1Q862

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86200
1VQLZ 1KQSZ 2QA41 3OW2Y 1VQ6Z 1Q7Y1 1YIJ1 1YJN1 3CCU1 1VQO1 1VQK1 1S721 2OTJZ 1VQ81 1KC82 1YJWZ 3CCVZ 1K731 1KQSY 1VQL1 3CXCZ 1VQM1 1N8R2 1Q7Y2 1VQ41 2OTJ1 1YIT1 3CC7Z 3CCV1 3CCE1 1VQ5Z 1K732 3I561 3CMEZ 1KD11 1M901 3CC71 3CMAZ 1VQP1 3CC21 1YJ91 1YHQ1 1QVGZ 1VQ9Z 1VQNZ 1JJ2Z 1NJI1 2OTLZ 3CMA1 1VQ61 3G4SZ 1KD12 2QEXZ 1M902 3CCLZ 1QVFZ 1Q821 1JJ2Y 1VQ7Z 1YJW1 3CCQZ 3CPWZ 3CXCY 1NJI2 1QVFY 3CD6Z 1K8A1 1K9M1 3CPWY 3G71Z 1Q822 1Q811 1VQ51 3G6EZ 1YI2Z 3CME1 3CCJZ 1W2BZ 2QA4Z 3G711 1YIJZ 3CCRZ 1YJNZ 3CCUZ 1M1K1 1K8A2 1K9M2 1QVGY 1VQOZ 1VQKZ 1VQ91 1VQN1 1Q812 1YI21 3CC4Z 1W2BY 2OTL1 3G4S1 1VQMZ 3CCR1 2QEX1 3CCL1 3CCMZ 1VQ4Z 1Q861 1VQ71 3I55Z 3CC41 3CCQ1 3CCSZ 1YITZ 1M1K2 3CCEZ 3I56Z 3CD61 3CCM1 3I551 3CCS1 1VQPZ 3OW2Z 1Q862 1KC81 3G6E1 3CC2Z 1S72Z 1YJ9Z 1YHQZ 3CCJ1 1VQ8Z 1N8R1
chains in the Genus database with same CATH superfamily
1VQLZ 3S1MI 4BBRI 2QA41 2Q4ZA 1Q7Y1 1YJN1 4RVFA 2QLVB 1VQO1 1QF8A 2OTJZ 3Q87A 4NBHA 3J80b 4A3II 5FLXb 1VQ81 3GTPI 1ML8A 3J81b 2DE6A 2K5RA 1N8R2 2RBLA 5C4XI 4MD9A 3VMGA 4A3BI 3KIHA 4NBEA 3MZKB 3KIFA 3VB9A 2W03A 1K732 5C44I 2VUGA 1TFIA 3D2LA 2H85A 3CMEZ 3H3VJ 2NVQI 1YUKA 4E32A 3NH8A 2F4MA 2VPYA 1X0TA 2JIOA 4NBAA 3K7AI 3VTNA 3GTMS 1Y1VS 1KD12 3GTJI 3CCLZ 2OOYB 1QVFZ 1Q821 1JJ2Y 4E2WA 1VQ7Z 4E2XA 2LEXA 1Q16A 1L1OC 4A3JI 1Z01A 1SFOI 1K8A1 3CPWY 4BBSI 5C4JI 5T67A 1RLYA 3G711 3CCUZ 4HGYA 3IF8A 3D9XA 4EWCA 1VQKZ 2R92I 3CC4Z 1W2BY 2P3YA 3GTMI 1AA6A 1Y1VI 1VQMZ 3I4MI 3IX0A 1WW9A 3GTLI 4NB8A 2V8JA 5CM2M 4NBBA 3CCM1 3LUSA 4E2ZA 3EERA 3OW2Z 3TE5B 3NFZA 2R6MA 5T64A 1KC81 3CC2Z 2G2KA 3CCJ1 4RVHA 1KQSZ 1VQ6Z 2Q51A 1QXFA 4QTUA 2Y0SA 1S721 2E2II 1YJWZ 4A3FI 2NVYI 1VQL1 2O4HA 4NBDA 2R93I 3NDJA 3VMHA 5IT9f 4CL1A 1Q7Y2 2KPIA 2NVXI 2OTJ1 1YIT1 4HGZA 1WJ2A 4NB9A 1VQ5Z 2JA5I 5FLMI 3VMIA 2PMZA 4A3GI 5C3EI 3GCFA 3HOYI 2R7ZI 2LIYA 1VQP1 2V45A 1FDIA 1ZB8A 4Y52I 1YHQ1 3M3YI 1VQ9Z 1I3QI 3HOUI 1NJI1 2OTLZ 2B63I 3MZLB 3HOZI 3G4SZ 3M4OI 2W04A 4DGLA 4NBCA 2M6NA 3CCQZ 3S14I 1X3ZA 2JIMA 4RVGA 3CXCY 1USPA 2F4OA 2PK7A 4A3DI 1WIIA 