2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
2H85A 2GTIA 2OZKA 4RS4A 4S1TA 2RHBA 2GTHA
chains in the Genus database with same CATH superfamily
2J3KA 4QLAA 1HYEA 1JFFA 4GGMX 5M5BA 4G26A 2X7JA 2VP2A 1DJLA 1WMAA 2O3UA 4RCVA 5DNVA 5AOCA 4KXXA 1XPJA 3Q7EA 4WSOA 3A9RA 3V7NA 3FRIA 2VJBA 2B3TA 3NORA 2BEUA 1E79A 3IIKA 4Y1GA 1ZHFA 1WCYA 4GSLA 5F5NA 1KVSA 2AJDA 1GTRA 2WJVA 2HHAA 4LHEA 3TTYA 5ADHA 2WJPA 3QVXA 5AT1A 4Q1CA 1SU8A 3PKJA 3INTA 2P9TA 2AT1A 2RGBA 2YZNA 4M9QA 2ERYA 2PBRA 3OIUA 4U7JA 3B1XA 3IA2A 2AZ4A 3EUFA 1I2CA 4BTVA 3IEVA 1I1NA 3A4YA 1RS0A 3QFTA 4H3VA 2EZ8A 1CF4A 1I1OA 2DUUA 2HMWA 2N75A 5DM1A 3AR8A 2Q50A 3OM9A 3TWOA 3S7ZA 4DM4A 1QQAA 1PV2A 3C3PA 3HABA 1QO0A 3EXEA 3WLNA 3VMIA 5DI3A 1PR4A 3RAPR 4I4CA 3MONA 4P8RA 2O19A 4AKSA 1V6SA 1UC4B 4GP9A 4OOEA 1XEFA 4Q3KA 1E9BA 1MXHA 1QIJA 3FI0A 4PPQA 1R9NA 1DE0A 2C5FA 4TLLB 3LO8A 4V0LA 1B6SA 3DZHA 5IAGA 2PWAA 1Q1BA 1UP6A 3P5BA 2IS6A 4H7PA 4CF6A 5C35A 4XUCA 5IMSA 3L4SO 1B8OA 2H07A 3GB9A 1VPWA 4BKUA 1QVVA 2CNKA 1GY8A 1AA6A 3AONB 4O4JA 3FQQA 5DISB 2H9YA 2XUQA 3QPBA 3PHGA 4P34A 3NP7A 4MWGA 2IS4A 2VAWA 1JHXA 1L5YA 4O4JF 2G9QA 1JQDA 2EDAA 2XCIA 3W1VA 4TMWA 1OPRA 3L1JA 4J03A 4FD2A 2NUTA 3TEFA 4CFYA 8OHMA 3U2QA 2BP7A 3B38A 2G72A 3WGUA 1BMTA 1WXXA 2P5YA 1H66A 5LIPA 3VC3A 4ETIA 4HSGA 4OXNA 4MD9A 1CX9B 5AOVA 1OBOA 2QG9A 4AKGA 5K0NA 4BFVA 1D04A 1MEEA 1EQUA 8ADHA 5K20A 4QZVA 1MPXA 5IC4A 1TYBE 1M7GA 5CLIA 5CXSA 4ESOA 1HFKA 2FKNA 5FUMA 2PQ2A 2RBKA 4WY5A 5AJVB 5SICE 2A9PA 2M2IA 3PEEA 2PMDA 2YUIA 4J90A 4QJBA 4UEOA 4BNWA 3KO8A 5DM2A 3O8RA 4YDRA 1ZKDA 2QY6A 4PANA 1LNSA 3REFA 3J81k 3DEZA 1T8YA 4RY8A 4WCFC 4D3DA 3JX9A 2ZEJA 4YMUA 3D3WA 3H2BA 4K81B 1TJ3A 1V8BA 3S16I 1VSQA 1L8XA 1X7XB 1X42A 2AFIB 2OCXA 2VHQA 2ZPTX 4KLCA 4TV9B 4YRRA 2NPFA 2ROQA 1JE1A 3EMDA 3I52A 3RYTC 3JQPA 3DTVD 4ALJA 4C5AA 5AFSA 4BO5A 2Y1LA 4TNUA 3EGXA 3PQ2A 2ZVDA 5JLJA 3GBVA 4I9HA 1ECPA 1PZHA 1W7AA 2F4VB 3A1SA 4H18A 2QYHA 1NQXA 3E05A 1Y1LA 3N2KB 1O95A 1IY8A 1CR4A 2RCNA 3N5CA 2MMGA 3Q3VA 5F3DA 3TW4A 2YJ6A 4YLEA 3W2IA 4U1RA 1NXVA 3PFWO 1X92A 4JVMA 3P9IA 4BCBA 1BCSA 5EL0A 1RJEA 1NTOA 1T1JA 2J0VA 2YJNA 3BHNA 2CDAA 3R6DA 1MLDA 2GN0A 3L8CA 3K6SB 3OWXA 3W5VA 5JAHA 1Y7IA 2H9AA 2XW6A 3QLVA 4GVPA 3TXAA 4U3JB 3MWGA 2C4TA 1P4AA 1YZTA 1HQDA 3BFKA 3ELUA 3ODGA 3KV1A 3KIFA 4H31A 4K6GA 4RXUA 1TVEA 2Y6UA 1H4VB 1ODFA 3E35A 4V38A 3BJEA 2ZVPX 3I4CA 5IF3A 3GLGE 1VQ7Z 1WP4A 2JAXA 3PPXA 4EHKA 5CCDA 3W8DA 4J1TA 4D79A 2V8KA 1E1LA 2JIZA 2KE5A 3KHKA 1DP4A 1KYQA 1V6CA 5JEDA 4C0JA 2VQEB 2ZDQA 3VNVA 1SRQA 3K0CA 4KFRA 4R1UA 3QXHA 1UQUA 5K0TA 1ISJA 1FYFA 3Q3EA 2GZMA 2OD9A 3ZK9A 2A9OA 3GJZA 2RGXA 1XZCA 4OMDA 2BHSA 3UC5A 4CMHA 5CFOA 2NT3A 4LJSA 3T7SA 4IJWA 1KH2A 4MW5A 4BQEA 3RAJA 1B0ZA 3ROKA 3A6PC 3ORQA 2PJUA 4CM6A 1RABA 3FBWA 5KC9A 4MRSA 1OX5A 3CCU1 4HS9A 4W6QA 3T4EA 1DC4A 4UKDA 1KDTA 1Q16A 1GXSB 2OBFA 3DDSA 1TECE 4JR1A 4QWMA 3MZLB 4CQMB 1EBBA 3FCSB 4F8EA 2CJFA 5BN4A 3AG5A 4KPUB 1P2FA 2QAGB 3FOBA 2ZJOA 3IEPA 3T06B 3ENWA 4ACAA 1Z8NA 1ZDMA 2J31A 3PQ4A 3QVWA 4N0DA 3IR5A 4N03A 5EKSA 4C89A 3DBHA 1VE6A 1KFJB 2PX3A 1QDLB 2GMWA 2HJSA 4OYRA 4U0JA 2BMEA 1H42A 3GRYA 4FGJA 2HXYA 1NUTA 3CKKA 1B76A 4IILA 1WW2A 1JQKA 1J4AA 3DE7X 1BX1A 3SJ7A 1DWQA 2J0UA 3KAKA 3BXXA 4IUBS 2FMTA 4S1VA 2X0IA 4FZRA 2GKOA 2X0JA 4BO0A 1TGYA 3FFAA 1WETA 2B4TO 3FSRA 4EPWA 2OZEA 2GCOB 1N2CB 2XX3A 3E84A 3NJ4A 3LA6A 4K9QA 4ZCSA 1UM9A 4QHYA 4A0GA 3TEJA 1VQ81 4CCAA 4EA9A 1HNNA 2V96A 3MMPA 4NSNA 2VLBA 1SKMA 4EZEA 3TVTA 1WDLA 4NESA 4PYNA 4EB3A 1JHRA 1VKZA 4KXLA 3V46A 3JR7A 4XYMA 1DC7A 1F51E 4WDRA 4B47A 1E96A 2YKGA 4HYQA 4H7DA 3LY5A 1R0SA 2XWQA 2H59A 1E3EA 1UZUA 4L72A 4E4RA 5K8JB 5JMTA 3KUXA 1UMBA 5G4LA 3A9TA 3VZRA 1YQ9A 4LC1A 3VUFA 3VX3A 4RU1A 2WUGA 4A1FA 4JD5A 1D1PA 5IXYA 5KNDH 3ETEA 1U31A 3LRPA 3WK6A 4F06A 1B43A 3LGXA 4G63A 5IKXA 2GCEA 5EP2A 1AN9A 3DOEA 2MWMA 5D87A 3TZHA 4D4JA 3O4VA 3KHTA 1T3LA 3OJFA 4MVCA 2KJQA 5AM2A 5MN6A 3EZXA 4CMKA 5KYWB 3IA7A 1U63A 3OTHA 4RW0A 4LF9B 2FQQA 4F3YA 2REQA 4REQA 2AFRA 2HJ9A 1Y5RA 1U1EA 1ETHA 1G3UA 3H5TA 3GLIE 5M2QA 4RIEA 1JF8A 3CTMA 2JLBA 4ZEVA 2J5XA 2Y93A 2ZAOA 4R0NA 1LF0A 5FO0A 5HA5A 4BVGA 4M1KA 4BQFA 1ZQ9A 3UWPA 1G20E 3VU9A 4YXFA 4DUYB 4XQCA 4MP6A 3L40A 1YRWA 1I24A 1UXIA 3FNRA 3T7TA 4ND7A 3KSDO 5C7OO 1ZMOA 1R1DA 5FRDA 2YINC 1V1RA 1XKQA 2QN7A 4Z7QB 2Q3HA 1G8MA 2YOGA 3GI1A 4LJ6A 3LCJA 5JO9A 4AECA 4CKYA 4MR8A 2X9NA 3N0WA 4MQMA 3U0BA 2OHHA 2NO6A 3FYUA 3LNCA 4RIGA 4DDWA 3EEDA 2WRZA 4DM3A 3MT9A 3J81b 1KSHA 1OZ0A 1T9BA 1ZM9A 5C1IA 5UKDA 3SC3A 1OT5A 1T9DA 3ZZTA 1P44A 2NO1A 1DDGA 1SXIA 4GXRA 3FMFA 4NPAA 6GPBA 5G0WA 4IINA 1M6NA 2ZBUA 3C6QA 3IXLA 3U17A 1U1IA 1EPUA 3G2LA 3YASA 2GM3A 2UZAA 3R6WA 1S96A 3AL2A 3NDPA 3V00A 2NV0A 4ZJYA 4QYIB 5FI1B 4YO8A 4J1QA 5CJJA 4TLCA 3C6ZA 3SR4A 4MI9A 2WJIA 5IDWA 1VL5A 4LJKA 4KOAA 4FKBA 5F64A 3CIFA 2AYYA 2WVJA 5JFOA 4KNWA 1DRKA 4P0TA 1OZGA 3THRA 4ND8B 4YQFA 4YY3B 3OEWA 3QXJA 3H3FA 2TMDA 4L8YA 2EKBA 1AGXA 1Y8AA 2NN3C 2JGLA 3LXRA 4NCJA 1KSGA 1G8AA 2Q3DA 4G5FA 3TOXA 2CDBA 1QNLA 4UM5A 1C7FA 1U04A 3ZVNA 3CCE1 