2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
b'SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
2GTHA 4RS4A 2GTIA 2RHBA 2OZKA 4S1TA 2H85A
chains in the Genus database with same CATH superfamily
4RTJA 2CVHA 2XGMA 2OA0A 4I1OA 3CN7A 1GGEA 1U63A 1KJIA 5HTKA 3BXOA 3A4YA 4YUYA 3C6BA 5IXSA 1U3DA 5EIAA 1NQXA 2QAIA 2ZJAA 5F9MA 5NULA 5ES4B 3RUFA 3CCV1 5CX1B 3GN1A 2PH3A 3HVHA 3JAKA 3ZE2B 2ORYA 5AQEA 5G1PA 1OASA 4B5LA 2J9RA 3K4QA 1VBKA 2CHGA 2ZJ7A 4HLDA 2VHJA 4WCFB 3L1JA 4JQCA 4Y1GA 5DISB 3ACDA 1XLUA 3CCMZ 1X2BA 2NQTA 1R3DA 1M34E 1T2UA 3HY4A 3MM4A 3OZ7A 4HDAA 1YK0A 4YRLA 4ZCRA 1T6BY 3P0EA 1ADBA 2IHZA 1CP2A 3S8EA 1XPRA 2WIDA 4FJ0A 4BRUA 3JWGA 1Q0TA 2YVLA 4Q6WA 4JWKA 2RH4A 1IN4A 2FWIA 1WXIA 3HFJA 1W85B 3I56Z 5IBCA 3PFCA 4HVCA 2ABWA 2A0UA 3GUYA 1C4OA 3H5NA 1UFQA 4EB6B 3FYDA 1EFRA 2H59A 3PNBA 5AXCA 1ISMA 4MYSA 3CNEA 4JX9A 1X7WA 5LUBA 4C7VA 2XJ4A 2QN8A 1J8MF 3D3NA 3E3OA 1SMKA 1WIWA 3IUBA 4GR4A 4IIGA 3I83A 2YHSA 1C8KA 4FJ2A 4MAAA 4A3EI 1Z5GA 4U0JA 4YBZA 1YCFA 2ZPTX 3VVBA 3TZ6A 3AUAA 1XDWA 3G8YA 2ON6A 3IV9A 3UZUA 4B6PA 1KGSA 1R18A 5B1IA 5FWDA 1NI5A 4IFBA 5BO5A 1CB7A 5FULA 3FWZA 3ZBTA 2HXYA 5F1KA 2R7ZI 2A8YA 1QX4A 1PWYE 4TS4A 4X71A 3L43A 1CNMA 3KAQA 1AMOA 5DF1A 4K7JA 5FOTA 3LMKA 3NDPA 1EINA 1EU1A 4B84A 4HNAA 4IG4A 3IUEA 1S72Z 1HSZA 2C9CA 4TVSA 1UFOA 2QLBA 2HCTA 2ZB4A 1YZVA 1N3YA 5IF9A 4OJKA 1Q1BA 1EVZA 1NU8A 2PZ8A 1RLYA 2DTEA 3DAYA 3F1LA 4INAA 3A10A 4HRYA 4C4ZA 1TIKA 4ZRMA 4YUVA 4C0HA 3R8FA 1TQ8A 2O3JA 2QMZA 4GE0A 4LV8B 1NMZA 5B7GA 5IJ9A 1YZTA 5KOJB 4GKKB 5K3SA 4CGYA 2UYOA 1O3YA 3ZU2A 4W5JA 4LMAA 5L45A 1T36A 4UVHA 3ZDZB 4PYQA 2FZ5A 1YDEA 4RMGA 2KPIA 1X8LA 2D1FA 4XDZA 5FYQA 4GX2A 3TINA 4I9UA 3VM6A 1KK1A 3VSCA 1C2TA 5JAOA 3EXHB 4GMGA 4J16C 4GUAA 4OGWA 1KDPA 1Q1QA 2BDUA 4B4WA 4XSHA 1B8VA 1ISSA 2C94A 3SMVA 1X3SA 4ZHSA 4LZWA 1K66A 2OXCA 4JX8A 5AN9F 1NMQA 1TCAA 1H2AS 1VPEA 2XHZA 3X1MA 4C14A 4EHDA 4MDEA 1PQYA 1BA2A 1GGHA 2GYVA 3L0SA 3LKZA 3G8BA 4LRUA 4O6VA 4RHTA 5ALFA 1URPA 4QASA 3V80A 3ZHRA 2I8CA 3UJ8A 1B8PA 2R8RA 3JD2A 3LS2A 2PQMA 3C7AA 2AF3C 1X74A 1E4EA 3RK4A 3M5WA 1GSHA 1JDJA 1I01A 2FKAA 1TKCA 1VZ3A 1VGRA 4JLPA 2PQ2A 4CHGA 3ZJUA 3FPJA 1QIIA 3G88A 3AR5A 3WGVA 4EKNB 3CVXA 3IC5A 1SM4A 1E4YA 5LMNB 4GHWA 4YAGA 1ZH0A 2H2HA 3K32A 3O2SB 3P0JA 4ID3A 2GKSA 3ZY4A 4Q9AA 3ETDA 1YR8A 1M1UA 4QPDA 5HIAA 4X7BA 3DV0A 4J29A 3TW0A 4FFSA 3CVUA 3SK0A 1QORA 5BNFA 1NJGA 1QHYA 1U8CB 4EABA 5A4AA 4XZ3A 3I9OA 2E89A 3CPJB 2V4MA 2Z3ZA 4FNOA 1U2EA 3O0DA 2H9IA 1NNLA 4YYZA 1YBMA 1QZZA 4ND8B 5TXGA 2OV2A 4KAJA 1G16A 1JX6A 1WF6A 1YUNA 5FTNA 4R54A 4LWOA 4UZEA 4DCMA 3CISA 5KNCH 2W8BA 1OI7A 4JLUA 3U4CA 1IYZA 2FHSA 2FZWA 2R11A 3MAAC 3AVTA 4D0SA 4G85A 1C4WA 5FJJA 1FZTA 1X1EA 3EXFB 2J5BA 2ZI4A 4OJNA 3RAFC 1WCXA 1TX4B 2CEAA 2JAOA 2QT0A 4B0OA 2FX2A 5AOBA 4EZIA 1RCTE 1Q7GA 1UBOS 5ABPA 3OCCA 1WJGA 3AV3A 3DZDA 3ROPA 5BQXA 4NCAA 1THZA 4RPJA 4GH5A 1ISJA 4BLPA 1G19A 1NBWB 1LZKA 2R6FA 1KC3A 1MX5A 5CBKA 2Z6VA 5DYWA 3BH6A 3DLPX 3NWEA 1R5JA 3Q88A 3QVGB 3TZBA 2BFCB 3N58A 2NYVA 1E6UA 2JIMA 1CJMA 1VP3A 4JYMA 4ENUA 1HQKA 2HDNB 5ALSA 5AI8A 3DZKA 5KYXA 5FTLA 6REQA 3H1TA 4N0MA 1OU4A 2P5UA 4AWBA 4E2YA 3DE4X 4FHDA 4QYTA 1L5KA 2C4WA 1TDJA 2ZYDA 4C2TA 2QL5A 4FJ1A 2BGNA 2YVAA 3GJTA 1MN6A 2GEUA 3KOWA 3W1VA 1B23P 2JDIA 2G8NA 3F3PC 1KJWA 3FZYA 4FS3A 1R6BX 2Z04A 3B85A 4MVWA 1JEJA 3U7RA 3VVMA 4TZKA 2QGNA 1TKBA 2RJOA 2XE6A 3E61A 2P1DA 3J7A4 2V74B 1NASA 3GP5A 3HBLA 3KG2A 3D2LA 1TT5B 3O1LA 2AMJA 4U02A 3RS7A 3X0DA 2P9QA 3I39X 1NVBA 4K1LA 3EQ9A 3GRCA 4PNEA 1H94A 1OC4A 5LA6F 4ZN6A 2JFZA 5A04A 2NZXA 2ZUDA 3PKIA 4XQCA 1V43A 4U2KA 2X58A 3D6UA 2FPMA 4YLGA 2C7RA 4BMPB 1QG4A 1M66A 5JS2A 2JJ2A 1XD9A 3HKBA 4BLOA 4NMMA 3ZZNA 2NUTA 1Z7GA 2FMKA 5DULA 1DRUA 2RGXA 4BLUA 5EUMA 1ZAYA 2VDOB 3FSJX 2GS9A 3K0BA 3N7UA 1A9ZA 5C4IA 3VJRA 3VH3A 3I2JA 3WLSA 3RC8A 3WGUA 1EFVA 4G0MA 4Z51A 3LP6A 4RLQA 4XIGS 3WWZA 1XMOB 4BUZA 4M4SA 4IG9A 5DIFA 2BEWA 3PQCA 1ZPDA 1B93A 4FQ8A 3ZD8A 3CC7Z 3TTXA 5HJ2A 5BR7A 1PNVA 3RS3A 1H4QA 2PLFA 3D6JA 3JQCA 3I55Z 3K3PA 4DXHA 2X23A 4QTZA 1KS2A 1E3DA 1HE3A 1WM1A 1IDN1 1LJLA 4JGGA 1K5PA 3IPCA 3PQ6A 4NRDA 4OYHA 3UC9A 1K8RA 3RT1A 4KMSA 5F2NA 3ICOA 1XE3A 1S2DA 2IOFA 1X77A 3EOBI 3MJFA 1IUKA 1QG0A 3ETGA 1P1RA 1Z0KA 4LECA 5F35A 2YNMC 4Y9SA 2IX3A 4Q1VA 2XV1A 5HYVA 5EJ6A 4LHZA 2WT8A 4KR6A 3WIUA 4ZVTA 3NC4A 4IS2A 1CQIA 2IXAA 4Q4HB 4BTLA 3FMFA 2ES4A 2A9FA 4GZLA 1I3OA 4NMHA 4GVXA 2O2HA 5DKFA 5BP7A 2ZUVA 1JFRA 3OO0A 4AJJA 4ZTZB 4NPHA 4FMDB 3C45A 3N8IA 3VO9A 4JU8A 2FSHA 1B2RA 1L5ZA 1PVVA 3DDOA 2CSXA 3NH6A 4ZVNA 3VZBA 3ITNA 1KFEB 2CLHB 1MPTA 5J2UF 2YWBA 2MR6A 2NTNA 2CB0A 1HE8B 2BDEA 3LBIA 3LLVA 1JSRA 5L6MB 4IF6A 2OYRA 5HW0A 3QBEA 1RPNA 1Z8NA 4CODB 2RAPA 2VWHA 1ZY2A 2P3LA 3GNTA 4X8OA 2CJPA 1J42A 4CR6A 4L07A 4LJAA 3TLZA 3H04A 2C20A 4E31A 2IHJA 2CLKB 2OAQ1 2VF8A 1J2UA 2BGLA 4F4FA 4G1CA 3O7WA 1G7TA 4QUAA 1FFDA 5TPWB 3AVOA 4WLEA 1MOQA 4QEKA 1IIBA 1W0KD 4JJ4A 1ZSVA 4B83A 1WOMA 2ACEA 2TRSB 3AKDA 3BFPA 4IFIA 1Q12A 1BRMA 5ALEA 2WD7A 5FPQA 4U7PB 2NU9B 1V5WA 1V8DA 5FOUA 5G3YA 1DBSA 