1Q862

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86200
1YHQ1 1JJ2Y 3CME1 1K731 1K8A2 1K9M2 1VQN1 3CCJZ 1VQMZ 3I561 1YJ91 1K732 1VQ7Z 1NJI1 2OTJ1 1QVGY 3CC41 1VQP1 1KC81 2OTLZ 3CCMZ 1Q7Y1 1YJW1 3CC2Z 3CCQ1 3CCL1 3CPWZ 1YIJ1 1YI2Z 1Q7Y2 1KQSY 3G4SZ 3CCVZ 3CCUZ 3G6EZ 3CCRZ 1VQ61 3CC71 1VQ5Z 2QA4Z 3CCSZ 2QEX1 1VQKZ 1YJNZ 1VQOZ 1YITZ 1NJI2 1W2BZ 1VQNZ 3G71Z 1VQ4Z 1VQ71 3I56Z 3I551 1KD11 1JJ2Z 1KC82 1QVFZ 2OTJZ 3CXCZ 1M901 3CPWY 1KD12 1VQL1 2OTL1 3CCM1 3CMAZ 1Q821 3CD6Z 1QVGZ 1YJWZ 3CCE1 1YI21 1YIJZ 3CCV1 1VQ8Z 3CCU1 1Q861 3G6E1 2QA41 1S72Z 1Q862 1KQSZ 1VQ9Z 3OW2Z 1YHQZ 3CMEZ 3CCJ1 1VQM1 1VQK1 2QEXZ 1YJ9Z 1K8A1 1YIT1 1QVFY 3CC4Z 3CXCY 1VQPZ 3G711 1M1K1 1VQ41 3CC21 1M902 1N8R1 3I55Z 3CCQZ 3CCLZ 1Q822 1M1K2 3G4S1 1Q811 3CCR1 1N8R2 3CMA1 1VQLZ 1VQ6Z 3CC7Z 1VQ51 3CD61 1Q812 3CCS1 3CCEZ 1VQ81 1YJN1 3OW2Y 1VQO1 1W2BY 1S721 1K9M1 1VQ91
chains in the Genus database with same CATH superfamily
1YHQ1 3CME1 1K8A2 2BJOA 5A2Qb 1K9M2 3MONA 1VQN1 3PO3I 1N2FA 2NAPA 4MONA 4RVDA 2ZAEB 4MD9A 1Y1VI 1VQP1 1RQFA 4RS4A 1YJW1 3LUSA 3CCQ1 1YI2Z 1KQSY 3T4NB 3H0GI 3CCUZ 2VPWA 1RO0A 1Y8CA 2RPRA 4A3BI 4MH4A 5IT9b 2W03A 3VTNA 1VQOZ 3F3FC 4E2YA 1NUIA 2WAQA 1W2BZ 3S1QI 2NVQI 1VQNZ 5C4JI 1RLYA 3BG1B 1JJ2Z 3EEDA 5FLXb 3CPWY 2GTIA 5CM2M 2OTL1 1NP6A 1Q821 3CD6Z 4DQYB 4A3KI 3J81b 1YJWZ 1SFOI 2WB1A 2QKDA 3GTMS 3RZOI 4BBRI 1L1OC 2R93I 4A3EI 2QR1B 4NB9A 4E2ZA 1YIT1 3GTJI 3CC4Z 2RIQA 1VQ41 3CC21 1M902 1PFTA 3GCFA 1KRLA 1N8R1 3CCLZ 2R6MA 1X3ZA 1N8R2 3GTMI 1K83I 1USPA 2JS4A 1TWAI 1DL6A 5LL6f 4Y7NI 2HF1A 3CQZI 3M3YI 1VQ81 5T6BA 3J80b 3OW2Y 2LIYA 4X6AI 4NB8A 4A3II 2E2HI 1WJ2A 4NBEA 1QVGY 4TNUA 2VPYA 2H85A 3CCMZ 4RVGA 2O4HA 3CC2Z 3GTGI 2JIMA 2OZKA 1YIJ1 3NH4A 2E7ZA 3G6EZ 1VQ61 3CC71 4MXUA 1R9TI 3IX0A 4MD7A 2PMZA 1VQKZ 1YUKA 3D9XA 1S7MA 2YU9I 2R92I 2OOXB 2HU9A 4BY1I 3VMIA 2F4MA 1VQ71 4RVHA 3I551 1KD11 3GTPI 2RT9A 1JWHC 1ZH1A 4E30A 1KD12 1VQL1 3S15I 2K5RA 4NBCA 2P28A 3TE5B 1I50I 1YIJZ 3CCV1 3I4MI 4HGZA 2VF1A 3U50C 3HOUI 2QRDB 2QA41 1RNIA 1KQSZ 4CL1A 1YHQZ 3CMEZ 3S2DI 2IZ4A 4HGYA 2E9HA 2V8JA 2OOYB 3GKQA 1VQPZ 3G711 2QRCB 