2GTIA

Mutation of mhv coronavirus non-structural protein nsp15 (f307l)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYLITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 78
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gtiA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gtiA02
4RS4A 2H85A 4S1TA 2RHBA 2GTHA 2OZKA 2GTIA
chains in the Genus database with same CATH superfamily
2Q41A 1W6RA 2WDZA 1R8XA 3AEQA 4IQ8A 1DRWA 1VKZA 1P2TA 4QODA 1K0UA 2V6IA 1W19A 1KO4A 5DHAA 5EL0A 4K0KB 4N3CA 4G23A 1H1LA 1NR1A 3A3PA 4L8YA 4GZ3A 4KE8A 4PZ0A 3U3OA 1THMA 5HZGA 3O2QB 2RHBA 1XUOA 3O26A 3SVLA 2JHFA 3H2BA 3ZNQA 3LQYA 3RWOA 1WXDA 1BYIA 3AIOA 3NEYA 4MQ4A 4O5OA 3T12A 4BN0A 1YD7A 3KPYA 1UC4B 5FX2A 2QM0A 3D31A 4DAOA 4PR3A 3GRYA 2WG2A 4IV5A 4UATA 5H16A 3H5RA 1QG2A 5DN6A 1EWQA 5E2AA 3CPJB 5EPOA 1N32B 3AY0A 5I9IA 3U4DA 1UK8A 3ZDCA 3RRNA 2UUBB 3HCAA 2C3YA 4IMRA 5CA0F 2ZIFA 1MB0A 2ZIZA 3GFVA 3TD9A 2Z9DA 2NO4A 3FHCB 3N7TA 4U7HA 4H0NA 3PL5A 4UQPA 4YNBA 2R6GA 3QITA 5JVDA 1A72A 4UBIA 2JAXA 4I9NA 1S02A 3GJ4A 2XDAA 2BSAA 3FNHA 1ZJZA 3WAKA 1CZUA 5DM2A 1YJNZ 2RT9A 3TR6A 1X92A 4CDMA 4RCYA 5CCDA 5LDDC 1G8SA 1RQNA 2PWYA 4BJ1A 4Z7NB 4F4CA 2QLFA 5ALEA 5I3ZA 2H2AA 2QMHA 1P0IA 1E3MA 3HNOA 5HOEA 2EF1A 3LFTA 1TYDE 1DWPA 4MUKA 4P3XA 2AH5A 1I9CA 5CT9A 5A2GA 4I55A 4YRQA 1FYFA 4D1YA 3IQHX 1EA7A 2OXIA 4DM3A 3LSTA 4V0KA 5DXAA 1H65A 3UFBA 3HY4A 3R3UA 5G0WA 3IT2A 3VBEA 3UGJA 3HYLA 4XR4A 3RDPA 3WKCA 3DC7A 3DNPA 1JQLB 3HXPA 1NUAA 1ODFA 2QVYX 2VS1A 2VP0A 3CXUA 3OI7A 4PHTA 4HEQA 3ZV3A 4HJRA 2GN6A 3TECE 1QUFA 3B6EA 2FEXA 3ESBA 2R6JA 4KMRA 4BBJA 1OE0A 4MA5A 4NG5A 3N3AC 4FLMA 1S8OA 1N92A 3MJEA 2CVZA 3CLVA 3C3CA 3W3AD 5CW1A 4CLDA 4O2RA 3VNAA 1ISJA 4RTJA 1AMUA 1KYZA 3LZCA 1Z0JA 2HCBA 3PVSA 4MR9B 1EDBA 4ZQBA 1Q7EA 2ZSJA 2VA9A 2FPRA 2JEZA 3KYDA 2A5JA 4JB8A 2M6KA 1D2HA 1QDLB 3VRHA 1NKVA 3COJA 3FB4A 5JO0A 1URPA 3MINB 4EJSA 4M9UA 4UTOA 2JIZD 1DXOA 3OFNA 4RBNA 3T95A 1VI6A 4IBOA 3WK5A 1AXEA 3FKSD 3LPLA 5ANRB 2BBTA 2WTBA 5F1OA 5LQUA 4KJZA 2HBZA 3STTA 1HH4A 3TEJA 3WLJA 3B7GA 3CGGA 1YH3A 3FMFA 4UZFA 4L8VA 2BFFB 2CCKA 1KZHA 4JJIA 3UJBA 3LJKA 5FO0A 5K5EA 4ZEMA 3GHHA 2C2WA 3A7EA 5IARA 3MF4A 1N8KA 4O4HF 2WUWE 5IFKA 1P1HA 4AG3A 3H42B 1EUCA 1IJFA 1EPUA 1P0QA 1U8AA 4O2AF 1DIBA 4X6UA 1AUQA 2LR0A 1BMDA 1KE1A 3AHJA 3FSGD 4WCFC 2W2PA 2LCQA 3Q10A 4E46A 5LIRA 3QE9Y 2AUNA 4B3HA 5KTTA 1ORRA 3PA6A 2FF7A 4Z2YA 5DNEA 4ZGWA 3E4CA 1P4RA 3TINA 1M2VA 3HRIA 4XQ9A 4BJ3A 3TR0A 1R6TA 1UPAA 3OM9A 4YCSA 3JD4A 4L5YA 3V8MA 3FKJA 2QXUA 1YR2A 2E85A 2IODA 4KQGA 3FOEC 3KWFA 4IH4A 1YR1A 2IYFA 4J90A 4PU0A 4W9RA 2AN4A 4DA7A 2I67A 3RVMA 4CCYB 4OQDA 5LCXA 4A1FA 1G21B 2X0IA 3LX6A 4CLXA 5F9HA 2DWUA 2B8WA 2NXEA 2XAUA 3CBQA 3S55A 4BQIA 5GJVC 3F9RA 5KPDA 1FQJA 1KKMA 1OLUA 4X1OA 4L9AA 1MIHA 4IP0A 2HT1A 2X14A 1X7ZB 1ZVMA 2VP2A 4GX2A 1GYQA 1OI4A 2QSUA 3I2FA 4PINA 2YN0A 4L78A 3U3ZA 4I5IA 5JJBA 4CCSA 1FTSA 1OH7A 4W1SA 4DRYA 4BLWA 3EZFA 2VJAA 4JN6B 4NBKA 4I1SA 2BI7A 4P4SA 2X5KO 5EKUA 1UJ6A 3GKQA 1T5TA 1QNFA 2YW9A 1YOVB 3ROKA 2I1LA 4AMYA 1L5HB 3PGKA 1LK5A 3A6JA 4JZYA 4DUPA 3EXIB 5HKLA 3GF4A 2B34A 3ETHA 2Q4OA 3EGIA 3JYQA 4EUNA 4D0GA 4TM8A 5TPWB 4EUFA 1WUJS 5EJEA 3U61B 4Y6SA 3FOAA 1W8DA 3NYRA 5ED4A 4IIHA 4BTLA 2FMKA 5E6UA 5TF4A 1EUDA 4MZXA 2JJQA 1OJLA 5G4KA 4ETMA 3KSAC 4J7AA 1CE8B 2HWKA 3H17A 1ADJA 1RCTE 2VAWA 2NVXI 4EG1A 5C4MA 3CVVA 1QYXA 2ZOSA 3DR3A 4W6QA 3ZLJA 3R23A 3CC8A 1J06A 1FVFA 3BQNB 1LF5A 2P9FA 3WGUA 1DQZA 2SECE 4RVUA 4GPEA 5K0BA 3ETNA 4G41A 4DV7B 5IBCA 1KI6B 1RRFA 3DAOA 3R0IA 4I8IA 4QXAA 3ZHYA 5JQGB 4M1SA 5EERA 3OCCA 4CF3A 4C7OA 3EXEB 2OUIA 4YUYA 2YFYA 2HMVA 5CD9A 1K0FA 1SCKA 3AJRA 4DCGA 3JD1A 4JLVA 1C7RA 1JLRA 4ACBA 4YMSA 5KTOA 4OPMA 3B52X 1DC6A 1CQPA 1HNXB 3S40A 1P9OA 3W8EA 3AT1A 3T7JA 3WOVA 5TRTA 4DG9A 1MG0A 1X1TA 2CLSA 3B1FA 3I5YA 3CVUA 5SZHB 1SA0B 1T2UA 2V3VA 2B1RA 3FCUB 4KQ9A 4Q16A 2ZZMA 5E0KB 1REQB 1FUEA 3QNUA 2LIYA 5JRZA 5K0SA 2ZRBA 1Z6AA 2PD6A 4C3ZA 3K0AB 3V48A 4DKXA 2R751 3ABZA 1VHWA 3B6MA 1H4VB 3G7SA 3MT9A 3K9HA 1CETA 5F4BA 1NG1A 1YQWA 1XROA 4P33A 3KUCA 3UT5A 3GAZA 4I55B 4LHYA 2GLUA 1XP8A 1ZISA 1HFEL 4EB6A 2KWIA 5CVJA 2H54A 4IH1A 4GOOD 2HA3A 3R3HA 1RBZA 3IDZA 3JALA 4I8XA 1Z4NA 5I8ZA 1L7BA 4XSHA 4G5HA 3ZDZB 4NABA 2FW6A 1XQVA 1GCIA 2AOTA 2D1QA 2XAAA 2ZM6B 1N8R1 4D3SA 3PSHA 2GJ4A 3LNCA 4L75A 4D57A 1DZIA 5BW4A 3KD2A 3GCFA 1VCOA 1HQDA 1RJGA 2OHIA 4JR0A 4S1WA 4UEQA 1XNJA 3WKAA 1AQJA 2YWHA 4XLZA 3U1BA 2B7CA 3MTJA 2QQGA 4FFBA 1W25A 3VPSA 3C5CA 2HIGA 4MV9A 4QZVA 1JFSA 1K66A 1WQ1R 3G6KA 3R8FA 2XH8A 3CRVA 3A2LA 4BUZA 4TTQA 3L8YA 5DBEX 3VZCA 4OHVA 3U44A 1D4FA 4HH3C 3FPSA 4EJSB 2PS9A 4JBIA 3PT5A 4P5EA 1T4BA 2DX7A 2JK1A 3CLSC 4FS3A 4JLOA 4L4ZA 2VUSA 3Q2IA 5B2FA 2A1IA 2WYHA 3MTAA 4UDOA 3RZOI 1U2SA 3RHTA 3PPVA 1XQXA 4U2CA 1VHLA 5IBRA 3HCOA 4I6GA 3RUPA 2BISA 4WOBA 1G5TA 4EPTA 1IBSA 2W6JD 4EBBA 3CJQA 4CLRA 3TLGA 2I2BA 2ECPA 1IXYA 2JLCA 4N54A 3TFOA 4ZA2A 4Y6OA 4C07A 4GE3A 3O47A 3HYSA 4MAAA 1RR6A 3CLTD 3S70A 1A5TA 4PICA 3PF8A 1QRUA 1TIKA 5AW5A 3VV2A 1Z8FA 3UA4A 4BB6A 2EX1A 3OCUA 4X9XA 4U9UA 1VECA 3PFGA 