4CGZA 4MWEA 3WYDA 3X1KA 1A5TA 4DCOA 2CVQA 3BCHA 4L27A 1JHPA 3EGWA 4LGVA 4IFEA 3HDQA 3CUSA 5BR8B 2JH3A 4J1QA 1PLJA 3E7PA 3K53A 1CIJA 3RS5A 1UC9A 2JLCA 2QP3A 1BYIA 3BTSA 1R8QA 3QLUC 1V7PC 1E7RA 1HKUA 2QZJA 3CEAA 1IZ7A 2D7CA 2O8VA 1P0IA 3IT0A 1OW3B 3PIIA 4F7WA 1WXWA 3I2HA 4A26A 2P11A 4FOLA 1IM2A 3T5TA 4J7UA 4B6EA 1LEHA 1CEXA 1T2NA 3SHOA 2HWWA 3TUJC 2DSTA 1JU9A 2HXSA 3B5EA 3BC1A 5AVKA 1I1OA 1SIWA 3AFGA 1CQJA 1S3FA 2W0SA 3NZEA 4GL4A 3FUCA 4LXIA 4Q12A 1Q77A 3MG9A 4WLFA 4X95A 3M83A 5DTQA 2DG2A 3RYIA 3WY9A 2JLUA 3G9QA 3JTEA 1K8YB 3DCNA 3PL1A 1PE0A 1MJFA 2B8EA 3QFRA 5B1HA 1OWNA 1WXEA 2Q0SA 3VZRA 2FV8A 1S02A 2PWAA 1P5FA 4NHOA 5IP5A 4GI1A 2RFLA 2W70A 1Q862 2IYUA 1BCRB 2ZRNA 2Y2UA 1PLLA 2YCLA 4UM9D 5JDIC 2R4QA 1EXVA 2KHZA 1JSZA 3S16I 1U3VA 2OCBA 3RRBA 1NLYA 4PN7A 1DHTA 2YZGA 3IBTA 3JVDA 2I22A 3TI7A 4BMSA 4P84A 5CFPA 5CDUA 2A1TR 1TWFI 3WL7A 5GQSA 2AFVA 2GLXA 4MVJA 3H8JA 3QIAA 3AFNA 5CFQA 4G5RA 1T26A 1X92A 3ESRA 5IAJA 3TRHA 4OHOA 1L1RA 1NMSA 2HCBA 1BE0A 3OMLA 4PW0A 3TQQA 1XZ8A 2G1KA 4CKEB 3INRA 2QN9A 4AY3A 1G7SA 2QMOA 3A1FA 3JALB 1ZJ5A 4PO1A 3OP4A 3TX2A 3JAMA 2H8GA 2ZRAA 1YI21 1Z17A 3CSUA 3NXKA 3DMDA 5F21A 5GJVC 5H68A 3W2IA 4RTRA 1ZX1A 4ZVUA 4N1AA 4CMJA 2GN0A 1T13A 4LY3A 1O4WA 3NBKA 4TMXA 2HJGA 2FRXA 4O02B 1E79A 1UBTS 5A71A 1JDBC 4CV2A 1I14A 1RWPA 2JNWA 3RODA 4ZV9A 4D43A 3R9XB 1USGA 5HA5A 3UNXA 5DLYA 5I7WA 1TKAA 2XE4A 4PQFA 4RCVA 3AEUB 1NP3A 1LB1B 4OXKA 3S5UA 3LCJA 4LZZA 3DMFA 4Q1BA 4B1FA 1KI7A 1G5QA 3RSZA 1KMQA 2V6BA 3NEAA 3UMVA 3ZY6A 3DQQA 5E4TA 5HF8A 4LBWA 2FW0A 3IQXA 1EX6A 2AFIB 3HGQA 1ACJA 1BWPA 1QG2A 1QH1B 4ZT7A 1SKBA 3ORYA 3QE4A 2XVMA 4BZWA 5BSEA 4LY6A 3GCXA 3LHIA 2OGSA 4GPEA 2JGDA 5AW6A 4DA9A 4LPSA 1P1KA 3ANTA 3GO4A 3IUMA 3KK0A 4TV9A 4U7FA 5ESDA 4WKGA 4LXTA 5HM6A 5JMPA 4DCVA 4E14A 5FR2A 4WZBA 1Z7WA 4Q9IA 1VLMA 4L74A 4MJLA 5LZ8A 5FHRA 3U31A 2EXXA 3C16C 3KRTA 3U7JA 1L7BA 3EISA 1U5BA 3CO5A 3E22B 2JLSA 5DWVA 4BN0A 3A70A 2HJHA 4QBKA 4C06A 1KKMA 1AJEA 1WHSB 1AUPA 1KYIA 3OOWA 5JSZB 4D3XA 1I9CA 5IT9f 5DNVA 4AKGA 1AZLA 4R8SA 2DBYA 4FOPA 2ADFA 3EHDA 1Z15A 3D7KA 3OTWA 5KYVA 2AN9A 4PIMA 1KY3A 3GCZA 2WG0A 3JPYA 3SIRA 4M1SA 1P29A 4R69A 5TVKA 4UHKA 1DTWA 4TTTS 1TYDE 3BD7A 1RBMA 3AF2A 4YJFB 2PX4A 2VNKA 1TEZA 2WOOA 3M5CA 2XECA 5EGSA 4GP6A 5EJ5A 4GW3A 4JJGA 5HTOA 1K732 5B58C 1E7SA 3NWPA 1XYVA 5DCLA 4CZ2A 1SVWA 1TWGI 2Y9PB 2ZJYA 3BJMA 5HCUA 4AZ0B 5KS2A 2HF7A 1F38A 1T3TA 3V00A 4D8VA 4DMLA 1L2TA 2GBIA 4N5NA 4L22A 4NK4A 5IC5A 4PN3A 2PXCA 3HBMA 3H8VA 3LHSA 3OO1A 4LQDA 4MGHA 3SX0A 5BWBA 4Q1DA 1TM7E 5K0NA 4BO1A 5D84A 3KUUA 2CLMB 3BMQB 5CIWA 4IXDA 4DKXA 1RO4A 5EPEA 5DK6A 1WTAA 2AFRA 1X8XA 1T91A 3FCXA 1DKLA 3NBFA 1PO7A 2G9QA 3IQIX 3SBXA 3MGCA 3UJ3X 5B6PA 4GLBA 2HK9A 3UW3A 2PJRA 1IHYA 2ZSBA 5IUJC 4Q9JA 4YIKA 1U0RA 1M34A 5KWVA 3D3KA 2RHTA 1U4NA 2F4MA 1TZMA 2ZRIA 3EPKA 2FPXA 1DJPA 3BS4A 3I9KA 1SBTA 1FMJA 3FTNA 1NUSA 3WR5A 2AR0A 2O14A 2P2CA 3N1UA 2RBEA 2XUHA 5J4VA 1M8PA 4NFSA 4KR3A 1ODSA 5IZCA 5JISA 1QF8A 4I9NA 5DGHA 4E4RA 3CC21 1ZXXA 3P9PA 3TCKA 4FGSA 5ALNA 4EI9A 1RWMA 3QLJA 1P5ZB 2CGEA 5E8JA 4YP5A 3BULA 3S14I 4EMUA 4FMCB 4ZCTA 1KC81 1KDRA 3GDOA 4ZT4A 1VGVA 5IDYA 4W63A 1Q0RA 2REOA 3D64A 3K1YA 4A1FA 2XWSA 2JGNA 3CF4G 3HVIA 3HXPA 4D9NA 2QMQA 4UHJA 3C7CB 3U19A 2VH2A 3CB4A 4D9IA 3K5WA 4K28A 4WVLA 3TEFA 4EKYA 1DX9A 3JATB 4PBTA 4RVDA 1HO3A 4UE6A 5F4BA 4A5SA 3LT5A 5LKRA 3KU1A 4N5IX 4JBNA 1K7SN 4WCFC 4W9RA 3MCWA 4QXRA 2YZ2A 4TKUA 5KQSA 4C7OA 4RTLA 5A7HA 3FJYA 1XTIA 5G0WA 5AW8A 5KVQA 4QZVA 1I94B 5DNAA 5ADUS 1DDIA 1C1DB 2ET6A 4DGLA 4KEAA 1CUBA 5H4HA 4PLHA 4G37A 3MEQA 4A93I 2NVWA 1N7JA 3DDWA 2IYTA 3W2EA 1GUYA 4PLFA 1BCSB 1V6CA 3LWZA 2RGCA 1A04A 3WLEA 4YAIA 2HBRA 2WC1A 3NHPA 4PHHA 2X0NA 1JHVA 2JJYA 1P6QA 2OC4A 1IZYA 3HEAA 2JGEA 4NOZA 2ZTSA 1Q3KA 3K09A 2YC4C 4MUIA 2WTAA 4Z8XA 3E1SA 4OUDA 1AUQA 1TVKA 1L4BA 4HK4A 3LSTA 2KE5A 2WIKA 5D3MA 5KNDD 3EPLA 3D8TA 3ZW9A 2C07A 2PKRA 4DOMA 1NZDA 3IP3A 5AVTA 3AFMA 1WEHA 4GGPA 3D4NA 4QT0A 3GW8A 4ALIA 3P96A 3RK1A 2C42A 5JALA 2B0CA 3UEOA 2WWWA 4GMFA 1X42A 3RS2A 2GUGA 2QQEA 4NZNA 4CEJB 3EF1A 2XUIA 3MOIA 4PZPA 2MCFA 2W6ZA 3TE6A 4A3SA 3TS1A 4FSXA 3DTVB 4HN2A 1Y1PA 3H4VA 4JJFA 1UDBA 3DWGA 1RI5A 1RXEA 1QNFA 1VYUA 1T35A 3QKRB 2A5DA 2HXGA 4NBUA 3TLEA 2OM6A 3LDGA 4UMDA 5HPYB 3H9QA 1PG2A 3DB1A 5FXMA 1X86B 1KD12 3OJOA 1XCJA 2AE1A 2FEOA 2R97A 3NH9A 4FFNA 5FWAA 4B5KA 2H5LA 5I7FA 4ISBA 5HHTA 1RE0A 2WIAA 1KY5A 1UXJA 4JYBA 1MAWA 4YFYA 3EEYA 4C0QC 3SZLA 1AHHA 2GN2A 1WTCA 3LKVA 3ECAA 3LYAA 4O0MA 3LQRA 4TL6A 4YJDA 2GCOB 1E20A 1KO4A 1TC1A 2GF9A 4UFNA 2BHRA 2DFNA 4X5OA 2XRFA 2I5PO 5ARCA 3KQUA 2DUUA 2PRYA 4HB4A 1JDNA 1AKQA 3GRFA 3OM9A 3OTIA 4MGEA 4OXNA 5IABA 3ZVNA 1VM6A 4CM9D 3WTCA 1G66A 3IDQA 3PO2I 2NO1A 4GVLA 2RK4A 1AVTA 1PJAA 2F3RA 4KQIA 4GI7A 4YCDA 4RVSA 4DTCA 3ESCA 4PG7A 2Y71A 1KVSA 1DAMA 3ROXA 4FFBB 5HJ7A 2A9OA 1PD1A 4V3CA 5ELLA 5AKLA 1NYTA 2WQ6A 1KAEA 3PVCA 3TKAA 4EGQA 5LWQA 1FNDA 1OBVA 3KAPA 2A5LA 1ULHA 1QGUB 5EJ7A 3BUSA 3AXTA 1KJNA 1DBPA 1YBHA 2B1QA 2R79A 2WF6A 2RI6A 1BU5A 1X7ZB 1FP2A 2EEZA 1V4VA 4I8IA 4J1SA 