2GTIA 2JMOA 4A3LI 1K9M1 3RZOI 1Q822 3F3FC 1Q811 1SIWA 3FQQA 1RO2A 3RZDI 3ESWA 1TWCI 4QTTA 4NFRA 2QA4Z 3CCRZ 1YJNZ 1Z02A 1K8A2 2NVTI 1VQOZ 1VQN1 2YADA 3HOVI 3BG1B 2EGTA 1TWHI 2HU9A 1KRLA 2QEX1 1RQFA 2JR6A 3I55Z 3CC41 3CCSZ 5IP7I 1VLAA 3CD61 2RIQA 4MRIA 2PM9A 4A3KI 2JS4A 3G6E1 3PO2I 3NH4A 3BG0B 2IV2X 3I4NI 3S1RI 1YIJ1 3IFUA 3HOXI 2QRCB 2WAQA 4E31A 1KC82 3CCVZ 3CXCZ 3D6WA 2QREB 4BXXI 1VQ41 2J6AA 1FDOA 1K83I 2LFUA 3CC7Z 5D1PA 3CCE1 3I561 2VPWA 2DE5A 2RT9A 4BY1I 3GTKI 2VPZA 1M901 3CMAZ 1JWHC 4E2YA 2V8KA 1TWFI 1NUIA 3I07A 2ZAEB 2OOXB 1YJ91 4HH4A 4A93I 3S2HI 4DK1A 1JJ2Z 2JUBA 4NH1C 3T4NB 5A2Qf 1TWGI 2E2HI 2JIPA 2DE7A 3GTOI 2IZ3A 2E7ZA 2K3RA 2OZKA 2QRDB 2BJOA 5IP9I 3CPWZ 2VF1A 1NJI2 2JA7I 1QVFY 3S1QI 1LQLA 1USPB 5A2Qb 3IR7A 2VPXA 3S17I 1N2FA 5IT9b 3U50C 1YI2Z 3CME1 3CCJZ 3QWUA 3FQMA 1W2BZ 3J80f 3GKQA 2JA6I 1M1K1 1K9M2 1QVGY 3H0GI 3J81f 1Q812 3PO3S 1Y1WI 4MD7A 2E9HA 3CCR1 2RHBA 3HOWI 3CCL1 1R9TI 3MONA 1Q861 1VQ71 1YITZ 4A3CI 2IZ4A 1QYPA 2I3CA 1I50I 1X3WA 5T6BA 2GTHA 2V8IA 3I551 3CCS1 2JIQA 1VQPZ 2P28A 4TNUA 1Z03A 4MD8A 1YHQZ 1I6HI 1RO4A 1VQ8Z 1N8R1 3CQZI 3HKZA 3OW2Y 3S16I 1NP6A 3CCU1 2JNYA 4NBFA 3NDIA 1VQK1 1K731 1DL6A 1KQSY 4RVDA 4NBGA 3S1NI 2QR1B 3PO3I 1VQM1 4RV9A 3TDHB 2RPRA 2HF1A 3CCV1 3GTGI 2WB1A 4E33A 1KD11 4AYBA 3J7A4 2M48A 5D1OB 3CC71 1PFTA 4XX2A 1S7MA 3CC21 1QVGZ 3EEDA 1VQNZ 4X6AI 1RO0A 3CMA1 1VQ61 3P5JB 3NH5A 2KI7B 2QEXZ 1TWAI 1M902 4A3MI 1RNIA 1YJW1 4MONA 4NOZA 4E30A 5AN9F 3GTQI 5D1OA 3CD6Z 1YUAA 3S15I 5LL6f 3F3PC 3JAMf 3G71Z 2QKDA 1VQ51 3G6EZ 1P9NA 2AKLA 1WCMI 2E2JI 1YIJZ 4RS4A 2YU9I 1VQ91 3JAMb 1YI21 3S2DI 2OTL1 2NAPA 4DQYB 4A3EI 4Y7NI 3G4S1 4MH4A 1ZH1A 2O53A 3CCMZ 3FKII 1VQ4Z 1ZB9A 1M1K2 3CCQ1 2JIRA 3CCEZ 1WZNA 2GU2A 3I56Z 4BY7I 4MXUA 2V3VA 2VUMI 2JA8I 4S1TA 5FLXf 1Q862 1S72Z 1YJ9Z 2AYDA 1Y8CA
chains in the Genus database with same CATH topology