4Q7JB 2XWBF 2WI8A 3ELBA 1TC2A 3K4HA 4V0LA 2XTMA 2PMCA 3AFNA 3GFOA 2R6FA 3F9IA 3LCMA 2X6QA 3OFSA 1E6CA 5DB4A 3K0BA 5KYKA 4OJMX 3K31A 1G7CA 1VLLA 3OTHA 3G7UA 3QTLA 4ZAWA 4BLOA 4PQFA 4W1RA 4CZ2A 3QQ5A 3UB2A 2H51A 5DRYA 4Q3DA 5EWLA 3QOFA 4FDUA 2PNFA 2HCRA 3F7NA 3LY9A 1KZ6A 3OTIA 4WASA 3ZDDA 3KT8A 2KJQA 4FYJA 4GU5A 3BB4A 4IGIA 2IHZA 3USZA 3HA3A 3HJAA 3VI3B 1EQ2A 2FN7A 2OE2A 3VVCA 4ARAA 4WINA 3V5NA 4MQ6A 1A71A 1G291 3JYNA 1F5SA 2GBCA 5FNZA 4B35A 1Q861 3DMFA 4TYNA 2XXAA 3Q3IA 3KQSA 4IIJB 1SB9A 2D1RA 2XW6A 3HBMA 1A7JA 1UZLA 2Y4OA 1EFLA 3TF5A 4ISCA 2NAPA 1T9BA 2ZP1A 2IS2A 4WBNB 2EFJA 4NDZA 1DC3A 3CH6A 2OBMA 1TRKA 1SU8A 4M7PA 4WNIA 1GZDA 3ROFA 5KJ6A 2O59A 2FVYA 2F4MA 1EFUA 3L6CA 3LPMA 1WLYA 2VTVA 2HV8A 2P4UA 3ZE9A 4CEIA 3MAAC 3VHQA 4AMBA 3LY8A 4MI9A 4TS4A 1FLDA 3W06A 3PGVA 3HEBA 4Q3CA 4FCWA 2H5EA 3SJZA 4Q7MB 4YQFA 5EGSA 2QL5A 1QIMA 4GP9A 4FMDF 3LHKA 3H9BA 1E0SA 3RHZA 1MW9X 3QVMA 3OZDA 2NVYI 4IGFA 4MW7A 4E1VA 2QA4Z 4GM1A 2QG6A 2J32A 3T5AA 4O08A 4HYQA 5B53A 1S3FA 3SSAA 3J81f 1W7AA 3VPGA 3JU3A 5H0IA 3QPVA 5LQCA 3NDBB 1EDEA 4X6YA 4DV4B 1RI1A 4P7FA 4Y1GA 5CB4F 1KKUA 2BFEA 2Z3ZA 1DJPA 2AFIE 1E4EB 1VHTA 3SDBA 1UZMA 1R9JA 2RGWA 3BEOA 4ZO9A 3RARA 3VVLA 1V25A 3BBLA 4G4SO 4M37A 2JA5I 3I9KA 1R0ZA 4NBSA 5DI9A 5J43A 3DAYA 2G4LA 3B1VA 3JQAD 1ZB9A 2RKOA 3NBQA 4IVRA 4NARA 2W22A 1EQUA 4QU9A 1EZ1A 1P2DA 1SC9A 4FW8A 1XJCA 2CB0A 3OQMA 5BN5A 1HV8A 3MZKB 3QJYA 2A0UA 4C0AC 1FMJA 3SC2B 4WOCA 4QXMA 5K1ZA 4Y9RA 4H6VA 4DLRA 1Z7YA 1UDCA 1HF3A 4GXNA 4JX8A 3T5BA 1CXZA 2XVXA 5HFAA 3FCOA 3IVRA 5IS2A 1W8IA 5H3HA 3QWFA 2H31A 3VKUA 2JI8A 2R6MA 2X1LA 3VR3A 2NO5A 1Z01A 1MC5A 3NH5A 2EP8A 3FMIA 3QM1A 4QPDA 5HFNA 2GXSA 3PQ2A 1QYVA 5AW1A 4MV0A 1D07A 1Z0SA 3AI2A 3HPRA 1YS4A 2HK9A 2NXWA 4IZHA 2VRBA 2AYYA 2H65A 2WA1A 4LZOA 2H4ZA 1J9ZA 4N3AA 4R1TA 2PX4A 2ZWIA 4YJ2B 2QJTA 5EC8A 5EUCA 5HCUA 1QHNA 3ML1A 1Y9ZA 3IOBA 1SKBA 3GAFA 3RSOA 4EECA 1NUQA 3N07A 1JDBB 3H2JA 3FOWA 1CUYA 5KTYA 3LW7A 4KIWA 1AJEA 5GP1A 1AB5A 5BY2A 3O93A 1GO2A 1PZEA 2GD0A 3QVGB 3V97A 1XLVA 2IS6A 1A95A 3PC4A 5FYQA 3VC2A 1K5GA 2IDKA 4L1KA 4BNTA 5EIXA 3ESCA 1R9NA 1JR3E 1XAGA 2FQ1A 3DHVA 3EXG2 3IJEB 4RTMA 2CXXA 3T34A 1AVTA 4RHUA 1R6XA 3ZHQA 1XYYA 3VR1A 3UPTA 1KY4A 1G5QA 2DFLA 3FGNA 4R2WA 3EOAI 4P3OA 4DA6A 3P32A 5BVGB 3HHEA 4YMWA 2ZI4A 3IX0A 4GRIA 4DANA 1B8NA 3BWVA 3VKGA 4BO1A 1ZJJA 4KDRA 4YO7A 3A4VA 3CSUA 1PT9A 4BAUA 2FK8A 1AK1A 4LGVA 2LZ0A 3G17A 3GRKA 3RKSA 1Y6FA 5AJYA 2R4QA 3O3OB 5LP6C 5TJ9A 2P2DA 1EVIA 4DPMA 4GFDA 2ODQA 2NYAA 4WLVA 1K5HA 3CCE1 1C3OA 4O25A 4P3YA 2I5PO 1TGYA 2VHCA 1E7MA 1B4DA 2QS9A 1Q0PA 2AEMA 2BWJA 2QVBA 2PPVA 2WJYA 3BXOA 3HZHA 3Q7TA 5IAOA 1KTVA 4FI3C 2ZATA 4L6IA 2W6MA 5H59A 3TYXA 2WFMA 1ZIOA 5D5HA 1KD11 1E63A 2RIRA 3MM4A 5DSTA 3WMWA 2HDOA 1WMDA 1UEIA 1YL5A 1JI3A 3K1TA 2PUFA 4BLUA 3GLKA 3GTOI 3MQ2A 3GAAA 1ZK1A 1K8XB 1FFBA 2X42A 3OJXA 4M1OA 4PWZA 4RJLA 5ESWA 3O74A 1NJ6A 3C3YA 1OI2A 3H9EO 2F55A 1T4DA 1ZHHA 1YTUA 1RRPA 3P9ZA 3TXXA 2RHRA 3DZIA 3ZIAA 1ZM7A 2ZE6A 4CE6A 2E55A 1F9EA 4OGGA 2Q6LA 3WDMA 4RVOA 3AHFA 3T4NB 4Z7OB 3D8TA 4Q4AA 1PT7A 4HDOB 4YAEA 1KOFA 3ENWA 4I9GA 2B3DA 3ZEAA 2WUDA 3NW9A 2DQYA 4PYOA 3VMFA 4EA9A 4EW3A 2XXAB 1U7OA 1G20A 1NBIA 2M48A 3GV0A 4ITVA 1IEXA 1EK5A 1KR5A 2I78A 1A97A 4P4GA 3T7DA 5TLSA 1VMIA 1ZVQA 2X5OA 2R96A 4X6XA 3RTDA 2QXYA 3AFMA 4L5IA 4H1WA 3UUWA 3ZHXA 3C43A 4EX6A 1M75A 1D0VA 2UYYA 4ESOA 3MTGA 4NL4H 4ZQCB 2ZRAA 4A3EI 1FX1A 1J25A 1NYTA 1XZEA 2YV3A 2C7VA 4ZI2A 1IHYA 3LD9A 4RIEA 5DJ5A 1ZH2A 3AR4A 1IZYA 2M1XA 1W2HA 3GYGA 1XCOA 1H5NA 5J1SB 3L4SO 2R79A 1W5SA 4D81A 1W88B 3HEAA 3SHTA 3MWDA 1L7XA 4IJVA 1C1XB 2CKMA 3ZW9A 4Q37A 1ZH0A 5CDHA 3BSSA 2O2YA 2PZAA 3L1JA 5AK3A 2F59A 5L3QA 1UPFA 2VJMA 1N2XA 1O87A 3EISA 1PG0A 1FY2A 2IIVA 2FSSA 2IZ5A 1MGPA 3PFKA 3DL7A 5FUBA 2INGX 2NU9B 1BHSA 1L4GA 3ZHCA 4AJLA 3LLCA 3DMPA 4XWAA 4X66B 2QB5A 1GCUA 4FQ8A 3ND5A 1KI8A 1IHDA 3ZEIA 2DPLA 3SS7X 1O8BA 1UFQA 3C8HA 3TTXA 1SXQA 3AVTA 3S2ZA 2A9QA 1OFUA 2YH2A 3ZK7A 1ML8A 3BMOA 3RO7A 1XMSA 1WBDA 4JI8B 2Q27A 1GLNA 3S6JA 4F1KA 1C80A 1O6FA 3VSBA 5GM1A 2BI4A 4X00A 1D2AA 3I37X 1MDFA 1MJNA 1VKOA 1Y63A 1FP4B 2QTCA 3DCYA 1N3BA 2QUJA 3EIXA 3JZMA 3CF4A 1XEFA 1T5DX 1U80A 3FBTA 4TXLA 4AN0A 2RI1A 2GN9A 1IATA 1ULZA 1E6KA 1KEWA 1DQPA 1PN3A 1Z5UA 3EH2A 3QGMA 4YQYA 4XVRA 5CCBA 2BSQA 1XKXA 1V1MB 1YB5A 1C8LA 2KI5A 2MHCA 4NOKA 2QUKA 5ITZA 4PQGA 1AZSC 1FX0B 2CNKA 4KH0A 4Z7QB 1XWFA 1OY1A 1GARA 3ZBTA 4ZZ3A 3TLKA 4MARA 4YC7A 4TKZA 3ZLTA 2CLMB 1VSUA 4H0FA 4Q1DA 4BTEA 3ZE1B 1DCKA 1YMUA 2K2WA 2WEKA 4IWXA 5KWVA 2O6HA 2ABWA 3VUEA 4UAGA 4LN1A 3G9UA 2BBSA 1LDBA 2HPVA 4HJXA 5TPWA 1XHEA 1ATIA 4UUAA 3PLRA 3PU6A 5AKYA 2R7ZI 4IHKA 2ZI5A 3QPBA 4G24A 4HTFB 1Q0LA 3K1AA 3OZFA 4KK3A 2IYVA 5DGTA 5K45A 1Z82A 2AKYA 1BS9A 3RAGA 4MROA 3PI7A 2YVAA 4F97A 4GLFA 3QX7A 3SGLA 1W581 3N2KB 4JX9A 1KMHB 1BXZA 2L18A 1E60A 3ENQA 4KU4A 5CRIA 4N8DA 1II0A 4EY3A 3WADA 4UOQA 4DQVA 1U4SA 3V1KA 3P1JA 3S4YA 3KG2A 2OUKA 5J40A 2ZB4A 1TZBA 1USWA 2GEVA 4KMSA 3UJAA 3VPAA 5ADVA 5F2KA 4RKQA 4QTTA 1NBMA 1JT2A 1K86A 1UT6A 3TIIA 3L7DA 5AUOB 3X1ZA 5DU2A 4AJHA 5EKXA 