2PBLA 3W4KA 3EGOA 1PWZA 4WOBA 4ZO4A 3X1DA 1QIEA 4MHOA 2LXNA 3IBSA 5E6SA 2HM7A 5H7XA 4CL3A 3AQIA 4KE7A 2BLLA 1NJSA 1E1CB 1MW9X 2JHGA 3FPEA 2OORC 4NBKA 3T0GA 3DJFA 1L8LA 1G1AA 1G8PA 2QUBA 3ONNA 3V4VB 1O5OA 4DV6B 3R09A 1UFVA 2G1AA 1AGPA 3I76A 3CKMA 4ICIA 1UOQA 3IMCA 1FDWA 4K6OA 4OUKX 5HZHA 1X8LA 4DCMA 3SOZA 3R9XB 2XKKA 1VHWA 1PJ2A 1Y80A 1Z73A 4RO0A 4ZO6A 2OK8A 2FFQA 2IW1A 2YDYA 3L7KA 2C9ZA 3UJCA 5CDTA 2XVXA 3L8MA 2X3UA 4J2TA 4WBSA 2ZIEA 3M8KA 2VSFA 1XK6A 2EP7A 3H9CA 3DE1X 1E8DA 4GXTA 4EDFA 2I4MA 5J43A 4XGKA 1K5HA 2CN1A 3O4IA 3RJ9A 4ZCPA 5JPCA 2FW8A 2QRLA 4RHXA 4B82A 1VQPZ 5LBIA 4KRYA 1X3SA 1J42A 2ZK7A 3TINA 3FM9A 1K7XB 1JBEA 4G9EA 5CB4B 2P69A 4AUMA 2ZTUA 4AKHA 5JMOA 1U81A 2A9VA 2JI8A 4FW8A 5LWQA 2LIVA 3TG2A 3A8TA 4RKQA 5BQ3A 3BICA 3N8DA 1NSFA 1NVDA 4HQ0A 3PTLA 1RQLA 4E5SA 2QHXA 2QJWA 1JMKC 3KVVA 3W3ZB 2HFJA 2I1WA 2ZZKA 2CB9A 3GVCA 4IRXA 4Y3UA 3VC1A 2EFDB 5A1JA 2B8EA 5JH7A 3NUQA 3SYLA 2YZMA 4MWDA 2ODEA 1OI2A 3C43A 3EJ6A 4GICA 4PINA 2W6CX 3N9IA 3PLAE 3RDPA 4QBHA 4U7WA 4RD1A 1V26A 2A1TR 5FA6A 4R16A 1XAIA 2ZJAA 3TNLA 1J1UA 2J9XB 4EMBA 3BZBA 3NKFA 4HPXB 2RKWA 4X6YA 4YGXB 1S2DA 5JHGB 2QD2A 3IULA 4NZZA 3A3NA 4COOA 4DV5B 3HYRA 2YCLA 4RJLA 2BFBB 3RRBA 2FSFA 2NQTA 1I7NA 1J21A 2G9VA 1LU9A 3CCRZ 4GI3A 2CJWA 4NK4A 1I33A 1GHTA 4YMLA 1WZ2A 1X8XA 3GCGA 2V9CA 3OZSA 4RLFA 2DCUA 2Y67A 1SR8A 3HNRA 4MV8A 2A5YB 5AICA 1QTQA 2YMPA 3WBKA 3AR3A 1JHQA 2WM2A 5IFKA 4PSCA 4F4DA 5ALLA 1QR6A 2PGLA 3PUVA 3VKWA 3OFVA 3I92A 1A7UA 4G1BA 3BJZA 1DBWA 4EPYA 3MILA 4I2VA 4L9RA 5DWQA 4ZHQA 1AO3A 2H1FA 5ALUA 4EPTA 4CIDA 2QVZX 3RC7A 1YR3A 4G8CA 2BP7B 1XDZA 3OETA 3QE4A 3NTXA 4Y7NI 4AWAA 1Z83A 8AT1A 4OK3A 3JAMA 4IGKA 3LD9A 3T94A 4DA7A 2P9QA 3P9NA 4DNPA 2K5RA 2A5LA 1FX1A 1Q862 4KO8A 1XF1A 2YY5A 4GECA 1DX4A 4UM9D 5CVEA 1OPXA 1TUGA 4M36A 3WLLA 3ZE1B 1YIT1 5ALEA 5JNWA 3BRSA 4ACBA 1J0XO 3KKOA 4MQLA 4WMLA 1ESEA 1VCOA 4YAWA 2Q2OA 3FKJA 4HRXA 2VK1A 1E8NA 1GZ6A 2OGSA 4CW7A 4Q3NA 4LXIA 2W00A 3DYIA 4NB9A 2H1SA 1YR9A 2BGIA 4FHFA 1KK2A 1GG2A 1C3XA 2JARA 3CU5A 3LTEA 3H4MA 3JYQA 2Q5JA 3PPWA 1OLUA 5DXAA 3TXYA 4IIUA 1K4YA 1Q57A 1QV6A 3UHOA 1ZNWA 1U0FA 4FT4A 2P9FA 4YQEA 4KKVA 5A4MS 1SOUA 1V7QA 1P2GA 1Q0QA 2M6LA 5CA1F 1T2NA 1ZGZA 2MINB 3WQQA 3ZJUA 4LMRA 3JARA 5DGCA 3COWA 3O4JA 4HN4B 3O8QA 3KUUA 1WZCA 1V1MB 2AG8A 2QL6A 1NMZA 3CX4A 4Z1OA 1XCPA 2H2GA 2PL1A 3ACCA 3GEIA 4KUHA 1KKLA 4ABYA 3PITA 3KCNA 4RUKA 4BGUA 2WT4A 4BZPA 2Q8QA 2C78A 3NWPA 2OZLA 2FE1A 3LX6A 2EWVA 3KVNA 3C4VA 4X1YB 5EJ8A 1MV5A 1Q822 4C0SA 4FLEA 4D0SA 4CEJA 1Q91A 4S1OA 5I48A 5JVDA 4RTLA 4CI0B 1MC8A 2V1XA 1DIBA 3NG1A 4OAOA 1X9HA 4PQRA 5BQ5A 2WB1A 1NSTA 1O57A 1U0TA 2GPSA 3ABSB 3ETJA 1X1QA 5GJVC 3RG8A 1J39A 1IIBA 2Y9MB 5FUVA 4IMIB 1R6DA 4LF8B 5DLQC 1N8R1 2JASA 4Z1MD 2W8ZA 2H57A 1P74A 3MYYA 2IY9A 4FDMA 1S7MA 7GPBA 3U13A 5JZOA 4BNLA 1H5NA 2DVMA 1AMNA 5A9TA 3V3KA 3EH2A 4P53A 1KEWA 1XCLA 1I6HI 3PC2A 4D9EA 4M1WA 1WUIS 2ZJ0A 4HDSA 4O5OA 3W06A 4ZI7B 2NP7A 2BKLA 3ZV6A 2ZBRA 1XQ6A 4WKGA 4TZ0A 5KREA 4KWHA 1HLPA 1UWLA 4OB7A 5I8PA 1Z25A 3VVLA 1LSSA 3HJBA 2J5KA 3W04A 3AVPA 1DOHA 3CQ9A 2C2KA 4L75A 3TGLA 3CXCZ 2VHVA 2JK1A 1QS0A 3EISA 2EYUA 2C4NA 1LX6A 1F0YA 3HB5X 3QWUA 1Z4OA 1PGNA 4LYEA 1QG2A 4BMXA 4KGVA 1T1IA 5CPFA 1GPLA 4M6WA 5T8KA 2OV6A 3HCRA 2VZ8A 1S721 2O2HA 4MRVA 3EXIA 1M76A 1NW8A 3HB1A 1JE0A 3C3DA 4ABTA 1HZZA 3LPLA 2R4UA 5K4AA 1R64A 1B42A 1I7PA 5ALPA 4UBNA 5FWDA 4BNNA 4EVQA 5IT5A 5IYZA 2WF6A 1ZVMA 2YJ4A 3PLRA 3PSHA 5KTRA 2DFNA 3GTMS 1E0KA 2Q1TA 4YFYA 1E4EA 3FKII 2SNIE 2MSEB 4XUEA 3T1HB 1G3MA 1X70A 1Z6YA 2VCHA 5JIBA 2GCPA 3F9IA 4ZO9A 1APBA 2O4CA 1ZH0A 3I8XA 5SZKB 1VC2A 1TKBA 9MHTA 2D5IA 5AIAA 1JT2A 1VMDA 2GZDA 4H7KA 3FYDA 2BTQA 1VQMZ 2VBCA 5F2EA 4ZU1X 2VH1A 5BT9A 3IFUA 2X23A 2PX6A 1MO5A 3MIIA 4IXMA 5TT0A 1IXYA 1WPGA 2RGDA 1TJ4A 3S5JA 1HE4A 3ETCA 1RI1A 1C7JA 4P4SB 3BMNB 4F60A 2ZR9A 1DARA 1G7CA 2QDKA 4HRAA 3BS4A 5D1HA 3OMXA 2AJTA 3U7JA 4EI7A 1SELA 2QGNA 4IJQA 1PUJA 2GNOA 4IOJA 1RXSA 3WGOA 1YQTA 4BHTA 3TE5B 5K0JA 3EPLA 1NN3A 3PXDA 3SF0A 4HQNA 1NHGA 4TXLA 3IAS1 1CV2A 2EJWA 2X9VA 2PD3A 5EJEA 1G16A 4JP3A 5IF9A 4ZOCA 1WXGA 3BD7A 5FIUA 2QIOA 2G0TA 2I22A 2WJ3A 3UCFA 2UZ1B 5I4KA 4JP1A 1JG6A 3AVVA 1AZLA 4QICA 2AFHA 3F3YA 2HA5A 3KZVA 3LK7A 4GL2A 4B8ZA 1VQ51 2J6IA 4DJDC 3IOBA 3SDBA 4QDUA 2D7CA 3KQYA 2DLCX 3PHHA 4L95C 1KORA 1KZGB 3BB4A 3OEHA 1JMVA 4NMLA 2CHUA 3UAOA 4RZIA 1ZVKA 4QU9A 5DIZA 1RXWA 4BV3A 4LVNA 4J1NA 4GRIA 4AZ0A 1ZN8A 2GFQA 5A3SA 1YZQA 1AQIA 4NDNE 1L7QA 1TFUA 3V4LA 1YBAA 5LYJF 2FDCA 1OA0A 3GLHB 1Q7GA 2G71A 4ZVVA 5E3IA 1R8QA 4B3GA 1A2QA 1I3CA 4F6CA 3VNUA 4RMGA 3L0CA 1EE2A 5TX7A 1XQ1A 1XTBA 2H5JA 2PY6A 2VLIA 3WK9A 4CMAA 1E7MA 2YHAA 4NYMR 1ONOA 4CM9A 4KW7A 2YRXA 4J94A 2C0PA 3T0IA 2PUCA 1FFYA 4WXMA 2VJYA 2ZJ7A 1TO1E 3A9CA 3EA0A 4KYUA 4RF3A 4RCYA 1KBZA 5CLQA 5CIQA 1R8SA 3G0BA 3N59A 2Q1WA 2GYWA 5IVDA 3NTRA 3EZGA 2HF2A 2NSHA 2QVCA 3DZJA 4FPXA 3TF5A 1P9NA 1A2BA 1ZNQO 3V1MA 3TKYA 4CQNA 2FLWA 2J7PD 2Q6LA 3G2QA 3OJWA 5D3KA 5E8JA 2CYBA 4JLKA 3UWSA 3V8BA 2R1TB 2EEZA 2NTYC 3MMSA 5JS6A 1F4PA 2OQRA 2F1RA 