1Q862

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86200
1KC81 2QA41 3CCQ1 1M901 1YJ91 3CCU1 3CCLZ 3CC2Z 3CC41 3CCVZ 3G71Z 1YHQZ 1VQN1 3CMAZ 1M1K1 3CCSZ 3CPWZ 1KC82 1M902 1JJ2Y 1VQLZ 3CCE1 1S721 3CCR1 1M1K2 1YI2Z 1W2BZ 3CMEZ 1QVFY 1YITZ 1YJWZ 3CCL1 3CC21 1VQ8Z 3CCV1 1YHQ1 3G711 1VQ5Z 3CMA1 1NJI1 1VQ6Z 3CCS1 1VQL1 1NJI2 1YI21 1K8A1 1KQSY 2OTLZ 3CME1 3CXCY 1YIT1 1YJW1 1VQ81 3CCJZ 1VQ51 2QEXZ 1K9M2 1KQSZ 1JJ2Z 1K8A2 1VQ61 3CXCZ 2OTJZ 3G4SZ 3OW2Y 1VQ4Z 1VQPZ 1VQOZ 1QVFZ 1Q7Y1 3OW2Z 1Q861 3G6EZ 2OTL1 1VQ7Z 1YJNZ 3CCJ1 1K9M1 2QEX1 3I55Z 1Q7Y2 1Q862 2OTJ1 3G4S1 1VQ41 3CD6Z 1VQP1 1VQO1 1Q821 1YIJZ 1VQMZ 3I56Z 3CPWY 1VQ9Z 1N8R2 3G6E1 1VQKZ 1VQ71 3CCMZ 3CC7Z 1YJN1 1Q822 2QA4Z 3CCQZ 3I551 1KD11 1YJ9Z 1Q811 3CCUZ 3CC4Z 1W2BY 1K731 1VQNZ 3CD61 1YIJ1 1QVGY 1KD12 1VQM1 3I561 1Q812 1N8R1 1VQ91 3CCEZ 1K732 1VQK1 1S72Z 3CCM1 3CCRZ 3CC71 1QVGZ
chains in the Genus database with same CATH superfamily
4NBCA 2IZ3A 4MD9A 2P28A 2RHBA 4NBAA 3LUSA 3CCLZ 3CC2Z 3NH5A 2QRDB 3CMAZ 5FLXb 4X6AI 3CPWZ 2V45A 1KC82 4DGLA 3RZDI 4DK1A 1M902 2NVTI 4MD8A 3CCE1 4HH4A 2V8KA 2V8IA 2VF1A 1S721 5LL6f 3RZOI 1YI2Z 2QREB 1YUAA 2RBLA 1YJWZ 3VMHA 4TNUA 3JAMf 3GTLI 1YHQ1 1WZNA 1TWHI 3P5JB 3FQQA 1VQ6Z 3GTMI 5C4JI 1WJ2A 1R9TI 5D1OA 4QTTA 2KI7B 4MRIA 4RVFA 4NFRA 1NJI2 3S2DI 1K8A1 4CL1A 1WW9A 2R6MA 1Y1VS 3S17I 1VQ51 1K9M2 4XX2A 1KQSZ 1JJ2Z 4E30A 2LIYA 1VQ4Z 2WAQA 1RO4A 4NBHA 2IV2X 3EEDA 1ZB8A 4A93I 1Q7Y1 4A3EI 3OW2Z 2OTL1 1YUKA 3GTGI 3GTOI 3CCJ1 1K9M1 3NDIA 2QEX1 1JWHC 3IR7A 2JIPA 1N2FA 1AA6A 2NVXI 3CD6Z 2M48A 2YU9I 5IP9I 2JIRA 2JR6A 1ML8A 1VQ9Z 3IX0A 1VQKZ 3MZKB 1VQ71 2LFUA 3CC7Z 2NAPA 3M4OI 3CCQZ 3ESWA 4NBDA 3CCUZ 2E2HI 1W2BY 3HOXI 2VPXA 3KIFA 2RIQA 4A3KI 4E31A 3GTJI 4A3DI 3VB9A 1K732 1L1OC 2OOYB 3F3PC 3HOZI 3CCRZ 3HOWI 2OZKA 1YJ91 3U50C 4MONA 1QYPA 2E9HA 1I3QI 1NUIA 3CCSZ 1Z03A 1VQLZ 2E7ZA 5A2Qf 3GKQA 3MZLB 3S15I 3JAMb 2W03A 1QVFY 4DQYB 2DE5A 2EGTA 4AYBA 3CCL1 3CC21 1VQ8Z 2HF1A 2LEXA 3CMA1 4A3GI 2AYDA 2Q4ZA 4A3LI 2AKLA 3IF8A 5CM2M 3GTKI 1YI21 2JIMA 3QWUA 2PMZA 3I4MI 2H85A 5IP7I 1YJW1 2PM9A 5D1OB 3J80f 1X0TA 1VQ61 1K8A2 