2Y1EA 2XI4A 3E7FA 4NBBA 5LC1A 3F7TA 1TU3A 3E9QA 2R8BA 4PXAA 1FVOA 2EF0A 2Z2YA 2GZMA 2ZIEA 3FYUB 3QUSA 1KEVA 3UHJA 1PZXA 3FTPA 2OZPA 1I1OA 3OZ7A 4XVQA 3WMRA 1Y1QA 2V3WA 2ORIA 4N4AA 4PN7A 1HT2E 2C54A 2C4MA 2Q5OA 5UKDA 3V1YA 4AC9A 4B34A 3PDJA 1GNPA 5EHNA 4A2PA 3HYTA 3NO4A 4LOAA 2OL4A 2YICA 4BPRA 2I99A 3ZHSA 1KEKA 4CUKA 1N2GA 4GP6A 1DIGA 4D9NA 2NVTI 5IULC 2AWOA 3OIUA 5C7OO 1ORDA 2FB9A 4M60A 5FI1B 3F1LA 3KYCA 4ZQEA 2OFFA 4UUPA 1UOPA 1Q3KA 1QVFY 4A3BI 4ER7A 3QX3A 4LTMA 1KNQA 5AUPB 4I2VA 2C04A 1KBZA 5KNDH 3ILHA 2FN9A 1D0SA 4RX1A 2FPMA 4RYDA 1Z5ZA 2VHWA 1P17A 3WLPA 4NCAA 3KZVA 2NTVA 4LDPA 1LJUA 3CKLA 3SLGA 3ZU3A 4CKYA 1IXRC 3QFHA 4IHJF 3MC1A 2C5LA 2OTJ1 2O7QA 4H17A 3I6YA 2ZRGA 3T61A 4G65A 4CM7A 3ZYZA 5AHWA 4P35A 1HUQA 2W6JA 1J0DA 2GVZC 3L2OB 3S7TA 3AKYA 4V03A 4XA8A 5A3QA 1KQFA 4EWLA 3V7UA 4YP0A 3PR1A 3NFRA 4KACA 5JNSA 3G2HA 4QO8A 5MHTA 5FOUA 3KIPA 3PS9A 3GTQI 2GPSA 3CB4A 3FLEA 3F73A 4GOMD 4C04A 2PLFA 5IK2A 1JJIA 5AFSA 5K0FA 1R18A 5KOHB 5CHEA 2A5DA 3K9GA 2VPPA 1F4VA 4A3LI 1RT9A 1DRVA 4A8PA 4OHOA 3EIWA 1KO1A 3SEFA 5L6MB 3H11A 3KV3O 3QKSA 4KQFA 1MD9A 5J2UF 2C58A 3HJRA 4L8FA 1V8OA 1Y1KE 2CHGA 2UZIR 3EUEA 1A82A 5AK5A 1UPBA 2WWWA 3GRRA 4HI0E 3MBKA 4YRJA 4ZEVA 4RU1A 1M7BA 3ANSA 2H08A 8ADHA 2FZKA 2PL1A 3U3DA 1LY1A 2O07A 2E82A 3FSGA 2IV3A 5KNCD 3D8BA 4JI7B 1U6IA 3GFGA 1ZGAA 3VPDA 5LMZA 4TYYA 1LBHA 1W2WB 2Q29A 4MUYA 3VFDA 2QA41 4DQYB 1AD2A 4L72A 5DF1A 2EHJA 2OCGA 1ZN7A 2EJCA 4YRDA 4NCHA 1XRMA 2I4TA 1IZZA 4NICA 4PQRA 1MENA 2X9QA 2ODAA 3GPBA 3KNZA 2XUHA 2Q2QA 1JH8A 3V1MA 2UZ0A 2OPHA 4KPUB 3V8PA 2ZWMA 1NJSA 2C8LA 3CEMA 3OIWA 1Q811 1OPXA 1ISGA 4GKBA 4MXUA 4HNHA 1X2EA 5THKA 1ZSYA 5E95A 5IVIA 1OROA 1TTTA 1YZKA 4XEHA 5BURA 3NNDA 5AJUA 3ROMA 2IYOA 5LP6B 4IJMA 4WPGA 2ZJ0A 3RS4A 3ZUPA 1DO8A 4L4SA 1YJAA 2BGWA 3KVOA 3S15I 2IHVA 2B2NA 2O2EA 5T5QA 2ZUTA 3R3JA 2WYVA 3UMBA 1NJFA 2OXCA 1EB8A 4ZMRA 1HY3A 1L4UA 3KRTA 3UHFA 3N75A 2JVKA 4PW0A 3WTCA 3D7NA 4LNAA 1OWPA 2DHDA 3HNPA 4BQEA 3TLEA 2CUTA 1DV1A 3IAS6 1PNOA 3OEWA 1PWHA 5SICE 3TRFA 3SZ3A 4YT2A 1D9ZA 2FH5B 4L50A 3B13B 4QX6A 3ZNOA 3NAMA 1GQFA 2I8AA 3BXGA 5LP6F 1J33A 4ROTA 4HG2A 4MX8A 5EESA 5ER9A 1KQOA 5DP1A 3H2GA 4KIUA 5EINA 4G8BA 1C7EA 1SZJG 2NSLA 3WY9A 3I4FA 5C7IO 3OO1A 2X9VA 2G83A 5C35A 3ZWOA 1BX0A 1C1HA 1Q0ZA 3ZWKA 3LCUA 2NVQI 4KXWA 1KK0A 1UK7A 3OPYB 3I1IA 1DB3A 3WKEA 1MP0A 4Q9AA 4AY4A 2H8KA 3H6HA 2YWCA 3EXIA 4J1QA 4CG0A 2A14A 4MWZA 4AZ0A 3KHSA 1XRQA 3CO5A 1HT1E 3WYGA 1GRVA 1QE3A 3DMHA 3OPXA 4QBFA 2PEYA 2JIQA 1XCGB 5EOVA 2GSWA 3LPAA 1A69A 4NZMA 1X7WB 3SX0A 3U9LA 1YC5A 4V0RA 1L4KA 4OF4A 4AF6A 4WY8A 4C3OB 4NBHA 1J49A 1PUJA 1AY0A 4DUGA 3UBTA 2P68A 3S29A 2C7QA 1XQ1A 1XTUA 5EPUA 1S7MA 4L3WA 1Z68A 1ZK2A 2I55A 3QF4A 2Q8NA 3ZDQA 3O7WA 1FS5A 1OXXK 3RQIA 2PCJA 4TV8B 4YRLA 5FL7A 1BEUB 5DYIA 3BCSA 4DW8A 3KXDA 4MKFA 4MKXA 5GMOA 1KD12 1E79D 3D3QA 3GEEA 1HKUA 4LXGA 3REOA 2C03A 3VNRA 1C8KA 4X20A 1P9RA 1JR2A 1RYZA 2GCEA 2VBCA 3HJCA 2CXSA 3K8QA 4GUDA 3PSAA 4HQLA 4Q9DA 4KMMA 3H5VA 4BRZA 2OBBA 4WBXC 2UXDB 1SXIA 1H8HD 2HF9A 2YZNA 2Z6VA 1TD9A 1RXUA 1JI0A 3G0CA 2VSFA 3HEMA 3FR7A 5C9ZA 1G19A 2B69A 3BRWA 3THRA 5KMGA 3LPNA 4ND2A 3SQOA 3UKOA 1M1K2 2XKBA 4NR0A 1K8A1 4Y1EA 2NVUA 2BMAA 1CNEA 2CCJA 1Q2UA 3BSYA 3QBVA 1VQPZ 1R3UA 4ICIA 1KJ9A 1U5BA 3A31A 3N8IA 4LRWA 3HLYA 5AM2A 3T3EA 5JJCA 1U2QA 2CFOA 4MTLA 4EEZA 5BP7A 4U2EA 3OQVA 3UT0A 2WSLA 2ODWA 5GIOE 2VNKA 3KYJB 1ESEA 2AJDA 2PR2A 3CUYA 4DLNA 3OICA 2CGEA 3H2KA 3NDIA 8MHTA 3PQ6A 5FTMA 4AUNA 1QE0A 3UCFA 4G4GA 1D9XA 4JVLA 3F1KA 3UV7A 3ACCA 4GZ5A 1GAQA 4E07A 2AGVA 1E69A 3G6EZ 1Q11A 2QVXX 4ZC8A 3W8FA 4F46A 1ODCA 2K6GA 5ABPA 1JRLA 4FFBB 4OUKX 2Q3LA 3STYA 4HN4B 1I6LA 2CZCA 5FOTA 4W5OA 3C1AA 3TM5A 4OHBA 4W9NA 3NM4A 3GLIB 3FJOA 4XTCS 4L6AA 3MJHA 1WXEA 2JFHA 4LPSA 1NI4A 1M2OA 2F8LA 5FFMA 4F38A 1VQ91 2GPTA 5AJHA 1L7RA 1PZNA 3ETCA 5FA8A 1HQCA 5CDGA 2XYVA 3NBAA 3WXMA 1SCNE 2PUDA 3OW2Z 3HJGA 3HKDA 1S96A 3KB6A 4RZUA 4QYXA 3M6IA 4OIFA 5JADA 3L8ZA 4OO3A 4Q39A 2LIPA 5KC9A 2QTFA 2QUAA 2VZ9A 2IXAA 4MWBA 2H9YA 5AKEA 4CV2A 3SHOA 1VP9A 5L3SB 1WY7A 4M1MA 4BB0A 5KOIA 4I6EA 5AM4A 2VPWA 2J85A 2H5IA 3OUUA 4MVCA 1T9HA 4KRGA 2Y93A 2GJKA 2GFHA 5BWNA 5C4JI 2IRWA 5KYVA 3G1WA 2JA2A 3RSQA 2YU9I 2HJSA 5BQXA 4NXMB 4NZNA 3HCDA 4NZYA 3LQ2A 1FX0A 3P9RA 4J9UE 3DYBA 3FQQA 5M2QA 1JAYA 3G5MA 5K20A 1DUVG 3CCJ1 4HGZA 2ZBGA 5KJFA 2IFTA 4B81A 1GKLA 3E61A 5MGNA 1RRKA 2OEPA 3OU2A 3WI7A 4DR6B 4WZAE 3HH8A 4DLVA 1K7SN 1U1FA 3PGMA 5BSEA 5CXXA 5D1HA 2XYRA 4R71A 2NMVA 3N2KA 3FUXA 4S0XA 3DONA 3U1VA 4A1OA 3UN1A 1WPXA 1LBSA 1N2IA 2AC2A 2QRLA 4KQMA 2VDJA 4TSRA 4XKJA 5G53C 5I45A 3QU4A 4BN5A 2ACWA 4E2YA 1Z4LA 2JL1A 3ZC3A 2ZJZA 4B6SA 1HORA 2D06A 1DADA 3FNRA 4OD0A 1A04A 3GY0A 4KFTA 2FQQA 5DLEA 3TPCA 2GF9A 1T29A 1AUVA 3AQIA 4QBGB 4S24A 4QT4A 1BTOA 5K9ZA 1QG0A 1TVEA 2ZXFA 4WXRA 5EZYF 3FAKA 4HAUA 1L5LA 4X8LA 3KO8A 3TK1A 5KSOA 4DIUA 1DJNA 4I55F 4JUCA 1PFUA 4GLOA 1T2DA 3HRHA 3KQOA 5IM4A 3PFHA 2ZQ5A 3O3CA 3ZLUA 1CF4A 4YP7A 4XQ0A 4TZTA 4RDXA 1A5BB 2P65A 2ZE7A 5GTDA 3EEYA 3ZWAA 4JI4B 1TFRA 5H7XA 2ZR8A 1CS4C 1IDN1 1WXQA 4NC9A 4YJ3A 3NBXX 