3ZPXA 3L5OA 1QG6A 2XOKA 4C6HA 4MV0A 1QDEA 1U3DA 2BR5A 5DYGA 4FFWA 2QTMA 3ULKA 1I2DA 2ARKA 1SBCA 2GD6A 3BTOA 5EA2A 4MK4A 3PQFA 1Z4IA 4TMKA 5DOZA 2RSLA 3BFXA 1PWHA 1J97A 3EW9A 4OKIA 4HDSB 1LPMA 2IYQA 2YWGA 1AQLA 1C2TA 4LXQA 3OPQA 4GYKA 3G8AA 2QTWB 1WZNA 2BGWA 1XDDA 2G1KA 3D4IA 3I9JA 3NETA 4V1CA 1ECLA 5C4MA 1IBRA 1PZMA 3T61A 1NUIA 3ONDA 4X60A 4ATNA 8ATCA 4MIKA 5FL7A 3U44A 1CZKA 4XGRA 3REQB 1PYOA 2O3QA 1IB0A 5TY0A 1P2UA 3NT2A 2DHDA 3HR8A 2ONCA 2LD4A 4PG6A 2CUNA 1OTYA 4WACA 1LI7A 4I3FA 5CGQB 1YE8A 2QD3A 3O2JA 3RS5A 5JVDF 1OWPA 1H6BA 1TQ8A 2OCKA 1SCKA 1UXJA 1UWCA 2VHTA 3OPNA 3DMTC 3V80A 1Z26A 3PXCX 4ISBA 2DLDA 2BFDB 2JK0A 2JA6I 5C0OE 1T9HA 3AETB 1COWA 2QRCB 1VKOA 3GVXA 4P38A 4YJ3F 2BFEB 2FW9A 4Y52I 3WJ7A 3ZZMA 5L3SB 3I0ZA 3L3BA 3V8RA 4KNVA 3R0QA 1OLSB 4QTXA 3UATA 4CTNA 3Q6MA 4MGKR 4DEXA 1OGYA 1OC4A 3KV3O 5H9VA 3G1TA 4WKOA 1LD3A 3NWEA 3DHYA 1QO7A 1RBZA 3MEQA 4RE5A 5ESXA 3WL3A 5JAMA 4Y2TA 1T3ZA 4JP5A 5CLLA 1P0QA 5CVUA 3EOZA 1N5RA 4LDZA 3IVCA 2I3GA 821PA 3C3CA 2C7GA 2P1DA 3BK7A 1OC2A 1V35A 3FDFA 4EG4A 1JJFA 4RIIA 1UR5A 2WU4A 1Y6FA 3AGPA 1VKHA 4WZBA 3OLQA 3WLSA 4EHBA 4Z7OB 3L6EA 1QFSA 4GR4A 4HQLA 3ERCA 1WO8A 2VHZA 5LMZA 2P67A 2NU9B 4A0SA 2PZGA 1ZR4A 3WL8A 4REOA 1BTOA 1OFIA 5TEVA 3RVLA 3NHMA 5DU2A 3HO1A 4DIBA 2I9KA 1R7RA 1SCAA 1GADO 1TEHA 1UDWA 1PL8A 2AX4A 2RHDA 3ES9A 3GLRA 1E6KA 4HAYA 4HGNA 1D1QA 2SKCA 2AD1A 2XF2A 5BUQA 1L1OC 2HREA 2B99A 3PR2B 3BQ9A 1GCOA 3QXCA 3NHSA 3PGKA 5E2IA 4A36A 1EVZA 1NXXA 2WIFA 4U5QA 3ZWDA 5B55A 1Y7HA 1L5QA 1ZONA 2HUPA 1XRMA 2ZJZA 3U31A 4EW3A 5JSHA 2EERA 2Z9BA 1LV8A 2NSYA 2GBLA 2OT3B 4R05A 5ULLA 2VUMI 2HA7A 2QROA 4ZRDA 3WZLA 2PKWA 2Z83A 2H1VA 4GZLA 3EHDA 2P6RA 3THOA 2ID8A 3D6JA 1M75A 1V39A 4D0GA 2REXB 2UYCA 3OI7A 4D5GA 5AD1A 2Y1GA 2W8BB 3FOCA 1SVNA 1TM2A 1NYQA 1XIVA 1T6BY 3S1RI 2R8YA 2DGDA 4LTMA 1MG5A 4A26A 4WERA 3ZEAA 4FQ8A 2VP9A 3ROPA 4GQIA 4NCAA 3TAUA 2PL9A 1XNRB 2Y76A 4JJ4A 3SNHA 2R68A 4RV4A 3PWZA 4DUZB 3SHFA 1YVRA 3AGQA 3OQBA 5FPYA 3HPQA 3WZ2A 3CRRA 1ATZA 4PFQA 3NM6B 2O53A 3ZY2A 5LD2B 2PUJA 3I5UA 3MUNA 3LT2A 2OM2A 1KHTA 1IEWA 1LK5A 2O1SA 1YAHA 2DP4E 3KM0A 4BP3A 4OFZA 5JMWA 4ZTZB 3MC1A 2CXQA 2RHMA 4IVPA 4AZSA 4MVWA 4H0CA 2LNDA 1LX7A 3OJOA 3QKUA 3LUFA 1TO6A 1KI7A 5IDYA 1GPAA 3V8EA 4Q15A 2I80A 4HNAA 3L7DA 5CMLA 5C5EA 3HLKA 4DCCA 3UMMA 1Q2UA 1WNFA 4JOSA 2D8MA 3AF3A 3AY7A 1FS4A 2VC2B 3LH5A 3RVOA 1FF9A 2B20A 1VP9A 2R9VA 4KE9A 3T3GA 3QVGB 4IV0A 1N4AA 1G5RA 2WINI 5KTNA 2QIPA 4PPFA 1VLAA 1P29A 2DYKA 4MAMA 1JIVA 3PPYA 4RLSA 4XTRA 5EMMA 3G9TA 4N8EA 4COKA 2HYIC 1PGOA 3ZNQA 1QIKA 3AEKA 3QI7A 4ZO8A 5AO9A 1JFSA 4BO3A 1GD1O 4PTYA 5AUOB 3IPYA 4D45A 5LNK1 4NZ9A 3KXIA 3FJOA 4U00A 3GLIB 1G7RA 4YR9A 3M6FA 3A32A 1PW7A 2O14A 3BTVA 3WK8A 4CT5A 2CF6A 3UPUA 1Y48E 1WXHA 4D4KA 4CLXA 4YB8A 5HIMA 2XQIA 3A11A 3KOOA 3KT8A 2B34A 3G2OA 4NV1A 1KO8A 2GDZA 1TZJA 3WB9A 1ML8A 2E2II 3N2ZB 4ASUD 2GEVA 3GA5A 1QQ7A 3MGAA 2X0EA 1O89A 3PQCA 4JI7B 3WL5A 4PAGA 1FSFA 4A73A 4AAYA 5BMVB 5JT1A 3PL5A 3KSBC 1GTVA 2GCGA 3H19A 1E9DA 2Y1EA 1ORIA 2XITA 2JGNA 4MUFA 3I72A 3SDSA 2B2NA 3PXAA 1MJ5A 3LS2A 1WE2A 4MUKA 5REQB 3BMCA 4YCLA 1N7GA 2VYND 3G0IA 3L6OO 2OBLA 2XNHA 4MUIA 1RWNA 1D7OA 2EJCA 5DX1A 1T91A 5T4EA 1KVRA 1LBTA 5JD6A 1GRQA 1DBIA 4CMBA 4K86A 3VVMA 4W6ZA 1SU4A 3WGTA 1YE3A 5AKEA 2BFFA 4DWOA 1WMSA 4FBLA 4OTZA 5JADA 3UJ6A 3FOWA 5L4NA 1EG7A 1X94A 5DO9A 3HFRA 4QT0A 4CCYB 1NVUQ 1BA2A 1CUEA 3X1WA 5HKKA 3AKZA 1CRZA 2X0NA 3MINA 3DTYA 3B1JA 3NANA 1PZFA 2VF2A 2YC4C 3K4PA 4TM7A 3F5DA 4V0NA 2VCYA 4R68A 3MOIA 3G89A 1R6XA 5HE8A 3UGTA 5IEJA 4C29A 4H15A 5MFPA 2WTUA 1OZAA 1K6JA 3B3QA 4YJHB 1UT5A 5K9ZA 4X8OA 2Y0SA 3K5PA 4YFVA 1ZICA 2I6FA 2ECQA 2YXNA 2IH2A 3IAS6 1L4KA 1ZCZA 3K2QA 2JCSA 3NU1A 2M32A 4HQRA 4IQFA 1T2CA 3UANA 4WKCA 1QF9A 4AB1A 1Z37A 1E66A 2ZJYA 3JALB 2X0DA 2XYRA 4QA9A 3ID6C 2ZJFA 3TDNA 5FOSA 3KJGA 3URKA 5A62A 3CHYA 2IUUA 4ZREA 1K7SN 4WXEA 2O0JA 3PLNA 4D25A 2ZUCA 1ILEA 5L95A 1ZJ5A 2QN9A 1VIAA 1BQ4A 1FTYA 5G2OA 5LXTF 2BC9A 3LRTA 3JWPA 5DCLA 3JQBA 4ZT7A 2FR1A 1I7LA 3QLUC 4J7XA 1L5KA 3WWCA 1H93A 2IEDA 4NLLA 4BNIA 2RIQA 4NICA 5EUQB 2IYRA 1GFZA 1TCAA 2FG6C 3GW8A 3TNJA 3UTDA 4E09A 3ZWBA 3B7WA 4RSGA 5H0IA 1UDBA 2PX0A 2NTEA 3I4LA 4G5SA 3EC7A 1UOEA 2VH2A 1HLGA 4Q3EA 4IVQA 4O25A 5HTKA 4ZYWA 2DTDA 3X1JA 5DWVA 1CLUA 1JQ3A 5EP1A 2Y4OA 1AB5A 2R2AA 3BKWA 2ZUUA 4HAWA 4OB8A 3ZE8A 1QP4A 3FWKA 1VGRA 2EKQA 1JN0A 5CEFA 1Z5OA 5JSYA 3CJRA 3HUEA 3MPUA 3LUJA 1E2DA 3OURA 2ZP1A 3R3YA 1SCUA 3CH7A 4F21A 1KO4A 1BXGA 2ZSEA 4MLCA 1TFRA 2XAAA 1PR9A 1U98A 3PV0A 3RI3A 1IG0A 3KSRA 4CVNA 1GZHB 3HVIA 3B1WA 1TYDE 3H16A 2AGVA 1PDWA 3O4RA 1T8WA 3K2EA 3PO3I 1UZLA 5J4VA 3UHPA 1EP1B 2HZ7A 3QKSA 5L3RA 3T9AA 2GGSA 1Q74A 2PH5A 3QE0A 3BN3A 3DM5A 4GMDA 5LU9A 1CU1A 2VFAA 1U02A 2QXYA 1TCBA 4OQNA 4YACA 5ITVA 2C29D 5CLGA 2PUFA 2ZRFA 2YV3A 4UUPA 2II6A 1OXVA 1I2ZA 3HBLA 3ISVA 3HVRA 2EG9A 2VJMB 4RXTA 1RVDA 3I4MI 1CJTC 3QKRB 3J80f 5ICEA 4IDDA 4A3GI 4HB2A 1B93A 3A6LA 3K0AB 3SQDA 4DQVA 2D3TA 2ZIGA 4K6HA 1O58A 2ODAA 4DT1B 1NMEA 1E6UA 2B8TA 4FHZA 3LJKA 4XTCS 3T6KA 3M1AA 