3IKTA 3NI2A 1C5KA 1QO9A 4EG1A 1E18A 3L6CA 5CMLA 4KNYA 1G2QA 3QM1A 2P4SA 3AKYA 2DR2A 4DDUA 1ZNQO 2IYSA 3AR4A 3AKZA 1SEPA 5DN6A 1WCWA 1Q861 3QWBA 1YRWA 1U4OA 2B4KA 4S3MA 1A2BA 5A4MS 1ODCA 2OAP1 4GMHA 2XLCA 4LOIA 3ADDA 2MYUA 2XB4A 1LI7A 1DWQA 3M4ZA 5AXDA 1GAXA 3H2IA 1G6HA 3CC2Z 4K6KA 2R6JA 4J4BA 2R65A 2NTJA 4CEHB 4YUZA 4RZXA 3B13B 3KUDA 2HSDA 4JXJA 4LHYA 3MCAA 1B3RA 3SS7X 4U2DA 3T4UA 1UCFA 3GFSA 1XKLA 4KVZA 4XVHA 3RDPA 1PAUA 1RABA 4MLPA 3FFAA 4E46A 3FOZA 4IVNA 4IH4A 1P8JA 5CG1A 3LIPA 3GAZA 4OJTA 3ABRB 4LJ6A 4ER5A 1M6NA 5LVAA 1Q7Y2 4Q7EA 2B9VA 1QWOA 4BQNA 2A5YB 3PEWA 4O2AF 1L1QA 3H11A 3Q3IA 4P2GA 1SC4A 1UPBA 3EVCA 1T0JB 4O63O 3PWZA 1MR3F 4TROA 3UF0A 4OOFA 2X86A 3WKBA 5C8VA 1DADA 2K5UA 2OD2A 4HYTA 3KETA 2DEUA 3V4LA 3FGZA 1HE1C 5ESWA 1DEOA 3LL7A 3DB2A 2CHQA 4UEJA 1ZCJA 1P7ZA 3BIOA 4WA8A 5DASA 5I3ZA 3QW4B 4RIIA 5FWYA 1BVHA 3D6HA 1XU4A 1FJ2A 3QWHA 5FUVA 1G4UR 2YV5A 1T9ZA 3E9MA 4MKZA 1XHFA 4AD8A 4UUBA 1JT9A 5K0BA 1XAIA 1P75A 2H1LA 2AG5A 3FMGA 3QYFA 3L4KA 1KO7A 3D0OA 5GIOE 2EFEB 2NXWA 3QYJA 1GXSA 4TLAA 2WUGA 3RVRA 2Y8EA 1Y8QB 2E4YA 3CZ9A 2ZDHA 4B3CA 3E2IA 4G4IA 4X7MA 5LBIA 3ZCVA 4DXDA 1DOZA 1KQSY 3HDJA 4HOYA 4WBSA 5IDXA 2G4LA 5CB4B 1BS9A 1ZB9A 1H6CA 2OOSA 5L53A 1PR2A 1VE7A 1YACA 1W36B 1H2EA 2ATXA 1QV6A 1W4LA 3MTJA 1LX7A 5D7BA 3T7CA 2VNJA 5BN4B 4NQZA 3K4PA 1NLUA 2ZTMA 4DCJA 3HMKA 1P4GA 3PR1A 3BRWA 4MD8A 1HURA 4I46A 1DRVA 1EWVA 2IRWA 5DGXA 4O4HB 3OOEA 1WUIS 2XVYA 4DSNA 2ZREA 3NIFB 5JNSA 2DU8A 3FCEA 5MF6A 1U1EA 3GGJA 2Q2VA 2GTPA 4FCCA 4IXMA 1YVUA 3RLIA 1DPGA 3WK8A 5K8LA 1V95A 2GCIA 2EJTA 3ONFA 3GWGA 1SD5A 2H2DA 1FFWA 2C8KA 5JPDA 1LK7A 2VK4A 3S8MA 5FORA 1WSBA 4QLAA 3OQOA 4OHPA 3OAAD 2ZSEA 5ALGA 1ZIOA 2FOIA 2EX1A 3D8SA 2RCYA 3BGOS 3PQFA 4ZOCA 1LBHA 2WKWA 3HABA 4GC5A 1K731 5JS6A 1WXFA 4CLXA 1D4AA 1VLLA 2EWVA 3L5OA 3ZQ6A 1OU0A 1EUDA 5TS3A 5K0CA 3KZNA 4BZQA 2VDPB 1T0UA 2X6TA 1DIRA 1PLKA 2BFAA 5ER6A 3TLGB 2RE8A 1UZLA 4DGSA 4CTNA 2FMHA 3SZGA 4M8SA 2WF9A 4IJWA 4BJ3A 4MRIA 2ADOA 2Q46A 4O59O 4DQDA 5F33A 4Z9XA 2GEBA 2RGYA 4EGCB 3T3IA 2QTZA 4G0YA 3NKVA 1BU8A 1V1RA 1YI0A 2FI1A 1DBRA 4QODA 4Y30A 3TEMA 2W6CX 4F38A 4DA4A 1GPAA 1RFLA 4MWBA 4RK5A 1R6AA 1QYVA 1C7RA 2IZ5A 4P4GA 1PUXA 1YOBA 3HCNA 2N1BA 2DFPA 4L8LA 1SQ0A 2KB0A 1UBEA 2Z9BA 3GYGA 2C2MA 4HDKA 4UUQA 1OGJA 3O8NA 3STWA 2PO5A 4DM7A 1TYBE 4OLAA 1L7NA 2Q1SA 1N9GB 3OJLA 5C3UA 1R88A 2QGZA 4O08A 2HPAA 1XCPA 4I55A 4ARBA 4TMTA 2HUPA 1P2UA 2VATA 3MJSA 7MHTA 4U9HS 2CDRA 4CDMA 4JV5B 3EOAI 3DEIA 3G0BA 3T0IA 1W4BA 3QUQA 3PGA1 1DMRA 3ZHTA 3F73A 3A6DA 4P80A 2HU5A 4L0QA 3KCQA 1XTJA 5TPZD 1Y7IA 3H75A 3MINA 4JBWA 1SH7A 5J2TA 4TYYA 2H4JA 3H5RA 1K9M2 2CMFA 4ESOA 3GFQA 3RJTA 1U8TA 4MQFB 1EYZA 1E2HA 3UHOA 4P1ZA 1K5DA 3I64A 1RTTA 2OV1A 2WBLC 1ADJA 3QEMB 5BMOA 1EK6A 5FO0A 1B0PA 3B3JA 3KEFA 5ALPA 4OB6A 1ESZA 4NWIA 3TDKA 2QJOA 4E5UA 2VPZA 2IUEA 1JR3E 1FNCA 1DMSA 3QMPA 3R6TA 4ENQA 5ITZB 3FE2A 4DQUA 1WCIB 1L4FA 2FXVA 2JAQA 2OAEA 2A86A 4FEGA 4OA8A 5JG7A 1H8ED 3J80f 3ZLTA 5FBHA 4Z8YA 3H18A 1GUFA 4D3ZA 1ZVKA 2RMKA 5IP7I 4RHCA 3RFCA 3WNBA 1Y5NA 4BNWA 1Y98A 5H82A 2JIZD 4PV7A 1I3CA 2DZDA 2RCNA 1ZK0A 4EA7A 1NNI1 1QYIA 3EYWA 3LT0A 3OT5A 1QBKC 4KYUA 4E12A 1Z18A 1WV1A 1YIJZ 3N8KA 3FZEA 5AOCA 1MDFA 2QUBA 3MT0A 3PQDA 3WMEA 3MK31 6CHYA 4FQ7A 3GRAA 2JGRA 4G1EB 4WV3A 2D3TA 1MB2A 1HZJA 2R00A 5CM8B 1GY8A 4G89A 3TSAA 2HV8A 1AGRA 1VCNA 2G36A 3CLTD 3F78A 2I3AA 1YIDA 1LRKA 2KYRA 3BK7A 3E3AA 4AO8A 1PFVA 4WBNA 4Z7NB 3OTHA 4P3NA 3WKDA 4POOA 5FPKA 3JY6A 2CJYA 4KLAA 4BFLA 1T9CA 2BL4A 3OQMA 3QUAA 2VPXA 4KXWA 3NC0C 1JF8A 2V6JA 1JG2A 1RLOA 4FFPA 4F86A 1DARA 1QSGA 1TTQB 4GWKA 1N2SA 1NBMD 4QBGB 5FBQB 1R10A 3HA7A 4X7PA 4BY9E 4UCXA 4IIEA 2JFBA 3AJEA 5EJ2A 2OCYC 5LM3A 2EP8A 4ER0A 5LLDA 3UT0A 5C0OE 1V0JA 2OBLA 2WPDA 2H9YA 4MWDA 3KXPA 2ZT8A 3HOVI 5F73A 1YFZA 1WDLA 1RAHA 1QDLB 2JI7A 4EK9A 5C8DA 2RGNA 3QI7A 3ZXSA 2PSEA 2E7ZA 2ZSUA 3BHMA 1RP7A 3ELWA 2NZ8A 3FRIA 3F5MA 3OICA 3R4VA 4IV8A 5A4JA 3HBFA 3VNUA 2BSAA 2YBEA 4M8NE 1P2TA 3S70A 3BWMA 4A73A 1KD11 3O8BA 4Q39A 3ZDXB 1Z22A 2JLRA 1F48A 3RZDI 4O4JB 1HYBA 1YBFA 2FSFA 4Y6LA 1LA2A 1Z38A 4AZVA 4B8ZA 5J23A 1XQXA 3UG7A 1WNFA 3ZU6A 1MEEA 3T61A 2HJVA 2IEZA 4CV0A 1BDIA 1DAEA 1KAMA 3OJXA 5TR9A 1ABBA 1D3AA 3J81f 1WZUA 1AHNA 1T9GR 1H5UA 2NUPA 1J0XO 1FUIA 1LC3A 1OR8A 2ZJOA 5K09A 2I2FA 1DC6A 2QBYA 2WA2A 4A2CA 1S1CA 4H6VA 4HWGA 5KC8A 3T5CA 3WYBA 4M9CA 4OCZA 1APBA 1O96A 2COUA 1OLSB 1G3MA 4PQYA 1JLLA 2WTUA 1QTQA 2D5CA 3NR2A 4I5EA 1Z6XA 1V96A 5TE9A 4AG3A 3A1SA 3VV3A 2ENUA 3COPA 2E4XA 5JXHA 3FFBA 4D0RA 4D3DA 3CWZA 3FYUB 3BOSA 1PJZA 1N6KA 3FLEA 4G86A 4YRGA 3T4NB 2ZRDA 2PWZA 1NFQA 3NPAA 3LXUX 2J0EA 4FB5A 1F0NA 4PE5B 1WD5A 2IIPA 1PCXA 2O3TA 3QA3E 3TZLA 1MH9A 2BFOA 2G6TA 1CUAA 1IB6A 2HMVA 2MSKA 3ANXA 3AUXA 3D3WB 3EQ6A 3K96A 4I4NA 4L50A 2G9NA 4F04A 1ZHOA 3CBGA 5BSTA 1BOFA 3HCDA 1MPXA 1SVOA 2A4MA 2HMWA 3L40A 1PSDA 2ORIA 3GWZA 4IIYA 1BXKA 3RGWS 4U7JA 1LJUA 4Q1AA 1RJDA 1TQ4A 1Q822 1FDTA 5T64A 2NUAA 3BFXA 2N46A 1CDDA 1JMYA 3P52A 2G7ZA 5J3JA 5KUTA 3TRKA 2R66A 2YIDA 3A7DA 4CJXA 3VHLB 5EIWA 3K15A 