3NBZC 1Z18A 3FDZB 3E7PA 4OI2A 1OYVA 5AHKA 5LKAA 3L7BA 1M6EX 4NWIA 1Z5GA 1JT9A 2CHVA 1VQ61 1DBQA 2NV2B 3OMXA 5EMMA 2FJPA 3UENA 3QHQA 3MOSA 2TRSB 4UM9D 3SJAA 3DE7X 3OJEA 1YFZA 3TLBA 4F12A 2X7XA 4RM3A 2CJFA 1S721 4IXDA 4B6GA 2YQ5A 4ZHSA 2NUPB 2WIJA 2Y1DA 2CXOA 4TRJA 2IYEA 3HJTA 3ROXA 5EHXA 1N2HA 2C4KA 1S01A 4G4JA 5LBIA 1AA6A 1M902 1E5DA 2NZYA 3NEPX 1LFDB 1L8OA 3DZKA 4MUMA 1CR0A 4ZEOA 1FNDA 4AF8A 2UVPA 3ZY5A 4AN1A 1WBJB 3LT2A 4B5KA 2PZFA 4IHJB 4MEJA 4U2DA 4CNQA 3RHFA 1ECFA 2WNHA 1J2TA 2E4XA 3E9YA 3LUFA 4HQRA 4LX8A 4RHYA 1TPYA 3SOZA 3ZTTA 4YT4A 4IIYA 4AWXA 4RJTA 4O1HA 5A5VA 5HNKA 1M5UA 2JZCA 4NULA 4TQ9A 2VNJA 1BWSA 2EBUA 3MWFA 4B75A 1YUAA 1F8YA 2PTHA 3U13A 2VP3A 2AL7A 5D5PA 1VKNA 1IB0A 1TM2A 3UKDA 4YJ2F 4CIYA 1W1IA 1IBMB 2BTEA 1P61B 3KVYA 4UTNA 4MYTA 5KYYA 3B70A 2HWUA 1VZ2A 3H9JA 4REMA 5DNAA 2YQZA 1M2FA 1Z0AA 3AP3A 3UW3A 4CMIA 3IIIA 2Q2VA 2NWQA 5TEVA 4Q47A 4EO4A 4RSHA 2DWPA 2DKOA 3VPFA 1N7HA 4CCWA 2ERXA 3OQ6A 2BMEA 1DL6A 5K4GA 4UNSA 2Z3VA 2OTJZ 3MXTA 4MJLA 1C3OB 3RI3A 1XO1A 2YZ2A 3IDAA 4K9PA 3W2GA 1Q822 1JIJA 3R7LA 2PFSA 4L02A 4QFMA 5AM5A 3N87A 5GOTA 1WIIA 4NBCA 2QN3A 2WJ3A 2Z2XA 1GKIA 4GVXA 3ZV6A 1PV4A 1TO2E 3ZXYA 4C4ZA 4JJKA 3CEAA 2PO7A 3DYIA 4G97A 2HD4A 3U3MA 3D5TA 3FVRA 4N3GA 2D4AA 3KQPA 5IVDA 2Q6OA 3GMTA 2FQYA 3D4PA 3CUSA 3KC2A 3RS3A 4CVNA 5BORA 3K73O 4RLFA 4LQCA 2RGDA 2DFNA 4B4KA 2D2FA 1YBMA 1MV8A 3T54A 1M2WA 3WLHA 5C8XA 1UPCA 1LZKA 1ZO8A 1VL2A 1G8YA 4PNHA 4IDQA 3BX1A 5AVJA 1TEHA 3P45A 1Q14A 3M3HA 5FUYA 3KEFA 3QW2A 1U6KA 3OCVA 5FUWA 3C70A 3BFJA 4TYQA 1GRNA 4QUJA 4U7TB 5D3QA 4ZXFA 2WRZA 2DR0A 1G20B 3VDQA 2YN2A 4DTIA 2WYOA 4FDVA 1AKYA 3MCAA 1VPLA 4ZYTA 5HW0A 3UKJA 2X15A 5KCMA 1KZ9A 4KQKA 2HXSA 5LQAA 1DIAA 4URVR 4DLUA 2AOWA 4BMCA 2I3AA 5ALVA 1GTJ1 1XXHB 3PNVA 4IUYA 4WZZA 4GPIB 1XZIA 4RZ3A 4KCGA 3RNLA 1IE3A 2P6OA 4L8GA 1RZRD 1T9CA 2Y1WA 1SHJA 3VH2A 4XI9A 2J07A 3QG1A 2FEPA 4ESVA 2G04A 4BY9E 5ERYA 3F6CA 1LBQA 3IYLW 4R69A 3WWDA 3KT3A 1SR8A 3QKRA 4XVHA 2EJVA 1UMCB 5P21A 2QN8A 4QOSA 1KI1A 3IODA 2E5LB 4EHNA 1V71A 1MIOA 5G0VA 3GCGA 3GLFE 1NMXA 2QTLA 5LDGA 4XFJA 1K6JA 1YRWA 1A77A 3USCS 2ATCA 4JCOA 2O7RA 3HUTA 4EVIA 1U8UA 3NYWA 1MIOB 2J87A 4X1IA 2PV0A 5F52A 4E2FA 2CDCA 1QPBA 2OZLB 3IQEA 4ENVA 1Z0DA 2BT4A 2VH2A 3A0RB 3FFBA 4JFRA 2F3PA 4AW9A 3P52A 1KRXA 2PWAA 2AZTA 1OCEA 3HU1A 2LKDA 1ZD3A 3R4VA 3ZGOA 2HA6A 4CQMB 1TFUA 1S2NA 2ZAYA 4US0R 4MXDA 1FEZA 1VQL1 2YL2A 3PIRA 4UBNA 4WI1A 3CVJA 1WB6A 1NV9A 1JF8A 2G9RA 1FYWA 2Z2IA 2VBFA 4GI3A 4LMBA 3I52A 1OPRA 1SKQA 2POQX 1L6IA 4NKRA 3LUDA 2CFRA 1RM0A 1G4HA 5KAMA 4MVYA 2HEGA 4RKFA 4WK4B 2V7VA 1IQUA 4FCTA 5DI3A 3FAZA 3VC3A 3V4FA 4RMHA 1A7UA 1YB6A 4ER6A 3SZRA 2YDXA 1PR1A 4NMLA 4QJIA 4TSFA 3GWGA 3SVTA 2ATVA 4N5HX 2FXIA 1Y1TA 3KPWA 1ZLYA 3HJHA 3FMOB 4FOOA 2PAAA 2IIQA 5C44I 2UUAB 2I0FA 3B3GA 1HO3A 2COUA 2UYQA 4KWTA 4M38A 1FU4A 2ECQA 5AR1A 1CZRA 4DMFA 1GNVA 3TQCA 3ZZ0A 2TS1A 4R84A 4ZYVA 1QZ3A 2ZTMA 1O77A 1WBBA 5LMCA 3GT4A 5AM0A 4ZQIA 3HCCA 2Z2JA 3BH0A 1C0EA 1XZBA 1WDTA 5IC4A 1WKVA 2E2JI 3BRWD 3G8YA 4X3PA 2XUPA 5KO2A 4DR2B 5C51B 2BY4A 3RSFA 2GK6A 4QOHA 2C82A 4X8HA 2ZI7A 1E7WA 2JAHA 2JFOA 3JSAA 2LNDA 1NR7A 3JZDA 5AI0A 1EGMB 2XT0A 2O06A 2NU9A 3KEMA 5BUCA 1OMOA 3QYAA 3GO4A 4OGKA 2G8NA 2G82A 4KQ2A 1D2CA 3W6OA 1N6PA 2HO4A 4Z4HA 1I7LA 5CM9C 2ZIGA 3DZFA 3BGDA 3PPIA 3UQYS 3R9XB 2D8MA 2OFPA 2QZ4A 2DQ4A 3AP2A 4I4TF 1IHXA 5CNIA 1HYHA 1CNMA 3IPXA 3T1TA 1QGDA 1U2GC 2XY4A 4Z99A 4FUTA 1WXIA 2JCVA 3MJVA 3MQ4A 4J6FA 2WPNA 3A1CA 2OK8A 1QBGA 3K1JA 3UANA 2FCAA 2QXTA 4WE3A 5LB2A 3R7DA 3RV3A 4CM8A 3D7RA 3I6BA 3KX2A 3KKLA 1JDJA 2QKYA 3AFIA 1A4RA 2OHVA 4BMSA 3IP3A 4LVNA 2F1IA 3T6KA 1BG6A 3P9CA 4LF4B 3OZVA 1CRPA 5HM8A 4ZTZB 1O95D 1FRZA 1N5RA 1PK8A 2DTEA 2QW8A 5EZQA 1E2FA 1R6VA 2LPMA 1FFWA 3OH8A 4EWCA 3NONA 1M2JA 2QRUA 2C2ZA 2AG6A 3M7IA 3LHSA 1GZ3A 4EP1A 2JLXA 1QP7A 5GADl 2MSDB 5ENZA 4UNIA 3BZBA 1UKZA 4I4IA 3K96A 4QHSA 5JE8A 3VAZA 2BEVA 3DOIA 4HWTA 4TWBA 2BCGY 1Z08A 2KHZA 4RYLA 2EW8A 4C08A 1IM8A 1WCV1 2ZTLA 1R5NA 4HDRA 1GPKA 2FPXA 1UDAA 1DXHA 2WIBA 1V1RA 1VL8A 2D00A 3SLRA 3U31A 2CMFA 5J5AA 2ZRQA 3G3EA 5T64A 1RPTA 5KNBA 1P7VA 3IPRA 4FXOA 4XWYA 1H5QA 2ZUCA 3TEFA 1U5BB 3H5AA 1CEQA 3NTOA 2V97A 4MYRA 1K63A 4PO3X 5IYZF 3R7WA 1PVOA 4BB9A 4YCNA 1N2CB 1LSUA 1IBRA 2ZVDA 1CX9B 4DIMA 2Z83A 2OBLA 4BPBA 3VR3D 2WM3A 3RVDA 5JXHA 4C43A 3R6GA 2PPLA 4FX5A 5CGQB 3UK2A 4F5ZA 1QR2A 4M46A 1U0OC 4NK5A 5C1PA 1YXMA 1CRWG 1T8RA 4IZIA 4MV7A 3WWYA 2HRCA 2UZ3A 4GOJA 3ZZUA 1DJOA 4S12A 2XOKA 1JR4A 4ZGGA 5JCXA 1SG9A 5IWAB 4YI3A 2B78A 1RQLA 5DH9A 3I3OA 1QVGZ 1RWWA 3N7AA 4MPTA 4DGQA 4BNMA 1XZCA 3EERA 1FUIA 1RAAA 3MJRA 2R8XA 4JBLA 1KEEB 2ATXA 4X94A 3WK7A 3KXLA 3EBPA 1H2RS 2ZUVA 1O96B 4GXQA 4KKXB 3ZX5A 2NU8A 4BIMA 3TX6A 2X9GA 2XRFA 5HRAA 2O9JA 5M5BA 2CLIB 2X6RA 3QBJA 3O4HA 3KP1A 3QXXA 2YQ4A 3DOCA 2W4MA 4LJ9A 4KB5A 4YACA 2PX3A 1BGXT 4TKLA 2P30A 4R0NA 5THXA 3AZQA 1U9JA 4YPOA 2IIPA 2GD1O 5BNWA 3A6EA 5JO9A 1HTWA 1YL6A 2FKNA 4GDMA 4NAVA 2IKQA 1V48A 3M3YI 5AXCA 2V6GA 1V37A 4RIFA 2UU9B 2P9CA 2IYUA 3PDUA 2XGGA 4YAWA 3K1YA 5D3ZA 3NHJA 3WLSA 2C3MA 5A5EA 