1CJUC 4OXQA 1Y3BE 4KX5A 2MJLA 2ENUA 4EB6A 3HDJA 3KYJB 4WUTA 2XTAA 4M1EA 4AIRA 1JHMA 3F4KA 1A97A 4KMMA 4JYPA 1Z38A 3HI4A 4WCDA 4ZYZA 3DFUA 1GPNA 1OZFA 1SVMA 2EFCB 1J23A 1TVKB 1RSZA 2OUKA 2Z5GA 3DONA 1II8B 3TFQA 5A3JA 3HADA 4YRZA 2IELA 2JFFA 3TSYA 2WF8A 5K8TA 3K53A 2WG1A 2BFWA 4M7OA 1DEAA 1PNRA 1KDPA 3FLEA 4BASA 5AVYA 1MT3A 1I3KA 2FMKA 3TYXA 3WGVA 3QV1A 4RJ2A 2EF1A 1NW4A 5GJCA 3DEIA 3G711 3H5WA 2FSGA 4F12A 5FQNA 3E8SA 3CW8X 1PJ3A 1FTGA 1R5JA 3QJGA 3W6UA 4A91A 2QNRA 1NW3A 1Y34E 1YL5A 4AY2A 1UT8A 2XV1A 4CMIA 8GPBA 2JS7A 3SFVA 3E15A 1YHNA 2Z2XA 1YNSA 4O6VA 2WTMA 3OPXA 4ZAFA 1AT1A 4TL6A 1CY7A 4RNCA 5BN5B 3K0EA 3P9ZA 1KP3A 3ILVA 3QU4A 5JD5A 2Q4ZA 1E2PA 1KK1A 1TKRA 2V4MA 3LQQA 4O4LF 5CPBA 5HDBB 4BFCA 5JZ9A 1VJ0A 2CL7X 5JBNA 2QTZA 3KJIA 1K5DA 1QK4A 3EWNA 4NKRA 1I7SB 4AZWA 3OCUA 2OWDA 4OKSA 4EKIA 4Q7QA 2B4YA 1T5BA 4JYBA 3FPAA 4P98A 1NR1A 3VMHA 2WVGA 3ETNA 3SX2A 5KYNA 3CUKA 2GBFA 5TMEA 3IYLW 4AZTA 4K7JA 3FWZA 4EI9A 3S1MI 1OI4A 3FCYA 4DIMA 1PJ8A 5M04A 4WK2B 1CYEA 5AJHA 1T10A 3A9UA 1EEXB 3AG6A 3T7EA 2ZUBA 4OHFA 4WDQA 4DUPA 2IBTA 1BCRA 1UDAA 4GXQA 4Z51A 3AF4A 2F43A 3W2TA 4KQFA 1AE1A 4H7FA 5A5FA 2VDJA 1YQDA 4Z9AA 3ZV7A 4YO7A 1VDZA 4N5NA 4ER0A 3TL6A 4EL5A 1XRRA 2HV9A 3N3BC 3R2JA 1SRRA 1U2TA 1ULBA 5GOZA 1PI3A 3HXOA 3RSQA 1AS2A 3C3MA 4V0KA 4WNAA 3NONA 1ZVVA 3WGIA 3GJSA 1VJRA 3C8ZA 4M53A 5H9WA 1OVMA 3DVLA 3VPFA 3SFTA 2BM8A 2IUSA 4MUBA 4MYHA 1SIOA 1UDRA 2ZJ3A 1ZP6A 1MQSA 2IXEA 2WU0A 1U7DA 2HDOA 1Z0UA 3H2ZA 2CK3A 5ALYA 1CC1S 4LV5B 1GEEA 1M2GA 2J87A 3M3DA 1NLMA 2P6PA 2K2QB 3RKUA 1E2EA 1F1BA 2QX4A 5KTYA 2DETA 1KJZA 1EFHA 1HV8A 2HIGA 2HQ1A 1XTJA 4FMCB 2ZTMA 5CH5A 1ILWA 4LMAA 1BW9A 1JAXA 4D8WA 3LDAA 3H7AA 1RXCA 3S44A 1TDJA 3WDLA 3OZEA 1WKCA 1JSLA 3KUKA 4DLSA 3EGWA 1BSVA 1VGVA 1KS9A 2PKYX 2V6MA 1NVFA 1RYHA 5CVVA 5MDHA 3RRXA 4DR1B 1B8NA 4HRVA 5DBEX 1VQM1 2O6LA 1T5SA 1UXKA 3QBDA 4P92A 5DTIA 1J8FA 4QGGA 5FPHA 3SHVA 3DWEX 2ZQYA 2VF1A 1CUDA 4O2RA 4MB6A 3P2YA 4ODIA 4ER7A 2VP6A 4ZP1A 1G63A 2ST1A 2JAQA 1P1BA 2BEKA 3CUEF 3PUWA 3N2IA 4R8KA 3ELYA 1R0LA 3NAZA 3VYVA 3SKYA 3UJ7A 4J16A 5JSKA 5BY2A 2D5CA 3D7MA 1IQPA 4DJTA 1KMNA 1XCBA 3KQMA 4UVHA 2V3CC 5CDYA 2FWNA 2WZCA 1C0PA 2EZ9A 1XKLA 3AWDA 1FA9A 2W98A 2XUAA 3CF4A 2O5VA 2WWWA 4MW0A 4QXPA 2XMQA 3ZTWA 2C2XA 3GLHA 3PD1A 4HWGA 2QS9A 5CJ2A 3N6RA 2QEX1 1CUVA 4IV8A 4JYMA 5E6UA 3O75A 2WE7A 4BY1I 1JIXA 1QCCA 4TKUB 3COJA 3VGPA 3AVTA 1XGKA 5GONA 3HDTA 4R1OA 5D3ZA 1S72Z 1P7ZA 2WKRA 4NDAA 3BGOS 2O50A 3VSDA 1JU4A 1DGQA 1EFLA 1KK0A 1KETA 1RJWA 4XQGA 2PT7A 1X1RA 1Z7BA 2FTKE 4C2UA 4ZJPA 2TYSB 2FPKA 1M0WA 2QZPA 3A4VA 4GC5A 4GKVA 4Q4HA 5K5EA 2JIPA 1Y1QA 2UYQA 4PZDA 4D92A 1JXQA 3ZIAD 1U11A 5HHTA 1VQ4Z 2IDJA 1GYRA 1WUKS 4Y6GB 4Y6LA 5ALVA 1XMQB 4DLXA 3RV4A 2NXWA 1NN0A 3IJPA 3SQMA 2ZFUA 4PONA 4DABA 4ENRA 5I7FA 4QSMA 3I8OA 3PX2A 1D0SA 2VQSA 4Q6WA 4QUHA 4TYPA 1YZVA 3G02A 3TNFA 1IU9A 3IQXA 4YDSA 4CFSA 3MA0A 3P9PA 3QKWA 2W8BA 1FB5A 2NZUG 1QRAA 4EHDA 1ZUNA 3CNOA 4KYTA 2QSUA 4LS3A 2IU0A 1A9XB 2WZQA 4XIJA 2Y2UA 3Q6NA 3OEYA 4FEGA 3DOHA 5IAEA 4KZPA 4QOFA 5I9NA 4MW1A 1P7CA 2W43A 1NE7A 2B9VA 1RMQA 4NBGA 3F8SA 4KP7A 4HUQA 4G5XA 4RZXA 2I7TA 2V74B 2WM9B 2OCBA 2R66A 1NU6A 3OO1A 2E48A 3I1JA 3L6BA 1YJNZ 1LBIA 1TA4A 2AZTA 2H1HA 2JJYA 2QX8A 4H2DA 4OB6A 3OOEA 1GILA 1NF3A 4O5AA 1L4EA 3MLEA 1WL8A 2X2PA 4MDYA 4J4HA 2DWOA 1GARA 3L0ZA 3OZDA 3PR1A 3V34A 2RBEA 5DLDA 4D8XA 5CCBA 1ZGGA 3WE7A 1RWMA 1O94A 2HU2A 2PVPA 4LOAA 2PS1A 1L5HA 3TPFA 3DCYA 5LQDA 1MFPA 1WLYA 1NX6A 1JHZA 1YZ3A 4Q9DA 4CI9A 1Y4AE 2FEWB 4AJJA 3HOUI 2D59A 3GNQA 2GSWA 3HDGA 3Q2IA 4LOIA 4YRQA 3V7WA 5I45A 1VQ6Z 1UFQA 2ID7A 3C3KA 2WBLC 1EDDA 3ZY3A 1SHUX 3T95A 4JJKA 3TR5A 3E7PA 1MAAA 4KSBA 2C7RA 1C8VB 1JDBB 2WWXA 1RAAA 3K5IA 4N41A 4CM1A 2VWPA 1YR8A 3W9UA 4MIOA 1X0VA 5EHQA 5BSWA 3WYGA 1GUBA 3R3SA 1E58A 3V1YA 5A9SB 4CQJA 4H6XA 1GRCA 1RJ9B 4P0QB 1DKOA 3IOEA 1AGYA 5KEIA 2Q62A 3U62A 2R25B 3OE7A 1IEQA 2R00C 4RTOA 1VI6A 1XK7A 1VIYA 1TCCA 4IDHA 3WWYA 2OOKA 3T7AA 3K0BA 2VUIB 3AESB 4RH1A 1NRWA 4I81A 2LUOA 4GP7A 2RAFA 3A1UA 4U2FA 1EE9A 1QIDA 4MVJF 4KUGA 3QUSA 3ZWKA 1L1QA 1XZAA 3UCEA 1VYVA 4W7IA 2QJTA 2FXVA 1I4LD 4NENB 2GJSA 4IYRA 3D81A 2VAVA 4N7RA 1R18A 4LXTA 4OI4A 4UEQA 1E3LA 2HCTA 3PNVA 4GR9A 4PQGA 3EXFB 4W5JA 5J2UB 3S6JA 2P27A 4C7KA 3RS3A 4EA8A 2I3CA 1XTPA 4FVTA 4TXNA 5JJBA 3K94A 3MXTA 1Z5VA 3GJ4A 3H6KA 3PQ5A 3KOYA 3FDZB 4M7RA 5BR8B 2XVZA 4PHTA 3HXKA 3RASA 1GNTA 1Z6ZA 1N1MA 2BH9A 4EG5A 5KX5F 4XIYA 3HLYA 4QBFA 4L2IA 3W5IA 1OFTA 2ERCA 3PRHA 4N0QA 3I01A 4BNKA 4M60A 1WMBA 3F7TA 1S7CA 1QBKC 1LVGA 2B4QA 5KB3A 5CH3A 2OXEA 2Q46A 4I50B 1TM7E 2QXTA 5CEJA 4N65A 3EZ9A 1AKTA 3BE8A 3HGTA 3JZMA 4YP9A 3L41A 4PYKA 4TVBA 3P5JB 2BKEA 2R11A 1H2BA 2R6ZA 3ZCXA 3M3PA 2O8FA 1TOAA 1F06A 5KTPA 5HMLA 1KVTA 5KYUB 3L49A 1QVRA 1KOLA 1NVTA 4TKMA 4YRNA 4F1JA 2HMYB 1DFHA 3QU2A 3AP3A 1J0BA 2YASA 3JPWA 1HGXA 3PDIB 5HIKA 1SXPA 3ZOKA 1OXXK 4BZZA 2DRIA 2NYAA 4PS0A 2XUJA 1DJQA 1UKCA 1AO0A 1C8KA 3RVKA 1LDNA 2RG1A 2OQVA 3EVCA 3VO2A 2ZB4A 4EYGA 5INTA 2FZ4A 1KH1A 4WECA 2H85A 2PPVA 2RG7A 4Z4CA 4WUVA 2FJUA 