2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
2GTHA 2OZKA 4RS4A 2RHBA 2H85A 2GTIA 4S1TA
chains in the Genus database with same CATH superfamily
3NM4A 4MKGA 4QGGA 3C4JA 1W36D 2N1BA 4KAAA 4S2UA 5LNK6 3R3SA 2C20A 3JQ8B 1K88A 1TW2A 4J4HA 1I2DA 2OAQ1 4L5BA 1VQMZ 3VKUA 4HAUA 4M7OA 2O2DA 4B4OA 2HWUA 2R85A 5GWXA 4F2WA 3H5TA 3JATB 3ZY2A 5CFRA 1MO6A 2OAEA 1Y1RA 3HJNA 1JBQA 4GKBA 5DTEA 3CCVZ 1U7PA 4B7ZA 4ED9A 5BSGA 5L3SA 2A1IA 5CVVA 5EPOA 2FN4A 1DFIA 1N3YA 4TKUB 3FTPA 4RD3A 3LBNA 5FBWB 1FMJA 1T0IA 4ZYTA 3H17A 1QE5A 2PAFA 2E7ZA 3FMPB 1MKYA 2ODTX 3M5PA 4HDCA 5AOVA 3RQSA 4D42A 5BSRA 3PWSA 2OKCA 2LXNA 4CIXA 2G0TA 5GM1A 1A7KA 1CUBA 1RS0A 3WADA 2GOYA 1GQFA 1P2DA 2I4LA 2REQB 1RC0A 3FPFA 3VZPA 2HA5A 4EKEA 1PT7A 2G7ZA 3LQ4A 3HJTA 1LI5A 4PQEA 2Z83A 3OT1A 4S1VA 4ZT5A 5IJ9B 3L8DA 3VTNA 4DGLA 3PXUA 1U7DA 1RWBA 5HKAA 4UC0A 4C3UA 2IXDA 1Z03A 5FPHA 4RZIA 3CNOA 3KQUA 1GSOA 3LVRE 4MWBA 4PQFA 2VDVE 2B9VA 2BKLA 3O90A 3ZDFA 1U11A 5BORA 3V32A 2Q99A 3LC1O 5E1BA 3HB4X 2QLVB 4DCNA 3HOWI 3OWXA 4D92A 3T3HA 2X4DA 1LBHA 1Q0LA 1JJAA 3KE9A 4MI6A 3GGDA 2W83A 3ODGA 2VT6A 3AU9A 2GRJA 4NCIA 1XD8A 3ZHZA 4TXLA 1E64A 1H2WA 1YS7A 1I24A 1UEIA 4JASB 1XLUA 2VLIA 4Y6LA 1EGVB 2FFQA 4EENA 3CCCA 2D0OB 3FPSA 4BTEA 4OHFA 5HQ3B 1R16A 1IJKA 2SHKA 2BSAA 2JAOA 2LGJA 1QHHA 2R6FA 4C6RA 4TSKA 2C5SA 1XROA 4I14A 3GKQA 1E79A 1FEZA 1NSFA 3M4YA 3G7UA 4FOTA 4TM7A 4ENTA 2VJAA 1UXKA 4MJ3A 3I01M 2OBMA 4KUEA 3VVLA 1MQ9A 4KIUA 4IZOA 4YQEA 1D2HA 2YHIB 3VVBA 1XNGA 1OFUX 2IZ7A 4I6JA 1VP3A 2BGNA 3W4IA 2O3SA 4AT1A 5LLTA 2WJVA 3L84A 3LUAA 4HPWA 5LMZA 4NF2A 1E9AA 1ODKA 1P3DA 4XJXA 5BNWA 2N0SA 2GNOA 1XPJA 4GWLA 4N03A 2OK7A 2B83A 5DISB 3UAZA 2W2XA 3GARA 5FPTA 5T4EA 4ESVA 1W76A 3V8VA 3EW9A 3MT0A 4NNJA 2AOWA 3QUSA 5CDSA 2JFVA 5KOIA 5JC8A 2XODA 5LVAA 5K99A 1KH2A 1DIRA 3DS8A 3AF1A 5MN5A 1U2PA 4MRIA 3GFGA 3HVKA 1IY0A 4FMPA 4GPAA 2GN9A 4JLUA 4MV3A 2AJBA 2EFEB 4XWOA 3TW8B 1Z2DA 1WP4A 3HB9A 5D1NA 1OBFO 3DW1X 4B81A 4CFZA 3GA0A 5KNBD 5I3ZA 3UTDA 2OLJA 5CNJA 2C9BA 2QMUA 4E7OA 4EFNA 5BV2P 3OIYA 4OB6A 4TV9F 2FPLA 1WCMI 2WFLA 1DJMA 2KLHA 4IBOA 4Y2SA 1GPUA 2C2BA 4J16A 1E5LA 5K3SA 1PV2A 1BYUA 1VBFA 1KQSY 2AX4A 1F0NA 3AR6A 1VQ81 4LJ5A 3IVRA 2GEDA 2GWRA 4X60A 4H18A 3OLCX 2QV7A 2VIIA 4O02B 5E7QA 1V2GA 2HWWA 1GFWA 4NCHA 3FIJA 1VSBA 3HCDA 1J4AA 2QRVB 1H6DA 2W4IA 3E5RA 4GKAA 3T12A 3Q3JB 5JNUA 5CXUA 3IMCA 4ENWA 2UXBB 1Z75A 1L7RA 5DV9A 1XTJA 4DNFA 2JW5A 1OQAA 3LC0A 3CCMZ 1Y9JA 2CLLB 3FGNA 3PEUA 1YJXA 4KACA 3UKJA 1I0IA 3GJ7A 2JRCA 4MPPA 2D1QA 3W8RA 4YR9A 2OV3A 1Z83A 1ND5A 2OD9A 3DV0A 5ALSA 2HPZA 4N39A 4BMNA 2AG1A 4JH0A 1IM2A 1SIUA 4FMBB 4CT5A 3DYVA 2Q51A 1E3WB 3JALB 3C98A 2EJBA 3ITNA 4Q5IA 1E98A 3RVMA 3IT1A 2NXNA 2I2FA 4U2CA 1P9RA 3MG9A 5FR1A 4L2IB 1HDEA 2JBAA 5E6RB 4B3XA 5BSVA 1TM5E 2Q5EA 3VHLB 1R6BX 3H1GA 2GJ4A 3FPBA 2X14A 3L8MA 3RREA 4YDRA 1U02A 1T34A 2MSWA 2ZIFA 3IT2A 3PNOA 1OX5A 3BTOA 1QIHA 3KYDB 1USVA 2DJ5A 3L6CA 4NC9A 1XHEA 4OUKX 3X1MA 4YHHB 3IUEA 1Y4SA 3LHDA 4G5OA 4IIYA 2IQIA 1J24A 4H31A 4ZDKA 3N0VA 4YRMA 5JANA 3E8XA 3F5QA 2OC4A 4C7OB 4GLOA 3OEHA 2GAJA 2CDRA 2V7GA 3H11A 2P9GA 1H4VB 4WSOA 3IBYA 4MQEB 2BKXA 1Y3BE 2D5CA 2GEBA 5D5QA 1YIAA 4LYEA 3HNOA 1RCTE 4DQYB 2R6ZA 4MX8A 2E4YA 1RJ9A 3SJBA 3BGDA 4JCCA 4EARA 1IQPA 1N1MA 4JP5A 5L4SA 1LBQA 3O8OB 4JLKA 1YS1X 4ZAZA 1VJGA 3B6KA 3MJHA 5DNEA 1VQ9Z 1RR6A 5J2TA 4L8VA 4MV0A 1Y7IA 5CFQA 3QWAA 4L3VA 3S8EA 3BGOS 2VKQA 4G24A 3A4IA 2QN1A 3Q3IA 3MSCA 5I9BA 5TEWA 3VPSA 1GUYA 4XDHA 5LQRA 2WKQA 4UEKA 4UFOA 3ZNQA 3E70C 3LBIA 2RB5A 1NRIA 1LZKA 1OF1A 2YY7A 4LOIA 2H1FA 4Y2TA 3Q7TA 2YKGA 5C5CA 2J5XA 5HDBB 1ZCAA 1KI4A 5FORA 2XNKA 3PTZA 1Y1KE 3COYA 4HLUA 5JD6A 4A27A 4KQ1A 1Q15A 1V1JA 4GXRA 1YTUA 4NMMA 2H00A 4PLGA 4DG8A 1RYNA 1KK2A 2P0YA 3BQMB 2YHAA 3PGKA 4FGJA 4ZAVA 1L5NA 3UJDA 4DJ5X 1VC2A 1BG6A 3IAEA 3RUEA 1B8VA 4OKSA 5FB3A 1UANA 1QVZA 1EB9A 2YCBA 2C83A 4LVCA 4PO3X 5EMNA 4F72A 5K0BA 1F2UA 3IBSA 1QRSA 1QDUA 1OYWA 3PDJA 4F71A 3E2PA 1ZRMA 1KTVA 3LQFA 1CF9A 4HUTA 3DW3X 4XWTA 1OYOA 2Q3BA 2R5FA 5GJBA 2V9PA 1P7VA 3PRKE 5AXBA 1VLMA 2CNKA 3CCQZ 3KFLA 3UOGA 1QVGY 3G9QA 2IZ4A 4P5PA 4TYQA 4YDHB 4A3MI 1TX4B 1LLCA 3WQRA 3LYAA 1O08A 3NEPX 4FCTA 4OFBA 1VA4A 4U9IS 3DCIA 4O6VA 4RJJA 3FWKA 4NU8X 3AEYA 4PZDA 2GWHA 4K46A 3EN0A 1ZD8A 3L92A 5CJPA 5F78A 3T7KA 3GAFA 2RHGB 4MRMB 4LV5B 1PL8A 3RU2A 3AOEC 1UBFA 5DTIA 5BWBA 3KWLA 2W6JA 3AI3A 5AICA 3WKAA 4PG8A 5LIPA 3E6AA 1DKPA 3EA5A 5AW1A 1I5EA 2PKRA 2XB6A 4IL5A 3O1IC 2WJYA 4I50F 1GNQA 3KQWA 1OYVA 2VCYA 3ZIUA 4BC0A 2I4IA 4WECA 1PO7A 3SMVA 5AQEA 3SJZA 3GFQA 1WWKA 1WZEA 2GRUA 4RGYA 4QT0A 5HJ2A 4YAFA 4PRZA 5TVKA 1IJEA 1C8KA 4JB8A 3UWDA 4DIBA 4Z4FA 4ZQFA 1ONOA 1KMNA 1U0HC 5EYPB 3IC5A 4Q82A 4QUAA 4OVKA 3OZRA 4NNPA 3R0VA 2B30A 1U4NA 1KEVA 1OJ7A 1B8UA 2JGEA 3N2ZB 2VNHA 2V3VA 2X76A 3M4ZA 3ZCQA 1N9ZA 4UHEA 4UFNA 1LPOA 5LQUA 4ZK6A 3TW6A 1TM3E 4RD2A 1T6BY 5TPWB 3VR5H 4IHJF 4LBVA 5IM4F 4H3HB 5FLXb 2WWHA 2PK3A 2RK3A 2OGSA 5C5IA 3JTMA 2QG6A 2BTEA 1TWCI 2QNBA 1HBJA 1V48A 1WDLA 2HSWA 1SUDA 2WC1A 3ETDA 1GUAA 3SOZA 5ADUS 4N47A 3MZ0A 2O4CA 