5DULA 3AJDA 1U7HA 2B30A 3K0AA 2N9UA 1S1MA 2HU5A 4F5YA 1I4OA 2HWXA 2EX4A 3K4PA 2BKLA 5CEJA 1TIPA 5DM4A 3HCPA 3L1VA 4M36A 1UZNA 3EE6A 3KTOA 2CXHA 1RE0A 2D5IA 2Z58A 3GLHA 5FPYA 2Y6VA 4KWCA 3DFUA 4KH1A 5JYBA 3IGFA 4FFMA 3NOOA 1NU8A 4FMBB 1NVFA 2G76A 3ZIUA 4MI1A 4D9HA 2L2QA 1NFFA 3OU6A 2BPOA 2IYXA 4NI5A 4YAOA 5KI6A 2AOTB 4RIHA 3CME1 2OCAA 2IP2A 4X5OA 4PQEA 4XAQA 2AD1A 3E0QA 4WN9B 3HKZA 2KYRA 3KBOA 4RGYA 3UK6A 4QASA 4GMFA 2E87A 1I2BA 5FOVA 4AMUA 4KPEC 1BU5A 2ENWA 3B60A 3SN6A 1H42A 1XU4A 1VQLZ 3QVLA 5KHAA 1SZPA 2YHUA 2PTGA 7REQB 3IIKA 3JW8A 1N8NA 4BWYA 3R74A 1JDVA 1A3CA 4CETA 4QUKA 4KR2A 4A16A 1VYUA 1L7EA 2ZDGA 1LBTA 5BN1A 1FDIA 2FP4A 3NVKI 1S2DA 3FGPA 1HC7A 3JTMA 1T5OA 1WW9A 5TVKA 3BRCA 4P32A 1YZFA 3E5RA 1J39A 4J91A 2M2IA 1H6DA 1H2YA 3AEXA 1ORVA 1FBNA 3B1KA 3AR2A 1R6DA 3GLHB 5IAJA 3UPDA 4DPKA 4E5UA 4ER5A 3DZDA 2I9KA 2O8DB 3TIXB 1T2CA 4KTTE 3I9V6 1UM9B 4FNMA 2PXXA 4JH0A 1SHLA 4KIGA 4EYEA 3FH0A 5ETJA 3UAOA 5T4FA 1G8KA 3O2SB 5CX4A 1HI9A 2RI0A 1NP7A 3QWIA 4LOHA 5JXWA 2O8FB 3V7NA 3X2EA 3X1KA 5I7EA 1FYXA 3AQ4A 5IC6A 1RBMA 1MPTA 2YXLA 2R1TB 1P45A 3AHCA 5JCJA 1DBWA 4WUTA 2W2QA 4BNHA 3R20A 4PSCA 3ZHUA 2CHQA 3DWGA 1NNSA 4IVQA 1CUSA 3FDJA 1U9IC 1VJTA 1Z4IA 2W2NA 2WW8A 2A5YB 1SN7A 1Z4MA 1J09A 2YWFA 3IA2A 4WWHA 2WUFA 4ITUA 3D7KA 3OTGA 2P78A 4GNRA 3NH9A 4L7VA 3CM0A 1M901 1YBFA 2CUNA 3I23A 3PC8A 1QRSA 3AV3A 1UIMA 4CG2A 2R68A 3VMHA 3AY6A 3IC5A 1YS7A 2X2FA 2IDJA 3FFXA 4BEWA 3L3BA 1N7IA 4OK5A 3G9ZA 2H2FA 3B7WA 4G5GA 4DWJA 4EYQA 3OT1B 1VLZA 1QO0D 2C07A 1N2EA 1P73A 1RSZA 2FFJA 4INJA 2PZBA 4ZJYA 2B1JA 4Y8VA 1PJSA 1VDMA 1NLZA 2CDAA 2X5XA 1TKAA 3CZ5A 3FWYA 3QOWA 4BUCA 3CE6A 3PYLA 3HXQA 3BG0B 1RC1A 3BWBA 5EZSA 3LO8A 1JILA 1H2HA 2YV2A 3EQ7A 4R0VA 4MB6A 3BXFA 4G2NA 1H2FA 1YNSA 2O20A 3ABIA 3AEKA 2PMKA 3SZGA 5HJEA 3I5XA 1DMRA 3GGPA 2EW1A 1FSPA 3V7WA 3WDKA 2GCOA 4OHCA 1UBFA 2XYHA 3EUFA 1NY5A 2QX9A 3R5TA 4NBUA 3LBHA 4PXSA 3U7JA 1MC4A 3GGOA 3VDRA 3ZWXA 3ZE0B 4BOYA 3TX2A 1ZG3A 4MMZB 1HG1A 2H8GA 1H9BA 2XJ9A 3I6IA 5IZ4A 2WJGA 2K2QB 5AKZA 4BVAA 2TMKA 2AKAB 1F2TA 1N6HA 2GHTA 4RVCA 2R8EA 3SHWA 2XB2A 2Y0EA 5FBLB 2OCYC 2J3QA 1ZJ6A 1X9GA 1M2OB 2FUG6 3K32A 3I5AA 1NT2A 1JE0A 1RM3A 5JSQA 3QVJA 1TA0A 1GGJA 2JKZA 2VJOA 4UUQA 5BV0A 3BHJA 621PA 3BGOS 4D44A 2D4HA 1SIUA 2DBVO 4FGZA 4AKHA 1O8CA 4X24A 5CJJA 2X3FA 1QR6A 1DBIA 3SSMA 1JXOA 2NO6A 4K9SA 2ZR9A 1CBUA 3HA7A 1FNSA 3BL5A 2I3BA 5DYWA 1RO0A 4XB1A 4XM1A 3SD7A 4C4PA 5BVGA 4WKCA 1Z6TA 2BTOA 2XQJA 4QDUA 3A4LA 4CU5A 4UZSA 2DH5A 4TTIA 4E5PA 4CQLB 4ARSA 2SKEA 4B4OA 3HA5A 4YMUA 4XCVA 1FFXB 2GARA 4RM2A 3W3ZB 3WQQA 2CXPA 1VSTA 2ZRCA 4Q1BA 4CDNA 1DUIA 2BKEA 1FP7A 4ZAVA 4NBWA 4Z9YA 2HMTA 4R3NA 3LO5A 3WQBA 4ROSA 3Q2KA 4YCLA 4IGKA 2V7TA 5G1OA 3AR3A 4D45A 3TGLA 3T3OA 1IIRA 1YIDA 3BRSA 4M1WA 1WTAA 2VPQA 2YZ7A 3W5VA 4D3ZA 3LWDA 1HYEA 1M1YB 3P9PA 5L4LA 1UFOA 4CKEA 1X9IA 2HXYA 4DNFA 1E6MA 1IG3A 3GP8A 2QD3A 1Q2XA 3VTZA 2ZRHA 5DSXA 1WB5A 4CHGA 4AFNA 3GJ5A 1S2MA 3LA8A 1X2BA 2JAWA 1U1GA 2EATA 4M9SA 2PSEA 2YTZA 3R9WA 4B3GA 4JT9A 4YUXA 3KOMA 1WSWA 2WV7A 2NOAA 2PIDA 5EYPB 4LF6B 3DB2A 1EX7A 4O3FA 4R2HA 3ORRA 4OHKA 1LS6A 1Q74A 3Q6MA 2DWQA 3AW8A 4CTOA 2ZXUA 4XSVA 1KI6A 2J5RA 2L42A 1I14A 1I51A 4LTNA 1X0TA 2XQGA 3UUGA 5GINE 5LOVF 2FEMA 1FSZA 2MYNA 3OQ1A 3RYFB 5EE9A 2JZNA 5BOSA 5I7OA 1DUSA 1E1DA 1H1LB 1YNOA 5CXSA 2RGRA 2DULA 3KAKA 3J80b 1K3TA 4ZRNA 4D2IA 5JBNA 4I50F 2X8WA 1V7QA 1JHMA 2TMGA 5DDIP 4RTQA 4WLNA 1NVKA 2YNMD 1XNQB 4MVJG 3P0HA 4GGMX 4QHYA 3GARA 3TTTA 2HIMA 2QTAA 3RJMA 2AYDA 1UFKA 4HDKB 3IKTA 5JDIC 3KXPA 2ZJBA 4FW9A 5LQJA 3OD1A 3TQIA 2J1LA 1BD4A 5G0TA 1QF7A 3D3NA 2ZTUA 3QI2A 4QTYA 4PS1A 2HFJA 1QP8A 1DQSA 3CXRA 5IFLA 3JD0A 5DLQC 4OKSA 1PDVA 3OEYA 5DLYA 4BCDA 3UMYA 2OD9A 2IYAA 2JIPA 1HLFA 3IKMB 2IZ1A 1A9SA 2P8SA 1ZNXA 3GRCA 3ND9A 3NLLA 3OQIA 4NYJR 5DP2A 2ZSKA 4Q3EA 4F60A 5EIFA 4BECA 3M4XA 2UYHA 4K6CA 4PAOA 1I3OA 2QAGC 1N2BA 4RVGA 2JDIA 5AI5A 1GZUA 1Y7PA 4CTNA 3JQFC 1APBA 1HQKA 3L0CA 1UEJA 4KYTA 1Q1NA 4JDUA 1IBCA 1TKBA 3K6SB 2GNAA 3SS9X 5A4DA 1ZH8A 3D5EA 3ICVA 4MAMA 1XJ0A 5JD3A 2ROQA 4F8JA 1Z28A 3CZPA 4Q18A 2FX3A 5F77A 2AN1A 3SIXA 1EK6A 2PX5A 1GVHA 2V1UA 2H1HA 1M1NB 2PRZA 1WU8A 3P2OA 4PSDA 3W6PA 3EPLA 4EHBA 1Z7BA 1TJ3A 4U7WA 4WV3A 2CJWA 2E2HI 5HPYB 3GA0A 4DBLE 4FT4A 3O95A 1U2RA 4Q3NA 2BEWB 2GAAA 3Q3JB 4RPKA 2O19A 3AYZB 5BNIA 1HDIA 3LRXA 5IYZB 2YHIB 3PNQA 1P1FA 1JBEA 5D6NA 5AKIA 4DCUA 2FETA 1ZVKA 1HE1C 1A9XA 3D9XA 2KSQA 2YYYA 4F4HA 5F76A 1A8PA 1N4DA 2B0JA 4R68A 1TU4A 3BFVA 4RMNA 4UHJA 4XB6B 4F6LA 1Q44A 4JGIA 1VHJA 2VNIA 2AN3A 3RK1A 4DC1A 3WR5A 4F92B 2PSSA 1W94A 1AF7A 5F2OA 1U7ZA 1H93A 1ZQ9A 3SDZA 4FGJA 5AOAA 2ZT8A 1V6SA 2J9XB 5AN9F 2C4NA 1B2RA 5MGBA 3TG8A 3A14A 1O0BA 1W44A 3MTBA 3C6BA 4ZDJA 2MINB 2WPDD 4G0VA 3RH0A 1NMEA 3OA2A 4QNNA 4ZVVA 2O3QA 4PPFA 1E77A 4IDNA 4MHSA 3N70A 5EIEA 1JN0A 1NBAA 5JDCA 2J30A 1U7PA 2G9ZA 4YJDA 2ICAA 3IOEA 1AK2A 3EZYA 1VFPA 3QFTA 1Z34A 2XMSA 3FNEA 4FE7A 5CFZA 3B3FA 4LXHA 2BE9A 3OG9A 4BKMA 2XZDA 4P82A 4MUAA 4Y2RA 2APJA 3M6AA 2AG8A 1ZAKA 3BERA 4YMVA 2VJLA 3DEIA 1HEYA 5H02A 3FNGA 4N7MA 2DLCX 2MSLA 2J3HA 3FOBA 