3E27A 2UAGA 1MXFA 4MJLA 3HOYI 1J09A 2C00A 2I87A 3EQ2A 3ETGA 3JQ9A 4W1RA 4G1FA 3NX4A 4LMPA 1OUMA 5CA1A 1G5IA 2YOHA 4G1CA 2I6GA 4FOTA 3UA3A 4LZNA 4XEHA 2ZCVA 4DWJA 3D3JA 1O03A 3K4QA 3R9IA 4WV3A 2H1CA 1S2OA 1FBNA 1T2UA 3OZAA 1KH3A 3AERB 3IUBA 4P2GA 1NURA 2DBRA 1X1BA 3EB9A 3G8BA 3HCPA 4MOWA 3T4NB 4UHEA 1NASA 3A0RB 1KO5A 2CNLA 1U80A 1SUWA 1T43A 2ETVA 5DM0A 4D57A 2VPIA 4FMPA 1JIJA 3RC8A 1ISHA 4UHDA 4WXYB 4AP9A 5EC8A 2C57A 1G8KA 1HDZA 4Z0PA 5ALMA 4MJ3A 1MH9A 3LC7O 4AJKA 3PXBA 2OXTA 4A3BI 5BRJA 2XTJA 4J7AA 2P4QA 4GNKA 4L5YA 4P4UA 1E9SA 2H00A 5EZYA 1UJ6A 3TG8A 1O97C 1SD1A 3GFRA 3ZX5A 1GDHA 2DKNA 4QEKA 3L0YA 3TM5A 1YJW1 1TZMA 4HX5A 5CA0A 3U4CA 4BBAA 5HQ3A 3NYIA 2IEGA 4FIZA 4UHJA 4XDZA 5DK4A 3TW0A 4C22A 1NAHA 2EBWA 4DIUA 3HJUA 3H97A 3NS7A 3ZWYA 5KQGA 1ADGA 4F2WA 1OAOC 2OO5A 4ETMA 4DA4A 2D4HA 4I5DA 1N2FA 4CXMA 3I9NA 4LTDA 4NU8X 4PHGA 5FEMA 3BDIA 4ZEWA 2AMJA 1V96A 4GPD1 3C4QA 2WNHA 1YI21 2PN1A 1T3TA 2QMHA 4MCHA 1B73A 3VTZA 3VV2A 5E6SB 3GTGI 4LYDA 1L5GB 1AQYA 4HAZA 2JGDA 2JIBA 4UCXA 3LC1O 1XQYA 3LBIA 5CNKA 1SKQA 4NARA 4QVIA 2IE8A 5DNWA 2W9XA 1G42A 4UPDA 4EYOA 3MNFA 4JJAA 4CKWB 2SKEA 2NVTI 3BPSA 3A6DA 1W85A 1Q22A 3ZU3A 1SXQA 2OFXA 5KQPA 1S8AA 5DGIA 2B2CA 4IIXA 4ZVNA 2DPGA 3D31A 3EEFA 1H05A 2I4NA 1Z36A 3C7TA 2A33A 4F5YA 3IVMA 1QP8A 3B6MA 2RHBA 4Q3LA 3KQUA 1AU9A 1TTPB 4FILA 4OUDA 1Q3HA 1NJFA 2PH1A 4KSCA 3CVOA 4K8OA 2PJZA 3JV7A 4L5BA 4E6PA 3FOFC 4GX2A 1N6RA 2B5WA 3P0IA 4TTIA 3WZMA 1TVKA 5AYVA 3FGZA 4U6SA 4N4AA 4BJ3A 1EK2A 1MRZA 5C4IA 4HDKB 2X8JB 4DBLC 3JD4A 5C46F 1RQ7A 2AXPA 2REOA 4XXHA 1XTIA 2GZ2A 4XVCA 3ZCUA 5JI2E 4CEJB 4IDAA 1K4MA 1PQUA 4RZUA 5EPOA 3DULA 2J32A 4LUCA 4R5HA 1V5FA 3DR5A 3ZCTA 1GFSA 2OCAA 2H29A 3FYUB 4X6AI 3KKQA 1CDZA 3LUAA 1H2HA 4MRPA 4WA8A 3DGFC 2QY9A 5JCJD 2G4LA 2OWEA 5EHZA 1O8CA 4UAUA 4S2UA 1QP0A 2NTVA 3NBFA 2NV2B 4ZZ1A 3ZV3A 1K75A 1P1RA 1BWQA 4ZRMA 3ZBPA 1M2WA 3Q6IA 3UHFA 3ZGLA 6REQA 4J2OA 1BE0A 2ZTLA 3CLTD 4CF3A 4BO1A 1U1DA 3HA2A 4J91A 4HNTA 1UK6A 2DY0A 3TUZC 1WJ2A 1L5MA 1CDOA 1K27A 3IJEB 3HLTA 1YDEA 4CN9A 4ND6A 2BFMA 3PCTA 3BCSA 4ZOQI 3W8RA 1FSGA 4M76B 5DGHA 2CJWB 1UXOA 4WA7A 2HHHB 2VNJA 3HYNA 4N3BA 3QY0A 3RWBA 1VLZA 4RS4A 1WPRA 2IU6A 1QP7A 4JY7A 4UTZA 3RC1A 3V97A 5BSFA 3IODA 1I3NA 4G9BA 5B4TA 2CUKA 3FJYA 3JYOA 4WH0A 5TXGA 3VR5D 4HAOA 4AJLA 3K73O 3NFYA 2E1PA 2JJQA 3K9QO 1WCXA 2E1RA 3QW4B 4CKZA 5F9FA 3VC2A 2P6MA 3GPLA 4EYQA 6PFKA 1VJTA 4UQLA 3BXHA 1GPMA 3PJGA 5CNMA 2QTGA 2ZI7A 3DOCA 4OMCA 1WSBA 5KAPA 2UV8A 1XLVA 2ATCA 3LQRA 5BSEA 5L9AA 1L5VA 1J06A 3W3AH 3MS2A 1NN1A 1W8DA 2H16A 1SVKA 1FDVA 1A4IA 4I5EA 4LJ5A 4RJIA 4IDFA 1DEOA 5JAZA 4DR7B 1D2AA 2C5EA 2XNKA 2JI4A 3HNOA 3S0JA 3QKRA 4C4SA 1TTHA 2RMKA 1SHKA 1GCIA 3IVGA 4JZYA 4D41A 3AFGA 2P90A 3HCOA 2IYYA 3K0HA 3PBKA 2AH5A 3HCFA 4QYWA 5KHAA 3ZVMA 1NJ8A 3N0TA 3C16C 4FHDA 1XD2A 2J7KA 5TMBA 1C3LA 3P9YA 3CPWZ 2R7NA 1V2HE 2WU1A 2G9UA 3L01A 3T15A 3CNHA 1K7YA 4ECEA 2Z1NA 3A1TA 4S0XA 5ER9A 3AB3A 3MTAA 2ZYHA 3SC2B 1SQGA 5DNYB 3O3NB 2A94A 3EFOB 3UK7A 2JD0A 2ZTVA 3H9BA 3N53A 3AX6A 5J3JA 3OKPA 1AZWA 2QNIA 3KHSA 4OK5A 2W7TA 3RPEA 1WG8A 1PD0A 2IYLD 2ZRHA 5YASA 3MTGA 3T1NA 3V4FA 3X2FA 4CZ2A 1UJMA 3GA0A 1B0PA 1WIWA 3DFIA 2ZJ2A 2G2KA 4J3JA 5LNK6 2YN0A 1GV0A 1IZZA 5D3MA 2V7VA 1JLMA 1W9HA 5H1YA 4IF6A 4MR7A 1XRQA 2M9MA 3E6AA 1UIMA 1HBJA 3G2HA 2Z2JA 3GGDA 3Q87B 3ZE6A 1AC5A 3JWHA 1PF7E 4EPVA 1WPXA 1XZFA 1FW6A 1ZH8A 4B84A 2D4AA 4G36A 5ESRA 4Q9JA 2DCMA 2F17A 1H6CA 1Z07A 1AGNA 3DLAA 2B7LA 4U7GA 2CXSA 3VO8A 4UOEA 3HMKA 2B4AA 4QOIA 4X1KB 2DFVA 4FFSA 4M0KA 4WOJA 4ILKA 2WHPA 2YXLA 5JWRA 1AVTA 3AFNA 1TWGI 3AYZB 4P22A 1J2RA 3SBDA 3FPKA 1WVMA 1R9TI 4NEGA 1Q21A 3BSFA 3MWLA 3WFJA 1GQRA 4L74A 2QE7D 4NCNA 4HZUB 1Q3TA 5DTRA 2GWHA 5T6MA 5I51A 1QF7A 4MUYA 1CJCA 4HXYA 4F93B 2VYFA 1IQ0A 1WBJB 5CDSA 1WD5A 4LRYA 1FRVA 1QFZA 3ZGVA 2HSEA 3C24A 5D5QA 2VVTA 2ZUFA 5FWXB 4TTAA 1O1YA 2B21A 1CQZA 3KJHA 5G0UA 3C2QA 1CUIA 1CG6A 4FFBA 4JC0A 5ALQA 4BUZA 4D42A 1GL6A 3GJ7A 4IOMA 2PK7A 2PUBA 2R1UA 3G7SA 1BH6A 4OIFA 5F9HA 3JQGB 3PNQA 3O0DA 2OTJZ 4X71A 4R2XA 2Z0MA 2IY7A 2Q0XA 2YNMA 1CUJA 4RVFA 2CKMA 3O8CA 1H69A 1U0JA 3VR6D 3WDMA 4PAQA 2VL7A 1VQL1 1B6GA 5DSZA 4PX3A 2CFRA 2XUKA 3PC3A 5ALHA 2XQVA 1IMJA 3MGKA 4JDUA 4G89A 3L8EA 4DIOA 5IBPA 3SE7A 1HEIA 5FOQA 5IJAA 1WZEA 4EAAA 3HC7A 2JCXA 3DZ8A 5DHQA 3DUFB 4II2A 4F4UA 1TT5B 1OJ7A 2FW7A 4Q93A 4Y9SA 1PFQA 1YS4A 4OHZA 1RWPA 3SU8A 3VTKA 4FHEA 4Y6OA 3VO9A 4BX0A 1MIHA 1Q12A 5MN4A 5DW3A 2OKCA 4PR0A 1N9KA 2B8NA 3PP8A 2FUG6 1RQ2A 3AEYA 2HFKA 3IF8A 4TLBA 4AL4A 3ZW8A 1GLGA 2IXBA 3PHJA 3C6XA 3I37X 4IQ4A 1E9RA 2W5UA 3R5HA 2WAAA 4N9QA 4A92A 1Y1VI 1K3TA 1QCDA 5JS1A 4PGFA 1G5HA 1NJI2 1ULAA 3M3HA 3QTLA 3S2DI 1YIJZ 5AJXA 1JBKA 2F2TA 3OD5A 4MW4A 1GL9B 5EVCA 2IH4A 4MHTA 2CLFB 3KB1A 2GJ9A 4DXDA 2J4DA 4JZKA 5JZBA 4UHHA 1DXQA 3QYAA 1DSSG 4JS0A 1XV5A 2H06A 2Z57A 3KLPX 4KOEC 3C98A 1VQK1 4M1YA 2JKVA 3DYBA 1W581 5K3EA 4GOND 5TQJA 2AG6A 1R4MB 1B2LA 1DADA 3ADPA 3IQEA 1P2BA 3GR6A 3S29A 1RFLA 4D81A 4A3KI 3FRHA 1US8B 5EE9A 1N6IA 4ROTA 2KX7A 1E59A 2YBEA 4QIHA 3A58B 3GJ0A 