1Q862

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86200
1QVFZ 1YJN1 3CCL1 1W2BZ 1KQSY 3I561 1M901 3CCVZ 1VQ7Z 2OTJZ 2QA4Z 1VQM1 1QVGY 3G711 1KD12 1YI2Z 1NJI2 1M1K2 1Q811 1K8A1 3CCRZ 1JJ2Z 3G4SZ 1YITZ 1YJ9Z 3CCV1 1Q7Y1 1VQ4Z 2QA41 3G6E1 2OTLZ 1YJNZ 3OW2Y 1M902 3CCEZ 3I56Z 3CCR1 3G4S1 1YIT1 1YIJ1 1VQLZ 1VQOZ 1VQMZ 1VQ8Z 2OTL1 3G71Z 1Q812 3I55Z 1K8A2 1Q821 3CCE1 1Q7Y2 1VQL1 1KQSZ 1VQO1 1VQ81 3G6EZ 3I551 3CCQZ 1QVGZ 1S721 2QEXZ 3CCUZ 1YIJZ 1VQ5Z 3CMEZ 3CPWY 3CXCY 1KC81 1Q822 3CCQ1 3CMA1 3CC71 3CD6Z 2QEX1 1VQNZ 3CCU1 3OW2Z 1VQ51 3CME1 3CD61 1S72Z 1VQN1 1Q861 1N8R1 1KC82 3CMAZ 3CC7Z 1K731 1VQ6Z 1K9M1 1VQPZ 1YHQZ 1QVFY 1W2BY 1Q862 3CPWZ 3CXCZ 1N8R2 3CCSZ 1VQ9Z 1VQ61 1VQP1 3CC21 1YHQ1 3CC4Z 3CCJ1 1K732 1JJ2Y 1K9M2 3CCS1 3CCMZ 1VQ91 1VQKZ 1YJWZ 1VQ71 2OTJ1 3CC41 3CCLZ 1YI21 3CCM1 1NJI1 1KD11 1M1K1 3CC2Z 1VQK1 1YJ91 1YJW1 1VQ41 3CCJZ
chains in the Genus database with same CATH superfamily
1YJN1 4MXUA 3GTKI 4A3GI 5D1PA 1KQSY 5FLMI 1M901 4AYBA 2OTJZ 2E2HI 3NDJA 3HKZA 3D6WA 1M1K2 3H0GI 4RS4A 1YI2Z 3S1NI 1TWFI 1JJ2Z 3CCRZ 1YJ9Z 2V45A 1YITZ 1Q7Y1 2GU2A 1WJ2A 2W03A 1VQ4Z 1TWGI 4A3BI 2JR6A 3FQMA 3GTJI 2G2KA 3G4S1 3J7A4 1VQLZ 2OOYB 2OTL1 1Y1VI 2R6MA 3G71Z 1Q812 5A2Qf 3I55Z 3JAMb 1K8A2 2GTIA 1RO0A 4NOZA 3RZDI 1KQSZ 3S2HI 1WCMI 3K7AI 2RBLA 1USPB 3GTPI 4A3FI 4A3DI 5IT9b 2JNYA 4RVGA 2VF1A 4MRIA 4DK1A 2IV2X 3CXCY 2JIMA 1PFTA 1Y1VS 1Y8CA 3CC71 5T6BA 2Y0SA 3I4MI 3IF8A 1QF8A 1WZNA 2E9HA 4BY7I 4A3LI 1ZH1A 3CD61 1S72Z 4HGZA 2JA6I 2P28A 2R7ZI 3GTMS 4QTUA 1ML8A 2OZKA 4BY1I 3ESWA 1NUIA 1VQ6Z 1K9M1 3F3PC 1QVFY 4DQYB 2V3VA 1Z03A 1Q16A 3CXCZ 1N8R2 5FLXb 4Y7NI 4A3CI 1VQ9Z 2HF1A 1VQP1 3CC21 1YHQ1 4A3JI 1K83I 4CL1A 3HOUI 4E33A 3S2DI 3CCJ1 2QREB 3CCS1 4Y52I 2E7ZA 1YJWZ 3QWUA 4NB9A 2OTJ1 2I3CA 2PK7A 3NH5A 1QXFA 1YI21 2JIPA 3CCM1 1YJ91 4NBGA 2QKDA 1VQ41 1QVFZ 2R92I 1YUAA 2QR1B 3CCVZ 4NBEA 2QA4Z 2IZ3A 1QVGY 1ZB8A 4E2WA 3NH8A 3G711 1I6HI 3HOZI 1N2FA 3P5JB 3J80f 3OW2Y 5C44I 1M902 