2ZR0A 4PIMA 4XIFA 3C6YA 1WB4A 3PQEA 2WVGA 3QYFA 3STHA 2BP7A 4WQMA 3UEOA 3WGLA 1GPLA 3ZXUB 4B7UA 4KYIB 1GTRA 3S2HI 3KLPX 3LF2A 2ISSD 1UM9A 2ZUEA 3A2MA 5ER6A 3E9DA 2FYTA 3V6LA 2H7VA 4CMKA 4OREX 1DRKA 4JWKA 2F7SA 4TLBA 2A57A 4IFBA 4U2FA 2HHAA 4EUSA 3KKQA 2V4ZA 2G70A 4E1AA 1MHTA 1D6NA 2HSZA 2FZEA 3B48A 3CCM1 1K9M1 8ABPA 4H1TA 3DWEX 4PLPA 1U7XA 5FR1A 3GN1A 2JD0A 4WN9A 3L18A 1EVEA 3ZJTA 2QHXA 1Z03A 2Y9PB 3GZ4A 4QJBA 1SQSA 2GAFA 1OFTA 4JC4A 1Q16A 1JS1X 2O8CB 5U4QA 1OV6A 2JFUA 2XTNA 4MV5A 1UF9A 2X8BA 3QE3A 4KVZA 1DAIA 5FF9A 1QUEA 3S17I 4OXYA 4ZAYA 4DR7B 5CFQA 5KKNB 7ABPA 1USGA 1YF3A 4NNPA 1Z2PX 1KO8A 1VJRA 2QUIA 1FYVA 3S28A 1PEAA 3ASYA 4LSZA 1SHUX 4W5HA 4ZVTA 5JYDA 5TQJA 1GN9A 4LISA 3DMGA 5TX7A 3NR2A 3P9YA 2XMZA 4DADA 5ECDA 2X19A 4EMSA 4LX0A 4WKOA 5A4FS 5KVSA 4GBGA 3PWSA 4RFVA 1ZD5A 3U48A 2GK3A 4AJ1A 2W8ZA 2YZKA 3PYMA 3QKRB 4AECA 3D0OA 3F6BX 1RYDA 1I6WA 3GUCA 5H70A 4RK5A 3SC2A 5JUWA 2GKSA 3NT2A 4X54A 4WW0A 5DASA 4C7MA 4DBVO 4DV0B 1UJNA 4RJ2A 1NSTA 4Y0AA 3DE1X 4B5LA 4K9OA 4FLEA 1ZR4A 3CIFA 4C76A 4IEIA 3ZCSA 3UUEA 2HJVA 2IOFA 5AW2A 3F98A 1TAHA 4F85A 2I03A 2OBXA 4B8WA 3CUTA 2EYQA 1Y5NA 5DM1A 4EG4A 5GVSA 1N0IA 2GX6A 3OZUA 1K75A 5IVKA 1U0JA 3OPVA 1XAIA 5IPFA 3TWOA 3U62A 3SKYA 3PQFA 2HEIA 1OASA 4W5WA 3WA6A 5CAEB 3MZLB 4F84A 1KMHA 2JD2A 2K4MA 1WJ2A 4JJ6A 4JQSA 3RT9A 2CZGA 3S27A 2VQFB 1AQLA 3PQ7A 2ZBEA 1X42A 1QGZA 4M53A 5CT5A 1EH5A 1TFIA 3VU9B 3HV0A 3OKAA 3TB6A 1MTOA 1JZSA 1AZLA 2JI9A 1RAFA 1ZJYA 5ILQA 2V8IA 1IYZA 2JBWA 3EG9A 1ZU5A 3HWRA 3M89A 3KQLA 1A98A 3IHTA 4L51A 5KJCA 2QP3A 3IXQA 1JG7A 3CCSZ 1ML3A 5KJEA 3W5IA 1OSNA 1CIPA 1ANKA 2H2IA 4X1YA 3HBNA 1RKQA 3NKFA 1OZ0A 3TKYA 2GTIA 2PDAA 4ZYUA 5J4YA 1C3JA 2PS1A 2FGJA 2MYTA 3GT0A 2GEFA 4B6RA 5JNTA 1J23A 4X6LA 5BUQA 1J5EB 3WLOA 1T4MA 1GFIA 3W8NA 3D3KA 4OLFA 3N59A 5CFPA 5E7JA 3R5JA 2CBGA 4IIVA 2BONA 2JGRA 2NW6A 1XXHA 2IXBA 2XIJA 4O63O 1BHO1 4Q1FA 3K0KA 5CDFA 3FCCA 1FFXA 3FVWA 3REQA 1JJVA 3DKIA 4WMLA 3VSDA 5IT9b 4N0DA 4UE2A 2QRMA 1Z5PA 2ZBUA 3N2YA 4TKUB 5JJIA 2VRNA 1OXSC 4FFDA 1HRDA 1NJGA 3ZX4A 4I2NA 1KJ8A 1VLMA 3IFUA 1YDFA 5FR2A 3UB4A 4BNDB 4C3UA 1HNZB 4UDNA 2G6BA 1AKNA 1RWPA 4IDCA 4X7BA 5EIOA 4ZYYA 4CKZA 3N6VA 2PSDA 4B76A 1ID8A 3S2DI 2A7XA 2EOAA 1NC1A 4GI5A 3U81A 3HO6A 4WX2B 3H1FA 2EXXA 3VPCA 3A04A 1ADBA 3BILA 2R25B 4PLYA 1MX1A 4Z0HO 5DFAA 2Y2VA 2IEYA 2I3ZA 2O2JA 3GIDA 2NVUB 4P8RA 2JCYA 1CJMA 3OCJA 3GLTA 4NCXA 4HADA 4OYYA 4Q0MA 4RMIA 4JL6A 3EH1A 3R40A 2NP6A 2VDLB 2P0YA 1NMYA 2IUUA 9LDBA 1QNLA 3PQ4A 4YCCA 1O0CA 1F8FA 3KAJA 2VP4A 3H9UA 3ON5A 2BM1A 1RXEA 4RY9A 3UY4A 1Y0BA 1Z13A 2QRVB 4PR0A 3KB8A 1N3LA 2XLCA 5TS3A 3VU8A 2I6SA 3F96A 4JYCA 4CLEA 4R41A 2XEXA 1V7PC 2BGIA 4B6OA 4G0OA 4CUJA 1YS6A 1MBZA 1L5SA 3PPXA 4O4LA 1MXFA 1R9MA 2VDWB 3C2QA 4EA6A 1MZVA 2XQVA 4M86A 1X8JA 4D9MA 4CI9A 5IAKA 5A02A 3L0PA 3O0TA 5JEEA 3UWOA 1GQOA 1CY0A 3AESA 2JEOA 2YY7A 3JYHA 1S2LA 2VZ0A 3GZNB 2Y2UA 2C1XA 4EB6B 3DXXA 1KVQA 3U4CA 3PWTA 4ZREA 3KYCB 3BQMB 4MJ7A 3DFFA 4G2TA 4RELA 4NH1C 2C4UA 5ILOA 3KSUA 3J81A 2CF6A 3OZRA 1SU7A 2LWIA 3F97A 5ICFA 2NQTA 1T1SA 5DNYB 5HDBB 3A9WA 4A5OA 4ZOEA 5TPZA 3FPAA 2J7PD 4EYGA 1P2SA 4RVHA 1KBQA 3C3EA 3TUZC 1S7CA 3C1OA 3BFXA 3IMFA 2YOGA 4PYQA 2CNOA 2DGDA 1PNQA 2CYAA 3KDAA 2G0TA 1T3HA 1CUFA 3HUFA 1XZGA 1L7PA 2OWEA 3CLRD 4GRAA 1PVDA 4QXRA 1PVVA 1V35A 2H3HA 5ES3A 2EVWX 5FADA 5HZHA 5K99A 1JTEA 5F9MA 4RF5A 4TMXA 4BWGA 1M33A 2RGBA 1BDJA 3GPDG 3NPAA 2WT9A 3TZQA 2Y9MB 4LMPA 3R8XA 5ICEA 1SKMA 4RD1A 2IZOA 1N5LA 4IY1A 4FIDA 3CVXA 4Q1EA 3Q6NA 3O1IC 1GFSA 5LNK1 2Q7XA 4LOIA 1J0AA 3MW8A 5L9AA 4QOJA 4RANA 4ND1A 1NJ5A 1TK9A 3EUAA 4I4CA 2CLKB 2AYXA 2PY6A 1KH1A 2H85A 1C4XA 1O95A 4KUEA 3RG8A 1WMEA 2VT2A 2IEAA 4H18A 1NTOA 2VJQA 2B9VA 1R10A 4JP1A 4BFUA 1JYEA 1Q0HA 2FW0A 1SWWA 2CWWA 2W00A 5L3SA 1KPHA 3K0CC 3RBZA 3B78A 3TRKA 2QX6A 4K3VA 3WWZA 5ES4B 3GRAA 4F9EA 3GUZA 3GLSA 3QLJA 4NYMR 2WWRA 3L6RA 2XUOA 3NC1C 4NOMA 3TUIC 1SIBE 4GL2A 3EAGA 3A6PC 3SXJA 5BT9A 2Q6VA 3U09A 3I04A 3C1TA 1MVLA 1Z5NA 3EAFA 4KTVE 1UBSB 4ZI5A 3RTBA 1XKQA 4PLGA 1PR9A 4FCCA 3COSA 3GFSA 3HKBA 3I32A 1W9MA 3ZPXA 3AVXA 3H6GA 3IDFA 3O9MA 5DYTA 1YB7A 1Z07A 3NHUA 4BGEA 2KI7B 3JYLA 4BC1A 2YC4C 2B83A 1QIIA 2O3RA 4JLDA 4XGRA 1PP4A 2HQBA 3S1AB 4Z86A 1KFCB 4CL2A 2DFDA 1WZ2A 2NPIA 3A9SA 4M1QA 4QNRA 5YASA 4BNFA 2B99A 2PUWA 1AHIA 3VTNA 1ISHA 3A6FA 1SO8A 1R5OA 5AI9A 5CW2A 2W04A 3AUJB 1P6UA 2CDRA 3RVLA 3JQ9C 3QTTA 4HWSA 2VZLA 4DHWA 3Q0IA 4PIVA 3EGCA 4P36A 4ZVKA 1E6WA 2G08A 2OHFA 2Q99A 3Q40A 2CXNA 3C45A 4LE0A 4LJ4A 1RQ7A 8AT1A 2WYUA 3TRJA 3ED5A 2YVUA 4J94A 1J1IA 2V9ZA 1T1EA 4NXNB 2WP0A 4TWRA 2D5AA 3ZGLA 3AVUA 4EUEA 1KOJA 4A23A 2WHPB 2HNKA 3UJPA 3QFRA 5IT9A 1BXRB 1I4DD 1Q95A 3AH8A 2CJYA 5EJ6A 5KNCH 2QMYA 2ZITA 4BCCA 1J8VA 1G7TA 3EZLA 2QLTA 3CR8A 1OGYA 2YJ5A 1YJW1 2I4RA 3GQVA 3Q7EA 1Q1ZA 4Y2PA 3LLSA 5BWBA 5C1DA 1LI7A 3AR5A 5IKPA 1Z12A 1EZZA 1WHTA 1XRJA 4IWYA 4QPNA 5LZ2A 4B6JA 3O21A 1NQOA 4LCBA 3ABSB 3M4JA 4MVJP 4RJKA 3L8FA 5COQA 4JV5B 1RPNA 2NYUA 3CVYA 3HY3A 3QEMB 2KPIA 3FYCA 3OZGA 3U0BA 4F3KA 3JQBC 2WZQA 2OMKA 3M6LA 2ZRFA 3NVAA 2X4GA 2AUMA 2IHNA 