3PO2I 4A3MI 1ZB9A 1LQLA 3IFUA 1Q16A 1TWAI 1VQOZ 1Q861 2VPZA 2JIOA 2VUMI 2VUGA 3TDHB 3T4NB 4QTUA 2JUBA 4RS4A 1Q7Y2 3FKII 3I4NI 2BJOA 1VQ41 1RQFA 3NH4A 1Q821 2G2KA 1YIJZ 3PO3S 4EWCA 3CPWY 3S1NI 3M3YI 1RO0A 4A3II 1ZH1A 4BY1I 3CCMZ 2QA4Z 2GU2A 1KD11 1Q811 3CC4Z 1VQNZ 2J6AA 3CD61 3D6WA 2WB1A 4E2ZA 2NVQI 2GTHA 1VQ91 1RO2A 1VQK1 2JIQA 4BXXI 3CC71 1WCMI 3CCQ1 3CCU1 3H3VJ 1RNIA 3KIHA 2NVYI 3CCVZ 3G71Z 5A2Qb 1M1K1 1USPA 1Y1VI 1JJ2Y 3S14I 3S1QI 4MD7A 1KRLA 1TFIA 2JA8I 3NH8A 3CCR1 4RVDA 3CMEZ 1YITZ 5C3EI 3HOYI 3NFZA 2OOXB 2ZAEB 4NBBA 3CCS1 1FDIA 2GTIA 2Y0SA 4E33A 1VQL1 3D9XA 5C4XI 3FQMA 3J7A4 2W04A 3J80b 3CXCY 3J81f 1VQ81 2R7ZI 2OTJZ 4A3CI 3G4SZ 2JMOA 2F4OA 2JA6I 1VQPZ 1Y8CA 3GTMS 3G6EZ 5FLMI 1YJNZ 4NB9A 5T67A 2E2JI 4BBSI 3I55Z 2VPWA 4S1TA 1Q862 1TWCI 3CQZI 1I6HI 1QF8A 4NOZA 4Y52I 1S7MA 2QR1B 1VQO1 1TWGI 1VQMZ 2QLVB 3I56Z 3S1RI 1N8R2 2R92I 2RT9A 4HGYA 2F4MA 1I50I 4A3FI 3VMGA 3HKZA 1Q822 2VPYA 2R93I 3S1MI 4MH4A 4NB8A 5IT9f 3BG1B 1TWFI 4A3BI 1Z02A 4HGZA 4E32A 1P9NA 2RPRA 4BBRI 1Z01A 1YIJ1 1VLAA 1SFOI 1QVGY 1KD12 1Q812 1N8R1 3CCEZ 2V3VA 1S72Z 3CCM1 1KC81 2QA41 1DL6A 3HOVI 1M901 2DE6A 3CC41 2PK7A 4E2YA 1VQN1 1YHQZ 3GTQI 2JS4A 1QXFA 3TE5B 4E2WA 4Y7NI 3S16I 5C44I 2KPIA 5FLXf 3D2LA 1M1K2 2Q51A 2HU9A 1NP6A 2K3RA 4NBFA 2QKDA 1W2BZ 3Q87A 4E2XA 1USPB 2E2II 3CCV1 3G711 1VQ5Z 2M6NA 1NJI1 2P3YA 3GTPI 3NDJA 2YADA 3J81b 2JA5I 1WIIA 2DE7A 2JNYA 1Y1WI 1KQSY 2V8JA 3CME1 1YIT1 2OTLZ 3CCJZ 2QEXZ 2B63I 3PO3I 4A3JI 2JA7I 4NH1C 3CXCZ 2I3CA 3OW2Y 2O53A 4BY7I 5D1PA 2IZ4A 1QVFZ 5T6BA 3S2HI 1VQ7Z 3MONA 1K83I 5AN9F 2QRCB 2OTJ1 4NBEA 3G4S1 5T64A 1VQP1 3H0GI 1X3ZA 4MXUA 4RVHA 3F3FC 3VMIA 3I07A 3G6E1 4NBGA 5IT9b 3VTNA 1X3WA 1YJN1 2O4HA 4RV9A 3I551 1YJ9Z 3K7AI 1K731 1FDOA 3HOUI 3BG0B 3GCFA 4RVGA 2K5RA 1RLYA 1VQM1 3I561 1PFTA 1SIWA 3EERA 1QVGZ
chains in the Genus database with same CATH topology