3R0ZA 3SX4A 4MINA 2PX5A 3AJAA 4RFLA 2PMCA 3AF0A 4MWSA 1BHJA 3EERA 3UJ3X 1S4MA 3H13A 5DHUA 3SQNA 4A2WA 4DJJA 4PX2A 4UD6A 1GAJA 1YC5A 4CTJA 2DULA 5AW2A 4RKEA 5HDQA 4BNHA 3V8VA 2AXEA 1TCVA 1NW7A 2EX4A 1Y4ZA 4NENA 2XYQA 3ROZA 1KEEB 1RD4A 3F96A 2ERXA 3FCOA 5CB4F 3N58A 4BO4A 2W2QA 4EYEA 1BGVA 2IVZA 4O4HF 3WNZA 2EJVA 4WKNA 4BBJA 2EL9A 1N7JA 2RHOA 4GH5A 2D1RA 1DIRA 4BDTA 1MMFB 2F55A 4JT4A 4C0BA 2AVNA 2PV0A 2P0YA 4AY6A 1S3IA 1ZUIA 4K05A 2JCYA 1VRWA 5G41A 2QU8A 2XMZA 2ZS7A 3M6IA 3CE6A 2L0XA 5I7EA 3WO0A 1IOWA 3ZD6A 1YB7A 3OE7D 4RVNA 4ZYYA 1NI3A 3WIEA 1N6HA 1BD4A 4DUGA 1IY1A 3RVBA 5LXTA 3WGMA 1TMYA 3QVOA 4HWKA 1KI4A 1MB4A 3S2HI 1WR8A 2AYZA 1USGA 3A04A 2QG6A 4XYBA 3RVRA 1PAUA 2JZOA 3T5TA 2RGWA 1Y9AA 1QZTA 2JF0A 4X84A 3RSGA 1P4JA 3IIMA 4QUGA 1Q20A 4YTEA 3L7OA 4EGCB 3KDAA 3OX3A 4FMBB 5T67A 3H8WA 2GLXA 4WT7A 3UZUA 4D9CA 4N18A 5K0BA 1AOXA 2CXTA 2D62A 2CBXA 2JAUA 1UJ5A 2D5LA 4TS3A 4QGAA 5JCXA 3AP1A 1IOLA 3HCBA 2PMWB 2YADA 1VMIA 4LFCB 2HW8A 2AR9A 3B70A 2ZW9A 4JJGA 1OOEA 3GNLA 1GOTA 2OTJ1 3P0JA 3FY4A 1MAUA 2WC1A 5IX8A 5AR1A 1U5AA 1SNYA 1BXRB 1KI9A 1ODLA 3CZMA 4MQFB 4DAOA 1HT0A 5KJ6A 5J2TA 4ZTUB 2O52A 2OVBA 3OHSX 1GTJ1 2ACWA 1DTEA 3A2MA 3QXSA 5AVWA 2HZBA 1PKEA 2IOQA 3LAWA 4L5IA 4PZAA 1Q83A 3TE7A 2R44A 2IE0A 4I8IA 1P7WA 2B0JA 2PYZA 3BL5A 4KIUA 1RAEA 2ABWA 3EXHB 4HVTA 3B36A 2YYAA 4MQUA 3ROQA 4TYWA 2AL7A 1HRKA 5LUAA 1DX9A 4M8IA 4LDAA 4C04A 4OX9B 1M6VA 2PSEA 3KZKA 4RTMA 3G0GA 5EIOA 2G9NA 1L4GA 4A15A 3D6FA 1ZD4A 4CIBA 5C5DA 3GEPA 1CEQA 5B7GA 1DBRA 2VJLA 3NHFA 3KIPA 5FTLA 1ISMA 2VS1A 4KFTA 421PA 4H3KB 1MABA 1O87A 1XZIA 2N9UA 5G0TA 3H1EA 1AD2A 4HYYA 1XZGA 5JCOA 3DLHA 1A7AA 3OX4A 4NFHA 1JLKA 2ODNA 4IDGA 3FUVA 3JAMb 2AB0A 4FGUA 5CFZA 3KT3A 3CSSA 3EBLA 1A8PA 4Q21A 3EZ6A 4E2XA 4LDPA 4PIPA 1Z3CA 3UJAA 1J24A 2OOSA 4F0JA 2BDUA 2JEYA 4PICA 4HXEB 1D6SA 2WMDA 1UPBA 3E3NA 3MD0A 2Y1DA 4AMUA 5KWVA 4IY1A 1CUHA 2WAOA 4EQ6B 1LSJA 2QTLA 4TTSA 4OXIA 5GGXA 2QTVA 3M6UA 1TD9A 5BW4A 1JTEA 1M1NA 3HZHA 1TFIA 1KQSZ 2NAFA 1G4UR 4UHFA 2XWPA 4Z3OA 3BJRA 2DQZA 4MGHA 2FE4A 2R6HA 1FS6A 2DU8A 3B9RA 3CE9A 4DOMA 4IHQA 4B46A 3ICWA 3KR0A 4FKMA 4J8PA 2BUCA 4RF2A 4UD2A 2H0RA 4GKBA 4R9VA 3BB3A 2JA1A 3CKLA 3CMCO 5G1PA 2HRDA 3HZOA 4QGHA 3WSWA 1R0ZA 4JL6A 5JRZA 5FUQA 3FI9A 1RYFA 1K1EA 2Q8NA 3NOOA 4K1XA 1U2RA 4BYMA 2XB9A 3C0KA 1ADBA 3VI3B 2V7XA 1T0PA 4X1OA 4KPYA 2Z9DA 4U3JA 4EF5A 3IC5A 3VPDA 2P3YA 4PAOA 2QLNA 3N2NA 4O3MA 3F3FC 1TK3A 1P60A 4AI6A 1VBFA 4ZKDA 1E0DA 3DTVB 1G0OA 3WLAA 3KKLA 1FMFA 4DSOA 2D1QA 3KPVA 3PSAA 2VJKA 3I6QA 2W37A 1UM8A 2BEUB 1E98A 4DSTA 3OZFA 2R6R1 4L3OA 2AEFA 5KQRA 4ZPJA 3IEMA 1JDNA 4MKRA 1FW8A 2AOXA 4TN5A 5JC1A 4DK1A 1ZSNA 4LY3A 3O6VA 5MGBA 1UEIA 3AUJB 1XDSA 1YL7A 1OXUA 5E4YA 1LLFA 2OY0A 1T34A 2P2CA 3RIEA 1IBCA 3KB6A 5JU6A 3PDWA 4BC0A 3DMTA 4X44A 4O02B 3GYGA 1CCWA 4OSOA 3SAJA 4DLNA 3KKEA 5I7VA 5A5GA 3I2HA 1VQN1 2FRVA 4FWTA 1QIIA 3UAWA 4GM0A 1U99A 2ZQZA 4WNIA 2HNBA 1MDFA 4UNIA 2QNBA 4KI0A 3VX4A 3CEPB 4NJMA 4Y2QA 2VNHA 1Y9DA 2GHIA 3CF2A 1SU7A 2XTMA 3F90A 4GPEA 4MI6A 4Q47A 3WAGA 3T3EA 4LOJA 4AY4A 3PGXA 2J09A 3LSYA 3TXXA 1F9EA 3PHLA 3QNUA 4YUXA 2GRJA 1SBNE 1T0JB 4GGPA 2P6NA 2SKDA 3IPRA 4KAFA 4FJ0A 2PZEA 4QXOA 1P6QA 2QV0A 4RKYA 4FXPA 3QNWA 5DYTA 2D5BA 4DMFA 1ZYUA 4B44A 5JISA 5JI3E 1CB7A 3PQDA 3AUSA 2O0KA 4K26A 5IN5A 2VT6A 4JC8A 3AEQB 5JE8A 4GEKA 1T36A 1WNTA 1DO2A 3TFOA 4C7OA 1U0SY 4U8GA 3JYPA 2QTTA 1M1ZA 3F6BX 2NM0A 3KFXA 4H59A 3S2EA 1F0PA 4W5NA 3DLPX 1VIVA 1ZMXA 2Q2WA 2V8IA 3GHHA 4OLHA 4W5TA 3NH9A 3S40A 5HUJA 2IHYA 1D2NA 3E8MA 3X1ZA 1ZI9A 4UVIA 3IO5A 1MC5A 1H1LA 3DBIA 3BAZA 1E3TA 2V6BA 4R1NA 1EVYA 3FKQA 3DAOA 4Q48A 5PGMA 1M66A 1GWNA 2FR8A 3CNNA 3O8BA 4RL4A 5IVIA 1KYXA 4OI1A 1OXTA 3KXPA 4ERNA 3THYB 3ASZA 1P4HA 2PA3A 5F7XA 4B75A 3HJTA 5FHQA 4M9ZA 1W47A 5ITZA 1Y89A 1R4ZA 2PGIA 4BFTA 3GDOA 3L0BA 4MVXA 1ESNA 5IK2D 1UJNA 2ZGVA 2P8SA 3HDQA 3LYLA 4LSMA 2IWRA 4G85A 1GNQA 2BF7A 2YJTD 2JLVA 3KDPA 5I5EA 4NH0A 4D4LA 4R7GA 1V1JA 3TI7A 4Q6BA 5EXDA 3W2EA 4K40A 2R3SA 4G8JA 1ST2A 1AUOA 4Y2YA 3HE3A 3N3AC 4N01A 5J4KA 5KNCH 1EUCB 4HDMA 4AG5A 2WPDA 2PPLA 2V59A 3RARA 1SWWA 3O82A 3RSFA 4EHJA 2A9FA 1CZUA 5ELLA 4EARA 3HKBA 4LDRA 4A93I 3A10A 1IHYA 5IBCA 4TMZA 1ZUHA 3AFMA 1IPFA 3R8CA 4C7BA 4CDGA 5KWSA 2VSQA 3QE3A 1H85A 3SNKA 3TTVA 1EXMA 4BNXA 2Q29A 5CHYA 1F48A 1ZXLA 2FK8A 4ZYVA 1N0HA 4MRMB 4OKNA 1TU3A 3AMVA 2HX1A 2HO4A 4H7JA 4C30A 3FCXA 4YJ2A 1GQYA 2I76A 1KQ3A 3DFKA 3KOZA 3P2OA 3N8NA 1YI2Z 4U9UA 1FSPA 1JVSA 1K68A 1K9SA 3AEUB 2XMBA 3BL8A 3RBXA 3ZXXA 5K1ZA 1I2AA 4OGLA 4DLPA 3BFPA 3RSCA 4KPEC 1K8RA 4X90A 2WD7B 1NP7A 5DKFA 4HLNA 5BYJA 5K0ZA 2G9RA 4DJAA 2B98A 2PRSA 2YR0A 3IMEA 4V39A 1TCUA 2JIZD 2NZWA 3MOSA 3I64A 3ZGYA 5FNVB 1BKDR 3TCXB 1I7QB 3IKLA 4MKGA 3V1TC 3V8NA 3R3WA 5EEGA 3IEIA 3VTFA 5JNSA 5TMPA 2IHBA 2EKLA 3FB1A 3K3PA 1JFVA 3MZ0A 3KJFA 1QIMA 1T2FA 3TDKA 4KHPB 4MYTA 4D9KA 4D6XA 2XXAB 2JLWA 4BVLA 4OL9A 1YJBA 1Q2XA 4JC5A 5EKXA 5C4XI 4MWTA 2O3RA 4BVAA 2IOHA 1ZO8A 3G9UA 4OHPA 3VDRA 4EHIA 3WKAA 4CIVA 4R2KA 1HSOA 2VF7A 3LYAA 2VYVA 1ZSVA 4D4IA 2VPYA 1O9HA 