5T67A 3I55Z 3CCQZ 1Q822 4NBDA 1LQLA 1Q811 4DGLA 3CMA1 2VUGA 1VQLZ 1Q812 4E33A 5A2Qf 3JAMb 1WW9A 2JR6A 1TWGI 3IFUA 1S721 2Q4ZA 3MZLB 3D2LA 4HH4A 1VQ91 4EWCA 1SIWA 2PK7A 5D1PA 1YJ91 3MZKB 2K3RA 3HKZA 1NJI1 2OTJ1 2V45A 2QREB 3HOVI 2RBLA 3NFZA 1X3WA 1KC81 2OTLZ 5IT9f 4NFRA 1WIIA 4NBBA 1X0TA 3KIFA 3FKII 1QYPA 2E2II 3ESWA 3VMHA 3P5JB 5AN9F 4NBAA 2JMOA 2V8KA 2M6NA 2RHBA 2AKLA 2NVYI 2IV2X 5C3EI 1Y1WI 5FLXf 1VLAA 1YITZ 3GTQI 2YADA 1VQ4Z 3J81f 2JA7I 3K7AI 5C4XI 1QVFZ 2OTJZ 1I3QI 3CXCZ 2AYDA 3IF8A 2JA8I 4A3GI 1QVGZ 2JIRA 4A3MI 4A3FI 1ZB8A 1YI21 3PO2I 1TWHI 1VQ8Z 3CCU1 1Q861 4A3LI 1TWCI 2B63I 1Q862 1USPB 3RZDI 3CCJ1 1VQM1 2VPXA 3F3PC 1K8A1 2JA5I 2KPIA 3GTKI 3HOXI 2V3VA 1M1K1 3S16I 2W04A 4DK1A 1FDOA 1FDIA 1M1K2 3J80f 3G4S1 2V8IA 3Q87A 2P3YA 3CCR1 5D1OB 1VQ6Z 3CC7Z 1VQ51 3CD61 3S14I 2VPZA 3CCS1 4BBSI 4MD8A 3HOZI 1YJN1 1TWFI 4NBFA 4E2XA 4A3CI 1W2BY 3BG0B 3GTLI 1JJ2Y 1K731 3CCJZ 1VQMZ 1YUAA 1ML8A 3I561 1K732 1VQ7Z 3S1NI 3VB9A 2LFUA 1RO4A 5IP7I 3CC41 2QLVB 1Q7Y1 4RV9A 4MRIA 3CCL1 3CPWZ 1Q7Y2 3G4SZ 3KIHA 3CCVZ 4A93I 3CCRZ 1RO2A 2PM9A 1VQ5Z 2QA4Z 1Z02A 3CCSZ 3NDIA 1WZNA 2DE6A 2JUBA 2O53A 2QEX1 3GTOI 3HOYI 2Q51A 1YJNZ 5IP9I 3S1RI 2DE5A 2JIQA 3NH5A 3H3VJ 3I4NI 1QXFA 1NJI2 1P9NA 4XX2A 3G71Z 3S17I 5T64A 4BY7I 2JIPA 3I56Z 1KC82 1Q16A 4NBHA 4S1TA 3M4OI 1ZB9A 1M901 2NVTI 2I3CA 3CMAZ 3CCM1 4AYBA 2LEXA 2J6AA 1I6HI 2M48A 3CCE1 1AA6A 3G6E1 2IZ3A 1WCMI 3HOWI 3NDJA 1S72Z 1VQ9Z 3OW2Z 4QTUA 3S2HI 3IR7A 2JA6I 4BXXI 1VQK1 1QF8A 4NH1C 2QEXZ 3I07A 1YJ9Z 3S1MI 2GU2A 4A3JI 2E2JI 3TDHB 2EGTA 3VMGA 1QVFY 3CXCY 2R7ZI 4E2WA 4QTTA 3FQMA 2F4OA 2NVXI 4Y52I 3PO3S 3FQQA 3EERA 3JAMf 5D1OA 2GTHA 4NOZA 2VUMI 2JNYA 3QWUA 1Z01A 2JIOA 1Z03A 3D6WA 1Y1VS 3J7A4 4NBGA 3NH8A 4A3DI 4E32A 5C44I 4RVFA 3CCEZ 5FLMI 2G2KA 1VQO1 2DE7A 2KI7B 1K9M1 2Y0SA 4E31A 1TFIA
chains in the Genus database with same CATH topology
