2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
4S1TA 2GTIA 4RS4A 2GTHA 2H85A 2OZKA 2RHBA
chains in the Genus database with same CATH superfamily
3NJ8A 3W8FA 1QMGA 2B7LA 4K9NA 2QX9A 5CGQB 1JYSA 1NG9A 3B2NA 4K05A 1CE8A 3DBLA 4Y1EA 3UY4A 5CFNA 2JAQA 1I0LA 4NEHB 3ZXUB 4HY3A 5KKNB 1M1YB 2ZJ1A 3NXKA 2PZKA 4IICA 1NVBA 3B9BA 5CJJA 5K4HA 4DPLA 2GEVA 1DC5A 1FFSA 1H8HD 1X38A 4YDRA 5GGXA 3TOZA 3MLEA 1IRXA 1BE8A 1Z5WA 1NHGA 2SKDA 5EJGA 1JKJA 2WTXA 4JP1A 4O29A 3L6UA 1VQOZ 2OTL1 3U9LA 1MC1A 5KJ1A 4LJ8A 1VLAA 5AHRA 3WL4A 4IIJA 5KQSA 3NM6B 4ENUA 4GKAA 1C8BA 4M9SA 4RGYA 2QG4A 2NTJA 1J5XA 2QVGA 4CWAA 2GT1A 2NADA 5CEEA 3TB6A 2V45A 2VJKA 4D79A 3BWEA 5WRFA 5IYZA 2LUOA 2GK7A 1L7DA 1JHOA 3QOXA 3QMMA 5LBIA 4AUKA 3LXRA 4QGGA 3VSAA 4ENQA 4CGZA 1Z4IA 2A6PA 3L1IA 4JLMA 2HEIA 2OHGA 4DEXA 3SHQA 1WU8A 2Y3IA 3HYLA 4RSMA 2VUIB 5IEBA 3BL5A 2GBLC 3O74A 3DCIA 3KVRA 3DGEC 3OUTA 4MJLA 1SELA 1WZNA 3RZDI 3A1CA 4S1NA 2PL3A 2BP7B 2AWOA 3SYRA 1NJ8A 4EY4A 4KWTA 3LG2A 1EBFA 1K4MA 2XWPA 3H2IA 3COPA 4ENTA 4URVR 1QG0A 1XVTA 2J0UB 1GCAA 2RGNA 3PPVA 4NZ9A 4B48A 3VZDA 3WXBA 3TFOA 3IUSA 3TZBA 4RENA 3F2IA 1XCPA 4J0CA 4ARAA 3C5CA 1FDVA 1LDYA 1Y1LA 2ZYIA 2O8BB 1ZC3A 4NFSA 2DSNA 3RVNA 2VEDA 1E2MA 4PSUA 1J4AA 2D7JA 3C16C 3TJRA 3UPDA 2QP4A 4PZAA 4F2PA 1JHZA 4Y2UA 1WF3A 1OWLA 3JPWA 3B60A 1JR3D 4M36A 4MVWA 1QIGA 1ECBA 5F76A 4PO9A 1LB1B 4UM9D 5BSUA 1Y7LA 1SKYE 2Y93A 3H5AA 3VUFA 4QX6A 3I5YA 2GM4A 2W03A 4Q3OA 4PX3A 4ZA2A 3U5ZB 4OMDA 4F9GA 1X7ZA 5FOXA 2ZU0C 3P0JA 1PS8A 4GP9A 4A0SA 4CMAA 1CZHA 4RMIA 4ZWNA 4ZDJA 4FGZA 2I1WA 5BOVA 4UBKA 2MWMA 4V0KA 1U2SA 3HFJA 4R1TA 1FFGA 3QVUA 1A76A 4BDTA 4Z7JA 1PDVA 2JLVA 1ONOA 1HDXA 3IC5A 2A35A 1U5BB 1B14A 2OQ2A 3OLXA 4K2HA 4LWQA 4Q3DA 5EQJB 1GL6A 1NVTA 2Z8YA 4R5MA 1MUUA 1RD4A 2JCSA 5ER6A 4O59O 2JFHA 4RJIA 2EF1A 4Y0AA 1AIPA 6AT1A 4RANA 4Q48A 4DGSA 5IT0A 4EHHA 1EFDN 4RA6A 3FCUB 2R47A 4IGEA 4X1YB 3HOXI 1VQO1 3GO4A 2RKBA 3GLHB 4QTXA 1EU1A 2WAMA 1JT9A 3LUPA 4IP0A 4OB8A 4TTSA 1VQPZ 2R00C 4LVOA 3L1UA 4AS2A 3MILA 4C43A 1KP9A 3DE2X 3EY4A 4QU0A 5HFJA 3EN0A 4BMDA 4XOUA 3CF4G 2FEKA 5A5FA 1KSFX 1TI7A 3A4LA 5FTNA 1REQB 2XVMA 3ZGVA 1RWMA 4BNKA 3I34X 2BFEA 5IRCD 1P2FA 1TC2A 3OEHD 4YRFA 4AY4A 1RHUA 3IESA 2IHVA 3KZCA 3FKJA 4JEIA 2AOTA 4WI1A 2IZ3A 4YAWA 1RM5A 1RWVA 5EFZA 2R8BA 1BS2A 5CA0F 5DI9A 2NV2B 5FOUA 2F3RA 3QE4A 4DHWA 1JLHA 3B5IA 1AC5A 3BEDA 1FQWA 2ORED 5JY1A 1GGMA 2POCA 4I4TF 1XEWY 4H15A 4ZGGA 1J39A 1E9CA 2ATEA 3ZV4A 4ARIA 1RFLA 2F43A 4NZYA 4UU0A 3F3SA 3WR5A 2EJWA 1RXSA 2KHZA 2YN2A 3DCYA 5M29A 4DQUA 2FXIA 5H9VA 1OZFA 3H84A 3UMRA 4ESVA 3OLZA 4R01A 3P2KA 5JWHA 5JAZA 2G09A 4IX1A 1YQGA 2ZBFA 5HG0A 3BIJA 1YL5A 4LY6A 4TL8A 2O7SA 3MYRA 3EWAA 2YWJA 1Q3TA 4FTWA 3E9CA 4P08A 4AF7A 5EEGA 3ANNA 4YRQA 2LGJA 4MVJA 4MUBA 4X20B 1VC2A 5DHPA 5B3KA 5JHHB 4UAGA 1TKRA 5FL7D 4RXMA 4DK1A 4PYKA 2PYDA 4XWAA 5AVKA 3SEQA 4PNHA 3JR3A 4YPFA 1C30A 1KGSA 1NA5A 5FUBA 5BVHB 3CO0S 10MHA 2MYPA 4BGVA 4R41A 5JZMA 3WMFA 3GZ4A 5JCOC 2WHPB 1MB9A 4MPPA 3QPAA 1ZUD1 3TZ6A 3PZRA 4HQKA 2ZYAA 4TRRA 4KGVA 3MCWA 1L7PA 3A9WA 1SMKA 4TX1A 1K27A 1UH5A 3HXTA 4NJOA 4A23A 4NOZA 2GOYA 3F7NA 1C1XB 3LMKA 5LQKA 2ACEA 1XAHA 5DYNA 3W8RA 3MJDA 4GI1A 1D2GA 4BV3A 2HV9A 4H1HA 4CG3A 1HE8B 4D9CA 3OEED 2PA0A 4XFDA 1EFKA 1X1TA 1MC4A 2R4UA 1FUEA 2DP4E 3CW9A 1T4GA 3R5JA 2G5TA 3AGQA 4FU0A 4FZ3A 1Z5GA 2YVKA 3ENNA 1HETA 1N7IA 4E5KA 1L8LA 3QEBZ 2D59A 1LWOA 3PHIA 2HHAA 4C4PA 1T15A 3I2GA 5BURA 4PLWA 3C15C 5C1OA 4WBNB 2GD1O 1AQJA 3OOSA 4C0WA 1GR0A 2VWGA 3LCJA 4N6GA 4EB8A 1Q19A 1J2YA 1NNI1 5E9JA 4JUFA 5ES3A 2QNRA 2K2WA 2BMAA 3PUYA 3U3JA 1SU6A 1TXGA 4H08A 4JUDX 2ZKIA 3S2EA 2P6RA 3ESXA 4HGYA 1JDSA 4RLFA 1QQAA 1SC6A 2ZKLA 4N8DA 2QQEA 4E2WA 3PVCA 4PS0A 4BV9A 2Q49A 1YJNZ 2QTWB 4FGKA 4L95C 3AVOA 1HL7A 3O4FA 5EMKA 2VYND 4MH4A 2H0AA 3HOZI 8AT1A 5JSFA 1L4UA 4N65A 3GELA 3KQSA 3RSFA 2HGSA 4TXJA 3UWPA 2ES4A 2P35A 2GM5A 1P39A 1QO7A 1UOPA 1Z3CA 3B51X 4LRYA 3PL5A 4HNGA 1A5TA 1O8BA 2NO5A 2CL7X 3GD5A 5E6UB 4RKYA 1C0KA 1DBQA 1ZFNA 2DLCX 1O6ZA 2YIMA 2V6FA 4RDIA 3IIEA 3SIXA 1B23P 1RI5A 2ZS8A 3GGCA 4OBWA 4PWYA 5A4AA 3AQIA 2AXPA 1ZJWA 1VQ6Z 1RPJA 2VOJA 4CKBA 4EMBA 2PLNA 4QXOA 4RM2A 3ZJVA 3G6WA 1GU1A 3SP1A 3VZCA 4CTOA 1GXSB 4UEOA 1V26A 2MSCB 3GEPA 4X61A 3RRMA 1CY0A 1W52X 3ZW7A 1V4VA 5IDQA 1N6KA 4PYLA 1DELA 1EDOA 3LYLA 2CHUA 2Y2UA 5FUVA 4RLSA 2M98A 5KIAA 2I4TA 1P1KA 3GPBA 2H8GA 3VOSA 1Z2CA 4UUPA 3PKZA 3WLJA 3ZLUA 1JLMA 2Z43A 3D1JA 4S1OA 5DTJA 4Z4CA 2ZE8A 3P0IA 1JA0A 3RC8A 3BCRA 1JIQA 3A31A 2YCLA 4OQPA 3ZBTA 3K96A 4F04A 2QUAA 3KQQA 4EYKA 3R3UA 3ZHSA 4A7PA 1XJCA 2ACWA 4D0LB 5KHLB 4JHXA 3WB2A 3D2BA 4M8IA 4LXUA 1M2JA 4Q9HA 5BR1A 1IPFA 1FYXA 2X19A 3TM4A 4K9KA 1THMA 4RXUA 3E9YA 1S3IA 1NNEA 3GMDA 4RK0A 1DRVA 4WUTA 3NBFA 3AERA 1QV9A 4EGCB 3GDOA 4MUHA 3NV9A 4HMOA 1TQ2A 2AR9A 2YHAA 2BI8A 4YI3A 3SX2A 3G9UA 4J49A 3SQWA 3I5MA 2WF9A 3D5TA 3IMKA 2FPRA 2X86A 4NOJA 4G8JA 3S2YA 1HYGA 4PFJA 3VTAA 3MMPA 2Q1TA 4PGFA 3OESA 3QENA 1ZI6A 3JR7A 1T5DX 3R6GA 4QUJA 1EXMA 3UIEA 2YV1A 4HLNA 1Z07A 2BFAA 3P9KA 4M8LA 2XMRA 2A92A 4M7PA 1Q7Y2 