3EEDA 3CCEZ 4MD7A 3CQZI 1DL6A 1VQOZ 2E2JI 1VQMZ 1VQ8Z 4XX2A 3JAMf 1Q7Y2 1WIIA 2RHBA 1QVGZ 1S721 3CCUZ 2PM9A 1YIJZ 3S17I 3HOVI 3CMEZ 4NB8A 3CPWY 3PO3S 1KC81 3CCQ1 3IR7A 2QEX1 1VQNZ 3RZOI 3OW2Z 1VQ51 3LUSA 2VPYA 3U50C 2JA8I 1SIWA 1LQLA 1Q861 3T4NB 4E30A 1Z01A 2V8KA 3PO2I 3GTMI 1TWAI 1S7MA 1FDOA 1W2BY 3CPWZ 1TWCI 2JMOA 4E2XA 2YU9I 4A93I 5T64A 1L1OC 2OOXB 2Q51A 1K9M2 1YUKA 1SFOI 3KIFA 3CC41 2JUBA 4RVDA 1NP6A 3F3FC 2NVXI 1Z02A 1KD11 1NJI1 1VQK1 5LL6f 3CCL1 5A2Qb 1W2BZ 2O4HA 4S1TA 3J81f 1VQ7Z 1VLAA 1VQM1 3NFZA 2J6AA 5IP9I 2WB1A 2QLVB 2Q4ZA 3G4SZ 2JA7I 2O53A 4NBHA 2OTLZ 2JA5I 3I56Z 3CCR1 3GTOI 1YIT1 1P9NA 4NFRA 3TDHB 1YIJ1 2DE6A 2LIYA 4E32A 1Q821 3GTQI 2NVTI 3VMHA 1VQL1 2VPWA 4QTTA 3G6EZ 3GTLI 1RQFA 3I551 1RO2A 2V8JA 2BJOA 1ZB9A 3BG1B 4NBCA 3CD6Z 3VMGA 2NAPA 3S1QI 2IZ4A 4BBRI 3IFUA 1AA6A 3S16I 1QYPA 3NH4A 3PO3I 4E2YA 2VUMI 1I50I 4HGYA 2YADA 3VMIA 3MZKB 2P3YA 2JIRA 1KC82 3EERA 1RLYA 3S14I 2HU9A 2B63I 3CMAZ 5IT9f 1K731 2M6NA 1VQPZ 1YHQZ 2RIQA 1TWHI 1Q862 3BG0B 3CCSZ 3VTNA 1VQ61 3M4OI 4A3MI 2RPRA 3H3VJ 2VPZA 3CCMZ 2AKLA 1VQ91 3I07A 5D1OA 4E2ZA 1Y1WI 4NBFA 1VQ71 1WW9A 2VUGA 3HOYI 3J80b 4RV9A 1X3ZA 4BXXI 3FQQA 1M1K1 4MH4A 2LFUA 1YJW1 2V8IA 3D9XA 1X3WA 5FLXf 2M48A 4MD8A 3I561 3M3YI 4X6AI 3GKQA 1KD12 1NJI2 4RVHA 1Q811 1RO4A 5CM2M 1K8A1 3CCV1 2PMZA 2QA41 3G6E1 5C3EI 2F4MA 1YJNZ 4EWCA 3GTGI 3S1RI 3VB9A 5C4JI 1USPA 3TE5B 1I3QI 5IP7I 3D2LA 2LEXA 2KI7B 3CCE1 2JIQA 1VQO1 1VQ81 1KRLA 4NBBA 3CCQZ 2QEXZ 4RVFA 3S1MI 1VQ5Z 1TFIA 4DGLA 4A3II 3GCFA 3FKII 1Q822 3CMA1 1RNIA 2W04A 2H85A 3CCU1 1X0TA 2R93I 4HH4A 4E31A 1FDIA 4NBAA 3CME1 1JWHC 3HOXI 1VQN1 2JS4A 1N8R1 4BBSI 2NVYI 3NDIA 3S15I 5T67A 2GTHA 3CC7Z 2JIOA 3MONA 2K5RA 2ZAEB 2QRCB 2VPXA 4NH1C 5C4XI 3MZLB 1R9TI 3IX0A 2DE5A 3I4NI 2AYDA 3J81b 3KIHA 4MONA 3CC4Z 3HOWI 2DE7A 4MD9A 2K3RA 1K732 1JJ2Y 2F4OA 1VQKZ 2RT9A 2QRDB 2E2II 2KPIA 4TNUA 2EGTA 3CCLZ 2WAQA 5AN9F 2NVQI 3Q87A 3CC2Z 4A3KI 4A3EI 4NBDA 3CCJZ 5D1OB