5KVCA 3OFVA 2Y0BA 1N5IA 1XXHB 5EJAA 4NABA 3WGJA 5BR8B 3I1YA 3JQAB 2YH2A 3PQ3A 1CEXA 4WCFB 2PNJA 1M5UA 1NW8A 5FP0A 2Z2YA 4EB6A 3RT9A 3T3NA 2LDXA 1PHRA 2PZLA 2B0CA 3UPTA 1F8GA 3UK2A 2XZLA 4V0NA 4HL6A 4XGIA 4OU4A 1KZ4A 2J33A 1DBWA 3COJA 3OU2A 2R97A 1PUJA 3MWEA 5KUTA 1JSLA 1N1GA 5JQGB 3DZCA 1MJNA 2EW2A 4KLAA 3ZE0B 4B7UA 3N2YA 3OKPA 3QJGA 2MINA 4KUHA 5CIWA 5FQNA 2Q5CA 3G0CA 3KE8A 3WG9A 4KO1S 3RRBA 2XGGA 1BX1A 3AR9A 2VZ8A 1C3LA 2QN9A 4W1QA 1NJ6A 5SV2A 3CLVA 3SGLA 2WDPA 3EDCA 4TPKA 2NT3A 3I32A 5LQAA 3BWYA 1GV1A 1TUBB 3Q7PA 4LDJA 4A0SA 1Z02A 2ZAGA 1W36B 1PEDA 2BBWA 1YVUA 3MS7A 4J8PA 4OH7A 4WCVA 3JQGB 4JYZA 2UYOA 2VPPA 1T9BA 4QYMA 1K8ZB 1KU6A 4FYXA 5IKOA 1G6HA 2OAGA 1L4EA 4LHEA 2GHIA 4L0QA 2QNRA 3UAWA 1ZN8A 1F12A 4Y0NA 4LSWA 4FIZA 4DQ0A 2EHDA 3UHOA 4E5MA 1F5SA 1XLVA 1RRGA 2I6SA 3BE6A 3ZLTA 3GY0A 1E1DA 3KEFA 3L49A 4PNZA 5DM1A 1U2QA 5TGDA 5AM2A 1DEHA 3IR5A 1IEWA 1NOKA 5EHXA 4X85A 1U5CA 1CQJB 1M1XB 1M1YA 3GK3A 4DJEC 5B36A 3O75A 4B3CA 3RUDA 5C5EA 2FMKA 2V7PA 3S2DI 4G4IA 4RZQA 3SN6A 4AY3A 2VEDA 4L5CA 3MMZA 2KI7B 5AKLA 3TECE 1TA0A 5JTTA 4B4DA 4JI6B 1RRVA 1YR3A 5IUKC 4PC1A 1Q7BA 4PTZA 4F7DA 4YIHA 3SM3A 5A9SA 4WN9A 1N6RA 1Z07A 5IEJA 2IPNA 4KDRA 1AK1A 4X6AI 1MB3A 1MCZA 2VSXA 3ZTTA 4ZVRA 3U7FB 3C1TA 1I50I 2B34A 2FWBA 5BWMA 4GOXA 2R2GA 4K9MA 2GD2A 4GD3Q 4NFYA 2CFIA 5CG1A 1HYEA 1SIBE 1U2GA 3CR8A 2IYSA 5FTMA 5IX8A 1MOZA 3UA3A 2YC2C 4KXXA 1GGVA 1GGJA 2XZDA 5D8DA 2GKSA 2EZUA 4NI5A 1FFEA 4MS4A 4XFDA 5I7SA 5F4BA 4YRGA 4N3NA 1GV0A 4GOMD 1P45A 4D02A 4GPD1 4MA4A 4NBFA 1ORRA 2RHDA 4HGRA 4KR0A 4TTRA 4OX9Y 5FNVA 3C6BA 1XAJA 4QNMA 1SUAA 2FMFA 4GZ3A 4G0UA 4B76A 5BQXA 3N2KB 4C2BA 1Y5IA 6CHYA 2JFNA 2JA7I 4P35A 1NKTA 2FDXA 2PWBA 5LP6C 3ZEIA 1TWAI 4LWZA 3R2JA 4O3FA 4F06A 1XYVA 2H8GA 5C52B 2HT1A 4Y6PA 3G4S1 3I55Z 1N2BA 3UAVA 3WLOA 2Q4RA 2DSNA 2W2TA 4TKVA 3MNFA 4RJKA 4AN4A 5L4NA 4DSZA 2ATEA 8GPBA 4DAOA 4R1PA 1R6AA 4XGKA 3CW2A 2JLRA 1QC5B 2B7CA 4ZPXA 1U8EA 3GT4A 4DA9A 4NCNA 1HNXB 1UQUA 2JLAA 3R4VA 3LYHA 1WXGA 1KEKA 1YGPA 5F9FA 1ZUHA 1DRKA 3MC1A 3I72A 4DLVA 5DN9A 1QQAA 3BMOB 4BMCA 2RARA 2H2AA 1N78A 1LV7A 1L7OA 2ZJZA 2BR4A 3W78A 5HJ5A 1JQLB 4WNCA 2F43B 3EOZA 4QEKA 4S0ZA 1YXMA 3W2TA 4AF7A 5FXMA 1M73E 2X3FA 3RSZA 4K9PA 1RSZA 3JVEA 3KQTA 2VUGA 3KQMA 3DDUA 4NHOA 5FI5A 2OXTA 3ZGOA 5IPFA 1L8XA 3JCZA 4RS4A 1QLHA 3JQPA 1P91A 4AVYA 1WL8A 2AOTA 2WHPA 1NV8A 2JGJA 1A77A 3DOOA 2YMLA 3KSDO 2C9DA 3N75A 4O2RA 4ILEA 2EKZA 3N6XA 1YJN1 4OJQA 2JH9A 2C7VA 3PCXA 4X7PA 3KCNA 1T43A 4KB5A 1D5CA 1U8FO 2PMDA 3AR4A 3IP5A 3CRRA 2PKWA 1YDHA 3KR9A 4QYIA 1H69A 4G23A 3TMAA 4PQGA 4EHKA 2D5IA 2PRSA 4LZNA 2OBYA 2W6PA 3V48A 1KMMA 4BL5A 1GSAA 4B6GA 1OA1A 2DSTA 2FW1A 2IY9A 4RSRA 1QLWA 5B2ZA 3O8NA 5BSMA 1FLDA 5DDIP 5L53A 2D4AA 3VM6A 1KPIA 3GWZA 2RGNC 3K5HA 3EWNA 2VDMB 1WHSB 1G38A 1H0RA 2FR1A 3WIUA 1I01A 2R7NA 2JAQA 1SCIA 2V4ZA 1I7NA 1AUXA 3K92A 4BLUA 4D9MA 2ZSFA 1LVGA 2I80A 4KIFA 2Y4OA 5TF0A 2PWZA 3GTKI 3ISTA 4D80A 3HBFA 2C88A 3DZGA 3INGA 5KWIA 1T3TA 1AQ6A 4I1PA 2MYNA 2VDOB 4EA9A 4MV7A 3IV6A 3UA4A 1QZXA 3ZQ6A 4NOJA 5I4CA 4LV6A 2QRCB 1T2FA 1CUEA 1PR5A 1NX6A 1C2TA 1REQA 5D51S 3RHZA 4MTCA 1KS2A 3AL2A 3KXKA 4JJ6A 3PPYA 1U6IA 1SKQA 1D6JA 3EQ7A 3MT9A 4JS0A 2QQEA 4QBIA 2FWJA 4QVKA 1J1UA 3LS2A 3I9V6 4MVJG 4CR7A 4FE3A 4LBWA 5T6BA 3RI3A 2HJHA 5K6AA 2FVXA 3ZGXA 1DKRA 3DMDA 3MAAC 3WYGA 2IHNA 4XYBA 3ZXXA 2AG6A 4Q4HA 5CUQA 5BWCA 3W5AA 3JAWA 4D45A 4ZEMA 2VHVA 3QZUA 1E2GA 3K0AB 3V1MA 1DXOA 4IKOA 1NUAA 2XDQA 2QVXX 5CM2M 2NU9A 4TL8A 1T1RA 3Q7SA 3MVEA 3MUEA 3WYNA 3ZHQA 5KJCA 2HF8A 1CR0A 2M6RA 3RVNA 2Q07A 3RBVA 3MLEA 1G8HA 1PGOA 3PP8A 4BCBA 1QVVA 3TM4A 1Z2OX 4HCJA 2HU9A 1A4XA 1TZMA 3F6CA 4KMRA 2P2ZA 4L8LA 4ZWNA 1YZYA 1YITZ 1JEDA 2XIQA 3I04A 4JBHA 5LBIA 3CD61 1ADFA 1JSCA 4ZYVA 2BELA 4G01B 1OREA 3LTNC 1S7GA 2WFZA 4DB4A 1II0A 3UANA 2E85A 4RVDA 4EL0A 1TTTA 4CKEA 3E2MA 3KKQA 4MGIR 2ZGVA 4M9SA 2FKAA 4HOYA 2VP6A 3SQMA 2IHBA 3I76A 3IQWA 3DNPA 3OF5A 5JIBA 3RRXA 2DZDA 4BGEA 4PXSA 3HXTA 4EW3A 3DZBA 2V3WA 3C3WA 1VQNZ 1GN8A 5T41A 3CVUA 2A5DA 2RGWA 2P9HA 3A26A 3AYZB 5F5NA 4YLGA 3UBTA 4G1FA 1M1NB 4HB4A 2COUA 2QKDA 3V2GA 3UWOA 3RUHA 1UAYA 3DOEA 1JEQB 1W9HA 1AZLA 1OV4A 1XTIA 3HKBA 3LD9A 4MDYA 5DWDA 2QTRA 5EI5A 4QOFA 2VWPA 1E2KA 1Y3HA 3DE1X 2XMGA 5FADA 2OESA 4C88A 2BCJQ 3OPQA 1L7AA 4FI3F 3WRWA 3C14C 3DM5A 3OPYI 3VTKA 4EPWA 2KBFA 2SNIE 4BAZA 3KEMA 5BUCA 3HLKA 3W6OA 3QLJA 4LRXA 2MT9A 3IAFA 3KJIA 3MA0A 3BVPA 2J6HA 4X7RA 1HDZA 2G88A 4KFUA 2I2AA 1Y9EA 4MP8A 4OPMA 5ER9A 5KSOA 5M2QA 3LE8A 3O9VA 3FD8A 5C4GB 3VR6A 4RW0A 1V3UA 4RJ2A 4W1PA 4CM6A 1O54A 5EIHA 4QO7A 2AD5A 3EVFA 3QUCA 5IJ0B 5KOHB 4KFSA 4R68A 4KXUA 2X7JA 1XAHA 1UK8A 2IP4A 1P1BA 1OC2A 1AXEA 2O52A 1WXEA 3K1YA 4FFVA 4OJMX 4WASA 4ZRNA 2HDNB 1Z5UA 2J07A 3VX4A 5HUJA 4DXHA 4KR7A 1E6CA 3FPJA 3CF2A 4QFMA 5C8YA 3GTJI 1RHKA 3TKAA 4B6FA 4FLEA 3ZJUA 2O1SA 4C5AA 4EG5A 3WJ1A 3GLIE 4O4IB 2IW1A 3VC7A 3IEMA 2WTUA 1D4FA 5F51A 3QFSA 4YT4A 1I5OA 5AHRA 5C46F 4UMFA 1OV6A 4RTNA 3OZVA 1T3HA 3PWTA 4JLWA 1LX7A 2A5JA 2JA1A 1WOYA 1QK5A 3EGEA 2Q9BA 1D6MA 3K0BA 4FUTA 