4NBCA 2IZ3A 4MD9A 2P28A 2RHBA 4NBAA 3LUSA 3CCLZ 3CC2Z 3NH5A 2QRDB 3CMAZ 5FLXb 4X6AI 3CPWZ 1KC82 4DGLA 3RZDI 4DK1A 1M902 2NVTI 4MD8A 3CCE1 4HH4A 2V8KA 2V8IA 2VF1A 1S721 5LL6f 3RZOI 1YI2Z 2QREB 1YUAA 2RBLA 1YJWZ 3VMHA 4TNUA 3JAMf 3GTLI 1YHQ1 3P5JB 1TWHI 3FQQA 1VQ6Z 3GTMI 5C4JI 1R9TI 5D1OA 4QTTA 2KI7B 4MRIA 4RVFA 4NFRA 1NJI2 3S2DI 1K8A1 4CL1A 1WW9A 2R6MA 1Y1VS 3S17I 1VQ51 1K9M2 4XX2A 1KQSZ 1JJ2Z 4E30A 2LIYA 1VQ4Z 2WAQA 1RO4A 4NBHA 3EEDA 1ZB8A 4A93I 1Q7Y1 4A3EI 3OW2Z 2OTL1 1YUKA 3GTGI 3GTOI 3CCJ1 1K9M1 3NDIA 2QEX1 1JWHC 1N2FA 2NVXI 3CD6Z 2M48A 2YU9I 5IP9I 2JR6A 1ML8A 1VQ9Z 3IX0A 1VQKZ 3MZKB 1VQ71 2LFUA 3CC7Z 3M4OI 3CCQZ 3ESWA 4NBDA 3CCUZ 2E2HI 1W2BY 3HOXI 3KIFA 2RIQA 4A3KI 4E31A 3GTJI 4A3DI 3VB9A 1K732 1L1OC 2OOYB 3F3PC 3HOZI 3CCRZ 3HOWI 2OZKA 1YJ91 3U50C 4MONA 1QYPA 2E9HA 1I3QI 1NUIA 3CCSZ 1Z03A 1VQLZ 5A2Qf 3GKQA 3MZLB 3S15I 3JAMb 2W03A 1QVFY 4DQYB 2DE5A 2EGTA 4AYBA 3CCL1 3CC21 1VQ8Z 2HF1A 3CMA1 4A3GI 2Q4ZA 4A3LI 2AKLA 3IF8A 5CM2M 3GTKI 1YI21 3QWUA 2PMZA 3I4MI 2H85A 5IP7I 1YJW1 2PM9A 5D1OB 3J80f 1X0TA 1VQ61 1K8A2 3PO2I 4A3MI 1ZB9A 1LQLA 3IFUA 1TWAI 1VQOZ 1Q861 2VUMI 2VUGA 3TDHB 3T4NB 4QTUA 2JUBA 4RS4A 1Q7Y2 3FKII 3I4NI 2BJOA 1VQ41 1RQFA 3NH4A 1Q821 2G2KA 1YIJZ 3PO3S 4EWCA 3CPWY 3S1NI 3M3YI 1RO0A 4A3II 1ZH1A 4BY1I 3CCMZ 2QA4Z 2GU2A 1KD11 1Q811 3CC4Z 1VQNZ 2J6AA 3CD61 3D6WA 2WB1A 4E2ZA 2NVQI 2GTHA 1VQ91 1RO2A 1VQK1 4BXXI 3CC71 1WCMI 3CCQ1 3CCU1 3H3VJ 1RNIA 3KIHA 2NVYI 3CCVZ 3G71Z 5A2Qb 1M1K1 1USPA 1Y1VI 1JJ2Y 3S14I 3S1QI 4MD7A 1KRLA 1TFIA 2JA8I 3NH8A 3CCR1 4RVDA 3CMEZ 1YITZ 5C3EI 3HOYI 3NFZA 2OOXB 2ZAEB 4NBBA 3CCS1 2GTIA 2Y0SA 4E33A 1VQL1 3D9XA 5C4XI 3FQMA 3J7A4 2W04A 3J80b 3CXCY 3J81f 1VQ81 2R7ZI 2OTJZ 4A3CI 3G4SZ 2JMOA 2F4OA 2JA6I 1VQPZ 3GTMS 3G6EZ 5FLMI 1YJNZ 4NB9A 5T67A 2E2JI 4BBSI 3I55Z 4S1TA 1Q862 1TWCI 3CQZI 1I6HI 1QF8A 4NOZA 4Y52I 1S7MA 2QR1B 1VQO1 1TWGI 1VQMZ 2QLVB 3I56Z 3S1RI 1N8R2 2R92I 2RT9A 4HGYA 2F4MA 1I50I 4A3FI 3VMGA 3HKZA 1Q822 2R93I 3S1MI 4MH4A 4NB8A 5IT9f 3BG1B 1TWFI 4A3BI 1Z02A 4HGZA 4E32A 1P9NA 2RPRA 4BBRI 1Z01A 1YIJ1 1VLAA 1SFOI 1QVGY 1KD12 1Q812 1N8R1 3CCEZ 1S72Z 3CCM1 1KC81 2QA41 1DL6A 3HOVI 1M901 2DE6A 3CC41 2PK7A 4E2YA 1VQN1 1YHQZ 3GTQI 2JS4A 3TE5B 4E2WA 4Y7NI 3S16I 5C44I 2KPIA 5FLXf 1M1K2 2Q51A 2HU9A 1NP6A 2K3RA 4NBFA 2QKDA 1W2BZ 3Q87A 4E2XA 1USPB 2E2II 3CCV1 3G711 1VQ5Z 2M6NA 1NJI1 2P3YA 