chains in the Genus database with same CATH topology
1YJN1 4MXUA 3GTKI 4A3GI 5D1PA 1KQSY 5FLMI 1M901 4AYBA 2OTJZ 2E2HI 3NDJA 3HKZA 3D6WA 1M1K2 3H0GI 4RS4A 1YI2Z 3S1NI 1TWFI 1JJ2Z 3CCRZ 1YJ9Z 1YITZ 1Q7Y1 2GU2A 2W03A 1VQ4Z 1TWGI 4A3BI 2JR6A 3FQMA 3GTJI 2G2KA 3G4S1 3J7A4 1VQLZ 2OOYB 2OTL1 1Y1VI 2R6MA 3G71Z 1Q812 5A2Qf 3I55Z 3JAMb 1K8A2 2GTIA 1RO0A 4NOZA 3RZDI 1KQSZ 3S2HI 1WCMI 3K7AI 2RBLA 1USPB 3GTPI 4A3FI 4A3DI 5IT9b 2JNYA 4RVGA 2VF1A 4MRIA 4DK1A 3CXCY 1PFTA 1Y1VS 3CC71 5T6BA 2Y0SA 3I4MI 3IF8A 1QF8A 2E9HA 4BY7I 4A3LI 1ZH1A 3CD61 1S72Z 4HGZA 2JA6I 2P28A 2R7ZI 3GTMS 4QTUA 1ML8A 2OZKA 4BY1I 3ESWA 1NUIA 1VQ6Z 1K9M1 3F3PC 1QVFY 4DQYB 1Z03A 3CXCZ 1N8R2 5FLXb 4Y7NI 4A3CI 1VQ9Z 2HF1A 1VQP1 3CC21 1YHQ1 4A3JI 1K83I 4CL1A 3HOUI 4E33A 3S2DI 3CCJ1 2QREB 3CCS1 4Y52I 1YJWZ 3QWUA 4NB9A 2OTJ1 2I3CA 2PK7A 3NH5A 1YI21 3CCM1 1YJ91 4NBGA 2QKDA 1VQ41 1QVFZ 2R92I 1YUAA 2QR1B 3CCVZ 4NBEA 2QA4Z 2IZ3A 1QVGY 1ZB8A 4E2WA 3NH8A 3G711 1I6HI 3HOZI 1N2FA 3P5JB 3J80f 3OW2Y 5C44I 1M902 3EEDA 3CCEZ 4MD7A 3CQZI 1DL6A 1VQOZ 2E2JI 1VQMZ 1VQ8Z 4XX2A 3JAMf 1Q7Y2 1WIIA 2RHBA 1QVGZ 1S721 3CCUZ 2PM9A 1YIJZ 3S17I 3HOVI 3CMEZ 4NB8A 3CPWY 3PO3S 1KC81 3CCQ1 2QEX1 1VQNZ 3RZOI 3OW2Z 1VQ51 3LUSA 3U50C 2JA8I 1LQLA 1Q861 3T4NB 4E30A 1Z01A 2V8KA 3PO2I 3GTMI 1TWAI 1S7MA 1W2BY 3CPWZ 1TWCI 2JMOA 4E2XA 2YU9I 4A93I 5T64A 1L1OC 2OOXB 2Q51A 1K9M2 1YUKA 1SFOI 3KIFA 3CC41 2JUBA 4RVDA 1NP6A 3F3FC 2NVXI 1Z02A 1KD11 1NJI1 1VQK1 5LL6f 3CCL1 5A2Qb 1W2BZ 2O4HA 4S1TA 3J81f 1VQ7Z 1VLAA 1VQM1 3NFZA 2J6AA 5IP9I 2WB1A 2QLVB 2Q4ZA 3G4SZ 2JA7I 2O53A 4NBHA 2OTLZ 2JA5I 3I56Z 3CCR1 3GTOI 1YIT1 1P9NA 4NFRA 3TDHB 1YIJ1 2DE6A 2LIYA 4E32A 1Q821 3GTQI 2NVTI 3VMHA 1VQL1 4QTTA 3G6EZ 3GTLI 1RQFA 3I551 1RO2A 2V8JA 2BJOA 1ZB9A 3BG1B 4NBCA 3CD6Z 3VMGA 3S1QI 2IZ4A 4BBRI 3IFUA 3S16I 1QYPA 3NH4A 3PO3I 4E2YA 2VUMI 1I50I 4HGYA 2YADA 3VMIA 3MZKB 2P3YA 1KC82 3EERA 1RLYA 3S14I 2HU9A 2B63I 3CMAZ 5IT9f 1K731 2M6NA 1VQPZ 1YHQZ 2RIQA 1TWHI 1Q862 3BG0B 3CCSZ 3VTNA 1VQ61 