3BWEA 4PRLA 2OCXA 1VSBA 2X2PA 1YQQA 5I4IA 3OJ0A 1NY6A 4PC6A 1NMSA 1ZXLA 2CHUA 4D9GA 1L6RA 2CVOA 1JB9A 3GXOA 4IQFA 4KZKA 1QCZA 2FV8A 4ZZ2A 5CLLA 2P91A 2GN1A 3L8CA 1KBOA 3GMDA 4YHHB 4DSOA 4FR2A 1XU7A 2DYKA 2FFAA 2GXQA 3T4UA 4AKSA 4I1YA 4ZJZA 4M1YA 2BR3A 5D00A 1W30A 2JFYA 5AVWA 3UMVA 1RZVA 4PZUA 3RF7A 5F51A 4CYMA 4UQOA 1BXRA 4D0RA 4IDDA 4PGAA 1PU2A 3H87A 4KO1S 4XR9A 4YN3A 5T6MA 3UATA 3COVA 3TOVA 5L3RA 3R2JA 1QGOA 2D3WA 2EP7A 1G2PA 3LBYA 3VZRA 4AICA 4B6FA 4D9JA 3RC8A 3AX6A 4EAAA 5EQDA 3V3TA 4YIKA 2OC9A 5ALLA 2PUHA 3EC7A 4LJ6A 2ODEA 4CFSA 1G59A 3K0FB 1YKGA 3H13A 5HK9A 3H1AA 3GRFA 1GGVA 3OUTA 4LJ5A 4YRBA 1OX4B 4MW9A 5GV7A 4JFAA 1VQ71 1VDZA 3G5TA 4ADSG 3Q3VA 4JHXA 2HR1A 3T4PA 1YBAA 4L9SA 3DEJA 3WJ2A 3DMRA 5HKOA 2ODNA 2WNSA 4M6WB 1OI7A 1R0XA 3NNSA 1PF7E 4D4IA 3DF7A 3U56A 2J3LA 1KP2A 3AEUA 2WD8A 3G2IA 3LIIA 5BNFA 2VUUA 1N2SA 1D09A 2HJ9A 2V9CA 3LWBA 1C2TA 3ADDA 4K87A 3R0ZA 3NHKA 4MAFA 3M81A 3CQZI 3BXPA 4IF6A 5DHQA 5FBKA 3FUTA 3OX4A 2R4TA 1LWOA 1J99A 3DTTA 2FOXA 1R8JA 1TQ2A 4IUCS 4NU5A 2GEUA 5DNDA 2D5BA 1J00A 1TQ6A 1Y8CA 2QV7A 2VDPB 5B3JC 4B3JA 4B09A 2I6QA 3QFSA 4OYRA 1T6XA 2GLXA 4H2DA 1G6HA 4RF2A 2VSYA 4NDAA 5JHGB 4YDQA 3JR3A 5B57C 4LRQA 1NYQA 5BSFA 4D4GA 2HU7A 4EPRA 3S8MA 3WZMA 3PO2I 4N39A 3T3HA 1E2BA 5KU7A 3D3WA 4WOJA 5DT2A 3HDQA 3WBKA 4IEFB 5EHQA 2B7BA 4N40A 1QH0A 1BD3A 4PZYA 4PSVA 2GS9A 1OOEA 1Y8QB 3D43A 1QIJA 4CQMA 4CTMA 4YYEA 1ZJ4A 3VTKA 2ANCA 5ALTA 1EFPA 2NQ8A 4EGAA 1M2HA 2V45A 1A88A 2BFDA 2OOYB 5JMTA 3RVNA 2G5TA 4LXYA 4LDRA 5IEJA 3GROA 1CJCA 2CB9A 1OZHA 2OFOA 5KQRA 3JARA 2I1VB 1I7DA 1GUFA 3HR8A 2QSYA 3OIDA 2QRNA 3WKDA 4DGSA 1NF2A 3ORSA 1EP1B 4NYMQ 5E4TA 3ZW8A 5LUAA 2QL6A 3OZSA 1YKFA 4HDSB 5LQRA 4LYAA 1QIHA 2SKCA 3V7YA 5L6LB 4GPBA 1O57A 2KX7A 3BKXA 3RC9A 3SF0A 3S2EA 2QLLA 2LEXA 1XMJA 1XSEA 2VPIA 5L3QB 3WYBA 3EGXB 1DINA 2XMPA 4AK9A 4HNRA 2YS6A 2LIVA 3M82A 4QUAA 4PS0A 1YULA 2PQ6A 3P26A 4NCBA 5IJWA 3A1VA 3B3QA 3K9WA 5EEHA 5LWQA 2BMJA 3G0DA 1T6BY 2Y4NA 4RGBA 5AKGA 5E7QA 5AW9A 1BDMA 5SYAA 4XVCA 2B20A 1H2WA 2IZ7A 1VQM1 1Y9EA 3NKVA 2Y68A 3ZH9B 3CGWA 1PWYE 3D54D 1Y8RA 3GG9A 1ZM3A 3LX4A 3OA0A 3PFWO 4KNWA 1E2GA 1KIMA 1GRRA 4ZXPA 1O6ZA 5ENDA 3URMA 2QIPA 1P5RA 4AZWA 4MUXA 1KGDA 2VEOA 3VOBA 1NBMD 2M6SA 4S35A 1K9SA 1UC5B 1Y6ZA 2WHPA 1DFHA 1JIUA 4ZCIA 5BN4B 4ZT3A 5I9TA 5AYVA 1JDPA 3JQ7A 3MMZA 1XDZA 4DWOA 4A92A 5KTMA 2UXBB 1F9AA 2E37A 2P0AA 4IIGA 1J8MF 3B20A 4OJQA 5IUKC 5B64A 2GYYA 5CVDA 2P62A 5BN3B 1Z37A 3D4OA 4JCCA 1R12A 4FFVA 1G0OA 1R6AA 3CE9A 4URFA 2B4AA 3ZCXA 1XLTA 2RPRA 3A0UA 5JAUA 3OT5A 4TMYA 2FRXA 2H2HA 4DS3A 5D7NA 2RGEA 1KWGA 1XPUA 2DECA 2AUTA 2FMTA 4WFIA 4C0XA 1CUGA 1TAQA 2OGTA 3G2LA 3QA9A 4KGXA 4RD6A 4XUEA 1UJ5A 4BY1I 2F1OA 1YRBA 1RO4A 4FC6A 4YK7A 2WWXA 3HB5X 3LWNA 4NV1A 1NFRA 3UCXA 1XE3A 3M4ZA 5TQ0B 4AWAA 3ELDA 5D1OA 1AQYA 1KEUA 3UJ8A 1O5IA 1P2VA 2YN4A 4NRDA 3HOZI 1J0EA 3C6KA 4O4JA 5BPFA 1LVHA 2A33A 4OXNA 2V7BA 2X0RA 3O90A 2Z1NA 4KPFC 1E7RA 2LV8A 2IEZA 4YCBA 4F4UA 2PHZA 3CN7A 1M2NA 1VCNA 1VJ0A 4R6WA 5BSWA 1BNCA 1YQ9A 1G18A 4FEGA 2FK7A 1H5UA 5KYUA 1SQGA 1XNHA 1Z2AA 3BJMA 4V24A 5E6SA 1ZGZA 5A3SA 2ZCJA 2W98A 5EWJB 3EQ2A 4RV9A 3AKZA 2BEWA 2OMEA 4OQ4A 3NHBA 3DSRA 4WKPA 2GASA 4FSXA 2R1VB 1TQDA 3GHYA 4EHHA 5AJWA 3GLVA 1JQJC 1NATA 3PO3S 3TIFA 3G2KA 1X19A 4OATA 5TT0A 3H0KA 1P1IA 5D7BA 5A9SA 2NGRA 3AILA 1QIGA 1BKSB 3LYAA 4L3OA 1OWMA 2P77A 3U37A 4UEKA 2GESA 3AM3A 4F45A 2O8DA 4M8NE 3IQDB 2PO5A 3KVNA 1VMKA 4FJ0A 4S1TA 1P8JA 2B9EA 5JZBA 2GT1A 3KE9A 1ZPDA 2GKOA 3VJKA 4FZRA 1TF7A 3TRHA 3B9QA 1WO8A 5EE0A 1JJAA 1W46A 3QU7A 2KM1A 3C3BA 3VOTA 4EMUA 5BV2P 4KRFA 1JR3D 1CPYA 1EE9A 4YP1A 3N2EA 4QARA 3C3DA 2WFZA 1Q0RA 3LUPA 5FO1A 4RH1A 3RF6A 2ZWAA 1L8AA 2W0SA 4RVNA 1DRJA 1YDMA 3UC5A 4YMTA 4DA0A 2JB9A 2XTJA 2WIAA 3GAMA 3L8MA 3MEQA 4LC0A 4KQ1A 4HZIA 4QTZA 1RLOA 2EX0A 3GELA 3W05A 4BBAA 3QWHA 4RV5A 2BDEA 2P8JA 2HC9A 4WH0A 5IKMA 4ERXA 5AM1A 1WXWA 4TWZA 3UTCA 3NX4A 5KS2A 3MNFA 2ZYUX 4P3PA 1QJCA 3JZAA 1N8TA 4J07A 3QMWA 5I9NA 2PKXA 1J4AA 3MCUA 2CFIA 1W35A 2N3ZA 1UPUA 4DCMA 1YJ91 1Y6GA 4CMEC 4WBSA 5IMBA 2GEDA 4GMDA 4MH4A 1Q0SA 2PSFA 3HZRA 4CFZA 1JMKC 1HETA 2IYNA 3AGPA 4FFNA 1DNPA 1VPVA 3WQRA 2A0YA 2ONCA 1G8HA 1Z0KA 4TNUA 3TZHA 2LBPA 1MRZA 2NU6A 3OIVA 4XPIB 5EPEA 3SPXA 1F7VA 1GXSB 1TX4B 3OTOB 1KQSZ 3TIGA 2ZDQA 1NSYA 3TW4A 4CWAA 4DCCA 2C7OA 4LWPA 2CW5A 1A5AB 1ODTC 3DC2A 4ZO6A 4RVSA 1YC2A 1H23A 2OHHA 2G5GX 4HY3A 1ZQ1A 3V4RA 2EGHA 1FFAA 4H3VA 4MRAA 2MMGA 1K7CA 3M6MD 3T9FA 4EHKA 3MBOA 4LF8B 2O5CA 4NESA 2IVZA 2XSZD 3IAUA 3QPUA 3GVPA 3C5VA 2VYFA 4C9BA 1ID1A 4PHFA 3A7DA 4AO8A 3RYHA 2P9BA 4V1CB 3ICQB 1X74A 4CV3A 8GPBA 5FI5A 1U81A 4QVGA 2WAAA 4QYMA 2DHEA 1HLDA 1P9WA 1PLLA 1ZCJA 3M6UA 3A36A 1ZMOA 4IS3A 5KQGA 4OXXA 5H1YA 1N7GA 3Q12A 1N36B 4Z4GA 5INTA 2XVAA 1E1QA 1K6EA 1MNQA 1YZTA 1EVQA 2J9FB 2OAGA 3HRKA 3PYXA 5AKKA 3BGVA 2IA5A 5IZCC 3B2NA 3EVDA 4XWOA 3K3PA 2WFLB 4UHCA 1NQXA 1NW8A 2FDCA 3AWDA 4EW2A 5C32A 4JLSA 1MPXA 2A88A 2NQ2C 2VG8A 4L5BA 3WFIA 4B3XA 5CTAA 2WWHA 3EGOA 4AU1A 5JISA 3LT0A 2N75A 3BGIA 3RWBA 3WL6A 3KUDA 3UPUA 4OK6A 3ANMA 2FF5A 3C39A 3RKUA 