1YHQ1 3CME1 1K8A2 2BJOA 5A2Qb 1K9M2 3MONA 1VQN1 3PO3I 1N2FA 4MONA 4RVDA 2ZAEB 4MD9A 1Y1VI 1VQP1 1RQFA 4RS4A 1YJW1 3LUSA 3CCQ1 1YI2Z 1KQSY 3T4NB 3H0GI 3CCUZ 1RO0A 2RPRA 4A3BI 4MH4A 5IT9b 2W03A 3VTNA 1VQOZ 3F3FC 4E2YA 1NUIA 2WAQA 1W2BZ 3S1QI 2NVQI 1VQNZ 5C4JI 1RLYA 3BG1B 1JJ2Z 3EEDA 5FLXb 3CPWY 2GTIA 5CM2M 2OTL1 1NP6A 1Q821 3CD6Z 4DQYB 4A3KI 3J81b 1YJWZ 1SFOI 2WB1A 2QKDA 3GTMS 3RZOI 4BBRI 1L1OC 2R93I 4A3EI 2QR1B 4NB9A 4E2ZA 1YIT1 3GTJI 3CC4Z 2RIQA 1VQ41 3CC21 1M902 1PFTA 3GCFA 1KRLA 1N8R1 3CCLZ 2R6MA 1X3ZA 1N8R2 3GTMI 1K83I 1USPA 2JS4A 1TWAI 1DL6A 5LL6f 4Y7NI 2HF1A 3CQZI 3M3YI 1VQ81 5T6BA 3J80b 3OW2Y 2LIYA 4X6AI 4NB8A 4A3II 2E2HI 4NBEA 1QVGY 4TNUA 2H85A 3CCMZ 4RVGA 2O4HA 3CC2Z 3GTGI 2OZKA 1YIJ1 3NH4A 3G6EZ 1VQ61 3CC71 4MXUA 1R9TI 3IX0A 4MD7A 2PMZA 1VQKZ 1YUKA 3D9XA 1S7MA 2YU9I 2R92I 2OOXB 2HU9A 4BY1I 3VMIA 2F4MA 1VQ71 4RVHA 3I551 1KD11 3GTPI 2RT9A 1JWHC 1ZH1A 4E30A 1KD12 1VQL1 3S15I 2K5RA 4NBCA 2P28A 3TE5B 1I50I 1YIJZ 3CCV1 3I4MI 4HGZA 2VF1A 3U50C 3HOUI 2QRDB 2QA41 1RNIA 1KQSZ 4CL1A 1YHQZ 3CMEZ 3S2DI 2IZ4A 4HGYA 2E9HA 2V8JA 2OOYB 3GKQA 1VQPZ 3G711 2QRCB 5T67A 3I55Z 3CCQZ 1Q822 4NBDA 1LQLA 1Q811 4DGLA 3CMA1 2VUGA 1VQLZ 1Q812 4E33A 5A2Qf 3JAMb 1WW9A 2JR6A 1TWGI 3IFUA 1S721 2Q4ZA 3MZLB 4HH4A 1VQ91 4EWCA 2PK7A 5D1PA 1YJ91 3MZKB 2K3RA 3HKZA 1NJI1 2OTJ1 2QREB 3HOVI 2RBLA 3NFZA 1X3WA 1KC81 2OTLZ 5IT9f 4NFRA 1WIIA 4NBBA 1X0TA 3KIFA 3FKII 1QYPA 2E2II 3ESWA 3VMHA 3P5JB 5AN9F 4NBAA 2JMOA 2V8KA 2M6NA 2RHBA 2AKLA 2NVYI 5C3EI 1Y1WI 5FLXf 1VLAA 1YITZ 3GTQI 2YADA 1VQ4Z 3J81f 2JA7I 3K7AI 5C4XI 1QVFZ 2OTJZ 1I3QI 3CXCZ 3IF8A 2JA8I 4A3GI 1QVGZ 4A3MI 4A3FI 1ZB8A 1YI21 3PO2I 1TWHI 1VQ8Z 3CCU1 1Q861 4A3LI 1TWCI 2B63I 1Q862 1USPB 3RZDI 3CCJ1 1VQM1 3F3PC 1K8A1 2JA5I 2KPIA 3GTKI 3HOXI 1M1K1 3S16I 2W04A 4DK1A 1M1K2 3J80f 3G4S1 2V8IA 3Q87A 2P3YA 3CCR1 5D1OB 1VQ6Z 3CC7Z 1VQ51 3CD61 3S14I 3CCS1 4BBSI 4MD8A 3HOZI 1YJN1 1TWFI 4NBFA 4E2XA 4A3CI 1W2BY 3BG0B 3GTLI 1JJ2Y 1K731 3CCJZ 1VQMZ 1YUAA 1ML8A 3I561 1K732 1VQ7Z 3S1NI 3VB9A 2LFUA 1RO4A 5IP7I 3CC41 2QLVB 1Q7Y1 4RV9A 4MRIA 3CCL1 3CPWZ 1Q7Y2 3G4SZ 3KIHA 3CCVZ 4A93I 3CCRZ 1RO2A 2PM9A 1VQ5Z 2QA4Z 1Z02A 3CCSZ 3NDIA 2O53A 2DE6A 2JUBA 2QEX1 3GTOI 3HOYI 2Q51A 1YJNZ 5IP9I 3S1RI 2DE5A 3NH5A 3H3VJ 3I4NI 1NJI2 1P9NA 4XX2A 3G71Z 3S17I 5T64A 4BY7I 3I56Z 1KC82 4NBHA 4S1TA 3M4OI 1ZB9A 1M901 2NVTI 2I3CA 3CMAZ 