2FPXA 3G5LA 1DDIA 1XD2B 1GGEA 2V6IA 2ZPUA 3OX2A 4KDCA 4EITA 1BEUB 2O50A 3LLVA 3LUHA 3KNZA 4QRIA 2PRJA 5B6JA 1M67A 1XEWX 1BMFD 3F1KA 4G36A 1E60A 1YJN1 1Z4KA 4GC5A 4HGQA 4R1MA 3ROPA 1PLLA 2DPLA 2FZGA 2HWYA 3OG9A 3AO0B 3A4IA 4DLRA 4CEIB 2FMUA 2HRZA 2Q1WA 2QRMA 5FLEX 4Q3CA 1M34E 2QW8A 3B6IA 3BGWA 1RZVA 3KXDA 3PWTA 2RHJA 4LTDA 2WJJA 4Q93A 4UXHA 1YQXA 4FSDA 2XTMA 4RGQA 3VR5A 4Y1GA 3WMWA 1Z82A 3EISA 2RE8A 1TAUA 4PSDA 3VR2D 3JU3A 1JR6A 1Z28A 4ZV7A 1LTHR 1SCAA 3D8UA 3QWAA 5CA0A 1O0BA 1B7GO 1BD4A 3RKRA 4NNPA 3BERA 2Q6OA 1VQ61 3AEQA 3L46A 2XQGA 5CFOA 2WSIA 3GGDA 2ON6A 3NOOA 1R8SA 5D1OA 4I2NA 2QGZA 4MWOA 4I4TA 5JI2E 2EKDA 4EVQA 2G7ZA 4H7FA 4BYMA 1DAGA 3HWX1 5ESRA 4B7ZA 1ND6A 2CDBA 1JNXX 2XE8A 3BXHA 1GTVA 1NDUA 1U6JA 1QU3A 4KKVA 3V3TA 4AQDA 1I5OA 4R6XA 3ANTA 4YAGA 4L9SA 2BOVA 2I99A 4Z6KA 3PJFA 2C2YA 4I4IA 2RBLA 3D6TB 3GMTA 1ZMXA 2F8SA 1T6BY 2B20A 2ATVA 3PDHA 1P33A 4WNYA 3X3HA 4DRZA 2D0DA 3E2MA 3R4VA 3V4FA 1V1RB 3NOXA 2VS1A 1RMQA 2AF3C 3BWXA 4NJEA 2BFWA 3D6NB 2FNAA 4A2QA 1FVHA 3SPXA 1SZJG 4WVLA 1GZ7A 2PKEA 2OEPA 4QU8A 5E6SA 1DQSA 3KYCB 3I9FA 3RODA 3HZHA 3TR0A 3V7WA 4ATNA 1XCOA 5A06A 3AVXA 1KRXA 1MB4A 3L1VA 4P33A 3PWKA 1NVDA 1HE4A 3UWMA 2IEZA 3PGVA 3HYSA 1DAKA 4GICA 5H70A 1C1YA 4OKNA 4KU4A 1AXRA 5EA2A 3HDGA 3UMBA 3DMRA 1WRBA 1NYLA 3LNTA 4M1YA 4MWZA 3HKDA 4WZBB 2YS7A 2YWCA 2Q27A 2I3CA 3O1HB 4GRIA 5EYPB 4AG3A 5ADHA 4NPCA 2EX0A 3KUXA 3E6AA 2GYWA 1SZPA 2NO0A 1C7FA 3CV3A 3FMFA 4QECA 4QD3A 1QPZA 5E1DA 5AOAA 3REFA 3V7YA 4O8CA 3OZGA 5BMOA 2I62A 4CV0A 2IBSA 5TNXA 2VDVE 5FYQA 1VHLA 4G07A 4JI1B 4CYMA 1GZSA 1T8YA 2B7CA 4DCPA 2MDTA 3I83A 3IT2A 1G5HA 2C95A 4W9NA 3IQXA 5JQGF 1PVOA 1LPPA 2EX4A 2J5QA 2O2IA 4N01A 4C5BA 3VDNB 2IEGA 4LWOA 2QLMA 4GZMA 3EGVA 2QLTA 3HYTA 2JFGA 3KLPX 1H85A 3CSSA 3OF3A 3GX1A 3C8DA 1N6NA 2HSWA 3HYCA 3G5UA 2QN2A 3NONA 4MWSA 5DHSA 4H60A 3KKMA 3VZSA 4GPZA 3VTNA 4R71A 4Z7QB 3DR5A 3HJBA 2ZJ8A 5TXGA 4B3SB 5JO0A 1JIJA 2C84A 2OY0A 1I24A 4UUAA 4OGKA 5CK5A 1BGWA 4K0RA 3V4PB 2VNHA 3U62A 4UUQA 4PQGA 3VSBA 3BA6A 1K6IA 3ZWBA 4B17A 4A1FA 1TQHA 1JPNA 1UMDA 4R3WA 4M1KA 3IGFA 2EKBA 3AF5A 2XCUA 1M6NA 1NJI2 1QHHA 2H7YA 1ADJA 2V4MA 2IP2A 3I5AA 3ICPA 3JD2A 1KYXA 3Q41A 4HH1A 4IRXA 4EB6A 4Q7LA 5K0JA 1QHIA 3I23A 3T52A 3W8NA 1UDAA 3PR2B 4WN9B 3BQMB 1DG3A 3JALB 3VDMA 4DV2B 1NJ6A 1WUKS 3IA7A 2BGKA 5LDDC 3IS3A 2D7CA 3V8QA 3G02A 1QLHA 1HOXA 4RTMA 1EUDB 1GHTA 3JXEA 2CVQA 3CR7A 2HXGA 3C5EA 4MW9A 5J58A 2IF0A 2Z1MA 2VXYA 3DL2A 3OFVA 1JU9A 4D4LA 5KYXB 1CEYA 1A88A 2JD1A 3GVPA 3NC1C 4M37A 2GJKA 5JE8A 2W6OA 3UHPA 3BKWA 4ER6A 4YV2A 4IGAA 3OLYA 1LTKA 4XDYA 2FPLA 4J0IA 1QH1A 3QRWA 4H1UA 3VTKA 1R00A 1MAUA 3T12A 1H1LB 2ZWAA 3EWNA 2WNHA 1MIOA 3HVUA 4OF4A 3PC8A 4R8VA 3T34A 1DBVO 1CUSA 4G0VA 3PPIA 1YJBA 2H16A 1KPHA 1S9DA 2L19A 2PGLA 4Z0TA 3UH1A 2ZXFA 4YAUA 1M5RA 5A3RA 1NJ5A 3WYAA 1CRPA 1L4EA 3WLMA 2P91A 5CCBA 5C5IA 2O7RA 1HZZC 5FQNA 3M6WA 3MFYA 1GARA 3RVDA 4CZ2A 1DIRA 3W5BA 5KS2A 2CB0A 4UFOA 3L79A 4AZTA 1K5HA 4D0NA 3FHTA 5IZCC 3FF1A 1FYFA 4N3BA 3WLSA 2BM9A 3EGDB 5TE9A 7REQB 3RBXA 1PZEA 4RVOA 4CE6A 4KUGA 1J8YF 1NQVA 4OI4A 1ANKA 2C4TA 1VDMA 2WTUA 3N0XA 4EY8A 4LI3X 3IIIA 4KLNA 5LL6P 1TCAA 3IOMA 4ZHQF 3QVLA 4YMVA 2IIPA 4RTLA 4WEOA 4CM3A 2IPAB 1IE3A 2AJTA 5ILOA 4FFDA 3WV5A 4Q4CA 5J43A 3HA2A 1UPCA 1K9M1 1KNQA 4J0FA 1KH2A 2KQUA 3PSAA 1J2RA 4QQRA 1CUJA 1L5SA 4INOA 2BZGA 4DLWA 5LWHA 4DR5B 3ZGXA 4N3AA 1IVSA 4IKPA 4UW9A 2DGDA 2EJTA 2PHZA 3AF0A 3UT6A 4AO6A 5BNWA 5EHXA 4US0R 1SEVA 2BEUB 3CH5A 4DUGA 1Z16A 1WM1A 1WD5A 3QQ5A 4NCJA 4TV8B 4NBAA 4ZOAA 4B7UA 5T3UA 4IPTA 3P2IA 5A5DA 3G2JA 3MSCA 4ZGWA 1ZSVA 1N2SA 3KYBA 4EHIA 3RSQA 1J0AA 1TQ8A 3QLVA 4DXHA 4D43A 3ADOA 1FRNA 2A59A 1U2DC 4G5QA 5E8JA 1H1TA 1NX6A 1UKCA 2GN4A 1M2KA 4UPEA 4KYIB 3HFRA 3SAJA 4LTMA 3KT6A 4JYMA 4MS3B 2B4TO 4BXOA 4KR2A 1JU3A 5FNVB 4EY6A 1HYBA 1QH8B 3O4IA 3KKQA 4G5GA 4GVPA 2G9QA 3WKAA 5K0EA 1LPOA 2ID4A 4GBGA 4H7DA 1GG5A 3O8RA 3WDKA 4J1SA 4FQ8A 2YHBA 2VRWA 3H2BA 4UM7A 4A5SA 4FD2A 4N48A 4GYJA 2C0PA 1ZOOA 3PEUA 3ZG6A 4F71A 4PBSA 4NZZA 1FW8A 1EA5A 1RYNA 4GLBA 3RFVA 1GNSA 5U1PA 4CQNA 4DG9A 4HNHA 3T1QA 5KNDD 3TNYA 1J5PA 3KETA 1LD3A 2BSQA 1W34A 3HMQA 2QORA 3ZWCA 5IG2A 5TB5A 1I4EB 3WLTA 4GQIA 3VR6A 3NFYA 1V45E 5GJBA 2H3HA 1UXHA 2VH5R 2ZSEA 3NJRA 4J7XA 3I9KA 4UXJA 3ROMA 1O4VA 1VIAA 2NUPA 2F2TA 1X19A 1XA0A 2ZUSA 2O57A 3E35A 3MWFA 4BFYA 2QF7A 5EJ8A 4HADA 4UVEA 2VF4X 2EWMA 4IS3A 1YI2Z 5LZ2A 5HF6A 4BY7I 3UCEA 1P60A 1Y9JA 3F3YA 2CNWD 3OOEA 4ZODA 3ZHCA 4DLBA 3VNAA 4D3ZA 4LVUA 1CB0A 2F3UA 3GOQA 2L42A 1R6TA 3KEMA 4GNRA 4AYWA 1NVVQ 4ESHA 2QDKA 1S2DA 2QE7D 3RT9A 4N47A 5KTRA 5C53B 1DU4A 3EPHA 4LQLA 5J47A 2F3TA 4G4SO 3GDFA 4YUWA 4O5AA 2Z6UA 4DQVA 2EZ4A 2HCJB 2V74B 5EMHA 2BVNA 3UOAB 3KLBA 3NB0A 1KQSY 1CS0B 1JLSA 2H4ZA 4EUNA 1EQAA 2VJMA 2R68A 1P18A 3G1TA 3EXHC 3IXQA 3QUCA 4FFSA 4H7HA 4JL6A 2E4VA 3TSOA 4EI9A 5B7QA 3L40A 2HXSA 4KXNA 3E5NA 4E5SA 2P11A 5U4QA 4CLHA 2OFWA 2QVXX 4KMOA 1JPVA 4JNKA 5L8VA 5ER9A 4N82A 3LDFA 1SG9A 1SC9A 3W5CA 1DGQA 1B4DA 2QX7A 5ABPA 1T1JA 3GVHA 3GZTB 3KJEA 4DR4B 5IJZA 5JQGA 