1QVZA 2HAEA 3CRMA 2JI9A 3MRVA 4E21A 1WBBA 1LBHA 4JQYA 2F1OA 4RHCA 3RSOA 3LNTA 2UUBB 2QAJA 5CVDA 5BV0A 4IZIA 5CLHA 5AKGA 1EWYA 1X1TA 4KIGA 2CV1A 2Z3VA 1X39A 1MQ9A 2GN4A 4G2TA 1T26A 4NECA 2JCGA 3RROA 1GSHA 3ZQJA 3T3IA 3RUEA 4FHCA 5GV7A 4EVRA 1KYIA 1OAAA 3Q5EA 1X3WA 1PL7A 4B2PA 1J2EA 4LQLA 1NKVA 2FZCA 4X8MA 5DCYA 3EPJA 3I58A 3OZUA 5LLDA 4P80A 3EXHC 1B7GO 2W04A 3JWGA 3BREA 1ZGHA 1OFUX 4BVJA 3I09A 4DANA 3T38A 1F14A 2B82A 4RD6A 2XUPA 4Q4JB 3WY9A 2BKUA 2LPMA 4A0QA 3DQZA 3I53A 1AKQA 2QZ9A 1EFPB 1YH3A 1Y5IA 3EXHA 3O8NA 4PC3A 4YX9A 3PDHA 3ML1A 3SHQA 3PFKA 3QE2A 1YULA 3DXXA 3KTAA 2VJMA 1BXZA 4HEQA 4Y2XA 2KLHA 1Z2PX 2H2DA 2DWQA 1F6WA 2IP4A 4LNHA 1KDYA 4NXMB 3CCJZ 1DX6A 1VLVA 1FFEA 3OCXA 2VPXA 4H4EA 2IIBA 4URXR 3ACDA 1QQBA 4QDKA 1FTWA 1N4DA 2JGAA 3KOUA 4PWZA 5SYAA 1XNGA 4X63A 3WBJA 2R8OA 4X3PA 1N7HA 1SN7A 3B3JA 3VNQA 1GA1A 3F71A 4FC7A 2AN4A 3GNSA 4HLQB 4HK4A 3O03A 3R74A 2BM0A 2OHJA 1YV9A 4F91B 4ZQHA 4BYGA 1BA3A 1CRLA 4PNEA 3OUZA 3EBPA 3U9TA 3ZLJA 1V95A 1FQKA 3JR3A 4U8HA 4EQ6A 1YO6A 1IG3A 2GT1A 4DEYA 1UBFA 3OWOA 4HYTA 4DQDA 1Z4MA 4J7UA 1H22A 2WWYA 5NULA 1D6MA 4RGQA 4EPRA 1YFKA 2YIMA 5D6NA 4H60A 2E4ZA 3NYRA 5HRUA 1MENA 5K8CA 3LHKA 4PTLA 3SBOA 1OXBB 4OEHA 4Y2VA 4F3TA 2QLFA 1TYAE 4EY8A 4PY2A 5SYNA 4RA9B 3PXGA 3LVQE 1TJNA 2ECKA 5K3AA 2Z6VA 1QH0A 1FDTA 5AKXA 3B51X 4H6VA 4US2R 1DEHA 2IUFA 3FLBA 1B16A 2J9GA 4PLCA 1ZESA 5KMGB 4YRFA 3EQ6A 5JPIA 1B23P 4BWFB 1X19A 1B6TA 4GMGA 4IDEA 4UUAA 1QRUA 1GN8A 4TXMA 4Z99A 2HCJB 2GPNA 2J3LA 4OY3A 3U3XA 1GG8A 1JDUA 3KSUA 1Z15A 5MN5A 2ZRQA 1HMPA 3Q9SA 5KYYA 4LWQA 2BI8A 2X2FA 4ASUA 5E4JA 2GBIA 5CVCA 4E2FA 5B1EA 5AW4A 5J5CA 4AJIA 2E2HI 5IAJA 1NXOA 1Z01A 4FT2A 2X86A 3KETA 4ALMA 1XZHA 1I8TA 2HRZA 1V16B 2QYTA 1HETA 5FUWA 3FF4A 3OFNA 4ND3A 1C7ZA 2QLTA 3GEBA 4Y9UA 3E48A 5IASA 2XEDA 2VPTA 2XBLA 4Q1DA 4AMGA 1Z8DA 3KUDA 4IR7A 4JLDA 1P7PA 5TGZA 4M87A 4JYCA 1IH8A 4A6PA 3DAYA 4FMDF 2W6QA 2OG2A 5K6AC 1DZIA 4L9SA 5JQWA 2JW5A 3CPJB 2ORED 4HY3A 3S8MA 4CIWA 3ENNA 2C7BA 1IUKA 1D5CA 4YP5A 4E1AA 4XRGA 1W48A 4NZMA 1G3IA 2JNYA 2ZT8A 3ABQB 3L84A 1Z3IX 3QG5A 4OQDA 3UNXA 2WHQA 1U1FA 4W9MC 5C7LO 2QTNA 3HN7A 4KR2A 2BUBA 3FZGA 3PVCA 2FMHA 4G5RA 2CVOA 4YJFB 3OSUA 3OOSA 4IZ6A 4PLZA 3WLFA 5IT4A 1N5IA 2Q4OA 4TTRA 4HV4A 2ZB3A 3A36A 1QYXA 4CQLB 5BR7A 5IC5A 3DCIA 3LCUA 1WMFA 3ELWA 3ESRA 1E3JA 1Y6ZA 5JO0A 1COWD 1Y7TA 2LCFA 1CERA 1Y3FE 4NL4H 2ODWA 3RYFA 1W4LA 2VRCA 3GELA 4IF4A 5LYYA 1L1EA 1Z82A 2FEOA 2AKYA 1XRLA 1J1ZA 1GNRA 2O2ZA 4NRDA 5JHHB 3SM3A 2GASA 1TZCA 1VKNA 3JQEA 1Y3DE 4G5OA 3M1IA 3U4AA 4AROA 2OD2A 1MR3F 2ESRA 4F6LA 5C8ZA 1N9ZA 1E1CA 2QAGC 4WRRA 3TPCA 2E4UA 2HMSA 4M21A 3M81A 1CE8A 2Y2VA 1SXJE 5ADUS 1BOFA 5HMMA 1F2TA 3UV3A 3JARB 3VR4D 1XELA 4ALKA 4GBJA 2UYHA 1TQHA 3DXFA 4XQEA 3MZKB 3IRUA 4XSGA 2DTXA 3GRUA 3U39A 2I62A 4M55A 2R4QA 3CCSZ 2VRCD 3DKPA 1M2EA 3RD5A 2O5CA 1TZKA 1JVBA 1TQ6A 1UL1X 2X76A 4FWBA 5DLPA 5FT9A 1Y42X 4B71A 4JLMA 4E5PA 4KEAA 1CS0B 3PNBA 2G36A 2PS3A 3GA7A 5E1DA 3SM9A 3UB2A 4BBZA 2J5BA 2G07A 3G2JA 1X7ZB 4LECA 1HE3A 4PLFA 2NO7A 3TTTA 1KAEA 1A2KC 2GPBA 1I0ZA 5HM6A 1NAIA 3WADA 2Y9PB 1C1XB 1CRQA 1W35A 2PU7A 3IAM1 1OFUA 1WS6A 1E6EA 1Y6RA 3FYTA 1UPXA 3L18A 5EZSA 1J0AA 1DRVA 3TB6A 2E5FA 3BHIA 3NASA 5E6RA 5E7IA 2XIJA 2PIAA 3TI9A 1GTZA 2QA4Z 1MA3A 1UK9A 2BGLA 2HU7A 2ILTA 3W6ZA 5HZKA 5A3RA 4A5SA 3MGBA 4B3BA 4L76A 2EDCA 4RORA 4IICA 3WQHA 4FBMA 4O4IF 4DYDA 1MB3A 4WY8A 5JUWA 2ZIZA 2VA9A 4ZEMA 4C5BA 4KVGA 3TN7A 2X9LA 2WTNA 4EA6A 1B26A 5CDGA 3QI2A 3ROMA 3ZU2A 2ATIA 3M9XA 4CF5A 2I8AA 1FUUA 2DQYA 5F9MA 5K2MA 4D2IA 2ISQA 5FUBA 3HO6A 4KQXA 4F9TA 5FADA 3ZD8A 4F2PA 4UUQA 4V0ME 1EXVA 4URHA 2F43B 2EKZA 4JT8A 4JLVA 3GUUA 4HJXA 1A8SA 5AW8A 5KVVA 5KKNB 4DEVA 3Q4GA 4LQDA 3F4BA 3NHZA 4CR6A 4M1TA 3WA6A 1Y5NA 3DVAB 1EP9A 3MB8A 3BE4A 3VVCA 5FI5A 1GG5A 2BKXA 4TQ9A 3SQWA 3RS9A 1H6DA 2JVJA 1GIAA 1S9DA 2A1TS 2PQMA 4UTVA 4BXOB 1QZXA 1U4NA 1W4RA 1XCMA 3F7NA 1RRFA 3MWKA 1DJMA 4IAOA 2FSVC 3GGSA 4EI8A 1CDEA 2PUDA 1NI5A 2R7KA 1A7JA 2F8LA 2R8PA 4CKEB 3ETDA 2P2SA 2I2CA 2HI0A 3MSCA 2X13A 1M8KA 4NS4A 4P86A 2NVUA 5ALWA 3LKBA 3RU3A 1RXEA 3U26A 2N47A 3K0FB 3WK4A 4IYJA 3MWEA 4KO2S 4UBOA 2GJ4A 2Q49A 5ICFA 2H2HA 4NATA 3NC0C 3RKSA 1RLUA 3W77A 2WUDA 4UQPA 1GDDA 3D5QA 3UTCA 1IL0A 2H7XA 2WZDA 3QELA 2CNBA 4LBZA 4WFIA 5DN6A 4MTLA 1CB0A 5IKPA 2PO5A 3OCJA 4INAA 4RESA 1UWVA 2KPOA 1L6RA 5DW0A 7MDHA 4E32A 1NWHA 2NVQI 4B09A 1E3WA 2F4MA 1G2OA 5AI8A 2DBVO 3PO2I 3L7JA 5KI6A 4IPTA 5I7WA 3QXXA 4G23A 4DV2B 4EW6A 3N28A 2DPMA 5CGZA 4IVNA 4LHYA 3CF0A 3FW1A 2Q4RA 5DPMA 3WGZA 5ENDA 2X19A 3KD2A 3OCWA 4POAA 5ITWA 1UOPA 2C82A 3TSZA 3GNTA 4EX7A 2JEZA 3OPYI 4RTNA 1JR6A 5JANA 2W2KA 2AV6A 1K9M2 1NJ1A 1USPB 3HXPA 4LBVA 1TTQB 2QRUA 4I9GA 2PSFA 3SI7A 1C1YA 2P6OA 1XAHA 4H1UA 1KMIY 4OGWA 4HFMA 2Q1XA 5U9CA 1E63A 3GLQA 2P9YA 4H16A 2W2VA 2JAHA 2W2LD 3SC2A 2ZSKA 3OCCA 1BRMA 2A67A 2Y0EA 3GO4A 1GPBA 3AF1A 4XYGA 1EWTA 1QHYA 5K3CA 3DKKA 1PG2A 4KQIA 1O5TA 3NM4A 5A5VA 5BSGA 4DQ0A 3U6KA 4XI9A 1OXSC 2P2LA 3CC21 2DR0A 1YBMA 4F4IA 3MRSA 1QYDA 5E95A 1MW8X 1ND5A 2PRJA 1FJHA 4R9RA 