3CCM1 4AYBA 2J6AA 1I6HI 2M48A 3CCE1 3G6E1 2IZ3A 1WCMI 3HOWI 3NDJA 1S72Z 1VQ9Z 3OW2Z 4QTUA 3S2HI 2JA6I 4BXXI 1VQK1 1QF8A 4NH1C 2QEXZ 3I07A 1YJ9Z 3S1MI 2GU2A 4A3JI 2E2JI 3TDHB 2EGTA 3VMGA 1QVFY 3CXCY 2R7ZI 4E2WA 4QTTA 3FQMA 2F4OA 2NVXI 4Y52I 3PO3S 3FQQA 3EERA 3JAMf 5D1OA 2GTHA 4NOZA 2VUMI 2JNYA 3QWUA 1Z01A 1Z03A 3D6WA 1Y1VS 3J7A4 4NBGA 3NH8A 4A3DI 4E32A 5C44I 4RVFA 3CCEZ 5FLMI 2G2KA 1VQO1 2DE7A 2KI7B 1K9M1 2Y0SA 4E31A 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ 1;  1JJ2 Y;  3CME 1;  1K73 1;  1K8A 2;  1K9M 2;  1VQN 1;  3CCJ Z;  1VQM Z;  3I56 1;  1YJ9 1;  1K73 2;  1VQ7 Z;  1NJI 1;  2OTJ 1;  1QVG Y;  3CC4 1;  1VQP 1;  1KC8 1;  2OTL Z;  3CCM Z;  1Q7Y 1;  1YJW 1;  3CC2 Z;  3CCQ 1;  3CCL 1;  3CPW Z;  1YIJ 1;  1YI2 Z;  1Q7Y 2;  1KQS Y;  3G4S Z;  3CCV Z;  3CCU Z;  3G6E Z;  3CCR Z;  1VQ6 1;  3CC7 1;  1VQ5 Z;  2QA4 Z;  3CCS Z;  2QEX 1;  1VQK Z;  1YJN Z;  1VQO Z;  1YIT Z;  1NJI 2;  1W2B Z;  1VQN Z;  3G71 Z;  1VQ4 Z;  1VQ7 1;  3I56 Z;  3I55 1;  1KD1 1;  1JJ2 Z;  1KC8 2;  1QVF Z;  2OTJ Z;  3CXC Z;  1M90 1;  3CPW Y;  1KD1 2;  1VQL 1;  2OTL 1;  3CCM 1;  3CMA Z;  1Q82 1;  3CD6 Z;  1QVG Z;  1YJW Z;  3CCE 1;  1YI2 1;  1YIJ Z;  3CCV 1;  1VQ8 Z;  3CCU 1;  1Q86 1;  3G6E 1;  2QA4 1;  1S72 Z;  1Q86 2;  1KQS Z;  1VQ9 Z;  3OW2 Z;  1YHQ Z;  3CME Z;  3CCJ 1;  1VQM 1;  1VQK 1;  2QEX Z;  1YJ9 Z;  1K8A 1;  1YIT 1;  1QVF Y;  3CC4 Z;  3CXC Y;  1VQP Z;  3G71 1;  1M1K 1;  1VQ4 1;  3CC2 1;  1M90 2;  1N8R 1;  3I55 Z;  3CCQ Z;  3CCL Z;  1Q82 2;  1M1K 2;  3G4S 1;  1Q81 1;  3CCR 1;  1N8R 2;  3CMA 1;  1VQL Z;  1VQ6 Z;  3CC7 Z;  1VQ5 1;  3CD6 1;  1Q81 2;  3CCS 1;  3CCE Z;  1VQ8 1;  1YJN 1;  3OW2 Y;  1VQO 1;  1W2B Y;  1S72 1;  1K9M 1;  1VQ9 1; 
#chains in the Genus database with same CATH topology
 1YHQ 1;  3CME 1;  1K8A 2;  2BJO A;  5A2Q b;  1K9M 2;  3MON A;  1VQN 1;  3PO3 I;  1N2F A;  2NAP A;  4MON A;  4RVD A;  2ZAE B;  4MD9 A;  1Y1V I;  1VQP 1;  1RQF A;  4RS4 A;  1YJW 1;  3LUS A;  3CCQ 1;  1YI2 Z;  1KQS Y;  3T4N B;  3H0G I;  3CCU Z;  2VPW A;  1RO0 A;  1Y8C A;  2RPR A;  4A3B I;  4MH4 A;  5IT9 b;  2W03 A;  