5DX8A 4BMDA 2Y8EA 3R8XA 1K89A 1R4AA 3Q11A 3M7IA 2V8BA 5GINE 3V00A 4KWIA 3H84A 1ZXBA 3H4MA 4PGGA 5E4TA 5DCUA 3SYKA 2R6HA 2R66A 2WIJA 1JU3A 4OAPA 5A05A 3EGVA 3TQCA 1LBEA 3RIYA 4IH1A 1T5HX 1XZFA 2DQ4A 2LEXA 2NPIA 3O74A 2DCMA 1X70A 3PHGA 1PG0A 4OFZA 4BS9A 1PWHA 3GTPI 4DHEA 1JU9A 5HXAA 1H1LB 1SZCA 3TDKA 1ISMA 1ZCFA 4FJ2A 1JU4A 3TBKA 4LF5B 3R24A 1FOEB 4MW7A 3TAHA 1KQSZ 3AINA 2ANCA 5E2AA 1ADJA 3ELBA 2FSSA 4WUTA 2CK3D 2F62A 4DCUA 1FSZA 1XNJA 4H4EA 4JGBA 3ABOB 4X44A 5JV5A 4GSYA 3G5TA 1P7YA 1GT91 1XQVA 3DDWA 1AX9A 1UFOA 3K96A 2C78A 4UKDA 1JIUA 3QU9A 2IWRA 3WDLA 2ZWPA 4GNKA 2UUPA 4MMZB 3SPXA 4ER7A 2Z6UA 2JA8I 2GBIA 1SWVA 4FGWA 4F1KA 3DAHA 2XHZA 2KJQA 2ZXUA 5AHKA 1EAYA 1MQ8B 4KPFC 5T7BA 3KB1A 5H9VA 4EVIA 1FYFA 1G66A 2EXXA 3WYEA 5B3AA 4HVCA 4H6VA 3BWVA 5TQ0B 3UAXA 4A3KI 3CG0A 3T5DA 1KYVA 1U2EA 2ZBEA 4ER0A 1QPZA 1E6EA 4GXQA 2H0RA 1ZM3A 1QYRA 1SWWA 2P9TA 1P1FA 3AFGA 4BDSA 5MHTA 3EVCA 1KQFA 2WVHA 2H52A 3EF3A 3JQ7A 4JGGA 4R7TA 1TF5A 4FFSA 2EGTA 3UNXA 2FUEA 4IF4A 1RM3A 3C85A 5LLDA 1X1EA 2PWAA 5KPDA 4JI8B 3DEHA 1ZFNA 1ZICA 521PA 3S81A 4IFTA 1KDZA 3PJDA 5HDQA 3PC8C 3DKRA 3HDVA 1DEKA 3NM6B 4AZ0A 1SD2A 1MEJA 3WC4A 2YHUA 4L72A 2ZRJA 3P20A 5FH9A 3VAAA 3TZKA 3KHKA 5TX7A 4ZO7A 1PBNA 3AJAA 2NT4A 1N0UA 2WPDD 3LDGA 4IXTA 5CW1A 1PNOA 3LKDA 4R51A 1SCDA 3IOBA 1CV2A 2J7PD 2M1XA 3FWHA 4IIHA 5DW3A 3KAPA 3JQEA 4FS3A 5AK5A 3NRJA 3OPYA 1RI2A 1B23P 4RD0A 5ITVA 1F2TA 1VL1A 2IYAA 3DDSA 1BYIA 1OAAA 3H9QA 1UOOA 4G1MB 4IGKA 4KPGA 4P08A 1GQOA 4KBFA 3NHMA 1TEVA 1F17A 1LXCA 3CH4B 4V0MA 4EY5A 5K3BA 2V7EA 4GL4A 1JECA 4OM7A 1COWD 4WNIA 5H16A 1SHKA 3CCSZ 4DMMA 2NTEA 2H9IA 2Z9BA 3KYCB 3TE6A 4Q12A 4GIBA 4DIMA 4RWEA 2OHXA 2B1GA 1N0HA 3TLCA 2YZMA 1T8PA 1RIIA 2AFHB 3DAYA 3HRKA 3F9IA 4V38A 1SIOA 4C08A 1J1ZA 3I2GA 5FNZA 4A5OA 2J3LA 3IKMB 5B7PA 1NMQA 4BBZA 3TL6A 3ZGVA 5CDYA 2XITA 1MXHA 3PYXA 3OLYA 1VG1A 1YI21 3E35A 3BOSA 3EH1A 3M1IA 1D4AA 4KQHA 3SSOA 2HRDA 1PR6A 2PGJA 1KK0A 2X0JA 4Z6KA 4AF6A 1VSTA 2BKEA 4CUKA 2OSBA 4Q1CA 3CJTA 3BZWA 1C7QA 4C4TA 5THKA 1EU1A 1W581 4LX8A 3ANYB 4U2GA 3KZVA 5JMWA 4CGYA 5GVSA 4ZCIA 2WFAA 3TW4A 4V0ME 4MO9A 1I2MA 1BA3A 3D3KA 2PAAA 3OTOB 2XWPA 5DSZA 1ZVVA 1Z88A 4C0LA 2YXBA 3H3FA 1QVGZ 3G5MA 2ZBQA 1G8GA 1VJCA 1FNMA 1ADYA 1RKXA 2JJ1D 3OX3A 4X6LA 3EXEB 4MVJD 1RBYA 1P4AA 2PH1A 4GPZA 4ILKA 4KO3S 2YASA 3NX4A 1G55A 4WXRA 2H63A 2MYTA 1EFVA 2CJFA 3LQ2A 4G67A 1V7QA 1JT2A 3H1PA 2QA4Z 2J9GA 3O3CA 2Y4NA 4PFQA 3SVTA 3UMRA 4BLRA 5LU8A 4L6IA 3OIUA 2EZ8A 1XVUA 3OFSA 1DDIA 2O8EA 1XZDA 1LQUA 3DFFA 1TAQA 1EFKA 3CCFA 4ER3A 3LRPA 4YAUA 3OPXA 4NG5A 5D00A 4DIOA 2KSQA 5EXDA 1V39A 4COOA 1CVIA 4HQNA 1PEKE 5AM0A 4EGQA 1Q861 2Q4EA 3L40A 5DHAA 1ZVKA 5AKXA 3WLMA 5JZBA 2O59A 1SU7A 2GYWA 2ZCVA 2ZE6A 3E8MA 2XE7A 5CPBA 2H9YA 1XKQA 4R1OA 5GTDA 5IMSA 1P1JA 2YW2A 2DLDA 4QJ4A 3QVSA 2PT7A 3OG9A 2IXFA 3K9HA 5HBRA 4D4IA 1XAGA 1W5EA 2QENA 4M54A 4MWSA 3ORHA 4ZEOA 3UXMA 3VZDA 1P0FA 1N1DA 4BB6A 2RIQA 1O5IA 2AXNA 2GERA 4LJ8A 1A9PA 1W75A 3KYIB 4CMIA 1EDBA 1JT9A 1EFAA 1C3EA 2ZT8A 3NH8A 1EBUA 3M6VA 1RYYA 2EWVA 4JYPA 4MV9A 4MYUA 4B71A 4WWHA 1PJZA 1HSZA 4R8VA 3VNSA 3ZNOA 4ZOQI 3TZLA 2J0QA 3DNMA 2GA8A 4MA5A 2C5AA 1HT2E 2H4JA 3OCXA 4CLOA 3AHFA 3HZZA 3IUBA 4RDXA 3NBQA 2JFXA 1K9M2 2IFTA 1GG2A 2ZVPX 3D59A 3HADA 4EW2A 3E18A 1OPRA 2WV9A 3AEKB 5JW6A 3ROKA 3QKSA 4JVNA 4WOBA 5ECYA 4DRXB 1ZC3A 3RJ5A 4ETWA 3QK7A 3QLVC 5A3QA 1JAZA 3NGXA 3HBNA 1TCUA 3GRZA 3FUWA 4IKEA 1A4IA 1L1QA 2GZAA 1QV7A 1FDRA 2XOKA 2X9VA 1U4OA 3EFEA 3SCZA 5L7WA 3IUJA 2CVFA 5CBPA 2ZIWB 1AS3A 4L74A 4P32A 3CVWA 3G85A 3FTQA 2IP1A 1RBMA 1B0PA 4F4UA 2P5YA 4YMWA 3EXIB 1AD2A 1OFTA 3G2MA 2PZMA 1TT7A 3VOAA 4CV1A 1ZU4A 1DKUA 3VGPA 5KKNB 4DSOA 1YR7A 4PHHA 3RAEC 4TT3D 5TPZA 2R6AA 3M1YA 1QQBA 4EL5A 1QZTA 4E5VA 1G6Q1 2BVNA 3NAMA 3WHLA 3AMVA 1HH4A 4LYAA 4XLTA 4BJ5A 1ZXXA 4C4RA 2HXYA 2M32A 3OC6A 3JQ6A 2MHCA 3OQMA 3O03A 2XA1A 3INRA 3O91A 5JEEA 2Q9UA 3VC1A 4QTYA 2HSJA 3WMRA 1KI7A 3VR4D 1G4AE 5HCIA 4XR9A 1H4QA 2XRZA 3OM9A 3LGXA 4XFKA 3ZV4A 2I8CA 2B2XA 3DSRA 3BZBA 4QDZA 4BU1A 5CPFA 5AVQA 1NVKA 3CJRA 2PBRA 1GD1O 2C5GA 1P73A 4GLLA 5AD1A 3T1HB 4QQNA 5H83A 4LJAA 4YO8A 1AOXA 1G7SA 3OFJA 5GOZA 5HUHA 5I51A 2FWNA 1UJ6A 3NKVA 4KGVA 4JEIA 3TE5B 4ZVUA 1ADGA 3HBAA 3HEMA 2PBLA 3B6MA 1E6UA 3N6RA 4KNWA 4F56A 3WNZA 4XSHA 3SJAA 1E8NA 1DJPA 3T3IA 3SG0A 3AKCA 3BCRA 2AJ8A 1QHFA 1KRWA 3QNWA 3ZVRA 3ORQA 3NGMA 2Y1FA 3JZDA 4M0MA 4R5MA 3R23A 4ACBA 5ES4B 5J47A 4K9LA 5DNVA 4WY2A 2E37A 3DEFA 2BFWA 4F8EA 1YZGA 1TUIA 2X13A 3AOGA 1N5KA 3JQ9C 3CC7Z 2WLTA 3BJIC 4ARZB 3I9LA 4BNJA 3CNQS 1NFFA 2YNMD 4ON9A 1ZGGA 2VJYA 5JSYA 3I6QA 4EJ2A 2H1OA 5IN5A 3K35A 4LUCA 3OFNA 4PVDA 3VQTA 2IDMA 2J46A 1EG2A 4W6QA 2XCQA 3GVCA 9ABPA 4I4IA 1R9NA 1DO8A 1U98A 1E3JA 4LOJA 3T1QA 4EO9A 4KLZA 5DTQA 2PFKA 3Q3VA 3O1JC 2GDJA 1S96A 3I6YA 1RQRA 4TTTS 4NBSA 5JAPA 5TDHA 1MJ5A 2BIFA 2EF1A 2B5VA 4GRAA 4M1EA 4NU0A 5H4HA 2XF8A 1YZHA 1OA0A 3HKZA 2FKNA 1GPJA 3LBYA 4HEA6 1XE3A 4PIMA 4QPPA 5FIUA 1PKXA 2XUQA 3WDMA 5AW2A 5JS6A 4NIMA 5BN1A 1ONPA 5CCDA 1CIPA 2QMOA 3ODPA 2HLDA 1XWIA 2XPCA 3LCUA 