4BKQA 1NVBA 4OLJA 3EG9A 5SY9A 2GXSA 1DL5A 2GJAA 2P3LA 2G0NA 2F4OA 1EXNA 2N0SA 3A3YA 3IHLA 5LZ4A 5FFNA 3SZLA 1S0UA 2QGFA 2CSXA 2E37A 1A9OA 5KCMA 2IZOA 1VFNA 4HAXA 3IX0A 2FGJA 1ICIA 3AJDA 2W6ZA 4AF7A 3FNFA 1LC3A 5K3BA 1RJFA 1QWSA 3BF7A 4URUR 3R6LA 1E0JA 2V5UA 3ILXA 3T7CA 3ZUPA 3H2HA 4MRMA 3CTPA 5FH9A 3E0XA 4B7ZA 2MSWA 2CLDX 4G24A 4QTUB 5FI0B 2YXBA 3I551 3O3OB 3WLPA 1F7VA 2XE6A 1ZMRA 3RV3A 3RT9A 4TKLA 5KYYB 1HFJA 1QKJA 1Y33E 4BEWA 1F20A 4DHEA 1AQNA 1BFUA 4JJZA 4MS4A 3AIOA 3KEGA 1ITZA 5HF9A 2R6MA 3CUSA 5K3FA 4DUGD 1ID8A 2RB4A 1YJ8A 1HYBA 2VZEA 4QRHA 3WHKA 2FN9A 1D0VA 5DBOA 3VPCA 4QBGB 1U8TA 3W7BA 3B1ZA 5F76A 4OBXA 4DMCA 1CF2O 1E7QA 2BSXA 1XALA 3DEAA 2PXHA 2XT9A 3VPGA 4JLPA 1FFSA 4PYIA 3OG9A 2VYCA 3E23A 4HN9A 1V41E 4WCFA 3VSAA 2F3SA 2OM6A 2C95A 4XOIA 5DMXA 2JUBA 4EA7A 3RODA 3ZDZB 3O26A 2GX6A 1WW9A 1YOVB 2NUPA 2QUKA 2RHHA 3ZHYA 2H17A 4Z0HO 1QYWA 2UZ0A 5AKHA 1WKBA 3W9SA 3W0LB 1YB6A 3CISA 1CETA 1TQ4A 1RRPA 1RYMA 1IY0A 2PDAA 1TAHA 4E46A 4YRMA 4GOJA 4GDFA 1XQWA 4JBLA 4DMHA 1U6IA 3SOPA 2JFBA 4AJ1A 1NBOA 4PWYA 5D7NA 1WOYA 2BJVA 4GX0A 4ND1A 3U7EB 4F9GA 3KLNA 4KJZA 1YDMA 3HV2A 1VIDA 5HQ3B 1Z5WA 3AINA 4RH3A 1N77A 1BAPA 1NT4A 1GXSA 2C92A 1QG4A 3BJMA 5H81A 2XA2A 2YNMC 3D6AA 2PFKA 2NO5A 3ABRB 3OPMA 3QUTA 4L27A 4OSEA 1WZUA 4N49A 1KY3A 4C0QC 4RTKA 1K83I 4B3MB 1LTQA 3D3EA 3IHTA 5FLMI 4ZOEA 3WLKX 4ZHSA 4RL6A 5HR5A 1S3SA 1PNOA 1XZQA 2V0CA 3IS3A 3VAAA 3TZKA 3KL2A 1W2WB 3L8HA 5F21A 2VPWA 1J5XA 3MK31 3CVVA 3Q1LA 1ISFA 3AR5A 4O2AA 1H2ZA 4NU0A 3A1DA 2OZPA 1OILA 1UWKA 1CR6A 1WMDA 2RH4A 3GFFA 3I56Z 2ZUVA 1D2HA 1GZ5A 2EC5A 4HXGA 1DIGA 5DXJA 3UOWA 5JDIC 2RC6A 5ELXA 1LW6E 2WABA 2WQ7A 1L4HA 1PSDA 4NTZA 2V54A 3G0OA 4ZRNA 2XGJA 4X85A 5E3JA 2AFVA 4P33A 3T9CA 3BK1A 3DEJA 3C6KA 3FR8A 4QECA 4ZC8A 3RUFA 2UVDA 3TIVA 3E9YA 2P9JA 3L4BC 3OJ0A 1FYXA 1NQAO 3GFPA 4TQGA 5BR4A 2NXEA 1IM8A 2C1ZA 5ALNA 1RHUA 2ZUDA 4FFOA 3A1VA 3NHRA 4RY0A 3UXYA 4CWAA 5JTUA 1NULA 1ZL2A 1S8FA 3JVVA 4W5QA 2GBLC 2DC1A 2E5WA 2PT9A 4GF5A 4RZ3A 1XTQA 4KQKA 3EVGA 3LDFA 4LRTB 2QVXX 4DG9A 4QTZA 3GFVA 2YJ5A 1G5QA 1D1TA 2Q8PA 3QE9Y 1GGVA 1ZH2A 3WFIA 4AJ4A 3KU4A 5JV5A 1ICEA 2YU9I 1RBQA 2VJNA 3KUCA 3GAZA 2JZCA 1LC0A 1NVMB 3WDKA 3IAHA 1QFXA 5A9RA 4EAQA 4J4BA 4A3EI 3IP8A 3NV7A 5TQ0A 1WULS 3ED5A 3GLFB 4EHNA 2P4SA 3Q5GA 4MNTA 4EX6A 3CC71 2XB8A 4OHWA 3HKCA 1D2EA 2E4XA 721PA 4KX3A 2X1VA 4B4WA 4ZJUA 2VZLA 1U2SA 1S2GA 3FBGA 2CMFA 2CL0X 1EUDB 2B6NA 1QE3A 2ZBDA 1RZ3A 3FCUB 3LXXA 3QTBA 5F5LA 1LQ2A 1QSGA 3L6UA 2QL7A 1JHOA 2HWYA 3B5JA 3H5NA 5EWJA 1G5PA 1HOTA 3JYLA 1QO9A 4OGGA 2UUAB 2BZ1A 4DC0A 3CCJ1 3GGPA 2QR3A 1CR2A 2Z09A 2AE1A 4EKGA 2YHSA 3LOQA 4G0YA 3HVKA 3K72B 1IZYA 2H3EA 3I2KA 1QMGA 1DS6A 2O48X 3PICA 4JL5A 3EGIA 3PIIA 3IOCA 1PT9A 1EDEA 1UPAA 1UAAA 1C4WA 2IHTA 2ZAIA 1PR2A 3GY0A 4UASA 5EQJB 3R9WA 5A3QA 2HD4A 3JQDA 2P4EA 3U44B 3DFMA 2W42A 1TA0A 1OD6A 2H48A 2GU2A 3PYMA 4JYZA 1RI2A 4Q7EA 3GFTA 3IV6A 3RVSA 5K0EA 2G5TA 3O2SB 3WRXA 3OQMA 2FEKA 1BMFD 5LL6f 2IBMA 2EGTA 3EARA 1C3OB 3M5WA 3PFFA 1F17A 4NG5A 4WVLA 2BRUC 4GLLA 4C21A 4KO3S 3H9EO 1JV2B 4EOGA 1EEHA 1WUTA 2WAYA 1G21E 5KYGA 5A04A 1MAVA 2VO1A 4EUNA 3S4YA 2BFEA 2C4UA 2DE5A 1QRDA 3JQ8B 5LP6F 4B3TB 1KQGA 1TJYA 4Z8XA 1OLSA 1VI5A 2RGNA 4P3KA 3ZJ4A 4CHTA 2O8EA 2FEAA 4FNGA 5GINE 2IJGX 2FA9A 3A6GA 4PPGA 1UODA 3T5PA 1Z6XA 4F45A 3T7DA 1J7KA 1K88A 2EX1A 1IJKA 4YYZA 1EG2A 1U0BB 4G0QA 3TB4A 4BLUA 3QFSA 5LOVB 3VDNB 1FU8A 1MABB 4BBSI 2JHPA 4ZQEA 5FD8A 4TV9F 4HWPA 3MN1A 2XZOA 4E7OA 1AG9A 5CD9A 5IK2A 3RT7A 5D00A 3K70D 4OFWA 3VZCA 5A2GA 4ZVPA 1YI1A 3GRPA 3WWDA 2ACKA 3MAGA 3DSRA 2DR3A 1H3NA 4V0SA 1IOVA 2AC4A 5C34B 3RIYA 3CX8A 1GEGA 4AJEA 1FXUA 3UT5A 4M9CA 4RAOA 4Y2SA 2WMOB 3P26A 4HB0A 4EHFA 2Y1KA 3OE1A 1FC0A 1DCMA 4JOBA 4YGYA 4P3PA 1YIDA 3C7KA 3LWDA 4JKIA 1I10A 1NNSA 1Q6YA 1YKGA 2GEUA 4FYYA 2DBQA 4GSYA 1FIUA 2ZUEA 3VSCA 4A23A 1TYCA 3D2BA 4Q39A 4EUKA 4L0CA 5BW5A 2JJ1A 3NRJA 1GAQA 5EYPB 1QYRA 3D8BA 2EU8A 5DF1A 5BVHB 4CKBA 5CT4A 5EQDA 1KYZA 1Z18A 4D1YA 1SQFA 5GY7A 3K35A 2CYAA 1VL8A 3TIFA 1SULA 1F0NA 3QHQA 4NCXA 3ANLA 3HN2A 1EDOA 1F0KA 1U9JA 1HZJA 1R12A 3FRJA 4QREA 3ZU6A 3GN2A 4LXUA 5ARDA 3LWNA 4UUNA 5IEBA 4EP1A 4X65B 5ALIA 2J5RA 1MUUA 2B69A 3CEHA 2C4KA 3G9ZA 1LLCA 5EY5B 4X66B 1NSYA 4EJSC 1PR0A 4DCNA 1XVTA 4Y7DA 4E5YA 1ZJJA 1OB2A 1KNXA 1DDOA 2YFKA 1YU9A 4V0QA 1N1DA 3BVPA 4JWKA 2I2DA 4J6EA 4O3FA 1EIWA 1YK0A 4ZWNA 2F67A 4EJSA 5EIAA 3HUFA 2J59A 4O4LB 3TUJC 3T5CA 5BN5A 3WR5A 2C1XA 1NVKA 1VB5A 1Y8ZA 1M2OB 3S2FA 1U65A 1QHHA 2YH2A 3P2MA 2NUBA 2W70A 4CIAA 4RACA 4V1CB 1Q7BA 5BR1A 3PF8A 4LX0A 1NDQA 4PYJA 5HBRA 2ZPAA 3B7GA 3DXYA 4MVJI 4XYEA 5E1MA 4CV3A 1GGMA 5CXUA 4OP1A 3MTDA 3LWZA 3ZJVA 1KAGA 4CIXA 3EIWA 3PNOA 3C1OA 2HBYA 4RM2A 6NULA 1UP4A 2AKAB 3U3MA 5LIRA 2D2EA 3GCZA 4CM7A 5FTMA 1C41A 1OAOA 1ONBA 2OO5C 4JUBA 3UQZA 3B9QA 3L8ZA 4PYMA 4BE9A 4F1WA 4F4HA 3VJLA 2CLCX 4UU0A 1NQOA 2R85A 4MH0R 4ZYUA 1GZ3A 2BBOA 2DFLA 2J3QA 3GJQA 5G53C 4FEEA 3ZCPA 3NAMA 4MPRA 3QW2A 2VI5A 3ZWCA 3TMYA 4BUJA 4DGSA 2IV7A 3GLTA 1K86A 2G8LA 4JB8A 1YJ9Z 4RF4A 3SIWA 3O1HB 1TD1A