3VTN A;  1VQO Z;  3F3F C;  4E2Y A;  1NUI A;  2WAQ A;  1W2B Z;  3S1Q I;  2NVQ I;  1VQN Z;  5C4J I;  1RLY A;  3BG1 B;  1JJ2 Z;  3EED A;  5FLX b;  3CPW Y;  2GTI A;  5CM2 M;  2OTL 1;  1NP6 A;  1Q82 1;  3CD6 Z;  4DQY B;  4A3K I;  3J81 b;  1YJW Z;  1SFO I;  2WB1 A;  2QKD A;  3GTM S;  3RZO I;  4BBR I;  1L1O C;  2R93 I;  4A3E I;  2QR1 B;  4NB9 A;  4E2Z A;  1YIT 1;  3GTJ I;  3CC4 Z;  2RIQ A;  1VQ4 1;  3CC2 1;  1M90 2;  1PFT A;  3GCF A;  1KRL A;  1N8R 1;  3CCL Z;  2R6M A;  1X3Z A;  1N8R 2;  3GTM I;  1K83 I;  1USP A;  2JS4 A;  1TWA I;  1DL6 A;  5LL6 f;  4Y7N I;  2HF1 A;  3CQZ I;  3M3Y I;  1VQ8 1;  5T6B A;  3J80 b;  3OW2 Y;  2LIY A;  4X6A I;  4NB8 A;  4A3I I;  2E2H I;  1WJ2 A;  4NBE A;  1QVG Y;  4TNU A;  2VPY A;  2H85 A;  3CCM Z;  4RVG A;  2O4H A;  3CC2 Z;  3GTG I;  2JIM A;  2OZK A;  1YIJ 1;  3NH4 A;  2E7Z A;  3G6E Z;  1VQ6 1;  3CC7 1;  4MXU A;  1R9T I;  3IX0 A;  4MD7 A;  2PMZ A;  1VQK Z;  1YUK A;  3D9X A;  1S7M A;  2YU9 I;  2R92 I;  2OOX B;  2HU9 A;  4BY1 I;  3VMI A;  2F4M A;  1VQ7 1;  4RVH A;  3I55 1;  1KD1 1;  3GTP I;  2RT9 A;  1JWH C;  1ZH1 A;  4E30 A;  1KD1 2;  1VQL 1;  3S15 I;  2K5R A;  4NBC A;  2P28 A;  3TE5 B;  1I50 I;  1YIJ Z;  3CCV 1;  3I4M I;  4HGZ A;  2VF1 A;  3U50 C;  3HOU I;  2QRD B;  2QA4 1;  1RNI A;  1KQS Z;  4CL1 A;  1YHQ Z;  3CME Z;  3S2D I;  2IZ4 A;  4HGY A;  2E9H A;  2V8J A;  2OOY B;  3GKQ A;  1VQP Z;  3G71 1;  2QRC B;  5T67 A;  3I55 Z;  3CCQ Z;  1Q82 2;  4NBD A;  1LQL A;  1Q81 1;  4DGL A;  3CMA 1;  2VUG A;  1VQL Z;  1Q81 2;  4E33 A;  5A2Q f;  3JAM b;  1WW9 A;  2JR6 A;  1TWG I;  3IFU A;  1S72 1;  2Q4Z A;  3MZL B;  3D2L A;  4HH4 A;  1VQ9 1;  4EWC A;  1SIW A;  2PK7 A;  5D1P A;  1YJ9 1;  3MZK B;  2K3R A;  3HKZ A;  1NJI 1;  2OTJ 1;  2V45 A;  2QRE B;  3HOV I;  2RBL A;  3NFZ A;  1X3W A;  1KC8 1;  2OTL Z;  5IT9 f;  4NFR A;  1WII A;  4NBB A;  1X0T A;  3KIF A;  3FKI I;  1QYP A;  2E2I I;  3ESW A;  3VMH A;  3P5J B;  5AN9 F;  4NBA A;  2JMO A;  2V8K A;  2M6N A;  2RHB A;  2AKL A;  2NVY I;  2IV2 X;  5C3E I;  1Y1W I;  5FLX f;  1VLA A;  1YIT Z;  3GTQ I;  2YAD A;  1VQ4 Z;  3J81 f;  2JA7 I;  