3M4OI 4A3MI 2RPRA 3H3VJ 3CCMZ 2AKLA 1VQ91 3I07A 5D1OA 4E2ZA 1Y1WI 4NBFA 1VQ71 1WW9A 2VUGA 3HOYI 3J80b 4RV9A 1X3ZA 4BXXI 3FQQA 1M1K1 4MH4A 2LFUA 1YJW1 2V8IA 3D9XA 1X3WA 5FLXf 2M48A 4MD8A 3I561 3M3YI 4X6AI 3GKQA 1KD12 1NJI2 4RVHA 1Q811 1RO4A 5CM2M 1K8A1 3CCV1 2PMZA 2QA41 3G6E1 5C3EI 2F4MA 1YJNZ 4EWCA 3GTGI 3S1RI 3VB9A 5C4JI 1USPA 3TE5B 1I3QI 5IP7I 2KI7B 3CCE1 1VQO1 1VQ81 1KRLA 4NBBA 3CCQZ 2QEXZ 4RVFA 3S1MI 1VQ5Z 1TFIA 4DGLA 4A3II 3GCFA 3FKII 1Q822 3CMA1 1RNIA 2W04A 2H85A 3CCU1 1X0TA 2R93I 4HH4A 4E31A 4NBAA 3CME1 1JWHC 3HOXI 1VQN1 2JS4A 1N8R1 4BBSI 2NVYI 3NDIA 3S15I 5T67A 2GTHA 3CC7Z 3MONA 2K5RA 2ZAEB 2QRCB 4NH1C 5C4XI 3MZLB 1R9TI 3IX0A 2DE5A 3I4NI 3J81b 3KIHA 4MONA 3CC4Z 3HOWI 2DE7A 4MD9A 2K3RA 1K732 1JJ2Y 2F4OA 1VQKZ 2RT9A 2QRDB 2E2II 2KPIA 4TNUA 2EGTA 3CCLZ 2WAQA 5AN9F 2NVQI 3Q87A 3CC2Z 4A3KI 4A3EI 4NBDA 3CCJZ 5D1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF Z;  1YJN 1;  3CCL 1;  1W2B Z;  1KQS Y;  3I56 1;  1M90 1;  3CCV Z;  1VQ7 Z;  2OTJ Z;  2QA4 Z;  1VQM 1;  1QVG Y;  3G71 1;  1KD1 2;  1YI2 Z;  1NJI 2;  1M1K 2;  1Q81 1;  1K8A 1;  3CCR Z;  1JJ2 Z;  3G4S Z;  1YIT Z;  1YJ9 Z;  3CCV 1;  1Q7Y 1;  1VQ4 Z;  2QA4 1;  3G6E 1;  2OTL Z;  1YJN Z;  3OW2 Y;  1M90 2;  3CCE Z;  3I56 Z;  3CCR 1;  3G4S 1;  1YIT 1;  1YIJ 1;  1VQL Z;  1VQO Z;  1VQM Z;  1VQ8 Z;  2OTL 1;  3G71 Z;  1Q81 2;  3I55 Z;  1K8A 2;  1Q82 1;  3CCE 1;  1Q7Y 2;  1VQL 1;  1KQS Z;  1VQO 1;  1VQ8 1;  3G6E Z;  3I55 1;  3CCQ Z;  1QVG Z;  1S72 1;  2QEX Z;  3CCU Z;  1YIJ Z;  1VQ5 Z;  3CME Z;  3CPW Y;  3CXC Y;  1KC8 1;  1Q82 2;  3CCQ 1;  3CMA 1;  3CC7 1;  3CD6 Z;  2QEX 1;  1VQN Z;  3CCU 1;  3OW2 Z;  1VQ5 1;  3CME 1;  3CD6 1;  1S72 Z;  1VQN 1;  1Q86 1;  1N8R 1;  1KC8 2;  3CMA Z;  3CC7 Z;  1K73 1;  1VQ6 Z;  1K9M 1;  1VQP Z;  1YHQ Z;  1QVF Y;  1W2B Y;  1Q86 2;  3CPW Z;  3CXC Z;  1N8R 2;  3CCS Z;  1VQ9 Z;  1VQ6 1;  1VQP 1;  3CC2 1;  1YHQ 1;  3CC4 Z;  3CCJ 1;  1K73 2;  1JJ2 Y;  1K9M 2;  3CCS 1;  3CCM Z;  