4PG6A 2FCRA 3B5JA 4B71A 4TTQA 1H2FA 1LPAB 3P9SA 4B3MB 3WP0A 4X3OA 2RHMA 4YROA 1PWHA 3HXLA 3S1MI 3KPJA 4BQSA 2O59A 3QWIA 1EJ6A 2D13A 3KEOA 1JVNA 3J7A4 3KB6A 2R8PA 4PTLA 4LZZA 4WDRA 2WWYA 2W4QA 5C4MA 4WOJA 5LXTA 1LLQA 2OM2A 3VSEA 5IJ9A 2Z4SA 3ETDA 4C7OA 4KQ2A 4IHJB 5CGZA 1SUBA 1AGXA 4PTZA 5HUHA 1GZ3A 4AY6A 3E1SA 2QPAA 3BXFA 3MJRA 4I1PA 4MWTA 3NP7A 1J24A 1QYDA 1YB5A 4XYEA 4DMMA 4YUAA 1U02A 4M4SA 3ESWA 3TGWA 1OT5A 1LXCA 2ZRHA 3BRSA 5CUQA 4MB2A 2X0DA 1HYHA 1KYWA 4EI2A 3JZIA 2QG9A 3I6QA 4AYTA 1P6QA 2BGMA 4TLMB 2ZJAA 5BMVB 3CCBA 4QYSA 3ZGNA 3UGTA 3C45A 2A0UA 4UDXX 3FDFA 3LZCA 2W2LD 4U02A 2AKLA 2BTOA 2ZB2A 3RFFA 2KX7A 1I3CA 1OKKA 2QT0A 2I7CA 3KU4A 5AUQA 3PFBA 4L7VA 1W6UA 5J63A 2R96A 5FOSA 1SO8A 2P1RA 4KODA 1WXXA 3KAPA 1KBZA 1XCGB 3L7IA 2RH4A 3Q5DA 1YI21 5ALWA 2PJRA 4RV9A 1Q1QA 2K5UA 5BYAA 2VUHB 3LSTA 1F2TB 4RVGA 1F48A 1S02A 4J2OA 4U7DA 4YV1A 2EQAA 3KJHA 1YR3A 5A3JA 1SKUA 3UENA 2QU8A 1NZDA 1D8AA 2BR3A 3EEBA 4IQ8A 1A9PA 1OLSA 1LLDA 1Z7YA 1IZ7A 2HMYB 3BRQA 4G5XA 4DOMA 4JI4B 5IT4A 1W88B 3UAWA 3ZK8A 1QYWA 1FMLA 1TJPB 1Z45A 2HNAA 3H2KA 4HBGA 2V3VA 2YWRA 3UAVA 5ITZA 2CZQA 5G1NA 4AK9A 2VDJA 4ZALA 4X1IA 1P81A 2BFFA 3VHRA 4BVKA 1KAEA 5H3CA 3DLHA 1E6CA 2ARKA 2VNJA 4HNRA 4GECA 4PHCA 4AZSA 1KVTA 1CUVA 1PKEA 4L0QA 3QEOA 2C2HA 3HY4A 2D2XA 2FSIA 3DV0B 4Q37A 1GZDA 3K0SA 1QZZA 3GFGA 2CXNA 1R9MA 4MAMA 1KK3A 1E2GA 3N5KA 1L1FA 4FZ5A 2YY7A 2OV3A 3R6TA 1QZTA 1YHQZ 2CUTA 1EMDA 4JFRA 4NG5A 5FA6A 2IPNA 4D45A 4ZHQA 3C3KA 4ZJZA 2OCIA 5CITA 5L45A 3KP1A 3D1LA 3D8TA 1I94B 1UAAA 2QRCB 3CUUA 1E63A 1VRCA 1UKBA 2XQFA 3TNDA 1JH8A 1Y7HA 4J9UE 4L16A 1KQ3A 4BZWA 2C5GA 1TM2A 1RXCA 3R2JA 5SV2A 1BX0A 4LZPA 4AKGA 1NC1A 1DEHA 3EZXA 5ISMA 1J1IA 2B5VA 4ZU6X 3CC8A 1LUAA 3DDZX 1NVMB 5GIOE 1R3DA 1B6RA 3ADKA 3MWDA 5JEDA 3J80b 4FONA 1I7DA 2YHIB 3EASA 5TPWB 5BSWA 1USGA 4GZLA 2QT9A 3RAFC 1ZL2A 1DSSG 1E2HA 2EU8A 2IUTA 5F78A 1I36A 4FEAA 2VQFB 4NF2A 3JYNA 2O3SA 3DF9A 3KR1A 4F97A 3PNPA 2CBGA 1H3EA 2OD2A 3O1JC 3OOHA 5I8WA 3CVXA 3NV7A 2GR9A 3HKEB 4M46A 1S7CA 3V8PA 1RLUA 5FBHA 1S2MA 1TRHA 4XM2A 3RARA 3IQGX 5KPDA 1A5AB 3A1NA 3DB2A 3ZC3A 4POAA 4NL4H 1T2FA 1Z47A 2H0QA 2J09A 3OHPA 4D6XA 1C8LA 1EWKA 1MV5A 3KYJB 1Z75A 2AK2A 3FFWA 3U40A 3GQBB 4RY9A 4X00A 4YAFA 3ZHVA 3O2JA 3U4HA 3E22A 3UTCA 4A91A 2BYTA 2PMWB 2ZS7A 1SUCA 1ODLA 3MONA 1YA8A 1D5CA 3BD8A 5TGTA 2P2YA 1F20A 3R7LA 3ZBPA 5B64A 5LUBA 4R0MA 1SWVA 2R79A 4QSMA 1M2OA 5EXEA 3NIBA 3MCZA 4YJGA 3IUEA 4FB4A 3SYMA 1ZLYA 4LTNA 3CEJA 1SQSA 5FLMI 4JLOA 2COEA 4LXQA 4XQ9A 3QKRA 4U39A 1CUXA 1I4DD 4L15A 1YC2A 1V8BA 1P5JA 4GP7A 5I4IA 4HGRA 3I01A 2FUKA 1PL6A 2X4IA 4Q9KA 1JHUA 5F7JA 1B6SA 3PQEA 4MGYR 4WOBA 4TMWA 1YIJZ 3C39A 1ZGBA 3IDQA 4KVFA 4L02A 5H81A 2RH9B 3WLRA 2ZI5A 1IG0A 1UBMS 3NZEA 5KVVA 5LYJF 4GL4A 2BLNA 4MUNA 2VHVA 1Y1TA 3B1VA 3HXOA 1YHQ1 3K2IA 2WHRA 4CG0A 4E70A 1Z83A 4EY5A 2VBFA 4NIMA 4XXHA 4C6HA 1PT5A 1VMIA 2AH5A 4BP9A 4P84A 4W9RA 1DKMA 2N46A 4B40A 1T8SA 4KYUA 2DQSA 2PAFA 3CPHA 1Y4AE 2QR2A 3IJEB 4BUZA 2C7RA 4JV5B 4P7FA 1CHNA 4PX2A 1E2PA 1X80A 2XLBA 3UYLA 4JBYA 4A16A 5IFLA 4ALKA 2ZI3A 4RM3A 1Z63A 2IV2X 2PRZA 1XQ6A 1LSSA 3I9V6 5SICE 5IP7I 4HDSA 2R92I 1Z6AA 1MRNA 2JIZA 3AEYA 5H5JA 4RULA 1HLPA 1ZI9A 3OCXA 1BD3A 1Y6ZA 1ECGA 3CNNA 4UEJA 2R6HA 5HVNA 5LD2C 2C94A 4MVJH 1Q14A 1GPH1 3CRRA 3U4QB 1J2EA 2EVWX 3MERA 3LDHA 5ALXA 1BCSA 3SI7A 3RLIA 3E7WA 1K86A 1ID1A 1ZEJA 3QBEA 4OJYA 3UGJA 2D5BA 1FNBA 5J2UB 2NU8A 2Y0BA 4W5RA 2GVNA 3MC1A 2BT4A 1I3QI 3CN9A 3EOAI 3D7LA 4KTTE 4OM8A 2P6NA 4ZT4A 5FL3A 4C4YA 3DLBA 3UC9A 1T1SA 5KJ6A 5EUBA 1A71A 4X85A 1VXRA 3PRYA 4RPCA 4Y0VA 5H8WA 3K9FC 1YA6A 3ND6A 1J49A 1EEHA 1BWSA 4IJVA 4DSAA 1IPHA 1XVUA 1E7RA 2BBTA 3RVOA 3R7WA 1JR2A 1ZD8A 1B73A 5EJMA 3HRKA 5ITVA 4P32A 3SZGA 4LJLA 3QX3A 1Q0HA 4NBBA 3OT1A 1NPDA 5HM6A 1D6MA 2JHFA 2PNJA 4F7DA 3HPQA 2ERCA 2OKGA 4ND8A 2JHPA 4EA9A 2H9YA 4TMTA 2EG9A 2ZBRA 1KDOA 5FBKA 2H2DA 5CA1B 1F2UB 3BD9A 4A3FI 2ZSAA 3GLQA 4ENPA 1ITZA 1E6MA 3DEJA 4EZEA 1AMUA 1G1AA 1PK9A 3LI2A 1II8B 3L0OA 3PXUA 3HCWA 4GE0A 4AMUA 5CBPB 4K81B 1H4TA 3K0AA 5FOVA 2JFVA 1BQ4A 1HDYA 3ONEA 3OF5A 3N2ZB 1Y8RA 4QNNA 3T3IA 5A4JA 1XLTC 1D4OA 2DUWA 2QTFA 5ALEA 6LDHA 5FV4A 4KV7A 1JUDA 5ILGA 3UO8B 1KY4A 1Z2PX 4A03A 1SBQA 5KB3A 1KP2A 3AX6A 3PNKA 3SKYA 3TAUA 1V8FA 2DECA 1SD2A 5FWNA 2W93A 4NBWA 4RVDA 3NVAA 3FYSA 2WJYA 4LHXA 2ZE5A 4LQCA 2IPMA 5FULA 1GTSA 3MGGA 1XMQB 3E3MA 5IVIA 2H1RA 5KI6A 3J7TA 3SBEA 2B1IA 4HLQB 5H3LA 4TZ6A 1EP1B 1K2WA 3A6ZA 4GLJA 1NUIA 2OP1A 2PH7A 2I2CA 3QPBA 5KVAA 3WGIA 621PA 3RADC 5BN1A 1SGWA 3HY3A 4FMDF 3MLAA 3IB6A 4CMIA 2GEJA 4NY1A 3WRYC 2GEFA 4BEBA 1S8AA 4CTNA 2PWZA 1KI7A 1TEVA 3OP4A 2EEZA 1AU9A 2AIRA 2NO1A 3TW0A 3RS3A 5AKZA 4EB3A 1WCMI 2BDTA 1XTTA 1UBUS 3QEMA 2N3ZA 3BTVA 1YVUA 1MV8A 1NNLA 3ZQ4A 4ZYZA 4XW2A 3NLLA 4P3XA 3ZHBA 4ZTZB 2ZYGA 2DLNA 3S27A 3WDMA 3AEZA 4GWLA 3UZUA 3ZJYA 1X1QA 3IUMA 2YFYA 3AMVA 1EEXB 2XCOA 2DBRA 4GI7A 3GY0A 2EW2A 1LX6A 3PFCA 4CL0A 2WB2A 3N5CA 1MOZA 4QDOA 2QD1A 3EXG1 2VDNB 4XB1A 3A1WA 1FSGA 3B3AA 1DC7A 3JX9A 3BTOA 4YJKA 1THGA 2I1VB 3ICWA 4Y8VA 3TXXA 