5FA8A 5K3FB 4BNVA 2AS0A 3G2QA 1Q7Y1 5IT9b 2XRZA 3I4CA 1F8YA 2UUPA 5F7JA 3CEMA 2XIQA 5JWHA 3PTZA 2AX4A 5I8WA 1ZHFA 3O8OA 3DE1X 3A9TA 3GVPA 3AIMA 3SG0A 2YVUA 4KWEA 5D2CA 2GJKA 3EX7C 1NV9A 2ZM5A 4JWTA 5IARA 1P4JA 4OH1A 2XVZA 5DBGA 4QRDA 3CD61 2OCKA 4KYIB 4QQFA 2BH9A 2YYAA 3KQWA 5I7EA 1JQ5A 1V11A 2EGGA 1L7OA 3JQ9A 4UEKA 5TV2A 5IJAA 2PL3A 4E07A 3QXXA 3C5CA 1CY2A 1BEEA 3HHPA 2VAWA 3FPCA 4HZIA 4ILKA 1GN9A 3WL5A 3JQAB 4NY1A 3EZNA 1V6SA 3LPAA 3S1NI 5TLSA 2ZROA 3C1AA 1F2TB 3AB7A 3F6YA 4IWNA 1DIBA 1UMCA 3CO0S 4KYVA 5AKYA 3WGOA 3ZDAA 2SBTA 5A5GA 1I13A 4G8BA 3ED1A 5EHQA 2GDJA 3WADA 3DJFA 1P7WA 1WJ2A 1AUXA 4NIMA 4X0EA 4MPDA 1NBAA 5TVGA 3A28A 2W0MA 3ILYA 4LF5B 1QG6A 1W52X 5L3SA 1KSFX 1P9RA 1ZCAA 2V0GA 2ATEA 2O57A 3DPSA 3HJBA 4DR2B 3I2IA 4LXYA 3FETA 2LEXA 2A0YA 3RAPR 1P2GA 1GNRA 1JA9A 1T0HB 1KI3A 3L7LA 2C61A 3C1UA 5AUQA 1PQUA 4TYPA 3OD1A 3EIWA 1PT9A 2IZ0A 3CLKA 4EPYA 1MABA 1MJGA 1F9AA 1IY9A 3B6ZA 1LTKA 1ZI6A 3RM3A 1RKXA 3E0XA 5D1OA 4ALKA 4MSUA 4TLEA 2XMRA 4BFZA 3R7AA 4H17A 2VFAA 1I7PA 2OOYB 3D5TA 3WV5A 2A58A 3S1QI 2X4DA 5U4XA 1J25A 3B8EA 4J3JA 5B7QA 3CC41 5IVPA 3EF0A 2GK6A 3Q3HA 3OOSA 3UXHA 2O4CA 4WD3A 1PNOA 5E3IA 2P6OA 1RAEA 2GFHA 4FYXA 4CI0B 2XTJA 1MH1A 5ARDA 2H4XA 1PGOA 1CRQA 2WM9B 3OEYA 4KWIA 1MJ5A 4W99A 1TB4A 3USCS 4ACBA 3WFIA 1UUFA 5JS1A 2UZ3A 4LSWA 4UREA 1UZUA 4NR0A 3RIHA 3I53A 3PQ3A 2I8AA 4IDBA 5I9LA 3FF1A 3QF7A 4DUPA 4FXPA 4ETIA 2J9YB 4Q3AA 1VG9B 1YDFA 1SNYA 3UK6A 1NUPA 1WKBA 4LDPA 3UOWA 4IZOA 3HVKA 4YGXB 5CG2A 1VL8A 3E70C 2CHUA 2QORA 1A27A 1ZGJA 1N2CB 2J9XB 1K75A 2D0DA 2RH5A 5AWFC 4KIUA 5A4FS 1C0PA 4ND4A 5I45A 4J76A 4JP1A 2AUNA 1ECCA 5JY1A 4JCCA 2FK8A 3A3NA 3FBTA 3TZHA 3THYB 1AHPA 4PC7A 4ARIA 2FWJA 4RIHA 1DIOB 3H9EO 1SCIA 4JQYA 3PNVA 1JPNA 2INGX 4CI9A 1G20E 3VX3A 2UXCB 2P5TB 4JI7B 3LWBA 4NXNB 2XR1A 2VSXA 3HN2A 2PUJA 2IYZA 3N86A 4AXBA 2DFTA 5D6NA 1ODFA 1IM5A 3B2QA 2ODBA 1W87A 4US0R 4AYWA 4X24A 5SZJA 3UGJA 1M0TA 1E6EA 4K9QA 5CDFE 3BTOA 1U6IA 1H42A 1TD1A 2CL0X 4ARSA 1KFKB 2C7BA 4G0PA 2ZT6A 3ZWMA 4DR7B 1K9M1 3ZS9A 2GILA 1JEQA 3L7KA 2R6HA 3DBHB 2RHGB 5BSWA 4K9OA 3FNEA 2BMAA 3HACA 5TF0A 4Y6RA 1BG6A 3V6MA 1TCVA 2Y27A 3W8EA 1GILA 3I73A 1XQVA 5KOHB 2IH2A 2O8CB 1DFIA 4P5EA 3GCFA 2ZKLA 3EGXB 3W78A 1ZA1A 4AKIA 3VPCA 1UAYA 2A78A 2A9PA 2I6TA 2VUUA 3LBHA 1KOLA 4ER7A 2WJ6A 3FB1A 4OGKA 3BTUA 5BUCA 5EFZA 1UAGA 2FA9A 2P78A 3LX5A 4REMA 5E6UB 2VP6A 5HZGA 1JNXX 3KDAA 4J3NA 1KBOA 1E1QD 4CETA 1LRLA 4AO6A 4DABA 2EJCA 3GBPA 3OFSA 3H4TA 1PKXA 1N2XA 2ZIZA 1EA7A 3DMPA 4G41A 4BNIA 5BN3B 1J21A 1JVNA 5KVCA 5CPFA 1JIKA 2FY8A 2HBYA 4P7JA 2V97A 1Q6YA 1TAGA 1KK0A 4KAAA 5BVHA 3QTTA 1GPYA 1ZNYA 1XDBA 1WMAA 2LIVA 2NW6A 5EMHA 3RSSA 1C7QA 5CD1A 1Y5LA 2L42A 2XNJA 2DFVA 5AK6A 2BMJA 2OORA 5C18A 3DM5A 4FGWA 4AMVA 4EHJA 4AB1A 3TQIA 1PT8A 1JIIA 3VX4A 2BN4A 4UCQA 4JJKA 3KZVA 3LUFA 4EG7A 3PNOA 1R6DA 5HQTA 1QTRA 2YXEA 2C54A 3DR5A 4BVAA 3W6ZA 1P9WA 2QPTA 2W2OA 3BILA 1Y8RB 3AR7A 4K9PA 4KXMA 2VPTA 2YMLA 2LBPA 4K86A 2RK3A 1T8UA 2IEIA 3IXMA 4F93B 2QD2A 4NENA 3GY0A 3WMRA 4ROTA 1X6VA 3DE5X 5JS8A 4GMKA 5KU7A 5LMUB 4KFRA 2WSLA 1R00A 1ECGA 3C48A 3EULA 5HK9A 3U16A 1WF3A 3VPHA 1UJBA 3RROA 1W1WA 2E82A 4GKAA 4G1BA 1ECPA 4EW2A 1Z2EA 2EAUA 3NUQA 2RHDA 3U2QA 5CFOA 5G3ZA 2ISCA 3BE5A 4Y1RB 2O4UX 3ROZA 5JNVA 4YCBA 2JA5I 1E5DA 1YRYE 3BFVA 3DVSX 4TV8F 4U00A 4ZXFA 3C3PA 4D1YA 1PWEA 4ECEA 3U3KA 4CR7A 2G9ZA 3ZVKA 4HDMB 4I8XA 4RKRA 1IJBA 1ZD8A 1UOQA 1E6MA 3CSDA 4HLNA 4M1EA 1Q15A 2BONA 4R51A 2PR2A 4BRZA 2IEAA 3TIIA 1T6ZA 2Q1YA 5H80A 1RWBA 4X66B 5DW3A 2IZ1A 5THXA 4F6RA 4NCHA 1UH5A 4Z54A 1NTOA 3DT8A 1CF4A 4GFDA 3GJ6A 3SIXA 4LX0A 2F43A 1OYVA 3Q87B 5AW0A 5JOQA 1DKRA 5J2UA 5IKXA 3FFTA 3GLHB 3OFKA 2YWDA 4IYJA 2EDAA 5CVDA 4BNKA 5LD2C 2AYXA 4MI1A 2CT8A 4YP9A 3AVWA 1TW3A 2ODTX 4NBLA 1X70A 3FIUA 5KYYB 1Z35A 5I51A 2X22A 3VFDA 4TYWA 3ENVA 1WETA 2F3UA 2J0VA 4UDXX 1HGXA 1E98A 2P91A 2WE7A 2ZU0C 3L7MA 1OH6A 1V41E 2C9BA 3OTGA 3RGGA 4EZEA 3WHLA 2Y1XA 2P9FA 1GPWB 1ORDA 2PMDA 2V9ZA 2Q4DA 1XFAA 3SLGA 1QVFZ 4WBXC 3FOEC 5EKTA 1GUBA 1Z63A 2H52A 3JYOA 4QXOA 4BBSI 2FQQA 4EATA 1ZZEA 1OFUA 4PFSA 5IDWA 5JNWA 2PG3A 2CJFA 1L4LA 3K92A 3E5NA 3THOA 1E2GA 4DMGA 3GYBA 3GTOI 4P36A 4W7SA 3BMOB 4BKUA 1NVUQ 4MONA 3SD7A 1TU0A 2CFRA 3BK1A 1Q7TA 4GX1A 4MARA 3SEFA 3EG9A 2K3RA 3NTRA 4YNBA 4ASUA 1H9CA 5JAQA 1EP1B 3GIDA 4DZRA 2BBTA 2O8BA 2BFNA 2MIIA 3MJTA 3FNFA 4AJPA 3BFJA 4HVLA 1VSVA 4RJTA 1FUUA 1R9MA 3PFHA 1Q821 4KPGA 4RTPA 1U80A 3K70B 3GLUA 1LBIA 2JBHA 5KJ1A 2QP9X 5BR4A 4DDTA 1N2FA 2QM7A 3CPWZ 2ZBDA 1E2IA 3KKQA 1TYAE 5EZYF 4DT1A 3U7FB 2AG0A 2VL7A 5EHNA 5BSHA 4AJ2A 1Z0ZA 1EVLA 1PS8A 2UDPA 4ZVPA 4M9RA 3CCL1 3SQDA 1OH7A 1RJEA 1PF7E 3G1WA 2RGWA 4BO6A 1ZHHA 1LNZA 2PYDA 3A2NA 3EBPA 5A1TA 3DH0A 1CUZA 1J33A 1H5QA 1WY5A 4CEIA 1Y34E 4HO1X 3BIXA 2JAWA 1Q2XA 2C8LA 4ENRA 1Z0DA 1FP1D 2G4CA 1A7UA 4JLWA 2K5RA 1H22A 4MUYA 5G4KA 1KOGA 4EI7A 3G2MA 2J67A 1DAHA 3ABIA 2OTL1 4URXR 5IT4A 2RGGA 1AOXA 3SEQA 1A5SB 1J4AA 1PK9A 1KZYC 2FW8A 1ENPA 2NQ8A 2P27A 4H1VA 3CF6R 4UZFA 3U3ZA 3DXYA 2XI4A 1Z29A 5CNKA 4N5LA 4JLNA 2VP0A 3H7AA 1EZ1A 