1MTOA 2JLBA 1JE1A 3L8YA 4UUOA 1W85B 3K32A 3QE4A 2G76A 5KQGA 3U9SA 2YRXA 3RFCA 2IYLD 3WB9A 2X7HA 3IBGA 4UTOA 1RYHA 3QOYA 1D9XA 4OUDB 2P4QA 3I04M 1Z0KA 4YP1A 4DDUA 2YWXA 3M9LA 4E32A 1ESEA 2AN9A 4YFYA 5CT4A 5DM70 1YZNA 2G4LA 3TS1A 1KIMA 4RABA 5GAJA 2A9PA 4D96A 2C2OA 3Q3EA 2QTZA 1L4BA 1XPRA 2FSPA 3AWIA 3EEQA 3UCEA 1P5HA 1V7CA 1EMDA 1U1IA 4AZSA 1G8SA 1RO0A 2I3BA 3IAAA 1MUUA 1K7XB 3WIDA 5AQ1A 3E3LA 1UM8A 5EEHA 3V8PA 2JI9A 3URMA 4MQBA 1OXVA 1JFFB 3ZHOA 1JE0A 4WK4B 2UV8A 1NG9A 4FZJA 4GUDA 1AKEA 3NDJA 1P1KA 2PLWA 2UZ1A 3RYCA 4CM8A 3IALA 2X6RA 1YL5A 3QG5A 4MWGA 3VOSA 4B79A 3EZNA 4PNPA 1Y1QA 1EVJA 2NTJA 2R00A 3ESQA 1TI7A 3V7WA 5ITZA 4DBVO 4U2DA 1GL9B 4IQ4A 3LLUA 3MAGA 4PTYA 1YBAA 2ZT6A 1GITA 4MWEA 1Z6YA 2G1AA 2X0KA 5IVHA 3T06B 3WOHA 5I4BA 3PHCA 5ICSA 4LK2A 4DQLA 1BA2A 3PRYA 1WB6A 1E1NA 4IGAA 4MRRA 2FP4A 1W34A 3U7IA 1QHNA 3L93A 4GLFA 5JLJA 4XQCA 5F7ZA 2N9UA 1EVKA 1X0VA 4LZJA 3WLRA 1RMQA 2C3YA 3WLFA 2VRNA 3DCNA 5K7SA 4RK0A 3RQIA 1SU6A 2IS6A 1J0DA 2EERA 5CFZA 2QEX1 3ABQB 7MHTA 4MD8A 3BRWA 3GG9A 4AJJA 2IUTA 4BQNA 4FN5A 3ICEA 3NVKI 1MN6A 5JJKA 3T7CA 1K9VF 4MR7A 1ILEA 5T8KC 2GLXA 3P9RA 2OFPA 1A9XB 4PHCA 4IQ8A 1Q5PA 1ZOOA 4CKYA 4E3ZA 4GW3A 1T3SA 3QY9A 2EL7A 3EB9A 3TUZC 2FPGB 4WDRA 2X5KO 2ZAIA 1Y6JA 5A0FA 3WMGA 5KKCA 3S8YA 2K7ZA 3AUKA 1FYDA 1NIPA 4ZCTA 2PUCA 3G1UA 2ZSEA 3Q1KA 4AJ2A 3QLTA 2JVJA 4GT1A 4UJ5A 1USGA 4FYHA 4QFCA 5BSTA 2GUWA 4YRBA 3BA1A 3EZXA 5TY0A 4BUCA 3SQXA 3VYTB 3GGCA 2FSIA 3NTRA 3QKRB 4QO8A 2HL6A 3IQIX 4PCLA 3A1UA 3UQYS 4ZRMA 4LCEA 4H9GA 2O8BA 4MUJA 2HBRA 3LBHA 3C3PA 4LQ4A 4HMPA 4WA7A 3VJLA 2DERA 2O57A 3GD7A 2A3RA 2DJIA 4BIIA 2OGUA 3ZHXA 3U3KA 4CKCB 4S1TA 1AGRA 2AWOA 1U3DA 1L5SA 3LXXA 1H2AS 1XTKA 3DL0A 5KYYA 4HHEA 1QDLB 2WB4A 4PPFA 1UDCA 1SC6A 3HCCA 4YMIA 2DR2A 4YS6A 4NBVA 4LS3A 5J5VA 1QUEA 4H7PA 2WKWA 1C5KA 2O23A 1NY5A 5DWQA 3PEVA 1M66A 5K45A 2Z2JA 4L4ZA 5BN5A 1QFYA 1SCBA 1W94A 2VHWA 3L46A 4ND5A 2QM7A 4PN7A 4R84A 2JJYA 1ZIDA 2ECQA 4LJLA 4IEFB 4N65A 1C9MA 4N0PA 3H8WA 3T9DA 3AKYA 1C9KA 3K16A 4J43A 2NXEA 4FDLA 5BWLA 3RASA 4ZANA 4KJZA 4Y7DA 2WVAA 4MGZR 1QCDA 1ZY2A 3RYHA 4HDSB 3ASUA 3JAMA 4OM8A 4LRYA 1ECLA 1HDGO 3ZBPA 1VKHA 1NTRA 1OASA 3FSEA 4UAUA 3G0HA 7MDHA 4HZUB 1IXKA 5CYOA 5JCJA 2CUKA 4DR5B 1UOQA 1Y3DE 2D0IA 3U17A 3NHAA 5IAGA 2NUPA 4CVNA 5LKAA 4UU1A 2ZSUA 3HN2A 4UOQA 1BN6A 3Q8LA 4D5GA 3EPJA 3TSWA 4BNDA 5KYTA 3N5CA 3ZG6A 4W7IA 1Q3KA 5JHGB 1BCRB 5KX5A 3BMQB 1XTBA 4I9FA 3MYYA 4OREX 4RPLA 3RHTA 3ROGA 3ZWDA 1Z56C 1K8YB 1THMA 1BE6A 4JLDA 1G5RA 2VF1A 3R3YA 4KIJA 4IICA 2G8LA 2UUBB 1E7YA 1QGUB 3KBBA 3OH8A 4O4JF 5TGTA 4RV9A 2ACEA 1NI4B 3I30X 3QJYA 5LA6B 3MGBA 4LMAA 2RHLA 3T4XA 1C8BA 3GDGA 5JPCA 1M6YA 3H5IA 4QTUB 4X61A 4EQ6B 1W4ZA 1KK3A 3SE0A 2K5RA 1EDEA 3B9QA 4OJYA 3P5JB 1GNRA 4NJMB 2YVUA 3P94A 4IDPA 2J4DA 3LY8A 5DB4A 4AQDA 1ZH2A 3UVEA 1F4VA 4WJZA 5E6UB 3WSVA 1KVTA 1PTJC 2Q4DA 5A0TA 3VXKA 3ZNPA 4K0KB 2VJDA 2Z2XA 3P9IA 1KDVA 5CD1A 4BFCA 4D0RA 3ZTWA 5HJEA 5GGYA 3M81A 2Z57A 4UNNA 1NLFA 2QRDB 4TQ9A 4CM7A 2W42A 4EYEA 2LUOA 4LPSA 2E87A 1NHWA 1O96B 4R98A 5FPKA 3U09A 2H1SA 5HP4A 3QOFA 3K70C 1IFXA 1TKAA 1P4SA 1ZIOA 3RUIA 2B8NA 1XDGA 2XD4A 1ND6A 5FLXf 4IDEA 5HIMA 1XB2A 1JJ2Y 1W25A 1Z9BA 1PRYA 1XZNA 2BWJA 3FWYA 4K6FA 4O4HA 1DAFA 1O4WA 2HGSA 3PUYA 3CX4A 3DUFA 1B93A 1E9EA 4MVJH 3FKII 2OC9A 1USPB 4L78A 5BUZA 2H4WA 4Q16A 3BWDD 5CFOA 2H4YA 2Q3DA 1I2CA 2NU6B 5KVQA 2HMTA 4DDWA 1FQJA 3ZS9A 4ALIA 2J4CA 2NADA 3KWMA 1N5DA 1R8XA 1ZR2A 1WD5A 3BHJA 1G5TA 1SJ9A 2V8JA 1Z8HA 2VRBA 4HB3A 1CJUC 1HURA 2W00A 4P98A 5IAAA 3I39X 2DEUA 3QWHA 1LLQA 3SR3A 5I7UA 4AC9A 1UZMA 2VJCA 1RJEA 4LE1A 5DCYA 1U6KA 4MQLA 4FM9A 1T6NA 1XMVA 1KEZA 3QITA 2UZ3A 3L8HA 2LIPA 1NN0A 3U4QB 2NVTI 1M8JA 2EQAA 3V1UA 4QSHA 3TLKA 2XQKA 3D5QA 4FEEA 1ODCA 3UAGA 3Q8MA 4M55A 3SZOA 4ZMBA 4XA8A 3EZ7A 3ROTA 1U0GA 3WJ2A 3ZXSA 3C6QA 3MFYA 4M1QA 1RRCA 3QX7A 2CYCA 2AFVA 1EINA 3IQGX 2QV0A 3JZMA 1MJHA 3AEUB 4GX5A 4U02A 4A2PA 3ELYA 4OHBA 1V5GA 4PIPA 3A25A 2NVUA 2XZPA 3GTMI 3HXOA 2RG7A 3WKEA 1NA5A 2R1TA 4LY0A 2DVMA 3ZLUA 4BDTA 4DM4A 2RBLA 3F98A 4PZAA 4PLWA 4RMHA 1VCIA 3AC0A 4WBSA 1HL3A 4DUPA 5EXTA 1P4JA 1WDWB 4EUEA 1E2FA 1SBHA 2WM9B 2Y1EA 9ATCA 4DLZA 1BU5A 3LT0A 2WSMA 4B3JA 1GRQA 5CFPA 1OFVA 1JDSA 3WA7A 2ZJOA 3HYRA 5FULA 4MOWA 2OBBA 3LRXA 2DWCA 3TR6A 2GK3A 1OLSA 3A58B 3O38A 4U8GA 5IK2A 1DAMA 4RY8A 3HKCA 5AI8A 4EDHA 4WFIA 4L5AA 4XVHA 2O2ZA 2O20A 1R8JA 3W5SA 1GAXA 4DLLA 4R1LA 1IXZA 4FZRA 2GARA 1UBEA 3KTAB 5EZYB 5FTJA 4ABTA 5SZIA 3CZAA 2OBXA 3VZQA 1NBMD 2Z08A 2ZI7A 5G3YA 1JKIA 5DK6A 5KOJB 1HYGA 1R66A 3K2EA 1E0AA 5EKUA 2Y9MB 1LKZA 4LFCB 2VK4A 1JLSA 2G8NA 1L4FA 3NDRA 1VQKZ 3QHPA 4EITA 3SS7X 4US2R 2OFXA 3E7DA 3HLYA 4KMMA 1JDZA 1V4NA 3E5NA 2WE7A 4FHCA 4UREA 5DYIA 4C07A 2NTYC 4OXYA 3VR4H 3KTDA 1TNDA 4HYQA 1H85A 2VDWB 2VYVD 1R3DA 1N7HA 1HM5A 3C6KA 4RAQA 3T94A 1O95A 3RC1A 4IGIA 2I91A 2FE4A 4ZC1A 3RS8A 1T4CB 1L7MA 2O2SA 1SQ6A 4DEVA 4F3KA 1ISGA 2HRBA 2RGYA 4IMPA 4C3VA 2J3KA 2XXAA 4O08A 3IR7A 1D2NA 4AZWA 1VBMA 4B8WA 4YCLA 2KX7A 1T35A 2PZ8A 2OV1A 4MLZA 4D5EA 1RQ2A 3AFNA 1X9GA 4N7BA 