3K7A I;  5C4X I;  1QVF Z;  2OTJ Z;  1I3Q I;  3CXC Z;  2AYD A;  3IF8 A;  2JA8 I;  4A3G I;  1QVG Z;  2JIR A;  4A3M I;  4A3F I;  1ZB8 A;  1YI2 1;  3PO2 I;  1TWH I;  1VQ8 Z;  3CCU 1;  1Q86 1;  4A3L I;  1TWC I;  2B63 I;  1Q86 2;  1USP B;  3RZD I;  3CCJ 1;  1VQM 1;  2VPX A;  3F3P C;  1K8A 1;  2JA5 I;  2KPI A;  3GTK I;  3HOX I;  2V3V A;  1M1K 1;  3S16 I;  2W04 A;  4DK1 A;  1FDO A;  1FDI A;  1M1K 2;  3J80 f;  3G4S 1;  2V8I A;  3Q87 A;  2P3Y A;  3CCR 1;  5D1O B;  1VQ6 Z;  3CC7 Z;  1VQ5 1;  3CD6 1;  3S14 I;  2VPZ A;  3CCS 1;  4BBS I;  4MD8 A;  3HOZ I;  1YJN 1;  1TWF I;  4NBF A;  4E2X A;  4A3C I;  1W2B Y;  3BG0 B;  3GTL I;  1JJ2 Y;  1K73 1;  3CCJ Z;  1VQM Z;  1YUA A;  1ML8 A;  3I56 1;  1K73 2;  1VQ7 Z;  3S1N I;  3VB9 A;  2LFU A;  1RO4 A;  5IP7 I;  3CC4 1;  2QLV B;  1Q7Y 1;  4RV9 A;  4MRI A;  3CCL 1;  3CPW Z;  1Q7Y 2;  3G4S Z;  3KIH A;  3CCV Z;  4A93 I;  3CCR Z;  1RO2 A;  2PM9 A;  1VQ5 Z;  2QA4 Z;  1Z02 A;  3CCS Z;  3NDI A;  1WZN A;  2DE6 A;  2JUB A;  2O53 A;  2QEX 1;  3GTO I;  3HOY I;  2Q51 A;  1YJN Z;  5IP9 I;  3S1R I;  2DE5 A;  2JIQ A;  3NH5 A;  3H3V J;  3I4N I;  1QXF A;  1NJI 2;  1P9N A;  4XX2 A;  3G71 Z;  3S17 I;  5T64 A;  4BY7 I;  2JIP A;  3I56 Z;  1KC8 2;  1Q16 A;  4NBH A;  4S1T A;  3M4O I;  1ZB9 A;  1M90 1;  2NVT I;  2I3C A;  3CMA Z;  3CCM 1;  4AYB A;  2LEX A;  2J6A A;  1I6H I;  2M48 A;  3CCE 1;  1AA6 A;  3G6E 1;  2IZ3 A;  1WCM I;  3HOW I;  3NDJ A;  1S72 Z;  1VQ9 Z;  3OW2 Z;  4QTU A;  3S2H I;  3IR7 A;  2JA6 I;  4BXX I;  1VQK 1;  1QF8 A;  4NH1 C;  2QEX Z;  3I07 A;  1YJ9 Z;  3S1M I;  2GU2 A;  4A3J I;  2E2J I;  3TDH B;  2EGT A;  3VMG A;  1QVF Y;  3CXC Y;  2R7Z I;  4E2W A;  4QTT A;  3FQM A;  2F4O A;  2NVX I;  4Y52 I;  3PO3 S;  3FQQ A;  3EER A;  3JAM f;  5D1O A;  2GTH A;  4NOZ A;  2VUM I;  2JNY A;  3QWU A;  1Z01 A;  2JIO A;  1Z03 A;  3D6W A;  1Y1V S;  3J7A 4;  4NBG A;  3NH8 A;  4A3D I;  4E32 A;  5C44 I;  4RVF A;  3CCE Z;  5FLM I;  2G2K A;  1VQO 1;  2DE7 A;  2KI7 B;  1K9M 1;  2Y0S A;  4E31 A;  1TFI A; 
#chains in the Genus database with same CATH homology