1YDEA 3DUFA 1KMIY 1TT5B 1XR3A 4JC5A 3ROQA 3VUEA 3WYFA 4TS4A 1C5KA 4D5EA 4G81A 1BC5A 3UV3A 2OXFA 1CNMA 2CLHB 3L8DA 4YJ2F 1VYUA 3HKCA 3X1MA 4PHGA 5B1YA 3D02A 3OFKA 3RIYA 2JLQA 2GCOB 1U9YA 3IYLW 3S55A 5CIWA 4B6GA 3JVIA 3U49A 1C1DA 1L5VA 2XWBF 1VFPA 5A4KA 3BVPA 3HEAA 4Y2YA 4LYJA 1S8OA 1GIAA 2YMQA 3DL0A 2BEVA 3PPXA 4U2EA 3KJIA 4BCDA 5DXJA 3AKDA 5IFKA 1QX3A 3I30X 1CIVA 4HDNA 2FB9A 2QAIA 4R7ZA 4YRKA 2HR1A 2Q8NA 3H1FA 2E4AA 2WM2A 3OO1A 3BJZA 1GLNA 3T7SA 3QYPA 4MUEA 4A8JC 1OX5A 2J1LA 2VHUA 1ZCBA 2EGHA 2I3DA 5AVYA 3VQTA 3IDOA 1KH3A 4R54A 1O2DA 4X7PA 5HRAA 2DBZA 3SJ7A 5L7WA 3HCAA 3ZWNA 1QX4A 3TTTA 4COKA 1C9NA 2FX5A 2GPAA 1GRCA 1LGYA 1M2VA 1WJGA 2INGX 2FZ4A 4HAVA 2YYYA 5FOTA 3WRXA 3Q6IA 5EJ4A 1N5KA 3IE2A 4MV8A 1NBOA 2B99A 4UPDA 3U3MA 1P61B 4W99A 5FAXA 3WHKA 2XB8A 3ZE2B 3VMGA 4RNDB 3BPSA 4YGXB 4IWNA 2YXPX 2WSBA 1Z4JA 3IP6A 2Y0DA 4ZOEA 3ULKA 1U0BB 4AQYB 4J0KA 2X2OA 3LRXA 4FFPA 2FETA 121PA 3O8OA 2G9UA 4IZHA 4S1PA 5JZOA 2WHXA 2FMTA 1XMPA 4NCAA 5F9HA 3VPHA 1JG1A 1JEAA 3VH4A 4IJMA 3ZD6A 1B1CA 1U3VA 2KLHA 5B3JC 3K8QA 3W2HA 1W7AA 3EK2A 5LYJA 1UKZA 3D7SA 3CVWA 3WVNA 5ITSA 5CX1B 4KPEC 1IMJA 2C78A 1I9CA 1J1ZA 2YN4A 4Y98A 2CNNA 3L5KA 1DG9A 4YV0A 2XIQA 1D1SA 1TM3E 1RO0A 5EFOA 4ARZA 5FD8A 3OPYI 4BZXA 4D2IA 3OOYA 3N74A 4XVCA 3R3XA 2PWPA 2UKDA 3HWSA 4MDFA 2E4YA 1RQLA 3I45A 2BR4A 3DM9B 3TLYA 1ZK3A 1NXTA 1LZKA 4JB8A 3FGNA 1ZI8A 4OGWA 1RT9A 3CISA 1G8GA 1XMVA 2DHCA 2PX4A 2FHSA 3LHDA 1K92A 1X8XA 1EFPB 1QRSA 2B0CA 1T2DA 1NJ1A 2EAUA 5DBOA 3RFUA 4DV1B 1O1YA 3OFNA 2HA4A 2VC2B 4II7A 1ESCA 1PFTA 3AG6A 3KZOA 4URXR 1IBKB 1PL7A 2C3UA 4C03A 3LW7A 1ISJA 2WYUA 4LECA 3T5AA 1S6YA 1KSHA 3PIRA 4P4SB 4U2BA 3KQHA 3OC6A 5MHTA 4P4LA 5JRZA 1ULTA 2HAEA 1NXVA 4GH5A 3H8SA 1QZXA 1DTEA 2Q6VA 3RIEA 3LUAA 1F7VA 5MN6A 1MRSA 3YASA 4YUVA 4M87A 1G20E 1U0NA 3FYCA 4TT3A 5DMHA 3EEDA 1I13A 1M72A 3HLTA 3JRNA 1TYAE 2MYNA 4NBNA 5AM5A 2AVNA 4OY3A 5IJ0A 4FYWA 3UW1A 3IF8A 2IBMA 1V6AA 1Z0IA 1N7JA 4MUIA 2XA1A 1BX1A 3AJDA 2GN9A 5HRCA 1W4LA 2JIMA 3PQ3A 4EG0A 3AZQA 3QE2A 3AUXA 4B3BA 2VN8A 3Q7IA 3Q98A 4R1PA 5HXAA 4LZLA 1KJIA 4JCCA 3RJMA 5E4JA 3EAQA 3FD8A 1GLGA 2PO5A 3TLEA 5I51A 1DJOA 1ADYA 3B1ZA 3HEMA 4ESEA 2W0MA 4I55B 3AH8A 4L08A 4X6YA 5B12A 5BV2P 3PUWA 5PNTA 1DHRA 5IJXA 4O1HA 3O95A 3FUXA 5AT1A 4DIEA 1LNQA 1KQFA 4XH9B 3QA3E 3B53X 3GWZA 4ROTA 2RG1A 2OG1A 3ILXA 2WJVA 1YK0A 5KX5F 2Q2QA 3H5RA 3RK1A 1F4LA 1AUXA 3QX7A 2W6CX 4WCFA 4FMPA 3H7IA 1RE1A 1YZQA 2I3AA 4JYCA 1AB6A 3DKKA 4MS4B 1P45A 3HSKA 3T1OA 4YCDA 3C6ZA 2CV0A 3CBQA 4G1UC 3S99A 2OHOA 3VC1A 2JCVA 3EARA 2QSUA 1PV1A 2E6UX 1N6IA 3IBGA 3RNOA 3L82B 3DPSA 3PQ7A 1AK1A 5B1DA 5I48A 3QZUA 3DYVA 1VSBA 1X86B 3E3AA 1SK8A 2W6JA 4JK3A 4WY5A 1Q7RA 5I01A 2NOAA 3QPDA 4UTRA 4DNQA 1DEXA 3QELB 1CJSA 4JLJA 4ZAXA 5K8VA 3TL6A 1B0PA 1Z6TA 3B6EA 1QAOA 1KKUA 4XD2A 1Y3IA 2OCBA 5FPKA 2X6RA 5EIEA 3LVRE 1JQAA 3MGBA 1A1VA 1P4SA 1E5LA 1Z88A 3DQZA 4EPWA 5IASA 3KFXA 3PUIA 2UXBB 4RKQA 4EKEA 1DWUA 3K9QO 3R3JA 3AI2A 1ZGCA 3UWDA 3GH3A 1PNRA 4B0PA 4R1QA 4CMKA 2Z58A 5CNMA 3Q87B 2H00A 1HDOA 3A4TA 1V9SA 3DTVD 4YJ2A 3BD7A 3MJ4A 4LMPA 1PIWA 4JEUA 3RS5A 4A27A 1XZAA 2AQIA 1XV5A 3CPSA 1JSZA 5C1PA 3AVTA 4HPXB 4AP9A 2QRJA 4L0DA 4V02A 3NX4A 3KPVA 1DS6A 5EJEA 4ECEA 1OXUA 4J6EA 2H1SA 3F3FC 1B41A 3DMYA 2R6AA 1D8TA 3LUGA 4MI3A 2NXCA 2JGEA 2O52A 4L0MA 2IH2A 3V4LA 1IXKA 3EMDA 3TEJA 5CCEA 1ZHOA 2ECPA 1FVXA 2FZEA 4P4NA 5EIAA 3IVCA 5EY5B 4DV6B 4UARA 4BMXA 3ABSB 3OZWA 4BO7A 1NZJA 4BLQA 3NEYA 3LH5A 5L4LA 1AHPA 2E5LB 4WIAA 1FQOA 2LXNA 2X23A 3SIRA 1OREA 1JLLB 1KU0A 3JW8A 3NPMA 4EX6A 16PKA 3OQ6A 4LIPD 1FEZA 2J7KA 2VDOB 3AJ9A 2GBCA 4F5EA 3DHWC 5H9WA 1WUIS 2W2OA 4TXNA 4Y67A 1XL0A 5EHGA 9LDBA 1KZ4A 4MOWA 1BXRB 3WLPA 1C14A 2H08A 1LLCA 2H1VA 4YMGA 1BOOA 1U6IA 2PVPA 4QOEA 2A57A 3CA8A 4NCHA 2RHBA 4NKRA 1FP6A 4LCBA 2OBYA 1L7QA 3H2GA 1Y7TA 3RC3A 5AVUA 4EDHA 2HT1A 3D3WB 1ABEA 2AOUB 3LTEA 4B3DA 4L2IA 4EHLA 3PFKA 3M4JA 1RACA 3C3WA 5AHOA 4DRXB 3I9OA 1OX6A 1O95C 5KOJB 3VHXB 1U1IA 2PT7A 2CE7A 3QU4A 2YQZA 2XA9A 4I3FA 3EYAA 4J7AA 3U3ZA 4XLTA 3D8HA 1A72A 4OXYA 4CUKA 4EO4A 4K6KA 1K7CA 4EMTA 4GR4A 1ACMA 5T4HA 1VIYA 1NMSA 4HAOA 3DLIA 2IYOA 2ZT6A 3DZGA 1MAWA 4NZOA 5B3LA 4MARA 5LMZA 1XCLA 1L3IA 3HO6A 1T36B 1KMHA 5JISA 4UHEA 2HDNB 5ALKA 2GA9A 5J1SB 1N6HA 5LQRA 1NYTA 2J30A 2YX1A 1LFAA 5ALMA 1TJ3A 4M86A 4BWVA 3NJ4A 5IAOA 3N8IA 1G7RA 3EDCA 1XVAA 4EPVA 1G0OA 5BQFA 1ISFA 1HF3A 4F8EA 3CWCA 1N2JA 1WOMA 1SVIA 1EFVA 5KWIA 4LA4A 2AHRA 3Q5GA 1H8HA 4ZI3A 1CF9A 4CIYA 3K05A 3L8FA 4QOHA 3WB1A 5E2AA 4EPYA 3VR6H 4P1ZA 4NYJQ 5AI4A 2GZ3A 2NQ2C 1FVOA 2OXRA 1U7HA 5EERA 1YJ8A 1TEXA 3IEIA 1M8KA 1WZEA 2CJFA 1TFIA 3RTGA 2ID7A 3C5VA 4BBJA 4NBCA 1F12A 1P2DA 1JKFA 1E9AA 1DADA 4MD9A 1Y1QA 1X1BA 2FPSA 5KHAA 4JVNA 1ISRA 2YU9I 2WE7A 4UOQA 3TH5A 4MGIR 5E8RA 5EJ7A 2V7VA 1D2CA 1P2TA 1OWMA 4BRWA 3BGOS 3WLOA 4JOBA 3DYIA 4H77A 4OM7A 5CLLA 4TMVA 1WXDA 3REGA 4BE4A 2H06A 5KNLA 1XAJA 2AB0A 4LV5B 5C7OO 1KFEB 1SAYA 4FW8A 3H5NA 4DSUA 5B6IA 2RBGA 4U7GA 1VKHA 3PT9A 3A9RA 3H1BA 1Y6GA 2C31A 2O53A 3PC7A 3TSAA 2ERYA 5LOVB 2WOJA 4UCXA 