2OBYA 5E1OA 5REQA 5JC8A 4K6HA 1M76A 5EE0A 1NLMA 4MINA 1NJ1A 1C3OB 2GJAA 4JT2A 3VH1A 1D1QA 1JRLA 3AVPA 3IFUA 1JR3A 2PUHA 3B52X 4YJGB 5FL7D 1XVVA 3MB8A 4X7RA 2LDXA 2OZLA 4QVKA 4WECA 3P5JB 2GA8A 2FX3A 2JGLA 4N5HX 1Z0FA 4M46A 5BYJA 3U7EB 5EMLA 3T7DA 2VDWB 4C89A 3FTEA 1XMVA 5B57C 3CLUC 4RH0A 3EJ6A 1DDGA 4YP0A 1JMVA 4RABA 3V7UA 1KU6A 1ZLXA 5B4UA 2IE0A 1F14A 2P90A 4EH1A 3OJCA 2XUAA 2ORED 1ZGCA 2XMDA 3BXFA 4BMVA 5DTRA 4RL4A 4M9UA 3ZY3A 1WB4A 3UVEA 4N0QA 3VDXA 4QUIA 3L1KA 1YITZ 2G40A 4KXLA 3S27A 1M8GA 5BMVB 1Q0LA 4QQNA 5IANA 5ISMA 1UKBA 5M04A 2QN3A 3C3AA 1G41A 1PZGA 4QGHA 1GRVA 5E3HA 4HQOA 2QRHA 4EG3A 2R6MA 1SBNE 5BRNA 3T12A 4DLKA 5FYDA 3O1JC 2CXNA 3KYCA 1OI4A 3I9FA 4PXAA 4DKJA 3RU7A 2OK8A 3DFMA 1NVVR 3DOJA 3BBPA 1OLXA 4TX1A 2MSNA 4G5XA 2CNWD 3ZWOA 2BSXA 4BKPA 4J8PA 4GWGA 4YJ2A 4NKRA 1F3LA 1O0SA 2VHEA 4PFJA 2VNHA 1IQRA 1IH8A 1VDMA 4JFAA 1U2RA 1E2NA 1TF2A 4EFLA 1JHQA 4PZZA 1UXKA 2DT8A 2AE2A 2JASA 4IHKA 4QVGA 1QHGA 5E2AA 3W8FA 3PNQA 1E2FA 4ZQHA 2JGIA 2XDWA 1K7EB 2BGIA 4FYYA 3V42A 3U9TA 2IBMA 1OPXA 4JP8A 3VZDA 4YCLA 1Q16A 1QF9A 1TUBA 4DRXA 5IU6A 2XDQB 3UAZA 1HYGA 3TW4A 3ZNOA 3D8RA 1FFGA 3HM2A 2DKOA 3UWKA 1A76A 4WTOA 4BGEA 4DBZA 1WMEA 3J80b 2XUQA 1KFCB 4BLSA 4DB2A 1VHLA 5EC8A 3TE7A 1EIWA 5HQ3B 5EQDA 1UANA 4G9BA 4Y6QA 5JXIA 5TIIA 3DXZA 1ZG3A 2NT4A 2ZETA 1OI3A 4I81A 3KSAC 4DW8A 3OTQA 5CIYA 1QXSA 1OX4B 3O4FA 5BSVA 3P5SA 4OMCA 4BASA 2J0SA 4FOTA 2G06A 3WLKX 4RK1A 4D8TA 3DKRA 4FNMA 3D4OA 4CKCB 4GP7A 4I3FA 3LDHA 1LPMA 1TUEA 2HRDA 4O25A 4RE6A 3AVVA 1ZXLA 3GLRA 1FE8A 2DUNA 1FXUA 4Y3UA 3CUWA 1T6NA 1Z34A 3CKMA 3GJ3A 1Y6FA 1NUAA 1T5HX 1COWD 1DCMA 2JJQA 2VHTA 3ZLJA 1HYEA 1QHFA 1WY7A 5EFOA 1V35A 2QG6A 4X3PA 3I1IA 2QEX1 1UBRS 2AYYA 3B7WA 1VI5A 4Y2JA 3TPFA 4DSZA 3CPWY 2WDPA 1N6OA 1OAOC 3PGKA 4GZ5A 4PS0A 1DZIA 3NHMA 3RG8A 3HE3A 5F2OA 3I62A 1UF9A 2QVXX 1KYYA 3CUVA 1C8BA 3ENQA 5K8VA 4NATA 1IHPA 3AEQA 3V4OA 3AHEA 4GPAA 2E2WA 1FTSA 2PRSA 1PRYA 4JBXA 3H5AA 3FTFA 3WKAA 3DKPA 1J5EB 2ISQA 4FI3C 5CVCA 2J5KA 1QP7A 3G0HA 3O31A 1AKUA 1GR1A 1BKDR 4FR0A 5DHQA 2R7NA 1U9CA 3LKDA 4D9FA 1Z82A 4MIEA 5DLDA 2OB2A 3SBEA 4RL6A 3PGJA 3HUEA 4KQ9A 1YCDA 2YIJA 2AEFA 4R1TA 4Y2YA 5AVQA 5JVDF 2OTLZ 4PX9A 1P9OA 3IBYA 1GUZA 4R2JA 4CU5A 4BOYA 2DHEA 4MQUA 4Y1FA 3GRVA 5FAXA 3H97A 1ZU4A 2W2PA 4JZKA 4MQEA 4U2FA 4Q4CA 1T8PA 5AUOB 2UXDB 1CUVA 4KSCA 1MA3A 1U5CA 3FYUC 4D79A 4RV4A 5LP6C 3H1AA 4EPVA 5I01A 2XBMA 4UUMA 1TTTA 5CDGA 1K8XB 2EDCA 2RGEA 5DM1A 4BX9A 4ZDKA 2QK4A 2AMLA 5FHQA 2VOEA 2P2LA 3N0WA 1B8OA 2CKMA 4JQZA 3COWA 4TXHA 1HFKA 1ZRSA 4X00A 3PE4A 1ORVA 1T24A 3RC3A 1VL1A 1FNMA 2GO1A 3E5HA 3FDFA 3HWX1 2VT7A 4U5XA 4E70A 1RBZA 1WU8A 3DP7A 2CY0A 3KIHA 3F5SA 4M49A 2X3YA 2GEJA 1SVNA 1NKTA 4HV4A 2FFHA 4ZU3A 1Q83A 2B2NA 2Z0MA 1DOAA 5ED0A 3ZQJA 4FW8A 1D0IA 1ZK4A 4IVQA 4JBHA 5LQSA 5CDHA 1WW3A 4GXNA 4RJ2A 4DMHA 5AHXA 2B4YA 2E2HI 1N92A 3STTA 4DCCA 1HH4A 4GS5A 2ZE6A 1E2KA 2GI4A 5CTJA 5A2Qf 4ZZ0A 4JT8A 5CH5A 3ZGXA 3DZ8A 5DXFA 3ZI0A 2IOFK 2RBKA 4I6EA 1YRBA 2JFQA 4ZOBA 3WISA 1LLFA 5K3OA 5BNIA 3ZK9A 5LB2A 3CZPA 1J8FA 5C44I 1OSNA 3B9RA 4ZP1A 4HGOA 5GOTA 4BO5A 4Z3OA 4QNNA 2A0FA 2FPIA 3JQDA 3LBNA 1KYVA 5KKAA 5JJIA 1KIFA 4AJIA 3GZTB 5C4GB 2XD4A 3HFRA 5JPIA 1R0KA 1MBZA 2HA6A 3H3FA 5FTWA 2I87A 4QKQA 1T3ZA 3ZU3A 1GKYA 1Z4LA 1ONSA 2PJDA 2G2KA 1EFCA 1CRWG 1IEWA 2UZIR 2YJ6A 3HRIA 4M7OA 4MO2A 3T9AA 4K6CA 1VI6A 5GGXA 1FTGA 1B00A 1E0SA 3DPUA 5FUQA 4D9CA 2GX6A 1E5QA 3KYIB 3CIFA 4D4IA 5J1SB 3WYFA 4B6SA 4RQBA 2YXLA 1BEUB 2Z2XA 3CT4A 4HVTA 2ZYTX 4F9EA 3R5SA 5CYGA 4H15A 4WLOA 4MYRA 4XPIB 4DQVA 5HK8A 3TPCA 5C1PA 3PUHA 5KKNB 4G63A 1SOUA 4PX3A 2XBUA 2HADA 3HYCA 4D4MA 4EA8A 1XYYA 3L7OA 1E2DA 1JKMA 2HPHA 2E1RA 2WABA 3LC0A 4RAQA 1XO1A 4TLMB 2O7QA 3G9UA 4NCXA 1RFGE 3KQMA 4HAUA 3NDIA 4ENSA 3EEOA 5JI2E 3WWPA 2HD4A 3PGVA 1ECJA 4DEVA 3MTBA 2W4QA 4ZJZA 1ETHA 2XY4A 3IIEA 1X9GA 3CME1 4BN4A 2Q9CA 3K9BA 2O50A 2O8EA 2R1VA 3SYNA 3F8WA 4O4LA 3U09A 5FOQA 2E85A 1CS0A 1ZH4A 4L4UA 4F84A 3JQ7A 3GNQA 4KJZA 1FTNA 4MA0A 3DCIA 2P2ZA 1H0RA 1M1ZA 4W5NA 4NH4A 4QE3A 3RWBA 4UE3S 1G20A 2QUZA 4PR0A 3ZJVA 3WO1A 4KDFA 4PLPA 4ESHA 1K8A2 3AEXA 4TM8A 3SE7A 2CNLA 3VNAA 1FVXA 1XC7A 1XD2A 1L8XA 2WSBA 3SGLA 1UT6A 4D0LB 2D5LA 4W6QA 3INGA 3DDUA 4FHCA 2AUTA 5HJEA 3DL0A 2P4QA 3KB6A 3L8ZA 2Q4RA 1JLMA 1Z01A 2UYHA 2AUMA 2QX4A 2WVHA 3D8BA 3TR0A 5CFLA 1M2WA 3PD1A 1Y7PA 1F2UB 3PFNA 4F60A 2XXJA 1OFHA 4MTLA 3AUJB 4MV7A 3MTAA 4JENA 2JGMA 3QHPA 2PA3A 3NCHA 2PUVA 4Y7CA 2WRZA 4JJZA 3MF4A 2IHVA 4OHYA 1RQPA 4EJ2A 3A9VA 3AGQA 1RWWA 2AOUA 3FKQA 3GKQA 3MJVA 5JH7B 4AMGA 2JLQA 3R44A 1XZCA 3L9WA 3ZD9A 3D6NB 1QYDA 3A26A 3UMFA 16PKA 1I0LA 1WULS 1FLDA 1VTKA 3GFOA 4Y9RA 3V1MA 3QFCA 4EB0A 1GCIA 2QAGA 1P1HA 2VJMB 3II6X 1YVPA 4JA2A 4KO4S 5THKA 1BTOA 3W5BA 3LLCA 1N3LA 3F9IA 1GKIA 3P1JA 3QEOA 4KPEC 3TQFA 2GPSA 4HLCA 4KUHA 1N9KA 4E4TA 3P2IA 2GZMA 3PUWA 2BP7A 2DQ4A 3QX8A 4KQWA 1TJ3A 4NSNA 3U37A 4BECA 4CQLA 2OESA 3F0TA 4EVSA 5BVGA 4F2WA 5JNUA 1MGPA 2PS1A 2VZLA 4FWBA 5GZ1A 4GLLA 3UHJA 1RRPA 5B36A 1F4LA 3LO5A 3X1XA 2DP4E 3TXAA 1WZNA 1CUCA 3O6VA 4EHAA 1Q1NA 