1VE3A 2QTNA 3WKBA 4CR6A 4IRUB 5DWVA 1KE1A 4J7UA 3FDIA 3QM1A 1E4VA 5DYYA 1KP2A 1BHO1 5L45A 5LMNB 1NJFA 1EE2A 2R96A 4TZKA 4ER6A 5UKDA 1PJ2A 2CUZA 2G4VA 2BMDA 1VGQA 2FN3A 3OOWA 4ZK2A 3NRCA 3LPLA 621PA 1MBZA 1WQ4A 4P1ZA 2UU9B 1VCNA 2XNCA 3CG4A 4IZHA 1DIGA 2IPAB 2EFCB 2XYGA 2VJKA 4AQYB 4DNPA 2ADMA 1TZKA 4HBZA 4JBLA 4UZFA 3F2IA 1SK9A 4Q9HA 4D81A 5IDYA 3GCDA 3J81k 4MR8A 4C05A 1RZRA 4BXXI 1O6GA 4ND4A 3W8FA 1G5FA 3G6EZ 2CVHA 1L8LA 3U3XA 3I2JA 1E7RA 4XZ3A 2B4RO 4DRYA 3K7EA 4OB7A 2DUJA 1X87A 1M0WA 5LQDA 3WO1A 4R2XA 2WTBA 2IZ3A 2PG3A 4KLRA 2I3GA 3ITDA 1W35A 5KTOA 2C0QA 1ODLA 2O5RA 3VVCA 1XPUA 5JATA 1GGMA 4OF4A 2QLMA 3PXGA 1I3OA 1RI1A 2NSHA 4JLAA 4RK4A 3FPCA 5IYZF 3S7TA 4KXMA 3OZIA 3NM5A 2EFJA 3EE6A 4FFOA 5GIPE 4HEQA 1JEOA 2JIZA 2J3HA 2XUOA 2JK0A 2ZG6A 3GP3A 4DL9A 5JNVA 2J0UA 2HR1A 4JWTA 3L01A 3JYOA 2H85A 2ORED 2Q41A 2QN8A 3LPNA 3OMLA 3QXGA 2YUTA 2H31A 3U7QA 3SJUA 3W2IA 1ECBA 2JC3A 3C8DA 3DQQA 3LZCA 3D6VA 4L50A 1ZH1A 5CEEA 4J0FA 1GZSA 3O83A 4CT0A 5LD2C 1QKJA 1N2IA 2XEDA 5A06A 3D2LA 3OC0A 4LG1A 1KZ9A 1R50A 2O8DB 1BEEA 1HQYE 5FUWA 1YOVA 4PS0A 3FKJA 4OIMA 5I8ZA 2OM2A 1PN3A 4N3GA 4BLWA 2PKEA 4A10A 3SWWA 4CM1A 3VKHA 5FA6A 5EJ9A 2LIYA 3SDZA 2BLLA 3HJBA 3PGVA 4WBNA 1WV1A 1G4HA 1UJ4A 4KCGA 3F90A 2HTFA 4YBZA 3BGIA 2I8AA 1VG8A 1IM8A 2DFLA 1PQYA 5AM5A 4KE7A 2D1SA 3GCWA 1NYRA 3Q1LA 1VLJA 4EPRA 4H1TA 4A36A 4BNGA 2CJWA 2G17A 4MIKA 1O97C 3SLKA 1U0OC 3LQRA 3ACCA 4KBGA 1IQUA 4PYNA 4B4UA 1LDGA 2WVGA 4B9AA 2BFBA 1GPAA 2HHAA 3QELA 1P81A 1VFNA 4M60A 2DFNA 2HMSA 1M76A 1NQTA 5H68A 4ZI2A 3J7AC 1XZKA 4KDFA 1LLDA 1JHPA 1KXZA 5AK3A 1AMNA 1X8KA 1OBOA 2CYBA 1BWSA 3BRCA 3TCKA 1TLFA 1I1QB 3Q98A 3VPCA 1X7ZA 2OE2A 4PLFA 4RY2A 3ZVKA 1YZ3A 4MAMA 1DKNA 1RQFA 2RH5A 2YDYA 1PQ4A 4PG6A 5A3RA 1DUSA 2AR0A 3DE3X 1A5BB 3OI7A 1MT3A 4YCJA 1LC0A 2XE8A 3OWHA 3Q4GA 4ZREA 3EXFA 1RW4A 3COVA 4ME6A 4WCFC 3UT5B 4TL9A 3ZPXA 3ZKWA 2QPLA 1DHRA 3ZK8A 3T99A 2ZI6A 4WH0A 1B1CA 5IT9A 1ZOSA 1GFSA 1ITZA 4HNAA 5DEOA 5DKFA 5EZYF 1NYLA 3HHEA 4DABA 1OZFA 5J2UA 2EWWA 1OVGA 2FEAA 2BOVA 2H1HA 1IJFA 3AQ4A 3AW9A 4WT7A 4ODIA 5J23A 1O0BA 2Q1YA 4FS8A 1T2NA 5CB4F 2H18A 1UZNA 1Q0SA 1DQYA 2IEGA 4IDFA 1N2ZA 4KI7A 5AMXA 2YVQA 3LZ6A 4B32A 1UKAA 4JP1A 1N32B 1CRLA 3U0VA 1XZAA 1E4YA 5FTWA 3TLXA 1BE1A 2KS6A 2CXPA 3NH6A 3T9AA 4DUGA 1EAMA 3ND6A 1W36C 1CJMA 1EVIA 1JVBA 3K9CA 3THXA 1QVAA 1ZAKA 4J75A 5DBGA 4DGSA 3CGWA 1GIAA 3FNQA 3KQPA 5DX0A 5IT5A 2ZTLA 1ULTA 3DV0B 3W34A 5CP8A 5LSAA 1QF7A 5TF4A 3IE1A 2W71A 5SZHB 5B7QA 3OCCA 4V0KA 4K6GA 3UK6A 1V9SA 3IT3A 2Q8PA 2RHJA 4BFXA 4HDMA 3HWSA 2PJUA 3MTGA 5KQMA 2PL3A 3IAUA 4HAWA 1Z17A 4LYYA 3HUFA 4QRIA 4OV6B 4D57A 1ZU5A 2JBAB 3IPCA 3HV0A 4PX9A 1K3UB 5G1NA 1I10A 3F6BX 2J5RA 4GZMA 1YB5A 2LV8A 4WGGA 2OTLZ 4A6XA 1UP4A 1X80A 3ND9A 1HMPA 4WLNA 1KY2A 4CCSA 1GUDA 4GYJA 1KFBB 2QRNA 4OAOA 4LF9B 3UZUA 1TT5A 4A9AA 1ZA2A 1QAOA 2E3JA 3D4PA 3VPHA 2XRFA 5ESRA 4EJ0A 3LDUA 1QF9A 3HCNA 3N5KA 5IMBA 1FX0A 2F64A 1CB0A 2NYRA 3CH7A 2HA4A 3E4CA 5ECWA 3HA3A 5K0LA 1FRFS 1BEUB 2IHYA 2LPMA 2H5EA 4I6EA 4H7EA 3UMFA 2PT6A 3D4BA 1JYSA 2VDUE 2ZB2A 4I8IA 1KQNA 3ZE2B 2XGJA 3U2QA 4OXQA 4JSYA 1USWA 3V6LA 3WBJA 1GRCA 3G0BA 1NP6A 5FR2A 3THSA 3KEOA 4Q3LA 1ZQ9A 1SK8A 1HETA 5G4KA 3V9PA 1RLMA 2C57A 5NLLA 1OY1A 1CJVC 1RHQA 5CFMA 4UXJA 4Y2PA 4Y2RA 2B6HA 1W52X 1DEXA 4D41A 3KQLA 1KC1A 1IONA 1CF2O 1UJMA 4LRQA 1FYWA 1MJFA 3RVLA 3CY6A 4O63O 4I1UA 3JWHA 4XFJA 4AIRA 1P8JA 5AJVB 1K5HA 4B80A 3B3FA 1GZ4A 1YJW1 3FKQA 4FI3C 5K20A 4A15A 2CLCX 4YJFA 4JXZA 3NOQA 5FDFA 3NDIA 1I4LD 1YQ9A 3EXG1 4GWGA 5FTKA 1Z06A 3L6BA 1EBBA 2B4QA 2RT9A 1ZMRA 5FUYA 2C2KA 1N8KA 1CR1A 5CH8A 2Z9DA 3JQFC 4QUDA 3CW8X 4NPAA 1K2VN 1BNCA 1BXRA 4ITRC 3VH4A 4J0GA 5CFNA 2OHGA 1V9LA 1BW9A 4IM7A 5ALHA 3D2CA 1F2UB 1HE8B 3CWZA 3BQ9A 3HACA 5DMXA 5K0EA 1FVHA 1J5XA 5D6OA 3EVAA 1WY7A 4E2XA 2D1RA 3OEWA 2PZFA 3OU6A 3UJ9A 4G1UC 3CT4A 2MOKA 3VMHA 2VG8A 3LFTA 4RQAA 4POOA 4RSGA 3C3BA 1A5ZA 3MJRA 4PINA 5E1DA 1VJRA 3VR6D 4H7IA 3CEHA 4C7BA 3KUUA 4F4CA 5AI6A 2VJMA 3JR3A 4EA7A 3TG8A 1P17A 1P5JA 3DL4A 3HHPA 4Y1RB 4ZYUA 2ZIXA 3H9JA 3I64A 4JX9A 1Z82A 4TGLA 1IPFA 1P29A 4D4LA 3TOXA 4EG4A 3PXCX 2FN8A 3HJCA 5G53C 4KFCA 1NDHA 4LVNA 3JPYA 1GU0A 2VA9A 4IHQA 1OIXA 3QEBZ 1OD6A 5ADWA 5FFMA 5AVSA 3F8SA 1ZIYA 4DKJA 5HOQA 1AHIA 4LXHA 4G4SP 4MUAA 2WA2A 3IPXA 1DAEA 1ZD4A 1L5ZA 3V1TC 3PNBA 1JWAB 1MX9A 2AE1A 3PF9A 4BO6A 5KSZA 1MA3A 1D07A 1OHHA 4MR9A 4GRIA 2WSIA 3QUQA 3GCFA 2D59A 1XDWA 2GA9A 3A31A 3OKAA 4IRMA 1EFTA 1NE2A 3CV3A 4A16A 3P9QA 4CXMA 3DVSX 3OZUA 2IS1A 1LC3A 1DIOB 1M6HA 5F9MA 1IMOA 2J9RA 3NT4A 1XTSA 2BGJA 5CYFA 1RXCA 2HWYA 4KG7A 1JAXA 1DL5A 2GHQA 3RAPR 4AY4A 1LQLA 5JD4A 1V95A 2ZJ7A 4J29A 1YR2A 3DA8A 1M902 2IEZA 3DMFA 4X1YB 2OYRA 4F2HA 5KO2A 4G89A 3H04A 1MABB 2DG2A 2MSLA 1VPWA 4OBWA 4R8SA 4TZ6A 1DZ3A 5GJCA 3I1JA 5TQ2A 4PYRA 4ROSA 1VHJA 1PUXA 3FNEA 3PFHA 4IOJA 2G04A 3AJDA 2YWHA 3LCRA 1E58A 4N49A 1DFGA 1DRVA 5LIRA 2FTKE 4D0LB 1PEAA 1RBQA 2EJWA 3OUTA 4IIJA 4TLBA 3HKEA 3CN7A 3F7TA 4GX0A 3I0ZA 4C0QC 4DBLC 5BXQC 2YQ4A 6ABPA 1CTQA 3ST7A 3G0DA 3X2FA 4LYDA 3FYCA 