3CH4B 4A3CI 1P7CA 4DQDA 2PD6A 3ANYB 3IQFA 3DA8A 3BXGA 3Q3IA 2V5AA 1RKQA 3UJPA 4NOKA 4L5CA 2A9PA 1T6YA 3IFUA 2Z5VA 2UUCB 1S1MA 3QF4A 3TPFA 1MKYA 3TLJA 1GT6A 2BSAA 3G2MA 3PV0A 5A5VA 2Z0MA 1DTWA 2DKOA 5CIYA 4R1NA 4DFDA 2VF7A 4F4HA 2G71A 1XT6A 3VOBA 4FS8A 5LA6F 4DLSA 1D04A 1P0QA 1CETA 4BNGA 2KM1A 5COAA 3WI7A 1V5EA 2R7MA 5BOSB 4R5HA 3W2FA 2R7KA 2JLXA 1DP4A 3GK3A 1K06A 4RPJA 1JR3A 2W98A 2GN2A 3UC5A 2C8JA 2Y1KA 1NDHA 3F74A 5KX5A 1GZUA 1DX9A 1RWWA 4FYVA 3K7AI 1BHSA 4MEJA 1Z22A 5JJLA 3KLMX 3DZIA 1PJ4A 1VLZA 2B37A 2NVYI 3KIPA 4R1LA 4XEUA 1PR4A 3WG9A 5A05A 1KAQA 1NRIA 3RDPA 1MJHA 3ICEA 1IH8A 2NYRA 4PXAA 2J3HA 3L6OO 2V4ZA 2XBUA 3A6FA 4R68A 5HCIA 1NN3A 4F91B 1EQUA 2VHZA 4N5LA 4ND5A 1I0ZA 2X58A 2DBVO 3DGFC 4QYIA 2FDCA 2CJWB 4XX0A 3OU7A 3DL4A 4DILA 1TA0A 5TT1A 3K5HA 4R6WA 1KEEB 3AINA 4QICA 2YRWA 1W1IA 4XVHA 2R6FA 3B8EA 4CL1A 1WHSA 2V5UA 4XM0A 4YMSA 3OTOB 2IHUA 2F8LA 3BOSA 4I8XA 1R1DA 1L4MA 2P0YA 3B38A 1GY8A 1HFJA 4XTRA 1IMOA 4WZAE 3SEZA 2V9CA 5AW1A 1LQLA 3MBOA 2FFRA 2CNOA 4Q1BA 2TSYB 2RHOA 4JVMA 3H99A 5DBGA 4RIFA 4QUHA 4AF6A 1A96A 4A15A 3FB1A 4XUEA 5A4FS 1T1EA 1BJTA 3OEHA 4GMGA 1VKZA 4G65A 1D9ZA 3CRMA 1T0UA 3LHFA 1KPGA 1Z0KA 3IUQA 3EIOA 1RXVA 4LJYA 3C3AA 5IAGA 4US2R 1M6VB 1SBHA 3JD3A 4IDDA 1W96A 2JHAA 1MO2A 2VAXA 2C2GA 2GZRA 2R1TA 4B4WA 4W8HA 1J8QA 3R77A 1NW3A 3P2OA 1Y3BE 3IP3A 4EHNA 4PG4A 2NZWA 1I51A 1YCGA 2M1XA 2Y66A 4FKMA 4BNUA 2VQ6A 4WKNA 4AJHA 2FEPA 2FP4B 2YCBA 3VPGA 2NUBA 3E1KA 5K6RA 4L8VA 3ITDA 2NZVG 3JWJA 2XKAA 1KJWA 4PAQA 5K4AA 5BSTA 3RB8A 4DN6A 4IM7A 3G13A 1HDRA 4Q7MB 1DXYA 3F7TA 1EA7A 2BDUA 2Q62A 3K5WA 3GRPA 3MWEB 1QUFA 2EZUA 5G02A 2QTZA 4I14A 2FDXA 1GTRA 1M1YE 5DHFA 3K1TA 4ZI2A 1YE5A 1UQUA 2VT6A 4DANA 1TE2A 1WUHS 1OCEA 2I4MA 4ES6A 2I91A 4H35A 1ULBA 2I76A 3F4BA 3JQAB 4ZPJA 2JNWA 4E0BA 1YE8A 4GR5A 3GNSA 5CJ2A 2JK0A 5CK4A 1W8DA 5FL7A 1KDZA 1CUYA 2B2XA 4BMSA 4L5AA 5ALJA 1JQDA 3CTMA 3TW8B 2X77A 1IUKA 1K7SN 3IKLA 4LV8B 5FBVB 4LMAA 1RTKA 3CKLA 2IXFA 1XQ1A 4BU0A 4OB7A 5IUJC 1XEAA 2MSKA 2Z95A 3UUFA 3ZWAA 2P6MA 1G8AA 4HF7A 1I4WA 4IG4A 3TIVA 1XRNA 1W9MA 2QRZA 3VPSA 3W8DA 4MXDA 3QWUA 2J3QA 1CQIA 3BE6A 4IVNA 5KYVA 4HVCA 2I65A 2O8NA 2HQOA 4RKRA 3WLEA 4LF9B 3GNTA 2O2GA 5A6SA 3R23A 1IK6A 3LP6A 3HWWA 5JZBA 1X7DA 3OWOA 4IGKA 4BAUA 1R4NB 2PR2A 4O4HF 2O5CA 2IP4A 4UAVA 3NHMA 3HGQA 4EX7A 2HHJA 1Y1VS 3FVRA 1YULA 3G59A 4U7WA 3OZUA 4B82A 4CKEA 1S2OA 1E7WA 1PX2A 3OEEA 1TM1E 2J9YB 4MI9A 5D3MB 1VL1A 1O96A 4F0JA 4TXHA 3OBBA 2B61A 3PJDA 5D8DA 1JFFA 2FFAA 1EHIA 2UDPA 3RIXA 4GVXA 3PJEA 2RGDA 1ISHA 1PCXA 1SB8A 2JLRA 2VOEA 1XXHA 1NXPA 1Z33A 3FNRA 4ISCA 3VH1A 5AXAA 1YAHA 3O8CA 1P17A 1Z8HA 1R3UA 2PEYA 2ZRCA 3GAAA 1MABA 1KRWA 2QM0A 2IHNA 5K3FB 3DBLB 2RHLA 1N3BA 3QFCA 2NPFA 3O1LA 4OUDA 2WYIA 4RHEA 5AVOA 2FF7A 1BFUA 1OXXK 2PFSA 2Q3JA 4IOMA 4MR9A 4CQMD 1P5RA 2NSJA 1NASA 2HTFA 13PKA 3H0CA 1PFUA 1QRAA 1WUTA 2VBIA 3K16A 1ZB9A 4NE7A 3SR3A 1F38A 3P7MA 1G8PA 4QDXA 5KSWB 1N33B 1NW7A 2FPIA 4MQEA 3V3KA 3U3OA 1GFIA 5JD6A 1JKMA 3G2KA 4MPRA 4Q9AA 2C9CA 3ASUA 1HNNA 2ZR9A 1X77A 1YUBA 3DD5A 3DZJA 1W1WA 4WKGA 4GEGA 3W6OA 4WW0A 3CRW1 3HL0A 3MHPA 2VVTA 3RU2A 4ZVVA 1W0KA 4GGOA 3Q3HA 3ILSA 1VP9A 4CCAA 1AZSC 5IYZB 5KTKA 2QX6A 1UFKA 1E0DA 1LPBB 3IMEA 1E2EA 3OLQA 1PWYE 2ZSJA 3OWXA 5JS7A 3CVJA 1E6LA 3F5MA 4Q4AA 2WM9B 4MYTA 2BKEA 2VHYA 3NT4A 2AG6A 2LIYA 1ZG3A 5H80A 3EIEA 2O1WA 4Y9DA 1EDBA 1NLZA 4PWZA 3OUZA 1EWQA 1NAHA 2A9RA 1YBVA 3O8LA 4D57A 3DE6X 4YR9A 4ESOA 5IT9A 3GLHE 1SHUX 3LGAA 3Q7SA 2QEQA 3FYUA 1FQKA 3KPYA 4Q34A 2H1CA 3UANA 5JD5A 2GLUA 5FUWA 1JA9A 1IATA 1WXWA 2XTAA 2CDNA 5JCJA 3RNLA 1M83A 5BR7A 2QZJA 1GG9A 3BE4A 2RGUA 1YDFA 3TQTA 5LA6A 2OYRA 4QPDA 1O9BA 3O2QB 4FFBA 3LSYA 2OR3A 2H18A 2C8VA 3FLAA 3GJQA 5HF8A 4BVJA 1PRYA 3VVLA 4MQ5A 2AOVA 2O2EA 5FFNA 5BN5A 2DRIA 1G4UR 4IJUA 3VKGA 5AKIA 3GEMA 4WJKB 2E55A 4BWYA 1NW5A 3HVKA 2R3SA 3D4IA 3DWEX 3FYDA 5DMXA 2WFLB 4P58A 4L4RA 4PFKA 1U0RA 4H1WA 4OHYA 4IDBA 2PWYA 3LD9A 4XX2A 1A8PA 2EFEB 4IMRA 4LE0A 1Z2OX 4C4XA 4IHQA 4DM3A 1AT1A 1CC1S 2FFJA 3GBSA 3MTDA 2E2HI 1SCUA 5AI5A 5JALA 4MQFA 3ZWXA 4YMUA 4OA5A 2YJZA 4AWAA 1FXWF 2MYTA 3R5KA 4DG5A 4G24A 5FWAA 1X87A 2SICE 4BJ3A 1QLWA 4FFVA 4BMVA 2AJCA 2EJVA 5EZSA 1IUPA 1L2TA 2PQ0A 3I39X 3T6KA 3GPCA 4S24A 4ER3A 3R9XA 2QAGC 3ETHA 1EX9A 1E98A 3OKAA 1QHSA 4UE2A 3S5UA 2QL5A 5K3OA 4RF4A 1CDOA 4WASA 4U7TB 3TTYA 9ATCA 4K88A 2O0JA 4UHDA 3MB5A 1RW4A 1FF9A 5JSZB 3HI4A 3B82A 3BCHA 1RHMA 2P9GA 2PZFA 3G23A 6REQB 1XDWA 5KYUB 4TQAA 4TS1A 4L78A 1LQTA 2VZLA 2XKKA 1RYHA 2ZRMA 3GR6A 3OZFA 1Z7EA 4WTOA 3UK1A 1NXXA 2I4LA 3A27A 2CVHA 3TMAA 4BMYA 4MZDA 1AZLA 1J22A 2XHZA 3VMIA 2EGTA 3LL7A 3ZS9A 1CR0A 2WMYA 4LJKA 1UJ4A 3N2GA 2OZEA 5EWMA 4P3NA 4D56A 3LC1O 2VZ8A 1W46A 1Z5PA 4EJ0A 4PIPA 3AY7A 1M2WA 4JKIA 1NTOA 5JD3A 3VR0A 1E59A 3FCOA 3P71T 4HB0A 1KP3A 3NCTA 3PNYA 4UNNA 5AIBA 1RKVA 4L3OA 4YASA 1P2UA 2CLCX 1X13A 1X74A 1JQJC 4HLCA 2CLDX 3OA0A 2RIPA 3E18A 5KTNA 2OG2A 3I32A 4BBZA 1KE2A 1YXMA 1E69A 3RBAA 4YT2A 4D3XA 2CVZA 4YT8A 1SQFA 4EELA 2ZIWB 3KKNA 1T13A 3D6FA 4RMHA 1KEUA 4PIVA 4DZTA 2GDZA 