 1YHQ 1;  3CME 1;  1K8A 2;  2BJO A;  5A2Q b;  1K9M 2;  3MON A;  1VQN 1;  3PO3 I;  1N2F A;  4MON A;  4RVD A;  2ZAE B;  4MD9 A;  1Y1V I;  1VQP 1;  1RQF A;  4RS4 A;  1YJW 1;  3LUS A;  3CCQ 1;  1YI2 Z;  1KQS Y;  3T4N B;  3H0G I;  3CCU Z;  1RO0 A;  2RPR A;  4A3B I;  4MH4 A;  5IT9 b;  2W03 A;  3VTN A;  1VQO Z;  3F3F C;  4E2Y A;  1NUI A;  2WAQ A;  1W2B Z;  3S1Q I;  2NVQ I;  1VQN Z;  5C4J I;  1RLY A;  3BG1 B;  1JJ2 Z;  3EED A;  5FLX b;  3CPW Y;  2GTI A;  5CM2 M;  2OTL 1;  1NP6 A;  1Q82 1;  3CD6 Z;  4DQY B;  4A3K I;  3J81 b;  1YJW Z;  1SFO I;  2WB1 A;  2QKD A;  3GTM S;  3RZO I;  4BBR I;  1L1O C;  2R93 I;  4A3E I;  2QR1 B;  4NB9 A;  4E2Z A;  1YIT 1;  3GTJ I;  3CC4 Z;  2RIQ A;  1VQ4 1;  3CC2 1;  1M90 2;  1PFT A;  3GCF A;  1KRL A;  1N8R 1;  3CCL Z;  2R6M A;  1X3Z A;  1N8R 2;  3GTM I;  1K83 I;  1USP A;  2JS4 A;  1TWA I;  1DL6 A;  5LL6 f;  4Y7N I;  2HF1 A;  3CQZ I;  3M3Y I;  1VQ8 1;  5T6B A;  3J80 b;  3OW2 Y;  2LIY A;  4X6A I;  4NB8 A;  4A3I I;  2E2H I;  4NBE A;  1QVG Y;  4TNU A;  2H85 A;  3CCM Z;  4RVG A;  2O4H A;  3CC2 Z;  3GTG I;  2OZK A;  1YIJ 1;  3NH4 A;  3G6E Z;  1VQ6 1;  3CC7 1;  4MXU A;  1R9T I;  3IX0 A;  4MD7 A;  2PMZ A;  1VQK Z;  1YUK A;  3D9X A;  1S7M A;  2YU9 I;  2R92 I;  2OOX B;  2HU9 A;  4BY1 I;  3VMI A;  2F4M A;  1VQ7 1;  4RVH A;  3I55 1;  1KD1 1;  3GTP I;  2RT9 A;  1JWH C;  1ZH1 A;  4E30 A;  1KD1 2;  1VQL 1;  3S15 I;  2K5R A;  4NBC A;  2P28 A;  3TE5 B;  1I50 I;  1YIJ Z;  3CCV 1;  3I4M I;  4HGZ A;  2VF1 A;  3U50 C;  3HOU I;  2QRD B;  2QA4 1;  1RNI A;  1KQS Z;  4CL1 A;  1YHQ Z;  3CME Z;  3S2D I;  2IZ4 A;  4HGY A;  2E9H A;  2V8J A;  2OOY B;  3GKQ A;  1VQP Z;  3G71 1;  2QRC B;  5T67 A;  3I55 Z;  3CCQ Z;  1Q82 2;  4NBD A;  1LQL A;  1Q81 1;  4DGL A;  3CMA 1;  2VUG A;  1VQL Z;  1Q81 2;  4E33 A;  5A2Q f;  3JAM b;  1WW9 A;  2JR6 A;  1TWG I;  3IFU A;  1S72 1;  2Q4Z A;  3MZL B;  4HH4 A;  1VQ9 1;  4EWC A;  2PK7 A;  5D1P A;  1YJ9 1;  3MZK B;  2K3R A;  3HKZ A;  1NJI 1;  2OTJ 1;  2QRE B;  3HOV I;  2RBL A;  3NFZ A;  1X3W A;  1KC8 1;  2OTL Z;  5IT9 f;  4NFR A;  1WII A;  4NBB A;  1X0T A;  3KIF A;  3FKI I;  1QYP A;  2E2I I;  