1MOSA 2QOEA 1MORA 5HEKA 3C2QA 1VMDA 3PHLA 1VJRA 3OPYI 5FNVA 3DS8A 2E5WA 4FKMA 4FS8A 4XIJA 3DNMA 5JMTA 2RB4A 3EPPA 1AD2A 3P19A 1QPGA 2I2WA 3PXEA 3AJDA 5IKEA 1ZVQA 4ZU1X 1MC8A 3PCXA 1HLDA 1M7BA 3P0RA 4JVOA 4YMUA 1DXYA 1GL9B 1UPUA 3J7AC 2K2WA 4A3JI 1V1MB 3QFFA 1VQN1 1SD2A 1O58A 1A8UA 3I37X 3KSDO 3O5AA 2LFUA 3LX4A 2QR2A 3HJNA 5IAEA 1Q0SA 1AGNA 3TD6A 3ILSA 3SSNA 3ZC3A 3KEMA 4DNOA 3RVDA 3TKYA 3L0PA 1VQ81 1RVDA 4QU0A 5HGXA 2BBSA 2QJFA 3B1JA 5LQDA 3IBFA 2GJ4A 3SMQA 2JIPA 3KV3O 3I6YA 4OG2A 2D1YA 3D7MA 3O4HA 4CMHA 5I7HA 1Y6JA 1H2WA 2E48A 2C84A 2ONZA 4K9LA 4BMDA 4F1KA 5C4JI 5F7XA 1V7CA 1WL8A 4BNFA 2OENG 5JYEA 3PKJA 3RT9A 2OWEA 3LY5A 4HNGA 1XCLA 5CT9A 2AH5A 2C5AA 2CFCA 1XROA 2WTNA 4HXGA 3HVUA 4PG5A 3IHTA 3KD2A 4BFCA 4DCPA 1THTA 1UBGA 5F5NA 2FEPA 1NZJA 2M6RA 3FTCA 4TZTA 3S55A 3O94A 1JI0A 3C4QA 2QSYA 3I9V6 2D5BA 3L04A 4EGAA 1GTMA 1OMOA 4HS4A 4D98A 3VPSA 1XZJA 2YXDA 5CT4A 2E49A 2FG5A 2H1HA 2Z56A 4ZYYA 1KFBB 1Q22A 3C8MA 4Y2PA 3B1WA 5BOVA 3RR2A 1HDOA 1TF5A 1ZUNB 3ZWBA 4CM4A 3WNZA 3JX9A 2Y9MB 5TQ0B 1Z06A 2IU4A 4MEJA 4LMPA 1NJ5A 4CTOA 4HXFB 2C92A 3VSDA 1E5XA 1MC1A 1DL6A 5D5PA 1JSCA 1R5NA 4KXQA 3P4XA 5E6RB 2DHCA 1QH0A 2G82A 4ZAFA 2QMUA 5KNDH 4BO0A 2VRCD 1E1CA 1CZRA 1JHMA 2JAPA 3K16A 4IHJA 1TFRA 1G2OA 2M1XA 2I91A 4WW0A 4QUJA 1SELA 4BO7A 3HLYA 1X1DA 1U2PA 4MP3A 2JLVA 1Z13A 2BEJA 2YOGA 4KQGA 4Q00A 4NICA 5H3CA 1ZK3A 1B1AA 3R7BA 3UJPA 4CQMA 3PUJA 2O9JA 4KO1S 3GLGE 2ZPAA 1DKQA 5E1DA 3ZW7A 1GQOA 2WJHA 1XYGA 4X1KA 2YZKA 2HBZA 2TYSB 3S7ZA 5JSHA 4C88A 2HMAA 2H08A 1G21E 1YVDA 3PA8A 4KLCA 5TJ9A 4BX0A 2EBUA 4KR2A 4TTQA 2CB9A 5LQUA 1W2BZ 2PKQP 1JYFA 2VNSA 3R24A 4Z0NA 5A5DA 3B53X 1N9ZA 1XEXB 2Z4RA 3OPNA 4BVGA 1NZFA 4IW3B 1XL1A 4HAWA 4AG6A 1JBEA 4TL8A 4AMZA 1JDTA 2H51A 2QU7A 1GCAA 3KB2A 4KFUA 3HXLA 4BWYA 3COSA 1YAHA 1X9IA 3WQRA 1GFSA 1OXTA 4HBGA 4UM7A 1NXSA 2J7PD 3MD9A 4GYJA 1YJ91 4HPJB 3SF8A 4MD9A 3T7KA 4HH4A 4V0QA 1EESA 2XZOA 1P5JA 5F77A 3W6UA 3CJTA 2V98A 5CITA 3KOYA 3VJKA 4A6XA 1UBLS 4QEZA 2GM9A 4YONB 3B1XA 2WF7A 2WU3A 4UHEA 1I6KA 1JH9A 3IALA 3PGMA 3R5JA 1M2HA 3NBXX 5B3KA 2KMLA 2FN4A 4R16A 5BUZA 4MS4A 2DUWA 3HZRA 3IAFA 2AOTA 3CUUA 2BEUA 1FDOA 3CCQZ 4OH7A 3TCXB 1GTZA 4JR1A 2PKQO 4NS4A 5F5LA 3G0CA 1RMTA 2UYQA 1W9MA 5AOVA 2CE2X 3U7QA 4S1OA 4DBLE 5IJ0A 2PXXA 1SD1A 1LFDB 1E5LA 4PGFA 4QYXA 1XI2A 1Q84A 3P45A 1YOVA 3SC6A 5CA0F 2RIQA 3NRJA 3IEMA 4ATNA 2MINB 1HORA 3E4CA 2P0AA 2ZYHA 4NBEA 1Y4ZA 2QNRA 4PG4A 4FLEA 4GL2A 4CCSA 3QSGA 3FSGD 5EUCA 5JO0A 1I4OA 1KMCA 2ODNA 2PRKA 2I4MA 4JELA 3ZXYA 1V6AA 5CJJA 2ID8A 2FRDC 3ZDEA 4B4OA 5IYZB 1EFUA 4OHZA 1X1BA 2FWMX 2OKCA 3BBLA 1A8SA 1NOIA 1ZC4A 3LGAA 3PGLA 3EWSA 2ZSAA 4P7BA 1M2VA 2LGJA 2D3WA 3NTUA 2C2BA 2XEDA 4Q34A 1IN1A 5TT1A 4RELA 1DV1A 3B38A 4C29A 1SU7A 3BPSA 3CLTC 3GHHA 2QVBA 3TPZA 4DA8A 1TO6A 4XE5A 1KP2A 2CZCA 4JFRA 1VLZA 2O2IA 1SPBS 2XTNA 4RZ3A 2XVXA 1WIIA 4WOJA 1QHSA 3HB9A 4AULA 3TG2A 3THWB 1SU8A 5LXTB 2FOXA 5CXUA 4HH0A 4MKHA 1M8JA 1FY2A 4KRYA 2O0MA 5MFZA 1QFMA 4F56A 3DA8A 1HDCA 1RLTA 3NPMA 1M1YB 1H6AA 1NF3A 2V3WA 2R8XA 3U5ZB 4KIJA 1HC7A 2DRIA 2VF4X 3JQ8B 3T06B 2VP9A 3QFSA 1TNDA 3JQFA 1GPDG 1Q7EA 1FUKA 1TZ2A 1JVBA 4L4ZA 4V24A 3UJ7A 1H23A 5IDQA 3IGFA 4MR8B 1NDHA 3OZAA 4TTSA 3DO8A 4HEJA 4BO4A 3W8DA 3NV7A 1GSAA 4ZT5A 5FBWB 5T4FA 3R77A 1M0WA 3EQZA 5KX5A 4DC9A 2D0OB 2CNDA 5DI3A 4KH0A 5EP3A 2C97A 2R8PA 1HQCA 1MV8A 4C7MA 4TOIA 3PLAE 3KHKA 2ODPA 2GDZA 1KZ9A 1Y5RA 3MD0A 3DDCA 4IPTA 2UZ4A 1T1SA 3F71A 3ESZA 5I6DA 1FRQA 5HRUA 1K8A1 4NAUA 3HYNA 5KI6A 1W19A 1GG8A 3OY2A 5G40A 4AJ9A 4EG5A 3ZHSA 3SYMA 1QHHB 5EYPA 4J4HA 2I4OA 3KDSE 3WWCA 1L5VA 2GVZC 5JT1A 1AC5A 5TGTA 3ESQA 1ZEJA 4IBOA 4AZ3A 2FCAA 4BFXA 1RIIA 4LCJA 1SBZA 4J2TA 3KWMA 1ZGAA 3FHLA 1N5MA 1B15A 1LNQA 2J3EA 3C7KA 4B2IA 4DG5A 4DQXA 1BKYA 1HFEL 3DLTA 3GFGA 5T3YA 1QPZA 2LIYA 4B43A 4L3OA 1A8QA 4TKMA 3BH7A 1U3WA 4XFJA 1DNPA 3Q72A 1JTFA 4LQ4A 3RRXA 4G1UC 4BVEA 1K5HA 3DL7A 1GQQA 5GM2A 3CVYA 5H16A 3UAVA 4DMKA 1KEEB 1XEAA 1J99A 2ZAGA 4JJAA 4HYYA 1B0AA 2GPAA 4J9VA 4MH4A 4R0NA 4ZCLA 3NUZA 4K9SA 4IOKA 4HRVA 4ZDIA 1GVHA 1RWNA 1NR5A 4L5YA 2FPLA 5IPFA 3BMCB 3TVTA 1PL8A 3EPJA 1UDCA 2F48A 2VS1A 4K9NA 1PX2A 5AHOA 3UFXB 1SFRA 2BMVA 1TA0A 2FSUA 3NTQA 4CMIA 4IINA 3A2KA 4OK6A 3CQZI 4YAJA 4Q4AA 4XAQA 1E2JA 4BYMA 2IUUA 1BQ4A 1PFYA 1UQUA 2BJVA 6YASA 4I4IA 2Z5LA 1A9SA 2ZYUX 5EWMA 3JQAD 5JFOA 5BXQC 1F9EA 2KI5A 1H0KA 1XQWA 4NE9A 1ZUWA 3N6RA 5DX8A 5FUWA 2VNAA 5JEDA 4YDRA 1JEEA 4QDKA 4ZCSA 3IAHA 4JUAA 1VDZA 3JVVA 4G0VA 1KWGA 2VBCA 3N7TA 3PEFA 4LXHA 4MCHA 4CKWB 3UKJA 1JXAA 4S1TA 5TSDA 1DINA 1RKQA 4QL3A 2A5GA 1FRFS 1CS4C 3GH3A 5E7QA 4C6HA 3H19A 5I9IA 2H4ZA 3BWEA 1Z6QA 2P4HX 4CF7A 1LUAA 2WDZA 4KQCA 2YWEA 3THRA 4MS3A 3AY7A 2OOKA 4D02A 1XA4A 2ID4A 2ZTUA 2PYIA 5BT9A 3SCZA 3CPEA 2R44A 1JAHA 4OGGA 2P1RA 2OYCA 4UBIA 5K0TA 4UMVA 3RJ5A 4ZV7A 1AGPA 2XF8A 3MLEA 4CM9A 2P41A 1TZKA 2Q4BA 4TL9A 1MZPA 2DLDA 2DPGA 4OMDA 4KFCA 3R75A 3W05A 3H3VJ 2WU0A 1H05A 1KQOA 3Q40A 1NSFA 1SUEA 1H2BA 4YAUA 3O9VA 1E9BA 1X0XA 1EUCA 4KP7A 4KRFA 2YIVX 3DLBA 3AM5A 4IVPA 1U9IC 1FA9A 4EY3A 5GVRA 3R74A 2A57A 