4HVCA 4I3FA 4B6QA 4G1FA 1XQ9A 5AT1A 3WE7A 1R0RE 1EINA 4L5CA 4NFYA 2ID7A 3PDCA 3WGZA 1GEEA 3QYJA 4UFNA 4EB8A 1T0HB 2AEFA 2FQXA 1TVCA 1C41A 3H4TA 4YBZA 4ABYA 1XPOA 1GNSA 3EHEA 1TKCA 4CL3A 3N2IA 4KSCA 2FVXA 1W48A 4ALLA 2Y1LA 1V2HE 3HJNA 3IUBA 5AIAA 2R6R1 4R4JA 4DTCA 4PZ9A 3AL3A 3DE3X 2AJCA 4DZZA 3TG2A 2W2KB 5A2Qb 5D87A 4HT3B 1B3RA 1ZL0A 2Q3FA 5IANA 3LYLA 1X1AA 1C0LA 2X9NA 1FDTA 3LGSA 1SOWA 3DEZA 4IO0A 3BRQA 4CM9D 4RKRA 1AKTA 2GH1A 1Y1SA 3DZGA 1NBOA 2XQFA 2FSIA 2WSMA 2YWJA 4UHKA 3I5UA 4B9EA 1N9KA 2O2GA 1DKNA 1I7NA 2Q2OA 3KIFA 1XDDA 3EVAA 4EBFA 2O5EA 5IJXA 3TRIA 5BNTA 4DXDA 4RPLA 3U7GA 3PXAA 1MB3A 5C8YA 1QH9A 4FNOA 4HLDA 2ZWPA 1BE0A 4N9WA 5BRNA 4CDGA 3TDMA 1MNAA 2H9AA 3WO1A 1J8YF 1O54A 4J2OA 1GT91 1LLUA 3WP0A 3PLNA 5KWIA 1CNFA 1WCMI 1GTZA 2JDID 3GEBA 1B0ZA 1IZ7A 4OB7A 4OGFA 1JKJB 1O94D 3LQ1A 5FFNA 4DCNA 1KI2A 2A5GA 1U65A 2WD7B 4LBYA 3H9GA 2A35A 1K98A 4QU0A 4KO4S 4Y98A 1F2UA 5JSHA 4GP7A 4MKHA 3ZCUA 4J16C 5DBGA 2FAXA 4MLDA 3VNQA 4DCTA 1D6JA 2R1TA 5KREA 1JVSA 4X84A 3V42A 4PSKA 1G2OA 4YUAA 1A8UA 1Z8DA 2YXNA 3UXYA 3OY7A 4B8YA 1OVGA 4H7JA 4L5AA 2BGNA 4B47A 3LT1A 4FQ7A 3NANA 3LGXA 3QWUA 3PKJA 4NH0A 1P5JA 4EOGA 4FU0A 1NU6A 3LLUA 1TVKA 3LKDA 4OQMA 3UG7A 4G5FA 3TQQA 4HNGA 2VBGA 3RFUA 2YJ4A 2CL7X 1P4JA 4CV1A 4J7UA 2ZU6A 4QDJA 4BXOB 2EQ5A 2XMRA 1VIDA 1U7TA 2HHCA 5LR6A 3IJ5A 2JRLA 4PCVA 4F21A 3NCTA 4MGHA 3SNHA 3QVOA 1UANA 2H1SA 5IK2D 3LC0A 5IBPA 3QUCA 4ZTBA 2RKBA 5TXGA 4EITA 2O2HA 2X7JA 5BQOA 1DZ3A 1CYEA 1E0AA 1EFHA 3LVRE 3ER6A 3PT9A 1YJXA 1YHZA 1A8HA 4ZU3A 3PICA 3C98A 1QYDA 2B92A 2X3YA 4RKEA 4UDXX 2G1JA 3UXEA 2W6ZA 1YIJZ 2GZ3A 4Q82A 3L4KA 2GM5A 5HSGA 2QTMA 1YR7A 2XCTB 1BDBA 2PZMA 3K72B 3PGA1 3ZR4B 1H2EA 4XFDA 1U8TA 3AINA 3E05A 3WWCA 4JC8A 3G71Z 1Q20A 4ZYWA 2J09A 1SWVA 2YZMA 3VZSA 2BGTA 3GDWA 2G8LA 4F6CA 1Q84A 2QPTA 4LNHA 4EHAA 1EXNA 1KAHA 3D59A 1FRNA 4JC0A 1L1FA 1Z5OA 3LOPA 4GIBA 3V34A 2X77A 4IS2A 3GJXC 5BYBA 2O0MA 3DVAA 1WKCA 1MORA 4C2AA 3SIPA 1G8AA 2LP4Y 3D5QA 3P2KA 2CL6X 4LBVA 3D8SA 4ZVMA 3ZXSA 4UTPA 5F73A 1F8GA 2P5UA 3ZVMA 2P67A 1JWHC 4X60A 1YITZ 3PHCA 4Y6QA 1QVRA 4UPEA 2AW5A 1NVEA 4KQWA 3MWYW 1UPXA 4RW0A 3PEVA 3M9XA 1QGYA 2ETXA 3TPFA 3DVRX 2W7TA 4DMRA 3JYOA 2GZDA 4DQDA 1J2JA 3PD0A 3R44A 1P7CA 4F2HA 5IDVA 5A3RA 4Z4EA 2VT7A 4F7WA 2G5CA 3R5HA 1NDUA 5JEDA 2D7DA 2NP7A 3LQ4A 2XMDA 1BGWA 4KFCA 3PXGA 1ODSA 1IY1A 1SKYB 1UJ2A 5CT6A 3SC3A 3ZBPA 1QANA 2Y1FA 4OLJA 4DSAA 2WAMA 2ZPAA 4YJHA 3LLMA 1XAHA 2OYCA 4RV4A 1Z06A 3O0DA 3UWDA 1VQO1 3CINA 1WZNA 2MSWA 2PMDA 4ML3A 2DUUA 3K70B 2WJPA 1SAYA 1T0UA 3M6VA 4R1NA 3I53A 3OQPA 2AOVA 4LHXA 1OB2A 1YDWA 4EMTA 2HNAA 5JHHB 2MOKA 4BAGA 2H1VA 3BXHA 4QREA 1PE0A 2IUEA 4OFBA 2OC4A 1L5HA 3GYBA 3GLIE 1QQBA 1QTRA 1VE7A 5BSMA 1U8XX 1NBWB 5FWXB 3X44A 3U19A 1ZR2A 2AE2A 2PGNA 4YRIA 2E5FA 2GO7A 3L0ZA 2DLDA 5JCPA 3AY3A 3G711 4YRZA 4JS0A 2DT5A 2CDNA 1E9AA 3E9RA 4K8RB 1HM5A 1JLSA 2NTYC 2W2KA 4LOJA 4RA9B 4U4AA 2HSDA 2J33A 3TAUA 5CDFE 2I22A 3ZVNA 4KQ6A 2GEKA 1QCYA 3KSBC 3TQTA 1VIYA 1ULHA 1M34B 1NXQA 4IMPA 4LVCA 4CEIB 1BCSA 1HRKA 3U3RA 3VMMA 3RRYA 1C1YA 1K4MA 4MS4A 2AG0A 4JJFA 4E88A 1FDOA 5FRDA 1NN3A 1YT5A 4NZ9A 2PD3A 4G5QA 5JAQA 3M6FA 3EWNA 4PGHA 2Q51A 4DCSA 2JJ2A 2RH4A 2MSKA 1JWAB 1QZZA 2MSCB 3BK2A 4HLQB 3FPGA 4MP3A 1DCFA 2NZ2A 1BQ4A 1MOPA 4WFJA 4Y2VA 2W9XA 2DSNA 2F4NA 1QGUA 4JXJA 5K0CA 1C29B 3I8OA 3KL2A 4ZCLA 4MEAA 3MJFA 2PSJA 2CYBA 1PHRA 3AU8A 3R4CA 5AVRA 3G7NA 2JI7A 5JNLA 4OAQA 3CUWA 4RTRA 3RVPA 1F0YA 2JBAA 4IDFA 3DOUA 2P3YA 3LC1O 3CPWZ 1JEJA 1USKA 1X7YB 3F4LA 3H7AA 3MINA 3OMWA 2R97A 3QEMA 4DCPA 4ETNA 4HLUA 5A7FA 1XDSA 4EG0A 3FTEA 1Q7Y2 5EZYA 1SC1A 2WFAA 3BK1A 3Q3CA 4I6JA 3QEJA 1E2KA 3H7IA 4FOLA 3RUIA 5JCOC 2WZDA 2V7GA 2H48A 1X87A 1JG4A 5HX7A 2Q1TA 4QNMA 4IQ4A 1XRSB 3CF0A 3L01A 2NV6A 3ASVA 5FWDA 2J7PA 4PLWA 4LRTB 4CEJA 3DNMA 1JEEA 4C3VA 4ZO7A 3CWQA 4JP5A 1U2DC 4DJ5X 1G6KA 1U1DA 1WXHA 2C92A 1YHNA 3JD3A 5FLXb 1XRLA 2SBTA 4GYKA 5JMOA 2GZ1A 3FPBA 4NYIR 5E4FA 1X1BA 3VXKA 1IUKA 1W4ZA 3BE4A 4NMHA 2QM3A 1YRLA 4QGBA 4NP6A 1EJ0A 3DGFC 3GUYA 4IFEA 4IOLA 5HFJA 3QLUC 5FFFA 3FKQA 1DKOA 2PZ8A 4MGZR 4OAOA 1Z39A 3U4GA 1AOXA 1AXGA 4JB2A 1PS8A 5L7YA 5DNCA 3JZIA 1Y1PA 2ZI6A 3LDGA 3QV1A 2F62A 1QO0A 1DBSA 4C4AA 1G5RA 1VI5A 3OEHA 1Y82A 1ECPA 5M3BA 4NBVA 3NCHA 4J0DA 2P9QA 3K9NA 5BN5B 3UJ6A 4ASUA 2GK7A 1XTTA 1L3IA 4B45A 4CM3A 1CW2B 5JY1A 1JDUA 3G5UA 2DE6A 5CFLA 4ZVRA 2DUNA 1SXJC 3IKJA 2C9YA 4NCJA 3LYUA 2V7PA 3I0ZA 3ZE6A 4JBYA 3ONDA 4FZJA 1ZWKA 5JVDB 5GOZA 2HCJB 3T0FA 3C97A 1NXOA 1CDDA 1KRHA 4CM5A 5A1TA 3T1NA 1DTSA 1WF6A 4I0WB 3WLIA 1PBTA 5BWMA 1ZLXA 4JYMA 3L46A 4DBZA 1YQEA 5KQPA 4B71A 1ELOA 2FW7A 3H3XA 3I9JA 5JDCC 4I14A 2H52A 3NHMA 1NN0A 5A9TA 4HH4A 4DJDC 2O8EA 3W9YA 1DG9A 3DZ8A 2BGUA 4MR7A 3UNXA 3IELA 2EBHX 3PCRB 4OFZA 4ZIRA 1EFAA 4IUDS 2DFKB 4IV0A 5K8CA 2O8EB 2AQHA 3WK6A 4BQPA 4URWR 3N0WA 1Q0TA 4WGGA 1O5TA 4UBJA 1QC5A 5D8DA 2WJ4A 4UFOA 4BLSA 4YRPA 1WS6A 1YZYA 3LCRA 4FXPA 5JSKA 5HKKA 5SY9A 4FD3A 5AI6A 4LWZA 5HMMA 1AV6A 2IYYA 1Z8NA 2DBYA 1DJMA 2VYQA 5JQGF 4QXOA 2QY9A 3F8TA 3AVPA 3F8WA 5JSFA 3BWXA 3C0KA 3DZBA 2AEEA 2NT4A 3K30A 1V9CA