4J3FA 4OQNA 4EB6B 1VTKA 4RK6A 1WZIA 2P5SA 5IC5A 5ALWA 4FJ1A 1B8OA 2WJPA 2HUPA 2Z3VA 4LJ9A 4UE2A 1C81A 4XUDA 1RRFA 1JVSA 2ZU6A 4UD6A 3HDTA 2NVXI 1IZ8A 2NZJA 3MWEB 4D3YA 1UXOA 1ZCBA 3M4XA 1YHQZ 1ZIPA 2LD4A 2MIIA 4PR3A 5E9WA 1JEJA 4EO4A 2FW6A 2FRDC 1SKAA 3CCJZ 4RFSA 2HY7A 2OCXA 1HFJA 3JWJA 3EPRA 4RK7A 1G7RA 4ZVKA 2FW0A 3R5JA 3AB8A 1WE2A 2VA8A 2HIGA 2WE8A 3MJFA 5JXHA 2GZDA 1N9GA 5SY4A 3AF6A 1IWPB 4RTRA 1RAGA 2JEZA 3ZXYA 1DG1G 1V8FA 1XXLA 4XB6B 2I4TA 3DE5X 4EB0A 5J5CA 1E3LA 1WETA 3HQ4O 1XVTA 2HLNA 5A6VA 3DBVO 3I5YA 3MT7A 3T3EA 3P4XA 1JJIA 4A8JA 3WFJA 3W1VA 3K0HA 3MQ2A 2AL7A 3KJHA 4WK2B 3KRTA 3VH3A 2AMJA 4CQLA 4DLSA 1UBJS 3H18A 3PC8A 1C0LA 2VZEA 5IJAA 1EHYA 1K75A 2JUBA 2Y93A 4EGAA 2JI4A 2YHBA 4JYCA 5BN4A 1ZP6A 3LKZA 4R4JA 1R5JA 3FPEA 1T5BA 3C2QA 4BUJA 4R6WA 4AP9A 1B8PA 5G3ZA 3LQKA 4KQ9A 1M1YB 1ZW1A 5J2TF 4MDHA 1SZPA 1Y3FE 3EAGA 1VCMA 3EPHA 3VA7A 4BC1A 3ESYA 1IN7A 1AK9A 4EEXA 4TL6A 3IULA 2XQIA 2PH5A 4IQFA 2W2MA 4OD0A 5DNYB 3AFOA 3MWLA 2WYUA 2DTDA 3G711 1QX3A 2ES4A 4R3NA 2QQ5A 3OJLA 1MT0A 3OQBA 5DULA 1XKLA 2KLBA 2P2LA 3VU9A 1U80A 3EZGA 1YVPA 6GPBA 2J3JA 2PKQO 1HZZC 2G25A 2X1HA 4DREA 2XUPA 1XMQB 1U9YA 1ECPA 1RFGE 2QTWB 2UYQA 1YS2X 4KN9S 1XCLA 2RG1A 4BVEA 1DIBA 2F67A 3F5SA 4NESA 3FGPA 3VAYA 2CNWA 3FA2A 2IEAA 1LFDB 2AMVA 2GTPA 2PN1A 3A9SA 3R41A 4JJIA 4Y6RA 4J9VA 2C4KA 5EVCA 4GLBA 4MS4B 1QIJA 4TTJA 1JJ2Z 5P8WA 5AHWA 4AKGA 4HDAA 3D1VA 3GPDG 4GQAA 4YN3A 4KN5A 2I3AA 1T1IA 3ZWXA 4HSEA 2ZS7A 5JSKA 2I2DA 1OOEA 3FOBA 1SCQA 2FMIA 4F93B 5FI1B 2GCIA 4DWWA 4Q1EA 3G0IA 4QX6A 2JMOA 3GMDA 2ASVA 3O8RA 4Z4QA 2P35A 1A9ZA 1U1FA 4IO1A 4R2WA 4UHHA 4ZQCB 5GONB 2G5PA 3NWOA 4EJFA 2X5OA 4EHHA 4Q39A 3H8SA 4KWHA 4XRRA 3RV4A 3MRTA 1PFYA 3WOVA 5EZSA 3L0OA 4JU8A 2JGMA 1GUFA 4S12A 5K51A 3OICA 3M4NA 4KC0A 1K5PA 1NT2A 4UM7A 3D3WA 4BFUA 2JHAA 3NPMA 3E3AA 1H3FA 3LHKA 2ZSKA 4UBKA 1IPHA 1YD7A 3U3RA 1DRJA 3ILVA 4B74A 3IIJA 1N36B 3L43A 3ZE9A 1Q11A 3NHKA 3ZK7A 4BO5A 2ECOA 2QXYA 1T9ZA 1HL7A 1PFQA 2ZATA 4GR5A 4K2AA 4P3KA 4WXYB 3MTJA 3DP7A 1FJGB 2QXUA 2VPWA 1THTA 5CA0A 3D9QX 3GT7A 1B4DA 4I55A 1LVUA 4L28A 2IF0A 4OLJA 1E2DA 2DOKA 4LNUA 3ZH2A 1W6UA 3E1KA 2R7LA 3MM4A 1WTCA 4E1AA 3GUHA 2VUHB 3S1NI 2YY5A 2ZRAA 3Q88A 5BRNA 3STTA 5BWNA 3ER8A 1RWKA 5K3EA 1MMFB 3SZ3A 2WHPB 3CZQA 4OBXA 4W7SA 1XKXA 2HNBA 4O2LA 4G81A 4EY8A 5KNDD 1TVKA 1T9CA 3EDRA 3I0MA 5EMLA 3JYPA 5DI9A 2CN1A 4M1OA 1JXAA 4M36A 2C2GA 2ZBRA 1JAHA 4FYWA 4NLLA 2XVMA 4QYIB 3V1LA 1M2VA 3U5TA 4YY3B 1O9BA 1IBLB 1PJ3A 3GBPA 3HNRA 4LHZA 4O8CA 3EJ6A 3DOCA 1GL7A 4JC5A 3EDOA 1I7SB 1OW3B 1RRKA 1IB0A 2HQRA 2TS1A 3MS2A 4U2FA 2YV3A 4G0QA 2JVIA 2VHUA 5I9TA 2QLLA 2YC4C 4LYFA 2BFCA 1NBIA 4ALMA 3OQ6A 4UPDA 1Q2XA 4LE0A 5IT4A 1F8YA 1RD4A 3CWCA 1KP9A 1JR2A 2J3EA 4V0QA 3HCBA 1CVLA 2W90A 3FFTA 1DNPA 1YJ9Z 4RPIA 5KSPA 1IQ0A 4Y3UA 3DKKA 2AEFA 1YK1A 4C9BA 3EHDA 4FHEA 2GXAA 2XTJA 1PT6A 1Q0ZA 1T8SA 1C1YA 1SBNE 3I6IA 4WBXC 3C3DA 2BFDA 2JCBA 3ET4A 1WAMA 1Z0FA 3H1TA 5EIOA 4BNXA 1S72Z 4F5DA 3RTCA 5F7OA 4BTLA 2LP4Y 4NQZA 2H4FA 3D6UA 4LZAA 5CVJA 4BKMA 4C4AA 4DV6B 1FC0A 4N5HX 2AHOA 2QPAA 3QLVA 4EECA 5FOTA 2Z43A 2CHQA 4HJXA 1ML3A 4Y0AA 2WIDA 4Y1GA 3WLJA 5IUJC 5HHTA 3CLTD 2SECE 4IH4A 1KFCB 3V8MA 1K3TA 1NVMB 2A78A 3HL0A 2YOGA 1NJ8A 3WK9A 1OWPA 1ZSVA 1EBFA 4AJ1A 4CHGA 5A7FA 2NXWA 1DTWA 1T5OA 4M8NE 5A4MS 1Z7WA 1PJQA 3OKCA 5C5DA 2QP9X 2JRLA 4B3IA 2OZLB 1N5OX 2C59A 3DDNA 1TW3A 2OXRA 4MQMA 2NZVG 3EVNA 3H2BA 3K1ZA 4Q4HB 4ROTA 4TRJA 3I8OA 4ETNA 4LWOA 3T5GA 4L75A 4FBGA 3WHIA 4LMRA 2H7VA 2XDQB 4FOPA 5FUVA 2ZTHA 5FHRA 1ZW6A 4BYGA 3NATA 4WZAA 2CXXA 2GO1A 1R10A 4JQSA 3G88A 1I33A 2PO7A 3UXHA 3I2YX 1UDRA 2A58A 1L1EA 4JBNA 3T0FA 3WGQA 3ZTYA 4BXOA 3DEKA 3ZJVA 1EFCA 4HWTA 3TM5A 4BATA 4OHXA 3U44A 3GLGE 1IWBB 3T3GA 4Z0HO 4PQYA 1QR2A 2JI8A 1Q0QA 5EE5B 4CKBA 1GL6A 2ZYRA 3NHRA 4YAEA 2C4UA 4EG8A 3IQDB 1W7AA 4JV5B 2HPAA 4GYKA 4CLDA 3T3PB 2INGX 3VJKA 1N0VC 1RE1A 5DASA 5A3JA 4CKEB 1XKTA 1ENPA 4FXPA 3LWBA 2WDZA 3QV2A 4EI2A 3VYRB 4Y52I 1VSVA 3UH0A 4LNHA 4XDYA 3T9BA 5BN3B 4DV1B 4IXMA 1L4KA 1UBGA 4RVNA 1PYDA 3MGCA 4NNOA 5EL0A 3U40A 3ERCA 2FW7A 2OBLA 2QX8A 2WAAA 4R7GA 5A1JA 4CW7A 2BFMA 4RMJA 4W9RA 2VF4X 4Z3OA 3QVGA 4KN6A 1II8A 2R11A 1KQ3A 1GTVA 3N0RA 4OQFA 3GEGA 5AJWA 2HQOA 5FFNA 5FNVF 1FLAA 3PNMA 3QYJA 4WDQA 3F74A 5I8PA 2UVPA 3T4PA 2IV2X 3ECCA 3KOXA 3F6YA 1DAIA 3OFND 5D2CA 1OGYA 1IZ7A 3L7IA 4UXHA 5DHUA 4MAAA 1TE2A 3HJAA 4PLVA 4QD3A 2Z8ZA 1NNSA 4TWRA 5CM2Z 5IULC 4EELA 1NM5A 1HYBA 2H2GA 3P26A 4EGCB 3GGGA 4M22A 1X13A 3ZOZA 4AROA 4YPOA 1IY1A 2YJ4A 2PL5A 3DWIA 3NIGB 2UXDB 1VQ51 3QVMA 4K5QA 4FC6A 4PYKA 3R5HA 5F1OA 3X1JA 1ZESA 3EUFA 3PQ4A 3HEAA 1M2WA 4U7TB 1G2OA 2WA1A 4GBMA 2Q0HA 1NP3A 2IYRA 2WU8A 4PAGA 3FUTA 4HUQB 3WK4A 2PD4A 3G9XA 5CLHA 5K3DA 1RM5A 5LL6P 1PS8A 4O1IA 2D8MA 2QVYX 3HUEA 4LGVA 5IDVA 5C3UA 5LQSA 821PA 2BEUA 3V8EA 1T8TA 3KC2A 2JFHA 2LCFA 3Q0TA 1ZUIA 4RYDA 1CDZA 4BGIA 2C8KA 3MHTA 1K0UA 4LHVA 4GKJB 2MTBA 1UDBA 2G63A 4GLJA 1DPFA 1U3UA 3BIFA 2PQ6A 1MLDA 2JJQA 2PR7A 3A6EA 1Z6PA 1EXVA 3REQB 3T1YB 2YJNA 2ONZA 4FFLA 5C1PA 3O94A 4X95A 4JLSA 