1UAAA 1E2EA 1NVDA 1FSZA 4H7PA 3FSEA 4ZYWA 3PEYA 1NN1A 3RHZA 3HMQA 3JQEA 2AL7A 3DE2X 1I3KA 3DE6X 4CMAA 1RQGA 4ZO4A 4EHKA 3UMYA 1DCFA 1CZKA 3RJ9A 4X20B 3RYHA 2I4IA 1ZRMA 4L4SA 1MVOA 1YT5A 4P54A 1UWVA 1YQUA 2XCRB 2V7PA 2POCA 1DO0A 1VHTA 4ZHQA 1C1XB 1TC2A 2ZXEA 4NMXB 1G0NA 1WPRA 5DGTA 4PC1A 1QFZA 3GZNB 3C3KA 3JQGA 4Q47A 1RO0A 3YASA 3P4YA 2PL1A 4FE3A 5EWLA 5HNKA 2W90A 2FZEA 3DOHA 3LIIA 3CZAA 1GZ4A 1UBKS 2QUAA 1XRNA 1A4RA 5DMXA 3QF4B 3RV3A 4D9GA 3P9KA 2QVGA 4WNAA 3IB6A 1CEQA 3H2BA 3Q3GE 1U65A 2GD0A 4HGQA 3OZFA 5B2ZA 5IJXA 3TMAA 3QLTA 4DRYA 1GPJA 1P19A 2BE7A 2DC1A 4QIHA 4BQFA 1J5XA 1QP0A 1HL3A 1KYXA 1QOPB 1PYGA 2AMYA 2GH1A 1O97C 4AY4A 1XTUA 3ITDA 4L9SA 2I34A 3AR6A 1T5BA 2HL6A 2VJNA 3KUXA 1TA9A 3U4IA 4KPUB 2YHAA 2A2ZA 3HUUA 5GONA 3V8MA 2F67A 2GSDA 2ZZNA 1ZDMA 1XOIA 1KQFA 2ZS7A 1K6JA 3JASA 2HMUA 4JUFA 4PU0A 2NWQA 3RUDA 3CNHA 2BV3A 1BHSA 4BNLA 2HAEA 4X93A 1EUZA 4X6XA 1FFEA 4JI2B 3ILHA 1XAJA 4EJSC 4M8KA 2Z2YA 2O2GA 1RRMA 2ZRLA 5J47A 1USIA 5FO1A 3RUEA 1SQFA 4C7BA 1EG2A 3VR5A 3GLIB 2KQUA 1JJ2Y 4MV4A 3KC2A 4ZQEA 3A9SA 2XUFA 3DQPA 4LE1A 4Q18A 1NVEA 2QRZA 2ZJ0A 5TQJA 3BMNA 5EPOA 2WFMA 1V8ZA 4YASA 4CL0A 1GLNA 1E66A 5IJWA 3WHPA 3VHXB 5HZMA 3MWDA 1YCGA 2ZI7A 4PPNA 3IJ5A 4RPHA 3NO4A 3E15A 1SKUA 4AZSA 3JQBA 2K7FA 1QH8B 3SDZA 4FQ5A 3HKDB 3HWRA 4MGZR 2P40A 3TD2A 1PSZA 4HQ6A 5ALQA 2BEVA 4A8HA 4BRSA 4CLRB 2IEBA 1YGYA 3U44B 4B3MB 2PUCA 7ABPA 4EYSA 4P08A 2Q5EA 3VHQA 1WSAA 4ND5A 5AM2A 2ZXFA 3FZNA 2PTGA 3BTVA 2AR9A 3AI2A 2B8WA 2IXTA 5M2QA 1P7PA 1JU3A 2O0LA 1K7YA 4CMEC 1A95A 1M2OB 2PGDA 1M67A 1QYWA 1P6XA 3ZDQA 1ZWKA 3MJ4A 3G7SA 4Q7MB 1AZSC 5A02A 3IVMA 2VF1A 5JI3E 5ER9A 1PZNA 2F4OA 5M34A 1R4AA 3DW1X 2AEJA 4ZU6X 3DBRA 3VB9A 1TQ6A 2CVOA 3D6MA 1XQYA 5D8DA 1PR5A 2B6NA 1B76A 1C81A 2BGTA 4L8FA 3PKZA 3HKCA 2I6XA 2FR1A 5EJIA 3SJAA 4YMLA 3WZMA 2BOVA 5LZ2A 1RJ9B 3DVAA 5E7IA 3V4VB 3ROQA 2DR3A 1JR6A 1MDBA 2DBQA 2X40A 4LQCA 4UNIA 3VYUB 4KUEA 1KTVA 2WW8A 2ZATA 3NETA 1CJTC 3RC9A 4O5AA 1G6Q1 5EEGA 3MHPA 3EQ2A 4UXIA 4JB0A 1I6LA 4E30A 2MT9A 1R0YA 2QA5A 3DD5A 5DBOA 4CUJA 3T3DA 2A4KA 3VAYA 2RKOA 3EVTA 2KW5A 5EQFA 5K51A 3U3DA 4CL1A 2XHEA 2WT4A 1WCYA 4EUEA 4XRGA 3SS8A 3WGYA 1NSTA 3BJRA 3NUGA 4M83A 2WZBA 4BX8A 5K8JB 3GD5A 1TKRA 4YYEA 2RKBA 4L15A 4J0FA 2IWHA 3U39A 4ZEMA 2VDNB 1T4CB 3X1JA 3OKFA 3ZU5A 2ZRHA 3TQSA 4B45A 4BO3A 2X2PA 3MXTA 5BOSA 4H1WA 1ORIA 1EFRD 1NDQA 2C3OA 2JI9A 2PPLA 2Q5JA 1XZDA 3E8XA 4MV9A 4RK6A 3UK2A 4IDDA 2QR5A 3ET5A 1CFJA 4DCTA 2I1VB 1K98A 4JP3A 4WCDA 1LBEA 4MWZA 4LC9A 1G3IA 1WSDA 3UQZA 3N53A 5LZ9A 2JBAA 5TPZA 4R40A 3ELYA 4DYHA 1THMA 1P3Y1 4X8LA 5ALDA 5GP1A 1SOVA 1IY0A 4UTRA 2BGJA 4BVBA 1FNNA 3VNQA 1Y37A 3LOQA 3KFLA 1ML3A 3BCSA 5HS6A 1EE9A 3F90A 1M7GA 1MZVA 1EX7A 1QV9A 3BF7A 3PNYA 3SHTA 3EQ8A 2B82A 2BELA 2FVYA 2V7WA 8ATCA 5ADHA 5ADWA 1KQ3A 4TTPA 3RT7A 3THXB 1RYHA 3VKFA 1TGYA 2CFSA 2Z5VA 4F3RA 4EL0A 2QUHA 3LVBA 3PD7A 1R3UA 3W7VA 4AO7A 5I4BA 1JYEA 4BDTA 1QVAA 2G72A 5BV2P 4NJOA 3UC5A 1H8EA 3FNHA 5FPYA 4KN9S 5K45A 3K6SB 1PV2A 3K70D 1X80B 4GSLA 3ZZMA 3Q8MA 4G9EA 2OOXB 1JDSA 3N2GA 1VQ51 2QTWB 2VBFA 4IIFA 3VOAA 4RFVA 4ARVA 5C53B 2I3BA 2AI1A 2BISA 3GAMA 1HFJA 4XW2A 2AJCA 1BC5A 3ISVA 1ZN8A 4ZI3A 1YB1A 1M6YA 1A9QA 1W47A 1YQWA 1ZI9A 3C6ZA 3EZLA 2YRFA 2PUBA 5EZSA 1J22A 3KTAB 5EZYA 4ZICA 3V4FA 3R3HA 2H0AA 4O1IA 4RK0A 4ZVQA 3GLGA 4WEQA 5IFKA 2K4MA 4NJMA 1DJLA 1NLZA 2YBDA 3ADKA 2Q5LA 4XVQA 2B30A 1P2BA 2AFIE 4X6YA 3QRWA 2KJQA 1YHQ1 1G21A 1MO4A 2P9TA 3EGDA 3TR5A 1CJUC 4MW6A 4GOND 1II0A 3BWBA 3HCFA 3GUUA 4RSHA 3WICA 1ZOSA 2IYAA 1J56A 2ZQYA 4IJ6A 3HP4A 2G0AA 4P9NA 2X4GA 3LA8A 5IP9I 2Q45A 3KR0A 3CVWA 3LQFA 1NM5A 3CCU1 1OA0A 3CX4A 4NBRA 3U9LA 3PXUA 1TLFA 1GO2A 2E0IA 4IY1A 1ISRA 2AD1A 2VWPA 4RMNA 5CDTA 1KH2A 2J5QA 3LKBA 2PX0A 1EB9A 3SZMA 2XA2A 2HDWA 3OWXA 3W9BA 1TQHA 1T4DA 3AV0B 4JXKA 3QVWA 1BEZA 5DXAA 1U11A 3UB3A 3DV9A 3OMXA 4F85A 1LBSA 1UEIA 4KZPA 4RGBA 4F3CA 1NVVQ 4REQB 4B47A 4KGVA 2CF6A 5BW6B 2WWHA 4RY0A 4O4JF 2X9NA 2X2OA 3ZV5A 4Z3DA 2FW1A 4JUBA 1LPSA 1JP7A 2BMFA 2ASVA 3K0FB 4FI3F 1UXOA 2C5FA 3W5VA 3ZYZA 4CCYA 2ACKA 4L73A 3WVNA 3NXSA 2ZUWA 2VHQA 4XUCA 2D74A 2N3ZA 5DNCA 2ZJ2A 1JIXA 2ODEA 5IBRA 3L1UA 1H85A 5BWMA 1I1NA 2PS3A 2WJPA 2P3OA 4QJ3A 4B40A 4WKPA 2OXIA 3ICQB 1C7ZA 5J58A 2QL7A 1U81A 1VQ41 4WK0B 1DJQA 3JAMb 3OZDA 3H6GA 1DFGA 3W6OA 1FYEA 3LZ6A 2AFHB 3OLCX 4YALA 1QC5B 3I1FA 2X3UA 2DSNA 3TEJA 3UAXA 3BWCA 3W77A 2GD1O 2QN7A 1M5TA 2HF8A 2ZDQA 4QUHA 5JLJA 5LP6F 1QH9A 2VDUE 1QO7A 1W96A 3DM9B 3ZNNA 1RRVA 2EF1A 5CX1A 2JNYA 1RZ3A 1LSOA 4MITA 3G5TA 4QGBA 1D5CA 1EE1A 1XDZA 3GEDA 2R92I 1OF1A 5DCYA 4C4PA 3HOYI 1GLVA 1XZAA 2XZPA 3KPUA 4ENWA 4X8MA 1XMPA 3G82C 1A2KC 2HO5A 2AIRA 4WCFA 1E89A 4HB2A 2WTBA 1NBHA 5IVIA 4NV1A 1QGYA 3IMGA 4L57A 1HMPA 2GXSA 4BV8A 5DEOA 4MGKR 1UR5A 5KU1A 2W00A 1AV6A 1VKOA 1SC3A 1XHLA 3TBKA 3MPUA 2G17A 1KQNA 1W85A 3FOWA 2V3VA 1Y1KE 3FBWA 1FLNA 1VSTA 3DSRA 1QS0B 3MJHA 2ANCA 3O0TA 5DNWA 2V0NA 1FTYA 3R7WA 3KKZA 4A16A 4XPZA 2PWYA 4EB6A 4YI5A 4DWVA 2AKYA 3X2EA 3QBDA 1IIRA 2HLPA 4JJ6A 2Z58A 4DY6A 1N5KA 3LLSA 4KDRA 4BJ1A 3FDJA 