3GTPI 3NDJA 2YADA 3J81b 2JA5I 1WIIA 2DE7A 2JNYA 1Y1WI 1KQSY 2V8JA 3CME1 1YIT1 2OTLZ 3CCJZ 2QEXZ 2B63I 3PO3I 4A3JI 2JA7I 4NH1C 3CXCZ 2I3CA 3OW2Y 2O53A 4BY7I 5D1PA 2IZ4A 1QVFZ 5T6BA 3S2HI 1VQ7Z 3MONA 1K83I 5AN9F 2QRCB 2OTJ1 4NBEA 3G4S1 5T64A 1VQP1 3H0GI 1X3ZA 4MXUA 4RVHA 3F3FC 3VMIA 3I07A 3G6E1 4NBGA 5IT9b 3VTNA 1X3WA 1YJN1 2O4HA 4RV9A 3I551 1YJ9Z 3K7AI 1K731 3HOUI 3BG0B 3GCFA 4RVGA 2K5RA 1RLYA 1VQM1 3I561 1PFTA 3EERA 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 1;  2QA4 1;  3CCQ 1;  1M90 1;  1YJ9 1;  3CCU 1;  3CCL Z;  3CC2 Z;  3CC4 1;  3CCV Z;  3G71 Z;  1YHQ Z;  1VQN 1;  3CMA Z;  1M1K 1;  3CCS Z;  3CPW Z;  1KC8 2;  1M90 2;  1JJ2 Y;  1VQL Z;  3CCE 1;  1S72 1;  3CCR 1;  1M1K 2;  1YI2 Z;  1W2B Z;  3CME Z;  1QVF Y;  1YIT Z;  1YJW Z;  3CCL 1;  3CC2 1;  1VQ8 Z;  3CCV 1;  1YHQ 1;  3G71 1;  1VQ5 Z;  3CMA 1;  1NJI 1;  1VQ6 Z;  3CCS 1;  1VQL 1;  1NJI 2;  1YI2 1;  1K8A 1;  1KQS Y;  2OTL Z;  3CME 1;  3CXC Y;  1YIT 1;  1YJW 1;  1VQ8 1;  3CCJ Z;  1VQ5 1;  2QEX Z;  1K9M 2;  1KQS Z;  1JJ2 Z;  1K8A 2;  1VQ6 1;  3CXC Z;  2OTJ Z;  3G4S Z;  3OW2 Y;  1VQ4 Z;  1VQP Z;  1VQO Z;  1QVF Z;  1Q7Y 1;  3OW2 Z;  1Q86 1;  3G6E Z;  2OTL 1;  1VQ7 Z;  1YJN Z;  3CCJ 1;  1K9M 1;  2QEX 1;  3I55 Z;  1Q7Y 2;  1Q86 2;  2OTJ 1;  3G4S 1;  1VQ4 1;  3CD6 Z;  1VQP 1;  1VQO 1;  1Q82 1;  1YIJ Z;  1VQM Z;  3I56 Z;  3CPW Y;  1VQ9 Z;  1N8R 2;  3G6E 1;  1VQK Z;  1VQ7 1;  3CCM Z;  3CC7 Z;  1YJN 1;  1Q82 2;  2QA4 Z;  3CCQ Z;  3I55 1;  1KD1 1;  1YJ9 Z;  1Q81 1;  3CCU Z;  3CC4 Z;  1W2B Y;  1K73 1;  1VQN Z;  3CD6 1;  1YIJ 1;  1QVG Y;  1KD1 2;  1VQM 1;  3I56 1;  1Q81 2;  1N8R 1;  1VQ9 1;  3CCE Z;  1K73 2;  1VQK 1;  1S72 Z;  3CCM 1;  3CCR Z;  3CC7 1;  1QVG Z; 
#chains in the Genus database with same CATH topology
 4NBC A;  2IZ3 A;  4MD9 A;  2P28 A;  2RHB A;  4NBA A;  3LUS A;  3CCL Z;  3CC2 Z;  3NH5 A;  2QRD B;  3CMA Z;  5FLX b;  4X6A I;  3CPW Z;  2V45 A;  1KC8 2;  4DGL A;  3RZD I;  4DK1 A;  1M90 2;  2NVT I;  4MD8 A;  3CCE 1;  4HH4 A;  2V8K A;  2V8I A;  2VF1 A;  1S72 1;  5LL6 f;  3RZO I;  1YI2 Z;  2QRE B;  1YUA A;  2RBL A;  