1VQLZ 3S1MI 4BBRI 2QA41 2Q4ZA 1Q7Y1 1YJN1 4RVFA 2QLVB 1VQO1 1QF8A 2OTJZ 3Q87A 4NBHA 3J80b 4A3II 5FLXb 1VQ81 3GTPI 1ML8A 3J81b 2DE6A 2K5RA 1N8R2 2RBLA 5C4XI 4MD9A 3VMGA 4A3BI 3KIHA 4NBEA 3MZKB 3KIFA 3VB9A 2W03A 1K732 5C44I 2VUGA 1TFIA 2H85A 3CMEZ 3H3VJ 2NVQI 1YUKA 4E32A 3NH8A 2F4MA 1X0TA 4NBAA 3K7AI 3VTNA 3GTMS 1Y1VS 1KD12 3GTJI 3CCLZ 2OOYB 1QVFZ 1Q821 1JJ2Y 4E2WA 1VQ7Z 4E2XA 1L1OC 4A3JI 1Z01A 1SFOI 1K8A1 3CPWY 4BBSI 5C4JI 5T67A 1RLYA 3G711 3CCUZ 4HGYA 3IF8A 3D9XA 4EWCA 1VQKZ 2R92I 3CC4Z 1W2BY 2P3YA 3GTMI 1Y1VI 1VQMZ 3I4MI 3IX0A 1WW9A 3GTLI 4NB8A 2V8JA 5CM2M 4NBBA 3CCM1 3LUSA 4E2ZA 3EERA 3OW2Z 3TE5B 3NFZA 2R6MA 5T64A 1KC81 3CC2Z 2G2KA 3CCJ1 4RVHA 1KQSZ 1VQ6Z 2Q51A 4QTUA 2Y0SA 1S721 2E2II 1YJWZ 4A3FI 2NVYI 1VQL1 2O4HA 4NBDA 2R93I 3NDJA 3VMHA 5IT9f 4CL1A 1Q7Y2 2KPIA 2NVXI 2OTJ1 1YIT1 4HGZA 4NB9A 1VQ5Z 2JA5I 5FLMI 3VMIA 2PMZA 4A3GI 5C3EI 3GCFA 3HOYI 2R7ZI 2LIYA 1VQP1 1ZB8A 4Y52I 1YHQ1 3M3YI 1VQ9Z 1I3QI 3HOUI 1NJI1 2OTLZ 2B63I 3MZLB 3HOZI 3G4SZ 3M4OI 2W04A 4DGLA 4NBCA 2M6NA 3CCQZ 3S14I 1X3ZA 4RVGA 3CXCY 1USPA 2F4OA 2PK7A 4A3DI 1WIIA 2GTIA 2JMOA 4A3LI 1K9M1 3RZOI 1Q822 3F3FC 1Q811 3FQQA 1RO2A 3RZDI 3ESWA 1TWCI 4QTTA 4NFRA 2QA4Z 3CCRZ 1YJNZ 1Z02A 1K8A2 2NVTI 1VQOZ 1VQN1 2YADA 3HOVI 3BG1B 2EGTA 1TWHI 2HU9A 1KRLA 2QEX1 1RQFA 2JR6A 3I55Z 3CC41 3CCSZ 5IP7I 1VLAA 3CD61 2RIQA 4MRIA 2PM9A 4A3KI 2JS4A 3G6E1 3PO2I 3NH4A 3BG0B 3I4NI 3S1RI 1YIJ1 3IFUA 3HOXI 2QRCB 2WAQA 4E31A 1KC82 3CCVZ 3CXCZ 3D6WA 2QREB 4BXXI 1VQ41 2J6AA 1K83I 2LFUA 3CC7Z 5D1PA 3CCE1 3I561 2DE5A 2RT9A 4BY1I 3GTKI 1M901 3CMAZ 1JWHC 4E2YA 2V8KA 1TWFI 1NUIA 3I07A 2ZAEB 2OOXB 1YJ91 4HH4A 4A93I 3S2HI 4DK1A 1JJ2Z 2JUBA 4NH1C 3T4NB 5A2Qf 1TWGI 2E2HI 2DE7A 3GTOI 2IZ3A 2K3RA 2OZKA 2QRDB 2BJOA 5IP9I 3CPWZ 2VF1A 1NJI2 2JA7I 1QVFY 3S1QI 1LQLA 1USPB 5A2Qb 3S17I 1N2FA 5IT9b 3U50C 1YI2Z 3CME1 3CCJZ 3QWUA 3FQMA 1W2BZ 3J80f 3GKQA 2JA6I 1M1K1 1K9M2 1QVGY 3H0GI 3J81f 1Q812 3PO3S 1Y1WI 4MD7A 2E9HA 3CCR1 2RHBA 3HOWI 3CCL1 1R9TI 3MONA 1Q861 1VQ71 1YITZ 4A3CI 2IZ4A 1QYPA 2I3CA 1I50I 1X3WA 5T6BA 2GTHA 2V8IA 3I551 3CCS1 1VQPZ 2P28A 4TNUA 1Z03A 4MD8A 1YHQZ 1I6HI 1RO4A 1VQ8Z 1N8R1 3CQZI 3HKZA 3OW2Y 3S16I 1NP6A 3CCU1 2JNYA 4NBFA 3NDIA 1VQK1 1K731 1DL6A 1KQSY 4RVDA 4NBGA 3S1NI 2QR1B 3PO3I 1VQM1 4RV9A 3TDHB 2RPRA 2HF1A 3CCV1 3GTGI 2WB1A 4E33A 1KD11 4AYBA 3J7A4 2M48A 5D1OB 3CC71 1PFTA 4XX2A 