1IVNA 5A4DA 2IDMA 2YJNA 4FPXA 1G291 1H2EA 4F38A 5F2OA 2W6NA 4CIVA 4DG8A 4FJ2A 2HPVA 1LU9A 3H2ZA 3RFCA 2PX6A 1CPYA 2ZWIA 3DNPA 5B7NA 2IUEA 1S5PA 4DPKA 1K8RA 1S2GA 2W58A 2OV1A 2WVAA 2GKGA 1C30B 1UWVA 3ZCUA 4F5YA 4JD5A 3TYXA 4MVJM 3OCUA 4BL5A 2TRSB 2FPOA 3ASVA 7ADHA 2X7JA 3KOXA 1ZP6A 3R9KA 4YRSA 1ZIDA 4XCVA 4JXXA 3WL5A 1M1XB 2RIQA 2UVDA 2QDXA 3GTGI 1KI2A 3GHYA 3DO6A 4O4HA 1XZHA 5C4JI 5K8UA 2BKXA 1XZGA 2VXBA 4F4DA 1P2VA 2CF6A 1ZM2A 2IQ5A 3KKKA 1Y5RA 4XWTA 4ZEVA 5JANA 4ANFA 1NXOA 5EXDA 3GCDA 1R0XA 2G4LA 2QA4Z 2ESRA 5JYCA 2JD0A 3HKBB 2FQWA 3L0SA 4JT4A 4XUCA 5SYAA 5F7ZA 2HA3A 3STTA 2HO5A 1S01A 2B98A 2XNJA 1R5NA 1RE0A 1VL6A 3CS3A 2A9OA 3EUFA 3QW4B 4U5QA 3ITKA 5BRNA 5E7QA 4Z1MA 3UTDA 3W4IA 4PSKA 1ZKDA 3DOEA 3IHLA 3AHHA 4YAEA 2YFKA 3O82A 4OBBA 3X1DA 3AVUA 5IEJA 4TYNA 2A30A 2ODNA 4P3OA 3O03A 4D3YA 1E1DA 4OJTA 4X90A 5CD9A 3U4MA 5TVGA 5EP1A 3H5IA 2A8YA 5LQAA 2HA7A 3IDAA 4RJKA 3I2IA 4P82A 3PJRA 3PXAA 3A9UA 1DX6A 2ZRIA 2BGGA 1XF9A 3WIEA 2VDKB 2XGOA 3HYRA 2H29A 4DLTA 1K731 1FTGA 1WMSA 4RD2A 4GOOD 1IBLB 2R11A 5FEMA 4MULA 1W47A 1LW6E 1UM9A 3M5PA 4TYMA 4UBIA 4MP6A 5FHRA 3L4BA 3HRIA 3P2JA 1U0OC 1ZMOA 5TMPA 3F49S 4R2KA 5U4XA 4MX8A 3ZV3A 3O31A 4URFA 2B9VA 2O2SA 2G70A 4EAAA 4JYAB 4OOEA 1QK4A 3JQ9C 3L7MA 5FX2A 2Q07A 4OAOA 3PHLA 4MW5A 1K97A 2WAXA 2PNFA 4JENA 4RMGA 5AK3A 1TJNA 1C0EA 4NE2A 3OSUA 5B58C 3VU0A 1NFRA 1IIRA 1WZUA 1PTJC 1B16A 3OY7A 3R24A 5D87A 4CGYA 1FMFA 2DYKA 4CKBB 4C7MA 2Q9BA 2V0CA 4F92B 5EVJA 2GEDA 3K9HA 3LLCA 3P32A 4MCHA 4OXIA 4TSRA 3V2UA 5E3HA 5HE9A 3JAMA 4G1MB 1R9NA 3GW8A 1Y6QA 4I1UA 5EWLB 5BSGA 2X8JB 3A2MA 4D26A 2YASA 3TG8A 2JUBA 2A7QA 2F1IA 4O4LB 3EA0A 1BDHA 1A50B 4RHTA 3U1TA 4HH0A 1LA2A 1T2NA 2QK4A 1UBLS 3DT8A 1LH0A 1N5RA 2VDUE 4N1AA 4P4TA 3ABZA 3D2LA 5K45A 3L0DA 4YY3B 1VE7A 4H6XA 3GYBA 4ZCMA 1E66A 3TVYA 2G3YA 3L7AA 3PQFA 1D2NA 3DDOA 4A3II 1RNLA 3HR7A 1G19A 2ZIAA 3HH8A 3ORSA 4RF3A 5B1EA 3NM5A 5JSKA 2LDBA 2HK8A 5LMNB 5CT9A 4A3GI 2BKLA 4BQOA 1HGXA 2HYIC 2QSJA 3HU2A 4PX5A 5HQ3A 4Q4DA 3FQMA 1ZEMA 3KWMA 5KC8A 1RXYA 5FXMA 3FZNA 1NXWA 2BMWA 1C2TA 3NHYA 4Q3EA 1HV8A 2OB2A 1V5FA 3E9ZA 1FXWA 1SIBE 2MR5A 4B45A 1HNXB 2I1LA 1Y9DA 1SRQA 1SA0A 2Y1XA 3CE9A 3IPXA 2E89A 2RJNA 1N5OX 1OMOA 3ME5A 1DQYA 1ILWA 2HO4A 4M6WA 5JW6A 3EVAA 4HQNA 3DKPA 4ZANA 3UK0A 1P31A 2WT8A 3LT0A 4YN3A 1O9HA 3GJ5A 4CR6A 2ZCJA 3QKWA 1MEEA 4M99A 3W4JA 3TD9A 3A4VA 2EEPA 4MYCA 3ZLVA 2X3YA 5C8VA 2XB2A 4HYEA 1QQTA 1YVRA 1EX7A 4ENRA 1CZOA 3S1SA 2W37A 2ZE7A 1O95D 2XUAA 3VA7A 2R8ZA 2Y1LA 4M1WA 5D7NA 1R4AA 2GD2A 3H2SA 4WZZA 3ADDA 2Y71A 4D25A 4ND7A 4IIYA 1Z73A 2PH5A 1RYFA 4BNDB 5GOTA 1A7KA 4RPLA 4DWVA 3ZD7A 4UHFA 3C48A 2HL6A 3BFKA 2GTIA 1AKRA 1T9ZA 3PXEA 3RM3A 1H3NA 3F73A 2ASVA 2FX3A 2HMAA 2WV9A 1QDEA 3P0FA 3QYAA 5FR1A 1AURA 4GW3A 4OHXA 3L7BA 2OFOA 2WTMA 4N0MA 4XB2A 1KC81 1T2VA 1WXEA 421PA 5CA0B 1U2PA 4AB1A 3HJGA 3P4XA 4K6GA 3IKJA 2C4MA 1DWOA 1IHOA 2HA6A 3O84A 3QLUC 4O1MA 4QBGB 5TX7A 3SMQA 1KI9A 3CCLZ 1MXHA 5G4LA 2B5OA 3ZY6A 2XECA 3HN6A 1H8ED 4I4TB 2I2XB 5C52B 4P2GA 1Y1WI 3E9DA 2XWJI 3VTZA 1HDCA 3W6ZA 1A3CA 1PZXA 4QUAA 3NPAA 2XSZD 1LBHA 1KD12 4FHFA 4IXWA 3T7JA 1FFYA 4Q3AA 1TOAA 4D9NA 3O4HA 4F85A 3KHUA 3ZDQA 1P9WA 2VRCD 4N12A 2CE2X 3RABA 4XD7D 4IL5A 4XA8A 1DI0A 2GNPA 2CK3D 4PO3X 1SVUA 5IMBA 5ED4A 1G8JA 1MDBA 3ITEA 4N4AA 1JI0A 2QE7A 2QXUA 4MRVA 1IY0A 3FHCB 4ZVMA 1QLJA 2P90A 2P9JA 3ZWQA 4YRLA 1V1JA 2IPLA 2O8VA 2DFKB 4UREA 4D9FA 3KXIA 2P41A 3CX8A 1PHPA 3UA4A 4E2XA 2P4SA 4GI3A 1DWQA 1LKZA 5G3YA 4JBLA 5G4KA 4XIIA 4B6FA 4HEA1 1WXIA 2OXEA 4MMXB 4MUKA 3H9UA 1F4PA 1E94E 1VL8A 2AG0A 2Q28A 5AM0A 3QMPA 1R64A 1TFUA 2VJBA 3MTIA 5D5PA 4B09A 2R44A 1OVGA 3M1LA 4QFDA 5BV8A 9LDTA 3HKDB 3MUNA 4OO3A 3VYWA 4BKPA 3H7AA 3AHFA 1R0ZA 5F9MA 4NFRA 3CO5A 3WNZA 1X70A 4PHHA 3AM4A 5CDTA 5AM3A 1BXGA 1RWBA 3W9UA 1T0IA 1VG8A 2QE6A 1ZAKA 1E4EB 4WNIA 1VQNZ 1G21E 2CSXA 1TF5A 5FWXA 5JJ5A 2MT9A 1JDUA 4IIVA 2L69A 2JGIA 3TLZA 3V80A 5C3UA 3MMZA 2CUNA 2I71A 3A14A 2YVLA 1MB0A 1QRRA 3OFSA 4CM4A 5KTYA 1N78A 3DFKA 1YO6A 1GL9B 4W1RA 2XQIA 3K15A 2ODQA 3GLKA 3EMVA 2QI9F 4RY2A 3ESZA 4JI3B 2O8DA 2AMFA 3U13A 2AEEA 3CQ9A 5T6MA 5B36A 1U0GA 2CNBA 3M9XA 4Y2JA 4KDRA 3IQEA 1K8YB 5SYNA 3FVTA 4HWTA 4AJ4A 3WMEA 1EIWA 2AMYA 1K0FA 4XGQA 4WBNF 4UBLA 4EI7A 1TAGA 2QEXZ 1EFHA 2HQRA 3MUOA 4B75A 1P72A 2AZMA 1O0SA 1S8NA 2B4YA 4NU6A 4YJFA 4LDJA 5EE0A 3DEHA 5A3SA 1AH2A 2P4QA 4W6ZA 1TLLA 1H6CA 2B36A 5BN4B 4JB0A 3RRZA 1G2OA 4PZPA 3VR1A 5IW8A 2XKBA 2R9VA 1VKRA 3WV4A 4YVFA 3WICA 1DCFA 4EB6B 3CCL1 3H19A 4YALA 1YBFA 5HFAA 3HGTA 4RSRA 3H04A 2QMHA 4B87A 4YK7A 4RC9A 1H0KA 3A36A 4A6PA 1TUIA 2GYUA 1GV0A 3A9CA 3P27A 3ZCVA 4Z7OB 2Q2WA 5AUPB 4TUYB 3E7FA 3ZE7A 5A5EA 2AUTA 5KTTA 3R0ZA 4HQ0A 3NRJA 1L1QA 4JSYA 5AXDA 1PGOA 4EUEA 2PUGA 1O94C 2R00A 3H2JA 4JN6B 5FI0B 1E3LA 1YUKA 3FSGA 5DOZA 5GGYA 4DJEC 1AQUA 2C29D 2C88A 4CV2A 2MHCA 4DA7A 5KINB 3EXAA 3FSJX 4K6FA 4E11A 2Z9CA 1J0DA 1OPXA 1GFSA 3KQWA 3WRVA 2IOQA 4S12A 5JDIC 2XQKA 3DG9A 1QH1B 2DY1A 3HN7A 2ZRQA 2BP7A 1F9AA 4HX9A 4F3RA 3F6EX 1UJ6A 2BFPA 2QRDB 1INLA 1EGVB 1GQQA 3EVTA 