3ESW A;  3VMH A;  3P5J B;  5AN9 F;  4NBA A;  2JMO A;  2V8K A;  2M6N A;  2RHB A;  2AKL A;  2NVY I;  5C3E I;  1Y1W I;  5FLX f;  1VLA A;  1YIT Z;  3GTQ I;  2YAD A;  1VQ4 Z;  3J81 f;  2JA7 I;  3K7A I;  5C4X I;  1QVF Z;  2OTJ Z;  1I3Q I;  3CXC Z;  3IF8 A;  2JA8 I;  4A3G I;  1QVG Z;  4A3M I;  4A3F I;  1ZB8 A;  1YI2 1;  3PO2 I;  1TWH I;  1VQ8 Z;  3CCU 1;  1Q86 1;  4A3L I;  1TWC I;  2B63 I;  1Q86 2;  1USP B;  3RZD I;  3CCJ 1;  1VQM 1;  3F3P C;  1K8A 1;  2JA5 I;  2KPI A;  3GTK I;  3HOX I;  1M1K 1;  3S16 I;  2W04 A;  4DK1 A;  1M1K 2;  3J80 f;  3G4S 1;  2V8I A;  3Q87 A;  2P3Y A;  3CCR 1;  5D1O B;  1VQ6 Z;  3CC7 Z;  1VQ5 1;  3CD6 1;  3S14 I;  3CCS 1;  4BBS I;  4MD8 A;  3HOZ I;  1YJN 1;  1TWF I;  4NBF A;  4E2X A;  4A3C I;  1W2B Y;  3BG0 B;  3GTL I;  1JJ2 Y;  1K73 1;  3CCJ Z;  1VQM Z;  1YUA A;  1ML8 A;  3I56 1;  1K73 2;  1VQ7 Z;  3S1N I;  3VB9 A;  2LFU A;  1RO4 A;  5IP7 I;  3CC4 1;  2QLV B;  1Q7Y 1;  4RV9 A;  4MRI A;  3CCL 1;  3CPW Z;  1Q7Y 2;  3G4S Z;  3KIH A;  3CCV Z;  4A93 I;  3CCR Z;  1RO2 A;  2PM9 A;  1VQ5 Z;  2QA4 Z;  1Z02 A;  3CCS Z;  3NDI A;  2O53 A;  2DE6 A;  2JUB A;  2QEX 1;  3GTO I;  3HOY I;  2Q51 A;  1YJN Z;  5IP9 I;  3S1R I;  2DE5 A;  3NH5 A;  3H3V J;  3I4N I;  1NJI 2;  1P9N A;  4XX2 A;  3G71 Z;  3S17 I;  5T64 A;  4BY7 I;  3I56 Z;  1KC8 2;  4NBH A;  4S1T A;  3M4O I;  1ZB9 A;  1M90 1;  2NVT I;  2I3C A;  3CMA Z;  3CCM 1;  4AYB A;  2J6A A;  1I6H I;  2M48 A;  3CCE 1;  3G6E 1;  2IZ3 A;  1WCM I;  3HOW I;  3NDJ A;  1S72 Z;  1VQ9 Z;  3OW2 Z;  4QTU A;  3S2H I;  2JA6 I;  4BXX I;  1VQK 1;  1QF8 A;  4NH1 C;  2QEX Z;  3I07 A;  1YJ9 Z;  3S1M I;  2GU2 A;  4A3J I;  2E2J I;  3TDH B;  2EGT A;  3VMG A;  1QVF Y;  3CXC Y;  2R7Z I;  4E2W A;  4QTT A;  3FQM A;  2F4O A;  2NVX I;  4Y52 I;  3PO3 S;  3FQQ A;  3EER A;  3JAM f;  5D1O A;  2GTH A;  4NOZ A;  2VUM I;  2JNY A;  3QWU A;  1Z01 A;  1Z03 A;  3D6W A;  1Y1V S;  3J7A 4;  4NBG A;  3NH8 A;  4A3D I;  4E32 A;  5C44 I;  4RVF A;  3CCE Z;  5FLM I;  2G2K A;  1VQO 1;  2DE7 A;  2KI7 B;  1K9M 1;  2Y0S A;  4E31 A;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...