5B6IA 3SHVA 3R9KA 4RF2A 1G1AA 4OGLA 4Q01A 1VQ9Z 4S05A 2WINI 1R50A 4HZGA 2QRDB 1WB5A 3MMXA 3KFVA 4TWAA 4XQ9A 3AFIA 2AX3A 3C3DA 4Z2YA 5LA6B 4HUTA 1U7TA 2B1IA 1N5RA 3NIDB 4U7DA 2HIAA 1MGOA 1O95C 4ZQFA 1NL3A 3K6JA 3CH6A 4C5CA 1WO8A 3UN1A 1RCFA 2FJ0A 4EPXA 2PS0A 3WRYA 2KLHA 3UENA 3FDZB 3QU5A 3KJNA 2Z9DA 4YH1A 1QZTA 1RPAA 1S6YA 3WLNA 4HWTA 1XN4A 4PPQA 2C7QA 4ZCQA 3WGGA 3G79A 3JD3A 4ARAA 2A30A 4DM3A 1L7DA 1SHZA 1Z7YA 4FYMA 2C96A 1LLCA 1UPFA 2XYHA 1P4AA 4KWHA 1E3TA 4C3OB 4D57A 5C1IA 2NZUG 1N8R2 1GKKA 4TLBA 3DQZA 4O0LA 4TRMA 2HR1A 3S40A 2J0UB 3R5TA 1I4LD 2XWPA 3GQVA 4X8HA 4ZT3A 3RK0A 4NP6A 1F7UA 3BN3A 4K0KB 1QIFA 4MKGA 4HDOB 5IKPA 5KOJA 3IBGA 3P2MA 4HMOA 2O05A 2Y3IA 3PV0A 4R9NA 2F1HA 4DJDC 1LGYA 4OQNA 3UJAA 4V1CB 2I54A 4NNPA 3TNLA 3NYIA 4QBFA 3FFXA 4KXNA 4PGAA 1YHQZ 1H2YA 1L7QA 1VCMA 4WX2B 4C5BA 3N39C 5IM4A 1BW9B 1XKQA 5J4LA 1TGVA 3EXHA 5TDHA 3F6RA 4D9HA 4NAVA 3L79A 1I2BA 2IKQA 1PQWA 4I50F 4TTVA 1PDOA 4GOOD 1WZ2A 2VUMI 3H2GA 3LUHA 4GNKA 4UPEA 2D7JA 2YFHA 2ZI9A 3M82A 4J7AA 1OA1A 4UVDA 1O94C 1W88B 1X2EA 4Y2QA 3HK2A 3MT7A 1VQLZ 2VSQA 3R1IA 1Z0SA 4WADA 3KXIA 5E4JA 1ZXBA 1WUTA 1KOFA 2BFPA 4F97A 4UC0A 2F1OA 3D6TB 1HPLA 3HDYA 3RFVA 1VJ0A 2IP1A 4PZ0A 1L5YA 3HY6A 3R0ZA 4LTMA 4ZAVA 4PZYA 1YS6A 5CK4A 5IT0A 4D5GA 3AJAA 4I4TF 1FPMA 1DAKA 1KF0A 1KYWA 3F5QA 4WEOA 1U9ZA 2P0EA 4CPDA 3OWOA 2JL1A 1BNCA 1QJ4A 2EZTA 1SU4A 4JJIA 4AN1A 1NMYA 4ZC1A 1AN9A 4QSHA 1SZDA 2HK8A 3VNSA 4JAVC 5A05A 3DOOA 4CN8A 4EO7A 1M901 5KYWB 3KEGA 4Z9BA 1L5SA 5ADVA 4MYUA 3A1CA 3M1YA 4Y98A 4A2WA 3T3OA 1LK0A 1SCNE 3UY4A 3WDMA 1A2QA 4ND8A 4CCAA 4F0JA 4PXSA 1RACA 1IPFA 5DOVA 1VQ4Z 3T1VA 4XYEA 1FIUA 4M9SA 1CIPA 3FVVA 3VZSA 2QTLA 5JCOC 2YHUA 2OFXA 1YAJA 4XR4A 2A3NA 3KCNA 4G56A 4MDHA 4HLQB 3W06A 2UUCB 1IJFA 1IK6A 1L5FA 3E35A 3CCE1 3EXFA 2VAVA 1S0UA 3K2EA 1NX9A 3MT9A 4HUJA 3VMFA 1JHRA 4C4RA 1DGQA 1VRWA 4ALJA 1R4NB 4K6FA 2PH1A 5JJKA 3V7FA 3CRRA 1AKEA 3GUVA 4JDUA 2XQGA 1W5TA 2ZYSA 5BXYA 3OU7A 2NX2A 2RD2A 4KWCA 1V9CA 3QFTA 3V2IA 4M22A 4FP9A 4U4AA 3EY4A 2ZCVA 3QVGA 1DB3A 2PUAA 4N18A 4Y6PA 1N32B 1SIUA 3OX3A 3WG9A 1IHUA 4MVYA 1CG6A 3NHRA 1WAMA 1ODIA 2QLLA 1QUEA 3LQKA 2QA4Z 3BL5A 3HNPA 1YFJA 1T4GA 2P6PA 4DADA 5LP1A 1SVKA 3CN9A 3QTLA 4DDVA 2DWPA 1N2JA 4PCUA 4CL3A 4RDHA 2E9HA 2R2AA 3LW8A 1F51E 1YXMA 4ZAWA 3UYLA 3USZA 4U3JB 2IQ5A 2I2BA 2IELA 1OXMA 5I48A 1FS4A 2ZR7A 1SZCA 2JKZA 2Q29A 3AHJA 1F6DA 3LQ1A 4D5EA 4M0EA 1W5AA 1BH6A 3ABZA 5DYTA 3V8EA 2W5UA 4LDQA 2Z09A 5JQGB 5CLLA 5B3JC 1R0XA 1YRAA 1WLSA 4Q4LA 3IQGX 4MVJD 1TT5A 1M2JA 1RZRD 3ST7A 4IJ5A 3O3CA 5EKXA 3DFIA 1B6SA 3SX2A 2RHCA 3GJ8A 1WB6A 2IIVA 3CB2A 1MW9X 1E1QA 3CRW1 4MV1A 1FSPA 1U3UA 2PM8A 4LSZA 4OGFA 1K0UA 3SNHA 4HN4B 2CXPA 1MB9A 4MVJG 5C1OA 5GAJA 5C5IA 1UP7A 3FVWA 1E7QA 5EJEA 2E6UX 4MW4A 2V6GA 5KYKA 2OV3A 3IR7A 2Z9CA 3IPAA 5CAEB 4DBVO 1XGKA 3EVDA 1VRVA 3O75A 3DFUA 4JASB 1PBNA 5DMHA 3B51X 1OAAA 4EDHA 3BHJA 5A4DA 2FQWA 3FPKA 3M1LA 2ZWOA 3JYLA 3QY9A 5EN4A 4F4JA 4XUGB 2BVNA 3HB4X 2AKEA 1V8BA 3EBOA 3PC4A 2ZKIA 3NRCA 3OOYA 4YDSA 3T1YB 3N07A 4RIFA 3T1TA 4NESA 2WMDA 1J09A 1OH5A 2LCIA 2X7JA 2Y1OA 4WOCA 1EWKA 1YQDA 3KYDB 4JLKA 2VR1A 4LJ9A 4UJ5A 4Y2VA 1J2EA 1Z16A 3RTBA 1HK7A 2Y4NA 4F4HA 3NFZA 3FR7A 3GNSA 1SCDA 5IMSA 1FVFA 4GI2A 4M6WB 3ZD7A 3FMIA 3GP8A 4EF4A 1J8VA 1ZUIA 4Z86A 3KOXA 1IB0A 1IBLB 1N8SA 1EQAA 1ESNA 2WZQA 5C2JB 2YCBA 3E7DA 5G2OA 2IODA 1VOTA 3EDCA 3AXSA 5LQKA 2C5LA 4E2ZA 4L08A 2WTXA 2GN9A 4IEEA 1MNQA 2R6R1 4PAWA 5FBRB 4X3OA 3O95A 3E9RA 2NOAA 3PXBA 4KGZA 1XX6A 3TZKA 2V54A 3P27A 2IYYA 5EIBC 4LZJA 3EEDA 4XWKA 4YRDA 4QM7A 2WD8A 4LZAA 3WS7A 1G8KA 2P5YA 4PTLA 5JRDS 5KB3A 2BPOA 3BX1A 1ZD2P 3KE8A 4Q4HA 3CURA 3OZGA 3CR7A 2HX1A 5FTKA 1PHRA 2IF2A 4QWWA 4BNDB 5DFAA 1VQ71 2WSSA 2BW0A 4NTZA 2CV1A 3L02A 2NVBA 1M1XB 4R1UA 1NMEA 4ZZ3A 1KK2A 1U8XX 2DOKA 3ZWNA 5C8ZA 4UHBA 4UDYX 3U26A 5JYDA 1SA0B 2SHKA 3JAWB 1R0BA 2QMEA 3F1KA 5JHHB 4F9GA 5T8KA 2YWFA 2FN3A 4AZ3B 3EA0A 2VUIB 5BRAA 4RVOA 1SVLA 1OTXA 2NM0A 1XF9A 3LLMA 2W2MA 2WM3A 1ISHA 1BFKA 2B69A 3KZMA 5FLXf 1W5SA 3IODA 4GPZA 4RESA 4JD5A 4LXUA 5B1DA 4RVFA 5TPWA 5JSFA 3OMWA 5EXEA 1FPQA 4JR2A 3WO0A 2Z6QA 5CM2Z 1V5GA 5K99A 1RYMA 2NU9A 2Q3EA 4I1SA 4IO0A 2C77A 4UNQA 4YJKA 1W4CA 1T9KA 3PU6A 5EP2A 1PHPA 3LZCA 2Q4OA 3FLAA 4RPIA 4WXMA 3AIKA 3PDIA 3L4SO 2NO0A 4XJVA 4D2IA 3N76A 1FDRA 4DA0A 2IOQA 4CF3A 3FZQA 1J97A 1SU6A 2FWNA 1KO1A 1GRQA 1LLDA 2GOYA 1UWCA 2Q3CA 2VP2A 3EE6A 3I8SA 3IXQA 1TCBA 4YGYA 4YMSA 3O03A 3LUKA 4NB9A 1I7SB 2P28A 3NT2A 1VLJA 1GZSA 4MRRA 4R6XA 1YJNZ 4PZEA 2RONA 3D2AA 1JH8A 4DQKA 2IHTA 4CDGA 3G49A 5HIIA 2OXFA 4HQNA 3NT5A 1FLVA 1W4RA 4HNAB 5EZ6B 5JSKA 5TMEA 3UUGA 3KLBA 1XZEA 2CN1A 1ZS9A 3EIQA 2X0DA 4DY4A 1U8EA 2HRBA 2XCOA 1N33B 1QE3A 2IX9A 5GVSA 2OR3A 1XPJA 4IIVA 4LN1A 4FYJA 5T4BA 1HA3A 1OZGA 4HDSB 5HWSA 2F7SA 4UEOA 4KU4A 1N2EA 3QU9A 3W1EA 4AJ4A 4QAJA 5ERYA 5FJIA 2QPLA 1Z4JA 1Z62A 4L8VA 4ZXPA 5K8UA 5KTMA 1DG3A 1BCRA 2ASEA 1NV8A 3KJQA 1TFIA 3IQZA 4KE6A 3E9EA 4FIDA 6ADHA 5ILOA 2BM1A 2GA9A 1J9ZA 4M0MA 3L7NA 2F8LA 5ICEA 3FYHA 4J94A 2AA3A 1Z5WA 1DXHA 4H0FA 4N47A 3VO8A 4BQI