3TLYA 1ZDMA 1KJ8A 5FPPA 4DC9A 1KEEA 3K0KA 5D85A 4R9SA 3BL5A 4PHTA 4EPXA 3BWCA 1YGYA 1U0NA 1PX2A 3BIOA 3N87A 4ZOLA 3GCZA 3VR6H 4N4AA 3B1JA 3R3XA 1NFRA 3W1EA 2YJ6A 5TQJA 2OORC 2TMKA 1DT3A 4BNMA 1WZ2A 3GLQA 1UQRA 5ECGC 4A3GI 2HD4A 3BFVA 1KAOA 4F9TA 2CD7A 4BRZA 2AJTA 3CX7A 4ZAGA 4OQQA 5MN4A 1YFZA 3NC1C 1QP4A 3DNFA 1ZX1A 4GO1A 2ZRFA 4JBXA 2AFIA 2AQ8A 2AN3A 3FZEA 4L4YA 4R1MA 3PO2I 2CYAA 4TRNA 4BJ1A 5JFTA 3NAQA 5TARA 5AI0A 3RRZA 4D3DA 1F2VA 4RBNA 1BDIA 5GMOA 3A7DA 5TXGA 4OU5A 1DELA 4R41A 4UTZA 3BWXA 3VMFA 4YJDA 2BBTA 3QKWA 4UU8A 1R6UA 3IUQA 4Z7NB 1AKQA 3NKLA 4D9CA 4EUNA 5EZ5A 4U2KA 2HEIA 2H2FA 3B1XA 1R0CA 3UWSA 4H4DA 1QP0A 4YACA 2ZCJA 2XWBF 4JDPA 4R8KA 1QHIA 4UBMA 3QYPA 2J85A 1GVNB 2YYZA 4FHGA 7REQA 2WAYA 2GETA 1CQIA 1V6SA 3GW8A 2BLNA 2XRMA 5EPEA 1XEAA 3DVRX 5GJVC 4O3MA 1F7UA 3L5KA 2H4ZA 4RVHA 3G82C 1UBCA 5BURA 1P2TA 3W6UA 4C4PA 2FSGA 4FGUA 4NG4A 1ZHFA 1CD5A 3DDOA 4H59A 4KKVA 1HC7A 2B3DA 2VUTA 3LOUA 3KZKA 4IMJB 4LXTA 1KC81 2D74A 5B37A 2IYNA 1U0FA 1V8PA 3EMDA 4P22A 4I7EA 2AFIE 3UJHA 1GGNA 2FPPA 2VS1A 3DZ8A 4OYHA 1AJEA 3K5PA 4WVFA 2X8LA 3M6WA 5IBPA 3R7SA 5FUBA 4AZ0B 2WT9A 3NFRA 4OI4A 2ZUVA 4C30A 3HOXI 221PA 5G02A 1C0PA 2FUG6 4QWMA 2N47A 4YJ2F 2CBZA 2QL6A 2KMLA 3L6OO 2I76A 1YU9A 1FS4A 4KR3A 1DE0A 3QBDA 4TTSA 2IA5A 2HW8A 4WMLA 5DLQC 4GR4A 3VOBA 1U2DC 1BDHA 2NUTA 1V8BA 2O7RA 2ZVJA 4TUYA 1JFVA 3T5AA 1JR3E 4R2MA 1M7BA 4INZA 3PLRA 3OW2Z 2XB4A 3A3NA 3D6JA 1U3GA 2C00A 3VO8A 4UCXA 3R20A 4P92A 1ZJ6A 4DCVA 5CX1A 4NK5A 3EGDB 2P3QA 1IOZA 4JJGA 1IN4A 1IUNA 2BHNA 1NYQA 1G2QA 1TQ4A 3X1WA 5A1TA 4C0BA 2FPXA 3TRKA 1Y5MA 1AKRA 3GFRA 3ZDRA 4BZXA 1SHUX 4HBGA 1I3KA 3FR7A 4M89A 2DBQA 2G82A 3ZZNA 3PXDA 1RMYA 3DBHA 1ML8A 2I2BA 4HLDA 1WO8A 5G1PA 1HEIA 3LPDA 3PFIA 5CDFE 1T29A 5C44I 1J0AA 3HGMA 3RTDA 3QKUA 3AY6A 3CIFA 4K6KA 5FA8A 3JQ8A 1MAHA 4B82A 5H02A 4G8BA 2FF7A 1WD7A 3K0FA 5GZ3A 3OEEA 3QQPA 1U9IC 4RVOA 2YINC 4URYR 2VPYA 3H0EA 2P3OA 4F2DA 3B3AA 3EWAA 1W87A 5IAOA 2QD5A 3UCXA 1YZQA 3G13A 4YJ3A 1TWFI 2ZJBA 4B3MB 1C8VB 4D2IA 4M7WA 4TKUA 2CUNA 2C29D 3D5TA 3FNHA 1GSHA 1DXYA 4IIXA 3WGMA 2QG9A 2WTNA 3F5MA 1DOAA 2I7TA 3L1JA 5C8YF 5IT9f 1W0JA 1EE9A 5PNTA 1GYPA 4IWYA 4QOIA 1NPTO 3M5WA 5IM5A 1VQ41 2DFVA 3NFYA 2ZRHA 4IX9A 3TTVA 3DB1A 4F3NA 3L6DA 3FF4A 1EVZA 5AYVA 4C7JA 2JIMA 5JO9A 3VNQA 3ETGA 4US0R 5IS2A 3LLVA 3O4VA 5JNTA 1CUAA 3RFFA 4Q02A 4DA4A 4R9VA 2DGDA 4HEJA 4RF2A 1WZCA 3EGOA 3TSOA 1N2CB 1U3VA 3GUVA 4LRSB 5JI2E 1TOAA 1N5RA 2OTJ1 3L7CA 3DPUA 5E4FA 4A2WA 1HE4A 4EBFA 4II2A 2JGNA 2LKCA 2NXCA 4RADA 3ZW9A 1LGYA 3A6FA 4FOSA 2VT7A 4Y6SA 1PVDA 4F5WA 4Z1OA 3AM1A 1PTJA 1I6HI 1TZCA 3DVLA 4EBBA 4QYWA 2EW1A 4YI5A 4JT4A 1JI3A 2P79A 3KOYA 5A3VA 3ENKA 4QGHA 1GNLA 1QIDA 2JDIA 2IOHA 3EHEA 1G2IA 3QUTA 5COQA 4X65B 3NYRA 3PFBA 1XIVA 3FCSB 4RLFA 9GPBA 4TN5A 2PGDA 2X5NA 2WUWE 3IP8A 3ZV5A 4YP6A 2XNJA 5I5GA 2JCYA 4KZKA 4XCVA 1RLUA 4B6RA 5MGBA 1ZSYA 2DULA 3VB9A 2ZYTX 1GKLA 5EJGA 1V35A 2C8LA 3EIFA 3M1LA 4UVIA 1Q0HA 5K8IA 1RI4A 2ZRKA 2DU8A 3C3MA 3GTOI 1EQAA 1P33A 2NO4A 4CLOB 3ADCA 2Q49A 1G8FA 4IUDS 5I9NA 5CFLA 2BDEA 4FCCA 2EATA 1FFDA 4Z86A 5IBRA 3RSFA 5EJ8A 1TUEA 1A98A 1RQ7A 4W9MC 1Z0AA 4OLFA 2O53A 5KNDH 4O0MA 1EEXB 1CHDA 1EHIA 3CCLZ 2RIPA 3PFCA 1SM4A 4OQXA 3I83A 4TZTA 1A2KC 4EY6A 2V7UA 3BSFA 5CBPB 1MD9A 1YQEA 2GH1A 3FLAA 4URHA 3DT9A 3QVWA 3R40A 4DJFC 4YFVA 4JQOA 4DDHA 4XGNA 1XRRA 4H7KA 3ETHA 4PXAA 4R16A 1K63A 1ZOLA 2WPNA 3TW8A 4WGFA 1G19A 1KYTA 1WSDA 4HNVA 2H5JA 1G6KA 1UP7A 2IITA 1I0LA 3TQOA 3W5DA 4B1FA 4UVDA 5FPQA 4BQOA 4U6QA 3NZEA 2Q7OE 3OQVA 1H2RS 4WUVA 2P1RA 2ZRDA 3QFFA 2QI9F 2H29A 2W2VA 3PE4A 5DLPA 1BVUA 3FDJA 4YA6A 3SIWA 3RYIB 1WLYA 3VJMA 4BQQA 5CT8A 2AF3C 1U81A 2O0JA 2PD3A 2CKDA 4Q19A 2NNWB 3TL3A 5A4AA 4LXUA 2GK6A 4GM1A 3BL6A 2WG2A 4W9NC 1L5YA 1Z5OA 3AM3A 3A0UA 2FX5A 5F2EA 4TYWA 3QFRA 4HMQA 4QHYA 5HF6A 3FVRA 3NFZA 3L1IA 1KWKA 1XMOB 1W5BA 2QN2A 5IK2D 1UINA 3AERB 1Z5VA 4GM4A 2WNHA 1EEHA 4GECA 3GLHB 1FY2A 2XQFA 3Q85A 4ZT7A 4KQIA 2HJSA 3AIOA 3BEDA 3KP1A 1FPMA 4OQ4A 1ATIA 1T5IA 3U0BA 3ZQJA 3PCRB 4ZVQA 2JNWA 3D8RA 3GD5A 4JY7A 4BTVA 2JLYA 4P7BA 4QXRA 3JWGA 5DVZA 1GWNA 1LQTA 1OI3A 2F1JA 2OT3B 3KJFA 3SKYA 5CAEB 1A69A 3B5EA 3FNGA 3JALA 3RUFA 3GAZA 3TLJA 1Z29A 1MC1A 1ZZEA 1PSDA 2BAGA 2D0PB 3PB3A 3FM9A 4H6WA 5D1HA 3P0JA 5AI9A 5DHQA 5JYCA 3B6EA 3SHVA 2ZYHA 4L2IA 2ZUFA 5E6RA 5BV1A 4EKIA 1YQTA 3KBOA 1OXSC 1S2IA 5BYBA 3R9KA 4IQGA 1DJNA 2I7CA 1O95D 1ZBDA 4GPBA 3SC3A 3SEAA 1VBNA 3NXKA 2GLUA 2Y66A 1N7GA 4Q3DA 1DQSA 1X0XA 3W9BA 2CMDA 4ZZ3A 1QFZA 1LLFA 3KUKA 3IA7A 4LBZA 4TV8A 5E8JA 2PVSA 3A0RB 4FOOA 4DNOA 2F3RA 3QI2A 4BV8A 1O7JA 5IP7I 2FPUA 1B14A 2V58A 4HGQA 4KPEC 3RU7A 3G8AA 4K8OA 5ETJA 2AGVA 3EY9A 1VQP1 1VL6A 3GH3A 4A6EA 1XRSB 5HIJA 3P9CA 4I5EA 1KEPA 4AYTA 5C7OO 4JT9A 4M21A 3EUAA 4S1OA 2VYNA 1VLQA 3ASYA 4J1QA 3ZV6A 4AY2A 5KHOC 4LA4A 1OGJA 1RRPA 3BRSA 4REQB 3ZDYB 3QU7A 5A5DA 5IDQA 5DRTA 2BZSA 1NUSA 4EABA 3O8OA 4MKFA 2AI3A 5KAPA 2X1MA 4ZMRA 3M6UA 3U60B 1KBZA 2YXPX 1VDMA 1KPGA 3Q6NA 3CCUZ 1IZ0A 2R4QA 2BONA 5DH9A 1RJFA 2OHOA 4C7VA 1SIWA 1ODFA 1UK7A 1R6DA 1QG2A 