Z29A 1QFZA 3P26A 2ZJ6A 5I3CA 2XUIA 4DWOA 2ECOA 5LU8A 2L19A 4NVRA 3N8NA 3DT9A 2ODQA 3HO8A 1VJRA 4HL6A 4BNYA 3BQ9A 4EW3A 4CLRA 2QMEA 1AXRA 3HZOA 2YWHA 1V25A 4I5IA 1M901 2GUWA 5JCJA 3SHTA 2VBFA 4BFTA 5TMPA 1RPZA 2G6TA 4NK4A 1TZJA 2K2WA 1J2YA 3ESDA 5CDTA 1F3LA 2JJ2D 2IEGA 2FN4A 4HAWA 3DG9A 2YS6A 4K86A 4MYTA 2GEDA 3GLFB 4N7RA 2OC4A 3S6JA 5LD2C 2X5XA 1DUIA 2XOKA 4EPTA 3U7RA 5EHQA 4YN3A 3Q7TA 4UJ5A 2RJNA 2VDPB 4ZOQI 5H0IA 3FCUB 1WBDA 3ZY6A 1AMNA 1NX9A 1BKYA 4HUTA 2XXJA 3OKFA 1XZMA 2NO1A 1Z4JA 2IDMA 4QBGB 3VDMA 2GSDA 4Q4JB 4IS2A 3BQNB 3JD3A 5H1YA 4NY1A 2VHWA 3MTBA 3PTZA 1TF2A 1IZ0A 1G4HA 1IHUA 1B6TA 2NN3C 2PGDA 3CU5A 3HCCA 1K66A 5EPEA 1SXJD 1DBPA 2Q8PA 2BM1A 2Z9DA 4C7OA 2WLTA 2HA3A 2JIDA 4C4SA 1NASA 4BP1A 4ND4A 3GPCA 4X63A 4F1JA 1P6XA 1IZ8A 3L1KA 3NFYA 4FXOA 1WSBA 4CDMA 4JDUA 3HJFA 3TTXA 1H1LB 5AK6A 4YP7A 3FHOA 1OMOA 1OX4A 1ZM7A 2QRPA 3R4CA 2WWFA