1JJ7A 3G49A 4P5PA 4P3KA 4U7JA 4DW8A 2J0UA 4QBIA 4B83A 4DSTA 5A2Qf 3TD2A 2XT9A 2HIHA 4IIBA 4BB5A 4HXGA 4JX8A 3PGJA 1POXA 4OQZA 3D54D 1R7RA 4OHUA 1ODKA 1V5IA 4DMGA 1E2DA 4UUOA 1U8EA 3WYEA 5K6TA 2O8BA 3UG6A 1IN1A 4OBXA 3N87A 3PJGA 3VO2A 2BKUA 4PF1A 5COQA 1VIDA 5DT9A 3RRNA 4IIFA 4QXAA 1RAEA 1VQN1 2ZBGA 3D7KA 1XZKA 1W2BY 1P0PA 2GA8A 3ML1A 4GKVA 4H6VA 4OYRA 5FR2A 4YPVA 2Q4BA 1TVMA 2WPDD 5FBQB 1JZSA 1G6HA 2XRMA 5G2OA 5IVPA 1VRVA 2HIAA 5BSMA 1IAVA 3GPLA 1K63A 3A6KA 1IBCA 4NYIR 4G8DA 4RKWA 2OV8A 3VZPA 4BVHA 1JQBA 2XZOA 1GEGA 3VU9B 3EYWA 3HUUA 4R9VA 2Y68A 3HO8A 3M3DA 4HFRA 2ORVA 3FVVA 3UAYA 3VDXA 1QIEA 4KP7A 4YAIA 1T6ZA 1SXGA 1U5BA 1ZCJA 4CFZA 3JAKA 1ENPA 4JKYA 3Q3EA 4LE1A 1DKNA 1FDSA 1T9GR 2QEX1 2C4NA 2F67A 1II0A 4G5HA 1X3SA 2NUTA 3UAGA 3GV0A 4DCTA 1KDVA 1LDGA 1P9LA 4AQ7A 3H8JA 3PT5A 1XPJA 1X7YB 2CCGA 2J46A 4PAMA 2UZ4A 4AJJA 3WRWA 5AP9A 1WMAA 3FKSA 1MOQA 5F4BA 3QVJA 1JVBA 2W2PA 1TZKA 3B9RA 3DDNA 5CHEA 1OFGA 3ECCA 4F5WA 1ZXLA 5LNK1 1DJQA 5BNIA 1OIXA 1XK7A 4Z4GA 4RLHA 5J40A 4XRGA 1KKMA 3F8WA 3TSWA 4QLOA 4A73A 5CYPA 1GO2A 1REQA 1A9YA 2A0WA 3DHVA 4QDTA 2QP3A 3FI0A 4CM9D 5GIPE 4MWCA 4FVTA 1T5LA 2NWQA 4C4TA 2I5PO 3NRCA 2C5LA 4W5WA 1XEFA 1WY5A 2DETA 4E2YA 1JA1A 1JIUA 2V7EA 1KK0A 2NQTA 3R6LA 4JQSA 1F17A 1GN8A 3F7MA 4AMVA 1N6RA 5CDYA 1JE1A 2P0EA 1RYYA 1XA4A 1WW9A 3O9MA 1SXJB 3E0QA 4JLVA 2ZJOA 4MIKA 4QYMA 4MUAA 3RSCA 4DBLC 3SJCA 3RSZA 3CCSZ 1XMXA 4PPNA 1KKLA 6CHYA 2VAWA 4YXWA 2XMQA 2Y4NA 3CVOA 3DE1X 1D7OA 1A9XB 5AVJA 3OZEA 2WA2A 4X3CA 5LZ8A 2W00A 5HZKA 2NUPB 1X39A 1QGYA 4PX9A 4BB9A 4Z54A 2VLBA 1FJGB 4MTLA 2I2BA 3IAM1 2X5NA 3ETGA 3SE7A 4UJ3A 4IBOA 4FYHA 4ZV4A 4PYQA 2KBEA 1DAMA 1KY5A 1P9OA 2PX3A 3ZIUA 5KQMA 1DC3A 3KZXA 4ETMA 2XMBA 2L18A 1KYIA 5EXPA 1A8UA 1W87A 4JOQA 4M9QA 2B6HA 1A8IA 4WSOA 4FCWA 1JJ2Y 1DKOA 1OTHA 2QUZA 4PYMA 4X20A 3W77A 1SVMA 1WUJS 3ER9A 1AOXA 3RRJA 5LUAA 5DOVA 1DARA 3SD7A 3E61A 4REMA 1N5DA 1UKVY 1Y9EA 2C2OA 4UCQA 1YI8A 1EZ1A 3KSMA 4R8SA 4EF6A 1XN1A 2YIVX 5BVHA 4I81A 1LSJA 5DJ5A 5EJ6A 3A2LA 3FGOA 3L8CA 1T4BA 2QJRA 4DARA 3KVYA 5JBQA 2CLMB 3K92A 3DZCA 1G5QA 3I92A 3D4NA 3C5HA 1RXIA 1L8XA 2WHPA 1YF3A 1SXPA 4M1MA 3T9FA 4XQEA 1NF8A 2AUNA 1J21A 2BGUA 2PFKA 4BFCA 4C0BA 4PICA 3BRWD 1JB1A 1X92A 2A5JA 4EJSB 2BH9A 5FLKA 1C1XA 3ELWA 1P5FA 2PCJA 4O5OA 2J3LA 3MQFA 3PNBA 1G7SA 2JA5I 3MJTA 4EK9A 5ELMA 5JNUA 5THKA 2KJQA 1UPBA 2PWAA 1ZVKA 1AG9A 2I29A 1TGYA 4DGLA 2P62A 5CCXA 2H1FA 1RRFA 1N5JA 3T3EA 2WIKA 4XR9A 3P5JB 1ZVMA 4Y9UA 3OCJA 3QU5A 2PU5A 2R7NA 5JVDB 3ZHRA 1A8SA 4AKHA 1G60A 1P6UA 1TWCI 4INAA 4GZ3A 3DLTA 1TB4A 5LXTB 2QUHA 3QMWA 3S44A 4WBNA 2GESA 5IJ9B 4L9RA 3C3BA 4MLDA 5K3AA 1DQNA 2DM6A 2J4FA 4OI2A 2V4UA 2IZ4A 1AQLA 2BGIA 3OJXA 4ZMRA 4N76A 1B6TA 2YQ4A 1Z5NA 3EDMA 2QBYB 1XZPA 4MNTA 2WKWA 3AUTA 2F8MA 4UM8B 1A98A 3UPTA 1GPLA 4R2HA 4L8GA 2W71A 2RB4A 521PA 1K68A 2G04A 1SCDA 2V7BA 2YYSA 3FR8A 4MVYA 3UYKA 3ZU5A 4BPRA 1LVUA 4HSEA 4YR7A 1COWA 1W59A 4YBZA 1M9NA 1TMOA 5G40A 1ZH8A 4K6HA 4BKOA 3CCS1 4D4MA 1Y3AA 3G5TA 3H9BA 1FE8A 2DXIA 2AOXA 5KBYA 5FP0A 2JCYA 1U2EA 2O6LA 2B1QA 1N6OA 1MG5A 1QFXA 1C1HA 2VNSA 5E6UA 3L6EA 5DTQA 3MPUA 1DAIA 5AK0A 4X8LA 4X92A 1YOBA 2ZJ7A 2GRAA 3K1AB 1YZLA 5ERYA 1O3YA 2AEJA 4U7FA 2PIDA 5FTLA 1DFHA 1QV7A 4NBHA 2X8WA 4ZCRA 2QYOA 3CG0A 3FMPB 3LY9A 5AK4A 3SC4A 2WQ6A 2AG5A 4L5YA 5DLYA 3R75A 1ZIXA 3IVXA 3LZ6A 1LZLA 1RAAA 2F3SA 3LRTA 4G5OA 2BZ1A 4IO1A 3T06B 4KXUA 4M53A 1UOOA 5K4GA 1TMYA 1NBMA 3AWIA 3MOSA 4NXMB 1BW9B 2I33A 3CZPA 4DIKA 1EDEA 3TE7A 1QKJA 2BFFB 2YDYA 3BREA 1ZNYA 4OJNA 1S72Z 5KOHA 1KQSZ 3IP7A 2R1UA 2ODTX 2JAPA 2O20A 3MZ0A 3RRXA 4CEHA 3WIBA 4L8WB 1VBFA 2EP5A 3EMKA 1XGKA 2ZAOA 4DREA 2J5XA 1VCHA 2QZSA 3CE6A 4OIFA 3T5GA 2AKYA 1KH1A 3FFTA 2KI7B 1IPEA 2B8TA 2DQZA 3HZZA 4G0MA 3TTUA 2G17A 5A1JA 1N2GA 4MR8B 1QHEA 1KQOA 1ZVVA 1Y1RA 1QE0A 1UAYA 2HZ7A 3C14C 2ZYSA 5E0OA 4JS0A 3U17A 1CQPA 3R8FA 4WCVA 1XWIA 2EZ9A 1MJGM 1I1QB 3LDGA 1HQCA 3EZ7A 5LC1A 5GV8A 2WSMA 3ZGLA 3SF8B 1UT6A 5J5VA 1RCUA 3CH7A 2UYYA 1GT91 3DZBA 4UMEA 4ZD6A 2IXGA 3W5HA 3KQLA 2FN8A 2ZAGA 2HFKA 3WKEA 3U7HB 3HYNA 2VJCA 2V9PA 3E8XA 5C0OE 4TLLB 3GLFE 4WBSA 3QV1A 3R3YA 3U44B 1O54A 1XD2A 4QGAA 2WTNA 1I7PA 1NV9A 2GAFA 2O3QA 4QPPA 4TV8F 1WCV1 1K8QA 2E85A 4YREA 4UEWA 4JH0A 4F11A 4K6MA 2IYUA 2DQYA 4YP1A 1U0EA 4V03A 1DZ3A 1N1GA 1YT5A 2GJAA 1Y37A 4X6AI 1M0SA 2VATA 3LBYA 5F51A 2O5VA 2HCFA 1OFTA 1L6RA 2YDXA 3ZDCA 4PG5A 4Q1FA 3WL6A 5CDSA 3OECA 4PIMA 2EG5A 3UJHA 5HK8A 2AEMA 5FNVF 1YL7A 3T1TA 4JAVC 3G7NA 1VI6A 2JJ1D 3GLRA 2XDWA 3KUUA 1RABA 3QLTA 4XQGA 2F8TA 3QHQA 5AWFC 2P5YA 5KWSA 1BN7A 2OD9A 4TXLA 3IQDB 1U3CA 3SHWA 3PQCA 4Q4JB 1L1OC 5C8DA 4JT2A 4RD1A 1Q862 4BGEA 2VUTA 1VG9B 3SCZA 1ZU4A 1PYOA 3BFPA 4GBED 1RQPA 2FLKA 4JP8A 3WK5A 1MT3A 1WX1A 3PU6A 1TFRA 3GRRA 4L51A 5CFLA 1VLQA 5F21A 4CODB 3WL3A 2G5CA 3OOWA 4IV5A 1V8ZA 4HSGA 4TLEA 4YT5A 3RWMB 3ZI4A 2QSYA 4EGQA 9MHTA 1XWFA 1KFBB 2XH8A 4WLUA 1UT8A 1DHTA 1FDTA 3G71Z 2VTBB 5D1PA 1S721 4GYKA 4TTVA 3I561 3IFSA 3RK0A 1NIPA 1YKSA 3L49A 4Q3KA 2Z8XA 1T5BA 2HBZA 3E53A 2RG7A 2ZJ0A 1V1RA 1FDRA 3GYGA 3JQDA 