1S7MA 3CC21 1QVGZ 3EEDA 1VQNZ 4X6AI 1RO0A 3CMA1 1VQ61 3P5JB 3NH5A 2KI7B 2QEXZ 1TWAI 1M902 4A3MI 1RNIA 1YJW1 4MONA 4NOZA 4E30A 5AN9F 3GTQI 5D1OA 3CD6Z 1YUAA 3S15I 5LL6f 3F3PC 3JAMf 3G71Z 2QKDA 1VQ51 3G6EZ 1P9NA 2AKLA 1WCMI 2E2JI 1YIJZ 4RS4A 2YU9I 1VQ91 3JAMb 1YI21 3S2DI 2OTL1 4DQYB 4A3EI 4Y7NI 3G4S1 4MH4A 1ZH1A 2O53A 3CCMZ 3FKII 1VQ4Z 1ZB9A 1M1K2 3CCQ1 3CCEZ 2GU2A 3I56Z 4BY7I 4MXUA 2VUMI 2JA8I 4S1TA 5FLXf 1Q862 1S72Z 1YJ9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Z;  1KQS Z;  2QA4 1;  3OW2 Y;  1VQ6 Z;  1Q7Y 1;  1YIJ 1;  1YJN 1;  3CCU 1;  1VQO 1;  1VQK 1;  1S72 1;  2OTJ Z;  1VQ8 1;  1KC8 2;  1YJW Z;  3CCV Z;  1K73 1;  1KQS Y;  1VQL 1;  3CXC Z;  1VQM 1;  1N8R 2;  1Q7Y 2;  1VQ4 1;  2OTJ 1;  1YIT 1;  3CC7 Z;  3CCV 1;  3CCE 1;  1VQ5 Z;  1K73 2;  3I56 1;  3CME Z;  1KD1 1;  1M90 1;  3CC7 1;  3CMA Z;  1VQP 1;  3CC2 1;  1YJ9 1;  1YHQ 1;  1QVG Z;  1VQ9 Z;  1VQN Z;  1JJ2 Z;  1NJI 1;  2OTL Z;  3CMA 1;  1VQ6 1;  3G4S Z;  1KD1 2;  2QEX Z;  1M90 2;  3CCL Z;  1QVF Z;  1Q82 1;  1JJ2 Y;  1VQ7 Z;  1YJW 1;  3CCQ Z;  3CPW Z;  3CXC Y;  1NJI 2;  1QVF Y;  3CD6 Z;  1K8A 1;  1K9M 1;  3CPW Y;  3G71 Z;  1Q82 2;  1Q81 1;  1VQ5 1;  3G6E Z;  1YI2 Z;  3CME 1;  3CCJ Z;  1W2B Z;  2QA4 Z;  3G71 1;  1YIJ Z;  3CCR Z;  1YJN Z;  3CCU Z;  1M1K 1;  1K8A 2;  1K9M 2;  1QVG Y;  1VQO Z;  1VQK Z;  1VQ9 1;  1VQN 1;  1Q81 2;  1YI2 1;  3CC4 Z;  1W2B Y;  2OTL 1;  3G4S 1;  1VQM Z;  3CCR 1;  2QEX 1;  3CCL 1;  3CCM Z;  1VQ4 Z;  1Q86 1;  1VQ7 1;  3I55 Z;  3CC4 1;  3CCQ 1;  3CCS Z;  1YIT Z;  1M1K 2;  3CCE Z;  3I56 Z;  3CD6 1;  3CCM 1;  3I55 1;  3CCS 1;  1VQP Z;  3OW2 Z;  1Q86 2;  1KC8 1;  3G6E 1;  3CC2 Z;  1S72 Z;  1YJ9 Z;  1YHQ Z;  3CCJ 1;  1VQ8 Z;  1N8R 1; 
#chains in the Genus database with same CATH topology
 1VQL Z;  3S1M I;  4BBR I;  2QA4 1;  2Q4Z A;  1Q7Y 1;  1YJN 1;  4RVF A;  2QLV B;  1VQO 1;  1QF8 A;  2OTJ Z;  3Q87 A;  4NBH A;  3J80 b;  4A3I I;  5FLX b;  1VQ8 1;  3GTP I;  1ML8 A;  3J81 b;  2DE6 A;  2K5R A;  1N8R 2;  2RBL A;  5C4X I;  4MD9 A;  3VMG A;  4A3B I;  3KIH A;  4NBE A;  3MZK B;  3KIF A;  3VB9 A;  2W03 A;  1K73 