1YJW Z;  3VMH A;  4TNU A;  3JAM f;  3GTL I;  1YHQ 1;  1WZN A;  1TWH I;  3P5J B;  3FQQ A;  1VQ6 Z;  3GTM I;  5C4J I;  1WJ2 A;  1R9T I;  5D1O A;  4QTT A;  2KI7 B;  4MRI A;  4RVF A;  4NFR A;  1NJI 2;  3S2D I;  1K8A 1;  4CL1 A;  1WW9 A;  2R6M A;  1Y1V S;  3S17 I;  1VQ5 1;  1K9M 2;  4XX2 A;  1KQS Z;  1JJ2 Z;  4E30 A;  2LIY A;  1VQ4 Z;  2WAQ A;  1RO4 A;  4NBH A;  2IV2 X;  3EED A;  1ZB8 A;  4A93 I;  1Q7Y 1;  4A3E I;  3OW2 Z;  2OTL 1;  1YUK A;  3GTG I;  3GTO I;  3CCJ 1;  1K9M 1;  3NDI A;  2QEX 1;  1JWH C;  3IR7 A;  2JIP A;  1N2F A;  1AA6 A;  2NVX I;  3CD6 Z;  2M48 A;  2YU9 I;  5IP9 I;  2JIR A;  2JR6 A;  1ML8 A;  1VQ9 Z;  3IX0 A;  1VQK Z;  3MZK B;  1VQ7 1;  2LFU A;  3CC7 Z;  2NAP A;  3M4O I;  3CCQ Z;  3ESW A;  4NBD A;  3CCU Z;  2E2H I;  1W2B Y;  3HOX I;  2VPX A;  3KIF A;  2RIQ A;  4A3K I;  4E31 A;  3GTJ I;  4A3D I;  3VB9 A;  1K73 2;  1L1O C;  2OOY B;  3F3P C;  3HOZ I;  3CCR Z;  3HOW I;  2OZK A;  1YJ9 1;  3U50 C;  4MON A;  1QYP A;  2E9H A;  1I3Q I;  1NUI A;  3CCS Z;  1Z03 A;  1VQL Z;  2E7Z A;  5A2Q f;  3GKQ A;  3MZL B;  3S15 I;  3JAM b;  2W03 A;  1QVF Y;  4DQY B;  2DE5 A;  2EGT A;  4AYB A;  3CCL 1;  3CC2 1;  1VQ8 Z;  2HF1 A;  2LEX A;  3CMA 1;  4A3G I;  2AYD A;  2Q4Z A;  4A3L I;  2AKL A;  3IF8 A;  5CM2 M;  3GTK I;  1YI2 1;  2JIM A;  3QWU A;  2PMZ A;  3I4M I;  2H85 A;  5IP7 I;  1YJW 1;  2PM9 A;  5D1O B;  3J80 f;  1X0T A;  1VQ6 1;  1K8A 2;  3PO2 I;  4A3M I;  1ZB9 A;  1LQL A;  3IFU A;  1Q16 A;  1TWA I;  1VQO Z;  1Q86 1;  2VPZ A;  2JIO A;  2VUM I;  2VUG A;  3TDH B;  3T4N B;  4QTU A;  2JUB A;  4RS4 A;  1Q7Y 2;  3FKI I;  3I4N I;  2BJO A;  1VQ4 1;  1RQF A;  3NH4 A;  1Q82 1;  2G2K A;  1YIJ Z;  3PO3 S;  4EWC A;  3CPW Y;  3S1N I;  3M3Y I;  1RO0 A;  4A3I I;  1ZH1 A;  4BY1 I;  3CCM Z;  2QA4 Z;  2GU2 A;  1KD1 1;  1Q81 1;  3CC4 Z;  1VQN Z;  2J6A A;  3CD6 1;  3D6W A;  2WB1 A;  4E2Z A;  2NVQ I;  2GTH A;  1VQ9 1;  1RO2 A;  1VQK 1;  2JIQ A;  4BXX I;  3CC7 1;  1WCM I;  3CCQ 1;  3CCU 1;  3H3V J;  1RNI A;  3KIH A;  2NVY I;  3CCV Z;  3G71 Z;  5A2Q b;  1M1K 1;  1USP A;  1Y1V I;  1JJ2 Y;  3S14 I;  3S1Q I;  4MD7 A;  