2P2DA 5KYNA 1BC5A 2BF7A 3THXB 5FBHA 2RGGA 2C31A 4RHEA 1IIRA 1RP1A 1ZL2A 2O1WA 1KFKB 2IDJA 4P3YA 1FNSA 3O8LA 1D0VA 3DFKA 4A3SA 4QT4A 4U3JB 1SRQA 3EG9A 3EZYA 3V2HA 1A27A 1W46A 2QD1A 4Q7EA 3UKOA 1T9KA 4ZEWA 4YMTA 5C51B 4KQFA 3F46A 2FSUA 1O94D 1RAHA 2QYSA 5FJJA 4YT8A 2DR3A 2WICA 1X8XA 1PJAA 3PS9A 3TIFA 4PNEA 4KOEC 4LN1A 4HADA 2DR0A 1I4WA 2J4FA 2WW8A 4L9AA 4LHWA 4P4TA 4I99A 4UM8B 2PDAA 4OQEA 5KKAA 3I23A 3EBPA 2RHBA 1QMGA 1TQ6A 2A84A 1OH8A 1HEYA 5C32A 2ZPUA 3RPEA 4ZI5A 3O1LA 3VSAA 3ZIAA 1UFQA 1YVDA 2BFFA 4II3A 4DBZA 4CM8B 3WYDA 2D8AA 5HKKD 1WSWA 3CE9A 4MK4A 3OE4A 1JQDA 4K0RA 5B3LA 3IEVA 2B5WA 2CZQA 1A5TA 1FSPA 3JSAA 3TJMA 2IVFA 3DHEA 3CMEZ 1WDKA 2FZEA 2X77A 3IB6A 2GPNA 1XTPA 1DO0A 2LBPA 4YO7A 4HWRA 1GXSA 1SC4A 1TUGA 5JI3E 1E2BA 1Z6XA 4M6WB 4JQCA 4ZYZA 4M99A 1Y82A 2HMUA 4MRMA 3SHWA 1W30A 2WRZA 2G80A 1TA4A 4XH9B 3LF1A 4Q24A 1Y8ZA 1G8YA 2E2WA 5KDLA 4BMVA 1K7EB 3EW7A 1UBSB 2R751 3B8HA 4HR7A 4BQRA 4N3CA 5B1IA 1NY6A 1DSSG 4E1VA 1ENZA 4Z3DA 5J1SB 4NYMR 1M0EA 1DL6A 3DLPX 5TT0A 3ZWVA 4O1MA 2VPZA 5EYPA 4C89A 1CNFA 2XQGA 2G5TA 5ED0A 5F52A 2Q1TA 4A8PA 2DPXA 3QJ5A 4U9HS 1B16A 3BXXA 1YT5A 4I8XA 3IB3A 1LF5A 4A3DI 4Q7KA 4LWPA 3BFXA 3RS7A 1ZB8A 5FBQB 5KNCD 3FOWA 4AG3A 1HYQA 2O3QA 4YRKA 3TTWA 3AIIA 4MW4A 2W22A 3B52X 1NKVA 1YQUA 3KVVA 4I1SA 5DZSA 3LT4A 1PTKA 3KR1A 1YQWA 1C9JA 1SXJD 2BTOA 2PGIA 4DR2B 1FPQA 1UWCA 5JJIA 2JD0A 1WCXA 4JMLA 1T9AA 1HOXA 2CV2A 1KR2A 1FRNA 3L4BC 4KYUA 1XXHA 2VBCA 4YBRA 3EQ9A 1YIOA 4YAIA 3JQAA 5D3MA 2I22A 3H1BA 5KYYB 2O7SA 3P2EA 4YDQA 3T95A 3ZWQA 2MU1A 1QV9A 4JA2A 3P9ZA 1HDOA 3PFGA 3T7JA 1H2XA 1EHCA 2BKUA 1MQAA 3QVUA 1DQZA 2QRMA 2Z8YM 3FZYA 1S8AA 3RJMA 3O7MA 1DKLA 2O07A 3AH8A 3FBWA 3CA8A 3GVXA 4FOLA 4MO2A 4LC9A 5CH5A 5BN5B 1M2KA 4D56A 4E21A 2CV0A 4P80A 1X6VA 4MDEA 5JQGA 3UW1A 1JS1X 1JEEA 4BNUA 1ZJWA 1UXJA 4Y6OA 1VYUA 5CURA 3NS7A 4AN1A 1T2VA 2PIAA 2NUAA 4CQMD 5JSHA 3CC2Z 4GP7A 1SQFA 3EFHA 4TVOA 4YDSA 5DFAA 1VIAA 3BE8A 3VH1A 2CW5A 1NE7A 4CL3A 5JSZB 1NVFA 1IN8A 1TUBA 2C5FA 3O2QB 2G28A 4TWJA 3S28A 3R77A 4I4TA 1HSOA 1O0SA 5EHNA 2PRIA 3PPIA 1BJTA 2ILTA 1L7QA 3JQGA 2NTNA 1FFWA 1MGPA 1Z4KA 3GJ6A 4IIEA 4LECA 1PF7E 3V5NA 4AULA 1Q6ZA 3W8DA 3PUIA 1XXHE 3DKIA 4UHCA 1SPXA 1WEKA 4KXWA 2NUPB 1RTKA 1S89A 2DQYA 3DR5A 4HN2A 3DHNA 4HNTA 2VPTA 1NONA 3CXCZ 2QL5A 4PGMA 2VQEB 4F60A 5FPYA 1AV7A 3S7ZA 4ZN6A 4D99A 5HIAA 3U62A 2OKGA 1PGPA 2D2IA 5HILA 2H1RA 2ZRMA 2A5LA 4JYMA 3CJQA 1DLJA 1CQJA 3EERA 3GPBA 2XYRA 2X0NA 5B7NA 2WYHA 4BNNA 1U3TA 1GKKA 1UK6A 4PRKA 3RSQA 3KAJA 2WF7A 2QGNA 3CRNA 4Q9DA 2ZXFA 3IELA 2B3TA 2D5BA 2R62A 2ZJ3A 4JBGA 4OHRA 2WNIA 4C5BA 1X1SA 2WYWA 3I8XA 4IVNA 5IKPA 2AI1A 2P6PA 4G5YA 2GVNA 4N1AA 1PK7A 4Y30A 1AB5A 1PR1A 4BVBA 5IBCA 2OCBA 4M86A 1QNFA 1EZ1A 3FROA 3FZNA 1TJ5A 3PXBA 5DF1A 3SZGA 2B20A 2N46A 4FJ0A 4RMNA 4XSVA 1R5NA 3DQPA 1HFEL 1P7WA 3MCTA 1XN1A 5CVEA 1YBMA 4KQJA 1JDVA 2CLOB 3EXHA 1J5PA 2I6GA 3CR7A 4C01A 2ZWOA 1I2AA 2HHJA 3SEFA 2EFDB 1KZGB 2WU0A 4MRAA 3RLFA 1JDBB 2JLZA 1FP4B 3NWEA 6Q21A 4RXMA 2HTEA 1QRDA 2G0AA 2WIBA 3IDAA 4V24A 2W2KB 2WI8A 1N6KA 3PLNA 3ADKA 4QDUA 3G68A 5DN6D 3GF4A 3L7YA 1DAPA 1IHXA 4RVFA 4CI9A 1RHMA 1X1TA 2J08A 1HQCA 2BH2A 2LKDA 3LQYA 3MN1A 4FUQA 2JK1A 1KDOA 1Z4IA 3OP4A 3QMPA 3OIVA 4NOLA 5JWRA 5CXXA 1RWOA 2P67A 3DUFB 4JQYA 5AOBA 1F6WA 3WL4A 1LU9A 4J0QA 4N6NA 1W5TA 4X7MA 2V7QD 3HO8A 2ZANA 2VH5R 2QE7D 4QQRA 1T2AA 1VL2A 1L9XA 1X7GA 3D6NB 3IURA 3TRDA 3UAYA 1QC5A 2GZ1A 2XGSA 5EQDA 1ZNYA 1JIQA 3TDMA 4HH4A 5ICMA 5CT9A 2IBTA 4UE3S 1UT6A 1JA1A 2F7SA 2OYSA 3REOA 3ZCPA 2WIAA 3QU5A 3EZ6A 2DP4E 3F6PA 1OKKD 2GJSA 3IH5A 4MEAA 1GR1A 1TCVA 3BMOA 4IOKA 3DMNA 4R8LA 3U4GA 2P7IA 4AY6A 2XY4A 2F4MA 4XSGA 3TB6A 4YMSA 2F43A 4J0HA 1WIIA 4R2IA 1DBIA 4KWCA 3ZYZA 3JWEA 1LRLA 4GX1A 4HZGA 3A9UA 1NBEA 2QZ9A 3PC2A 2OWEA 5D01A 3K20A 2ZIAA 3S40A 3SYNA 5KNBA 2JANA 3QLUA 2QKYA 4RZ2A 3D7KA 4L08A 4JZKA 1O8CA 4J16C 1NN5A 4LTNA 3KS9A 1NAIA 1TM1E 2HSGA 1E1YA 5C7YA 2QBYB 1VIYA 2NVUB 2HT6A 3RG8A 1G9XA 2R1TB 3S2ZA 3R8FA 1W8DA 4K8RB 5CXQA 3ZDCA 3NANA 1UH5A 2C3UA 3CCEZ 1DV1A 3QWUA 2ZCUA 3D2BA 1EX6A 3JTEA 2PYDA 3WNVA 4NE2A 4CM5A 1TC2A 1XZGA 1OHHD 4W8HA 4B7XA 1JF8A 3C7DB 1UF9A 4DMCA 1E96A 3QEKA 3RVRA 4GC9A 1VHLA 2J5QA 2CL6X 3FMOB 1MQSA 3L0IB 3GNQA 1YC2A 3KU4A 2GM5A 3L06A 4BO7A 1PJCA 2BGMA 1C7ZA 1I14A 3IT0A 2RJOA 1SQGA 1WHSA 2PM8A 5AIBA 3HKCB 1I0ZA 2RHCA 4JJ8A 2OAP1 1ZGBA 1QO9A 1YRYE 3V1NA 4P5EA 1G21A 2F17A 2X1LA 1JLRA 2IP2A 2Y76A 2ZRLA 3JSXA 1D0IA 4JWKA 3RVKA 4JZYA 2D7CA 2DBYA 3AF4A 4ZI3A 1Z28A 1A8QA 2M6SA 2DPLA 3O5AA 1KIAA 5IVDA 4PPNA 4WL0A 2FLKA 3MD0A 5SYMA 3L6UA 3R7FA 1TYZA 2EKQA 2Z04A 2CXSA 2H59A 1EXNA 1PDOA 1XV5A 1MU0A 1SXIA 1T10A 2WHRA 3F7MA 1IJBA 4YRIA 1KJ9A 1RE0A 4AJLA 1LPSA 3ADDA 4V1CA 3TIXB 2RGAA 4LXIA 2GBPA 3ONNA 3ID6C 2P75A 3JARB 2PV7A 3PX2A 5G40A 4RDCA 5BQPA 5F7JA 1RYEA 1ZK2A 3T7AA 2Z5GA 4DZRA 4ZFNA 2JCGA 1LA2A 4AJ9A 3VAZA 1HY3A 2VCHA 3SU8A 1SCKA 1DKMA 2B7BA 4BZZA 3QXSA 5CA1A 1AVTA 2X40A 1XRNA 3DEAA 1MFPA 3HFRA 5AWFC 2XXAB 4DCJA 4NE7A 4N0QA 2AZDA 3GEMA 4Y9SA 2WD9A 4BFVA 1LSUA 2OPHA 5KX5F 4BKPA