2;  5C44 I;  2VUG A;  1TFI A;  3D2L A;  2H85 A;  3CME Z;  3H3V J;  2NVQ I;  1YUK A;  4E32 A;  3NH8 A;  2F4M A;  2VPY A;  1X0T A;  2JIO A;  4NBA A;  3K7A I;  3VTN A;  3GTM S;  1Y1V S;  1KD1 2;  3GTJ I;  3CCL Z;  2OOY B;  1QVF Z;  1Q82 1;  1JJ2 Y;  4E2W A;  1VQ7 Z;  4E2X A;  2LEX A;  1Q16 A;  1L1O C;  4A3J I;  1Z01 A;  1SFO I;  1K8A 1;  3CPW Y;  4BBS I;  5C4J I;  5T67 A;  1RLY A;  3G71 1;  3CCU Z;  4HGY A;  3IF8 A;  3D9X A;  4EWC A;  1VQK Z;  2R92 I;  3CC4 Z;  1W2B Y;  2P3Y A;  3GTM I;  1AA6 A;  1Y1V I;  1VQM Z;  3I4M I;  3IX0 A;  1WW9 A;  3GTL I;  4NB8 A;  2V8J A;  5CM2 M;  4NBB A;  3CCM 1;  3LUS A;  4E2Z A;  3EER A;  3OW2 Z;  3TE5 B;  3NFZ A;  2R6M A;  5T64 A;  1KC8 1;  3CC2 Z;  2G2K A;  3CCJ 1;  4RVH A;  1KQS Z;  1VQ6 Z;  2Q51 A;  1QXF A;  4QTU A;  2Y0S A;  1S72 1;  2E2I I;  1YJW Z;  4A3F I;  2NVY I;  1VQL 1;  2O4H A;  4NBD A;  2R93 I;  3NDJ A;  3VMH A;  5IT9 f;  4CL1 A;  1Q7Y 2;  2KPI A;  2NVX I;  2OTJ 1;  1YIT 1;  4HGZ A;  1WJ2 A;  4NB9 A;  1VQ5 Z;  2JA5 I;  5FLM I;  3VMI A;  2PMZ A;  4A3G I;  5C3E I;  3GCF A;  3HOY I;  2R7Z I;  2LIY A;  1VQP 1;  2V45 A;  1FDI A;  1ZB8 A;  4Y52 I;  1YHQ 1;  3M3Y I;  1VQ9 Z;  1I3Q I;  3HOU I;  1NJI 1;  2OTL Z;  2B63 I;  3MZL B;  3HOZ I;  3G4S Z;  3M4O I;  2W04 A;  4DGL A;  4NBC A;  2M6N A;  3CCQ Z;  3S14 I;  1X3Z A;  2JIM A;  4RVG A;  3CXC Y;  1USP A;  2F4O A;  2PK7 A;  4A3D I;  1WII A;  2GTI A;  2JMO A;  4A3L I;  1K9M 1;  3RZO I;  1Q82 2;  3F3F C;  1Q81 1;  1SIW A;  3FQQ A;  1RO2 A;  3RZD I;  3ESW A;  1TWC I;  4QTT A;  4NFR A;  2QA4 Z;  3CCR Z;  1YJN Z;  1Z02 A;  1K8A 2;  2NVT I;  1VQO Z;  1VQN 1;  2YAD A;  3HOV I;  3BG1 B;  2EGT A;  1TWH I;  2HU9 A;  1KRL A;  2QEX 1;  1RQF A;  2JR6 A;  3I55 Z;  3CC4 1;  3CCS Z;  5IP7 I;  1VLA A;  3CD6 1;  2RIQ A;  4MRI A;  2PM9 A;  4A3K I;  2JS4 A;  3G6E 1;  3PO2 I;  3NH4 A;  3BG0 B;  2IV2 X;  3I4N I;  3S1R I;  1YIJ 1;  3IFU A;  3HOX I;  2QRC B;  2WAQ A;  4E31 A;  1KC8 2;  3CCV Z;  3CXC Z;  3D6W A;  2QRE B;  4BXX I;  1VQ4 1;  2J6A A;  1FDO A;  1K83 I;  2LFU A;  3CC7 Z;  5D1P A;  3CCE 1;  3I56 1;  2VPW A;  