1KRL A;  1TFI A;  2JA8 I;  3NH8 A;  3CCR 1;  4RVD A;  3CME Z;  1YIT Z;  5C3E I;  3HOY I;  3NFZ A;  2OOX B;  2ZAE B;  4NBB A;  3CCS 1;  1FDI A;  2GTI A;  2Y0S A;  4E33 A;  1VQL 1;  3D9X A;  5C4X I;  3FQM A;  3J7A 4;  2W04 A;  3J80 b;  3CXC Y;  3J81 f;  1VQ8 1;  2R7Z I;  2OTJ Z;  4A3C I;  3G4S Z;  2JMO A;  2F4O A;  2JA6 I;  1VQP Z;  1Y8C A;  3GTM S;  3G6E Z;  5FLM I;  1YJN Z;  4NB9 A;  5T67 A;  2E2J I;  4BBS I;  3I55 Z;  2VPW A;  4S1T A;  1Q86 2;  1TWC I;  3CQZ I;  1I6H I;  1QF8 A;  4NOZ A;  4Y52 I;  1S7M A;  2QR1 B;  1VQO 1;  1TWG I;  1VQM Z;  2QLV B;  3I56 Z;  3S1R I;  1N8R 2;  2R92 I;  2RT9 A;  4HGY A;  2F4M A;  1I50 I;  4A3F I;  3VMG A;  3HKZ A;  1Q82 2;  2VPY A;  2R93 I;  3S1M I;  4MH4 A;  4NB8 A;  5IT9 f;  3BG1 B;  1TWF I;  4A3B I;  1Z02 A;  4HGZ A;  4E32 A;  1P9N A;  2RPR A;  4BBR I;  1Z01 A;  1YIJ 1;  1VLA A;  1SFO I;  1QVG Y;  1KD1 2;  1Q81 2;  1N8R 1;  3CCE Z;  2V3V A;  1S72 Z;  3CCM 1;  1KC8 1;  2QA4 1;  1DL6 A;  3HOV I;  1M90 1;  2DE6 A;  3CC4 1;  2PK7 A;  4E2Y A;  1VQN 1;  1YHQ Z;  3GTQ I;  2JS4 A;  1QXF A;  3TE5 B;  4E2W A;  4Y7N I;  3S16 I;  5C44 I;  2KPI A;  5FLX f;  3D2L A;  1M1K 2;  2Q51 A;  2HU9 A;  1NP6 A;  2K3R A;  4NBF A;  2QKD A;  1W2B Z;  3Q87 A;  4E2X A;  1USP B;  2E2I I;  3CCV 1;  3G71 1;  1VQ5 Z;  2M6N A;  1NJI 1;  2P3Y A;  3GTP I;  3NDJ A;  2YAD A;  3J81 b;  2JA5 I;  1WII A;  2DE7 A;  2JNY A;  1Y1W I;  1KQS Y;  2V8J A;  3CME 1;  1YIT 1;  2OTL Z;  3CCJ Z;  2QEX Z;  2B63 I;  3PO3 I;  4A3J I;  2JA7 I;  4NH1 C;  3CXC Z;  2I3C A;  3OW2 Y;  2O53 A;  4BY7 I;  5D1P A;  2IZ4 A;  1QVF Z;  5T6B A;  3S2H I;  1VQ7 Z;  3MON A;  1K83 I;  5AN9 F;  2QRC B;  2OTJ 1;  4NBE A;  3G4S 1;  5T64 A;  1VQP 1;  3H0G I;  1X3Z A;  4MXU A;  4RVH A;  3F3F C;  3VMI A;  3I07 A;  3G6E 1;  4NBG A;  5IT9 b;  3VTN A;  1X3W A;  1YJN 1;  2O4H A;  4RV9 A;  3I55 1;  1YJ9 Z;  3K7A I;  1K73 1;  1FDO A;  3HOU I;  3BG0 B;  3GCF A;  4RVG A;  2K5R A;  1RLY A;  1VQM 1;  3I56 1;  1PFT A;  1SIW A;  3EER A;  1QVG Z; 
#chains in the Genus database with same CATH homology