3I01M 4IJQA 4AURA 1YFLA 2CV2A 1IHDA 3HBAA 3TAXA 3QOFA 3TQSA 3TJZA 3LCCA 4NENA 4JX9A 4YQYA 1W30A 1XRRA 3KYCA 5FYDA 1M2NA 1XJ5A 4EMUA 2G2KA 4Z1OA 3GKQA 1U2QA 5GZ6A 2O3JA 1MTZA 4M3NA 4Z4HA 3OZXA 2JHCA 1KZ6A 1Y3FE 2F1KA 3RU9A 2EJCA 4GZ5A 2ZYVX 3IPYA 3O7MA 4BO5A 2PUCA 1CFJA 1PZNA 1TECE 4I4CA 4KQWA 5F1PA 1X80B 3L0YA 4WZBA 5K6AA 2JLAA 5EYPA 1BKYA 2DBQA 3AL2A 4W5JA 1W36C 1M33A 3DTYA 4HDSB 4G1CA 4CLRB 3K2EA 5CW1A 3K32A 4NH4A 4KQ9A 3VC2A 2IZ1A 1Q1NA 2V7PA 4G4JA 3GWGA 5LDGA 1U2GC 4EKNB 4TS3A 3HO1A 1ONBA 1PSWA 5IZCA 3NTOA 2GDJA 1F8XA 1Q95A 4LW8A 4KBYA 1PFKA 4R51A 4WLFA 3BMOB 2WW8A 4E03A 5JAPA 4OI0A 2VKQA 4HDQB 3JYQA 3NEJA 3R09A 1CYEA 3OY2A 1NBIA 1ZK2A 3LXXA 2MOKA 3OH8A 4Y6GB 1RR6A 3FX2A 2HSJA 1KTIA 5AOCA 4JJGA 4BRSA 5GVRA 3VMHA 1XELA 4MI6A 3RVRA 4BC1A 5DLEA 3K9CA 2WILA 2AJBA 4II2A 1O77A 4HDMB 3RV3A 5I5EA 5CFQA 4WECA 2W6ID 3EBLA 4TN5A 5AI0A 4NNJA 1CEXA 3V55A 1NYRA 3W06A 1QTRA 5BNZA 1I4OA 2G63A 4IHJF 1P1BA 4KN8A 4RA9B 1C7EA 4OBEA 3UK7A 1JJFA 4BTVA 2O8EB 4NB8A 1YHYA 3NUQA 2ZRLA 1ECPA 3KOUA 3LKBA 2FKAA 4WGGA 4A0RA 4BJ5A 3RJ9A 1T29A 3JQBA 4ODIA 2VF5X 1Y9AA 2EFCB 4OU4A 4KHZA 2AXEA 1EUYA 2CL6X 3L7CA 1HEUA 4WN9A 3JALA 3NQ41 3H3FA 1SOVA 4RWEA 4YTEA 5DT2A 3VOTA 2AJLI 2GYYA 3ZDEA 4FGUA 5BMVF 2Z9BA 1SKQA 2ECQA 2PLFA 3KM0A 2H7CA 1EUDA 2FR8A 1A69A 1HSOA 3K0AB 1QIHA 1B8VA 3R7DA 3RI3A 4E3ZA 2HNBA 3G711 1EGQA 1R88A 2OHJA 2F4VB 3UXEA 1HXHA 3DPUA 1W8IA 3BQ9A 5K8LA 4IH1A 1SUFA 5KSOA 4KH0A 3EVNA 4DAOA 1GKLA 3KKZA 1QZUA 1J7JA 1Q20A 4K9QA 2PJZA 4X24A 2BELA 2P9EA 3ORYA 4K9OA 1S1CA 4TSFA 5DNAA 3QKUA 1J20A 1P4HA 5KVQA 1Z38A 2I7VA 5HIAA 1K6JA 1LV7A 3IAXA 4QQKA 3NWEA 4F4CA 1H1LA 2Q3DA 3TKLA 2ENUA 5FLXf 3CRZA 2GD6A 5F35A 3BG1B 4XJSA 2SKCA 3RUIA 4N6OA 2XB4A 1HE2A 4G0WA 2AQHA 3HU1A 3PCTA 1LY1A 4NBSA 5JDCA 1XRPA 5JRJA 2BGNA 4GGMX 5GADl 1RRPA 2C03A 1KI8A 1PFQA 3DF7A 3P9RA 4X6XA 2P3LA 1E3MA 3EGDA 1G8SA 3GXBA 7REQA 2XUJA 2NGRA 3T7AA 2W7TA 1FFBA 2E48A 2C2KA 1OHHD 3G9ZA 2OTCA 3GJRA 4K8OA 5GTDA 3TDHB 1DEKA 1J23A 5L9AA 2JDIA 4LYFA 1TM5E 4LOHA 5JI3E 4HEQA 4KXLA 3KV3O 1R27A 4HYTA 2QL7A 1A4UA 1VKOA 5B57C 2O0MA 1UBRS 3GEHA 2B25A 2ORYA 3GJ0A 3KBBA 1JIKA 4WK6A 4E1AA 3DTVA 2GCGA 4QRHA 3JQFC 5K3SA 1H2RS 3L0PA 1H3FA 3WS7A 2WYWA 4N5MA 4CLDA 4HCJA 2IUUA 2GCEA 3DEFA 4K03A 1TM4E 4DV3B 1JEYB 1R4MA 1JEYA 3VPXA 4HWKA 1XTKA 3NANA 5A9SB 1C7IA 4QLAA 1PGQA 3HKCB 2BEUA 1S0UA 3HPRA 4LV6A 1IHPA 2C5HA 5J9FA 4IJ5A 4TV8A 4DMCA 3NG1A 5I7WA 1T1IA 1NE2A 4AYXA 1NRWA 2ZIUB 4D0SA 2GK3A 2EARA 1EE9A 1C1DB 1QYRA 1XMSA 2Z5LA 1MQ9A 3C97A 3CURA 4FFNA 4MYUA 4R69A 5C81A 1PQUA 3RS2A 3JASB 3ZDBA 3KALA 1Z4LA 4HDNB 3FCEA 4W7SA 5TLSA 4H31A 2A1TR 4Y7NI 1ISSA 3CCRZ 2V6BA 4MS3A 1G2IA 1U0JA 3GMSA 1E1RD 3OEWA 4Q47A 3TFWA 1QH8A 2O2CA 3ZU4A 3Q9LA 1T8PA 5F52A 4I1VA 2DH6A 2Q3HA 3WJ2A 3OCCA 3TLGA 2IYWA 2NZXA 1AK2A 1G41A 4EHAA 4KIJA 3BJMA 3CSDA 3ETLA 1NIJA 2M1ZA 4IUYA 1JG6A 2GZ1A 4JYBA 5HKKD 1HEYA 3RUCA 1M2VB 3C4VA 3VYTB 3IUYA 4L3WA 1SBCA 4PTYA 4IVQA 2QRHA 4CIDA 4J94A 3C74A 1TWFI 4JC4A 3WL8A 1ZNWA 5A3QA 1CJBA 4IQFA 4LYAA 4ERXA 4DBZA 5DCLA 4PQFA 1YSCA 1MC5A 1U9IA 4A3LI 1S2LA 3ZVLA 5C8ZA 1ODTC 1CNEA 2ZZKA 1GCUA 2P9HA 1ONNA 3DC7A 2WYOA 4Q9IA 1AHIA 4L5JA 1EESA 2TYSB 1UIRA 5J5CA 1Z29A 1GAJA 1RAGA 4DV5B 4DIOA 3V1KA 1CCWA 2WNIA 2V8JA 5DRYA 3AETA 1D2HA 3C7TA 2PM9A 3AIKA 4JLAA 3QJGA 4KQXA 3SSAA 5DNUA 2FN7A 2IVFA 1KJJA 1PBNA 1NR7A 3HP1A 5E4TA 3ZW8A 4F06A 3GTQI 4EO7A 5KNDH 3HVIA 4CNBA 1RRKA 4YCMA 1PR3A 1E3EA 2VLIA 4RIEA 3J81k 3W1WA 2WU0A 2OOSA 4Z8YA 1O94D 5HEKA 3RREA 1L4BA 3NTRA 2BHSA 3F9IA 1GUDA 3DT9A 2FK8A 1HE3A 2X0RA 4I1SA 3DDWA 4RHUA 4CM8A 4B8WA 4QTYA 1I6LA 3DKVA 1QQ7A 2OV2A 4FGWA 4J6FA 4JCOA 5ALUA 3P2MA 5T6BA 5ITWA 1DJNA 5CPBA 3ZLBA 4BFVA 1SD5A 4WXRA 2J5KA 3TZLA 1XE3A 1MG0A 2DUMA 4A9AA 3ZTYA 1X1EA 4V1CI 2WKRA 3OU6A 2CLOB 2A33A 2XTNA 3BHIA 3E03A 3IUPA 4KQHA 3PEWA 2HHLA 4JC8A 5F3RA 4LDZA 3UFXB 1AA6A 4BVBA 4EG3A 2P2CA 2HPHA 3PVSA 5E9QA 3UAOA 4QUDA 5HJ5A 1Q0RA 3ESRA 5IT9f 1JR4A 3FPKA 3QGMA 4A92A 3V32A 1VJDA 1KE1A 5JSYA 5EZ6B 3RCBA 3H0GI 3PQ6A 4E6EA 4DDMA 4EECA 3T9AA 2NVQI 1R9JA 3ENKA 5AR1A 5IC6A 3TRKA 2XYPA 3EEYA 3CCR1 1PJTA 4AMBA 1EVLA 2YZMA 3USCS 1RHKA 1L5MA 2EF0A 1HA3A 2OHXA 1BHQ1 2P9YA 4ZCPA 4YRAA 2DOKA 2XXJA 3ZZ1A 5J2UF 5IJ0B 4IHJA 3O3CA 3G6EZ 3GDGA 2WUVA 1D1PA 5BN3A 2RK4A 3H1GA 2Z56A 2D0IA 1EM8A 4PQRA 4TRNA 2FWPA 1OA1A 5DGDA 3ILYA 3GGJA 2RI0A 3UN1A 4EW3A 2HA0A 3MGCA 3AR2A 3QPWA 3B1JA 1WZCA 3EIUA 1CY6A 1HM5A 2IUSA 3MK31 2LE0A 1PG5A 3SQDA 1BJKA 2O9JA 4W7IA 5BMVA 1Z0JA 5IM5A 5IC4A 2NSHA 4FWIB 1ZONA 3N39C 5AICA 4AFNA 3IV7A 5AKHA 4F3KA 1U8CB 4Q1EA 5EP4A 3NH9A 3CZAA 1NQUA 5EPOA 1UKEA 1MENA 4A8TA 1P0IA 4UD2A 1QP0A 2G9NA 4TWZA 4ER7A 5LQSA 3W9YA 5HK9A 3QP9A 3CME1 3CCVZ 4F56A 4EPRA 1Z39A 2ZYUX 5B37A 5BP7A 1KYQA 2AI3A 3F6SA 1PNOA 1Y4UA 3MTAA 1W93A 4JWKA 4NOLA 5IN5A 2Y8EA 5BO5A 5BQ3A 1F2TA 3HM9A 2WIBA 2DPHA 5T3YA 3FYHA 4YRNA 1B76A 4NE9A 3U60B 2G1PA 3JRXA 4PM4A 1B0AA 3UT5A 1CEEA 1RWNA 2CSUA 2VZ0A 1JBEA 1ADCA 2QLVB 1CLUA 1JVSA 1X2BA 3PC3A 1S7GA 1G8MA 1W88A 2W83A 3EVFA 1VPEA 3LIIA 2A1UA 3PL1A