2DE5 A;  2RT9 A;  4BY1 I;  3GTK I;  2VPZ A;  1M90 1;  3CMA Z;  1JWH C;  4E2Y A;  2V8K A;  1TWF I;  1NUI A;  3I07 A;  2ZAE B;  2OOX B;  1YJ9 1;  4HH4 A;  4A93 I;  3S2H I;  4DK1 A;  1JJ2 Z;  2JUB A;  4NH1 C;  3T4N B;  5A2Q f;  1TWG I;  2E2H I;  2JIP A;  2DE7 A;  3GTO I;  2IZ3 A;  2E7Z A;  2K3R A;  2OZK A;  2QRD B;  2BJO A;  5IP9 I;  3CPW Z;  2VF1 A;  1NJI 2;  2JA7 I;  1QVF Y;  3S1Q I;  1LQL A;  1USP B;  5A2Q b;  3IR7 A;  2VPX A;  3S17 I;  1N2F A;  5IT9 b;  3U50 C;  1YI2 Z;  3CME 1;  3CCJ Z;  3QWU A;  3FQM A;  1W2B Z;  3J80 f;  3GKQ A;  2JA6 I;  1M1K 1;  1K9M 2;  1QVG Y;  3H0G I;  3J81 f;  1Q81 2;  3PO3 S;  1Y1W I;  4MD7 A;  2E9H A;  3CCR 1;  2RHB A;  3HOW I;  3CCL 1;  1R9T I;  3MON A;  1Q86 1;  1VQ7 1;  1YIT Z;  4A3C I;  2IZ4 A;  1QYP A;  2I3C A;  1I50 I;  1X3W A;  5T6B A;  2GTH A;  2V8I A;  3I55 1;  3CCS 1;  2JIQ A;  1VQP Z;  2P28 A;  4TNU A;  1Z03 A;  4MD8 A;  1YHQ Z;  1I6H I;  1RO4 A;  1VQ8 Z;  1N8R 1;  3CQZ I;  3HKZ A;  3OW2 Y;  3S16 I;  1NP6 A;  3CCU 1;  2JNY A;  4NBF A;  3NDI A;  1VQK 1;  1K73 1;  1DL6 A;  1KQS Y;  4RVD A;  4NBG A;  3S1N I;  2QR1 B;  3PO3 I;  1VQM 1;  4RV9 A;  3TDH B;  2RPR A;  2HF1 A;  3CCV 1;  3GTG I;  2WB1 A;  4E33 A;  1KD1 1;  4AYB A;  3J7A 4;  2M48 A;  5D1O B;  3CC7 1;  1PFT A;  4XX2 A;  1S7M A;  3CC2 1;  1QVG Z;  3EED A;  1VQN Z;  4X6A I;  1RO0 A;  3CMA 1;  1VQ6 1;  3P5J B;  3NH5 A;  2KI7 B;  2QEX Z;  1TWA I;  1M90 2;  4A3M I;  1RNI A;  1YJW 1;  4MON A;  4NOZ A;  4E30 A;  5AN9 F;  3GTQ I;  5D1O A;  3CD6 Z;  1YUA A;  3S15 I;  5LL6 f;  3F3P C;  3JAM f;  3G71 Z;  2QKD A;  1VQ5 1;  3G6E Z;  1P9N A;  2AKL A;  1WCM I;  2E2J I;  1YIJ Z;  4RS4 A;  2YU9 I;  1VQ9 1;  3JAM b;  1YI2 1;  3S2D I;  2OTL 1;  2NAP A;  4DQY B;  4A3E I;  4Y7N I;  3G4S 1;  4MH4 A;  1ZH1 A;  2O53 A;  3CCM Z;  3FKI I;  1VQ4 Z;  1ZB9 A;  1M1K 2;  3CCQ 1;  2JIR A;  3CCE Z;  1WZN A;  2GU2 A;  3I56 Z;  4BY7 I;  4MXU A;  2V3V A;  2VUM I;  2JA8 I;  4S1T A;  5FLX f;  1Q86 2;  1S72 Z;  1YJ9 Z;  2AYD A;  1Y8C A; 
#chains in the Genus database with same CATH homology