 4NBC A;  2IZ3 A;  4MD9 A;  2P28 A;  2RHB A;  4NBA A;  3LUS A;  3CCL Z;  3CC2 Z;  3NH5 A;  2QRD B;  3CMA Z;  5FLX b;  4X6A I;  3CPW Z;  1KC8 2;  4DGL A;  3RZD I;  4DK1 A;  1M90 2;  2NVT I;  4MD8 A;  3CCE 1;  4HH4 A;  2V8K A;  2V8I A;  2VF1 A;  1S72 1;  5LL6 f;  3RZO I;  1YI2 Z;  2QRE B;  1YUA A;  2RBL A;  1YJW Z;  3VMH A;  4TNU A;  3JAM f;  3GTL I;  1YHQ 1;  3P5J B;  1TWH I;  3FQQ A;  1VQ6 Z;  3GTM I;  5C4J I;  1R9T I;  5D1O A;  4QTT A;  2KI7 B;  4MRI A;  4RVF A;  4NFR A;  1NJI 2;  3S2D I;  1K8A 1;  4CL1 A;  1WW9 A;  2R6M A;  1Y1V S;  3S17 I;  1VQ5 1;  1K9M 2;  4XX2 A;  1KQS Z;  1JJ2 Z;  4E30 A;  2LIY A;  1VQ4 Z;  2WAQ A;  1RO4 A;  4NBH A;  3EED A;  1ZB8 A;  4A93 I;  1Q7Y 1;  4A3E I;  3OW2 Z;  2OTL 1;  1YUK A;  3GTG I;  3GTO I;  3CCJ 1;  1K9M 1;  3NDI A;  2QEX 1;  1JWH C;  1N2F A;  2NVX I;  3CD6 Z;  2M48 A;  2YU9 I;  5IP9 I;  2JR6 A;  1ML8 A;  1VQ9 Z;  3IX0 A;  1VQK Z;  3MZK B;  1VQ7 1;  2LFU A;  3CC7 Z;  3M4O I;  3CCQ Z;  3ESW A;  4NBD A;  3CCU Z;  2E2H I;  1W2B Y;  3HOX I;  3KIF A;  2RIQ A;  4A3K I;  4E31 A;  3GTJ I;  4A3D I;  3VB9 A;  1K73 2;  1L1O C;  2OOY B;  3F3P C;  3HOZ I;  3CCR Z;  3HOW I;  2OZK A;  1YJ9 1;  3U50 C;  4MON A;  1QYP A;  2E9H A;  1I3Q I;  1NUI A;  3CCS Z;  1Z03 A;  1VQL Z;  5A2Q f;  3GKQ A;  3MZL B;  3S15 I;  3JAM b;  2W03 A;  1QVF Y;  4DQY B;  2DE5 A;  2EGT A;  4AYB A;  3CCL 1;  3CC2 1;  1VQ8 Z;  2HF1 A;  3CMA 1;  4A3G I;  2Q4Z A;  4A3L I;  2AKL A;  3IF8 A;  5CM2 M;  3GTK I;  1YI2 1;  3QWU A;  2PMZ A;  3I4M I;  2H85 A;  5IP7 I;  1YJW 1;  2PM9 A;  5D1O B;  3J80 f;  1X0T A;  1VQ6 1;  1K8A 2;  3PO2 I;  4A3M I;  1ZB9 A;  1LQL A;  3IFU A;  1TWA I;  1VQO Z;  1Q86 1;  2VUM I;  2VUG A;  3TDH B;  3T4N B;  4QTU A;  2JUB A;  4RS4 A;  1Q7Y 2;  3FKI I;  3I4N I;  2BJO A;  1VQ4 1;  1RQF A;  3NH4 A;  1Q82 1;  2G2K A;  1YIJ Z;  3PO3 S;  4EWC A;  3CPW Y;  3S1N I;  3M3Y I;  1RO0 A;  4A3I I;  1ZH1 A;  4BY1 I;  3CCM Z;  2QA4 Z;  2GU2 A;  1KD1 1;  1Q81 1;  3CC4 Z;  1VQN Z;  2J6A A;  3CD6 1;  3D6W A;  2WB1 A;  4E2Z A;  2NVQ I;  2GTH A;  1VQ9 1;  1RO2 A;  1VQK 1;  4BXX I;  3CC7 1;  1WCM I;  3CCQ 1;  3CCU 1;  