 1VQL Z;  3S1M I;  4BBR I;  2QA4 1;  2Q4Z A;  1Q7Y 1;  1YJN 1;  4RVF A;  2QLV B;  1VQO 1;  1QF8 A;  2OTJ Z;  3Q87 A;  4NBH A;  3J80 b;  4A3I I;  5FLX b;  1VQ8 1;  3GTP I;  1ML8 A;  3J81 b;  2DE6 A;  2K5R A;  1N8R 2;  2RBL A;  5C4X I;  4MD9 A;  3VMG A;  4A3B I;  3KIH A;  4NBE A;  3MZK B;  3KIF A;  3VB9 A;  2W03 A;  1K73 2;  5C44 I;  2VUG A;  1TFI A;  2H85 A;  3CME Z;  3H3V J;  2NVQ I;  1YUK A;  4E32 A;  3NH8 A;  2F4M A;  1X0T A;  4NBA A;  3K7A I;  3VTN A;  3GTM S;  1Y1V S;  1KD1 2;  3GTJ I;  3CCL Z;  2OOY B;  1QVF Z;  1Q82 1;  1JJ2 Y;  4E2W A;  1VQ7 Z;  4E2X A;  1L1O C;  4A3J I;  1Z01 A;  1SFO I;  1K8A 1;  3CPW Y;  4BBS I;  5C4J I;  5T67 A;  1RLY A;  3G71 1;  3CCU Z;  4HGY A;  3IF8 A;  3D9X A;  4EWC A;  1VQK Z;  2R92 I;  3CC4 Z;  1W2B Y;  2P3Y A;  3GTM I;  1Y1V I;  1VQM Z;  3I4M I;  3IX0 A;  1WW9 A;  3GTL I;  4NB8 A;  2V8J A;  5CM2 M;  4NBB A;  3CCM 1;  3LUS A;  4E2Z A;  3EER A;  3OW2 Z;  3TE5 B;  3NFZ A;  2R6M A;  5T64 A;  1KC8 1;  3CC2 Z;  2G2K A;  3CCJ 1;  4RVH A;  1KQS Z;  1VQ6 Z;  2Q51 A;  4QTU A;  2Y0S A;  1S72 1;  2E2I I;  1YJW Z;  4A3F I;  2NVY I;  1VQL 1;  2O4H A;  4NBD A;  2R93 I;  3NDJ A;  3VMH A;  5IT9 f;  4CL1 A;  1Q7Y 2;  2KPI A;  2NVX I;  2OTJ 1;  1YIT 1;  4HGZ A;  4NB9 A;  1VQ5 Z;  2JA5 I;  5FLM I;  3VMI A;  2PMZ A;  4A3G I;  5C3E I;  3GCF A;  3HOY I;  2R7Z I;  2LIY A;  1VQP 1;  1ZB8 A;  4Y52 I;  1YHQ 1;  3M3Y I;  1VQ9 Z;  1I3Q I;  3HOU I;  1NJI 1;  2OTL Z;  2B63 I;  3MZL B;  3HOZ I;  3G4S Z;  3M4O I;  2W04 A;  4DGL A;  4NBC A;  2M6N A;  3CCQ Z;  3S14 I;  1X3Z A;  4RVG A;  3CXC Y;  1USP A;  2F4O A;  2PK7 A;  4A3D I;  1WII A;  2GTI A;  2JMO A;  4A3L I;  1K9M 1;  3RZO I;  1Q82 2;  3F3F C;  1Q81 1;  3FQQ A;  1RO2 A;  3RZD I;  3ESW A;  1TWC I;  4QTT A;  4NFR A;  2QA4 Z;  3CCR Z;  1YJN Z;  1Z02 A;  1K8A 2;  2NVT I;  1VQO Z;  1VQN 1;  2YAD A;  3HOV I;  3BG1 B;  2EGT A;  1TWH I;  2HU9 A;  1KRL A;  2QEX 1;  1RQF A;  2JR6 A;  3I55 Z;  3CC4 1;  3CCS Z;  5IP7 I;  1VLA A;  3CD6 1;  2RIQ A;  4MRI A;  2PM9 A;  4A3K I;  2JS4 A;  3G6E 1;  3PO2 I;  3NH4 A;  3BG0 B;  3I4N I;  3S1R I;  1YIJ 1;  3IFU A;  3HOX I;  2QRC B;  2WAQ A;  4E31 A;  1KC8 2;  3CCV Z;  3CXC Z;  3D6W A;  2QRE B;  4BXX I;  1VQ4 1;  2J6A A;  1K83 I;  2LFU A;  3CC7 Z;  5D1P A;  3CCE 1;  3I56 1;  2DE5 A;  2RT9 A;  4BY1 I;  3GTK I;  1M90 1;  3CMA Z;  1JWH C;  4E2Y A;  2V8K A;  1TWF I;  1NUI A;  3I07 A;  2ZAE B;  2OOX B;  1YJ9 1;  4HH4 A;  4A93 I;  3S2H I;  4DK1 A;  1JJ2 Z;  2JUB A;  4NH1 C;  3T4N B;  5A2Q f;  1TWG I;  2E2H I;  2DE7 A;  3GTO I;  2IZ3 A;  2K3R A;  2OZK A;  2QRD B;  2BJO A;  5IP9 I;  3CPW Z;  2VF1 A;  1NJI 2;  2JA7 I;  1QVF Y;  3S1Q I;  1LQL A;  1USP B;  5A2Q b;  3S17 I;  1N2F A;  5IT9 b;  3U50 C;  1YI2 Z;  3CME 1;  3CCJ Z;  3QWU A;  3FQM A;  1W2B Z;  3J80 f;  3GKQ A;  2JA6 I;  1M1K 1;  1K9M 2;  1QVG Y;  3H0G I;  3J81 f;  1Q81 2;  3PO3 S;  1Y1W I;  4MD7 A;  2E9H A;  3CCR 1;  2RHB A;  3HOW I;  3CCL 1;  1R9T I;  3MON A;  1Q86 1;  1VQ7 1;  1YIT Z;  4A3C I;  2IZ4 A;  1QYP A;  2I3C A;  1I50 I;  1X3W A;  5T6B A;  2GTH A;  2V8I A;  3I55 1;  3CCS 1;  1VQP Z;  2P28 A;  4TNU A;  1Z03 A;  4MD8 A;  1YHQ Z;  1I6H I;  1RO4 A;  1VQ8 Z;  1N8R 1;  3CQZ I;  3HKZ A;  3OW2 Y;  3S16 I;  1NP6 A;  3CCU 1;  2JNY A;  4NBF A;  3NDI A;  1VQK 1;  1K73 1;  1DL6 A;  1KQS Y;  4RVD A;  4NBG A;  3S1N I;  2QR1 B;  3PO3 I;  1VQM 1;  4RV9 A;  3TDH B;  2RPR A;  2HF1 A;  3CCV 1;  3GTG I;  2WB1 A;  4E33 A;  1KD1 1;  4AYB A;  3J7A 4;  2M48 A;  5D1O B;  3CC7 1;  1PFT A;  4XX2 A;  1S7M A;  3CC2 1;  1QVG Z;  3EED A;  1VQN Z;  4X6A I;  1RO0 A;  3CMA 1;  1VQ6 1;  3P5J B;  3NH5 A;  2KI7 B;  2QEX Z;  1TWA I;  1M90 2;  4A3M I;  1RNI A;  1YJW 1;  4MON A;  4NOZ A;  4E30 A;  5AN9 F;  3GTQ I;  5D1O A;  3CD6 Z;  1YUA A;  3S15 I;  5LL6 f;  3F3P C;  3JAM f;  3G71 Z;  2QKD A;  1VQ5 1;  3G6E Z;  1P9N A;  2AKL A;  1WCM I;  2E2J I;  1YIJ Z;  4RS4 A;  2YU9 I;  1VQ9 1;  3JAM b;  1YI2 1;  3S2D I;  2OTL 1;  4DQY B;  4A3E I;  4Y7N I;  3G4S 1;  4MH4 A;  1ZH1 A;  2O53 A;  3CCM Z;  3FKI I;  1VQ4 Z;  1ZB9 A;  1M1K 2;  3CCQ 1;  3CCE Z;  2GU2 A;  3I56 Z;  4BY7 I;  4MXU A;  2VUM I;  2JA8 I;  4S1T A;  5FLX f;  1Q86 2;  1S72 Z;  1YJ9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...