3H3V J;  1RNI A;  3KIH A;  2NVY I;  3CCV Z;  3G71 Z;  5A2Q b;  1M1K 1;  1USP A;  1Y1V I;  1JJ2 Y;  3S14 I;  3S1Q I;  4MD7 A;  1KRL A;  1TFI A;  2JA8 I;  3NH8 A;  3CCR 1;  4RVD A;  3CME Z;  1YIT Z;  5C3E I;  3HOY I;  3NFZ A;  2OOX B;  2ZAE B;  4NBB A;  3CCS 1;  2GTI A;  2Y0S A;  4E33 A;  1VQL 1;  3D9X A;  5C4X I;  3FQM A;  3J7A 4;  2W04 A;  3J80 b;  3CXC Y;  3J81 f;  1VQ8 1;  2R7Z I;  2OTJ Z;  4A3C I;  3G4S Z;  2JMO A;  2F4O A;  2JA6 I;  1VQP Z;  3GTM S;  3G6E Z;  5FLM I;  1YJN Z;  4NB9 A;  5T67 A;  2E2J I;  4BBS I;  3I55 Z;  4S1T A;  1Q86 2;  1TWC I;  3CQZ I;  1I6H I;  1QF8 A;  4NOZ A;  4Y52 I;  1S7M A;  2QR1 B;  1VQO 1;  1TWG I;  1VQM Z;  2QLV B;  3I56 Z;  3S1R I;  1N8R 2;  2R92 I;  2RT9 A;  4HGY A;  2F4M A;  1I50 I;  4A3F I;  3VMG A;  3HKZ A;  1Q82 2;  2R93 I;  3S1M I;  4MH4 A;  4NB8 A;  5IT9 f;  3BG1 B;  1TWF I;  4A3B I;  1Z02 A;  4HGZ A;  4E32 A;  1P9N A;  2RPR A;  4BBR I;  1Z01 A;  1YIJ 1;  1VLA A;  1SFO I;  1QVG Y;  1KD1 2;  1Q81 2;  1N8R 1;  3CCE Z;  1S72 Z;  3CCM 1;  1KC8 1;  2QA4 1;  1DL6 A;  3HOV I;  1M90 1;  2DE6 A;  3CC4 1;  2PK7 A;  4E2Y A;  1VQN 1;  1YHQ Z;  3GTQ I;  2JS4 A;  3TE5 B;  4E2W A;  4Y7N I;  3S16 I;  5C44 I;  2KPI A;  5FLX f;  1M1K 2;  2Q51 A;  2HU9 A;  1NP6 A;  2K3R A;  4NBF A;  2QKD A;  1W2B Z;  3Q87 A;  4E2X A;  1USP B;  2E2I I;  3CCV 1;  3G71 1;  1VQ5 Z;  2M6N A;  1NJI 1;  2P3Y A;  3GTP I;  3NDJ A;  2YAD A;  3J81 b;  2JA5 I;  1WII A;  2DE7 A;  2JNY A;  1Y1W I;  1KQS Y;  2V8J A;  3CME 1;  1YIT 1;  2OTL Z;  3CCJ Z;  2QEX Z;  2B63 I;  3PO3 I;  4A3J I;  2JA7 I;  4NH1 C;  3CXC Z;  2I3C A;  3OW2 Y;  2O53 A;  4BY7 I;  5D1P A;  2IZ4 A;  1QVF Z;  5T6B A;  3S2H I;  1VQ7 Z;  3MON A;  1K83 I;  5AN9 F;  2QRC B;  2OTJ 1;  4NBE A;  3G4S 1;  5T64 A;  1VQP 1;  3H0G I;  1X3Z A;  4MXU A;  4RVH A;  3F3F C;  3VMI A;  3I07 A;  3G6E 1;  4NBG A;  5IT9 b;  3VTN A;  1X3W A;  1YJN 1;  2O4H A;  4RV9 A;  3I55 1;  1YJ9 Z;  3K7A I;  1K73 1;  3HOU I;  3BG0 B;  3GCF A;  4RVG A;  2K5R A;  1RLY A;  1VQM 1;  3I56 1;  1PFT A;  3EER A;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...