1VQ9 1;  1VQK Z;  1YJW Z;  1VQ7 1;  2OTJ 1;  3CC4 1;  3CCL Z;  1YI2 1;  3CCM 1;  1NJI 1;  1KD1 1;  1M1K 1;  3CC2 Z;  1VQK 1;  1YJ9 1;  1YJW 1;  1VQ4 1;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 1YJN 1;  4MXU A;  3GTK I;  4A3G I;  5D1P A;  1KQS Y;  5FLM I;  1M90 1;  4AYB A;  2OTJ Z;  2E2H I;  3NDJ A;  3HKZ A;  3D6W A;  1M1K 2;  3H0G I;  4RS4 A;  1YI2 Z;  3S1N I;  1TWF I;  1JJ2 Z;  3CCR Z;  1YJ9 Z;  2V45 A;  1YIT Z;  1Q7Y 1;  2GU2 A;  1WJ2 A;  2W03 A;  1VQ4 Z;  1TWG I;  4A3B I;  2JR6 A;  3FQM A;  3GTJ I;  2G2K A;  3G4S 1;  3J7A 4;  1VQL Z;  2OOY B;  2OTL 1;  1Y1V I;  2R6M A;  3G71 Z;  1Q81 2;  5A2Q f;  3I55 Z;  3JAM b;  1K8A 2;  2GTI A;  1RO0 A;  4NOZ A;  3RZD I;  1KQS Z;  3S2H I;  1WCM I;  3K7A I;  2RBL A;  1USP B;  3GTP I;  4A3F I;  4A3D I;  5IT9 b;  2JNY A;  4RVG A;  2VF1 A;  4MRI A;  4DK1 A;  2IV2 X;  3CXC Y;  2JIM A;  1PFT A;  1Y1V S;  1Y8C A;  3CC7 1;  5T6B A;  2Y0S A;  3I4M I;  3IF8 A;  1QF8 A;  1WZN A;  2E9H A;  4BY7 I;  4A3L I;  1ZH1 A;  3CD6 1;  1S72 Z;  4HGZ A;  2JA6 I;  2P28 A;  2R7Z I;  3GTM S;  4QTU A;  1ML8 A;  2OZK A;  4BY1 I;  3ESW A;  1NUI A;  1VQ6 Z;  1K9M 1;  3F3P C;  1QVF Y;  4DQY B;  2V3V A;  1Z03 A;  1Q16 A;  3CXC Z;  1N8R 2;  5FLX b;  4Y7N I;  4A3C I;  1VQ9 Z;  2HF1 A;  1VQP 1;  3CC2 1;  1YHQ 1;  4A3J I;  1K83 I;  4CL1 A;  3HOU I;  4E33 A;  3S2D I;  3CCJ 1;  2QRE B;  3CCS 1;  4Y52 I;  2E7Z A;  1YJW Z;  3QWU A;  4NB9 A;  2OTJ 1;  2I3C A;  2PK7 A;  3NH5 A;  1QXF A;  1YI2 1;  2JIP A;  3CCM 1;  1YJ9 1;  4NBG A;  2QKD A;  1VQ4 1;  1QVF Z;  2R92 I;  1YUA A;  2QR1 B;  3CCV Z;  4NBE A;  2QA4 Z;  2IZ3 A;  1QVG Y;  1ZB8 A;  4E2W A;  3NH8 A;  3G71 1;  1I6H I;  3HOZ I;  1N2F A;  3P5J B;  3J80 f;  3OW2 Y;  5C44 I;  1M90 2;  3EED A;  3CCE Z;  4MD7 A;  3CQZ I;  1DL6 A;  1VQO Z;  2E2J I;  1VQM Z;  1VQ8 Z;  4XX2 A;  3JAM f;  1Q7Y 2;  1WII A;  2RHB A;  1QVG Z;  1S72 1;  3CCU Z;  2PM9 A;  1YIJ Z;  3S17 I;  3HOV I;  3CME Z;  4NB8 A;  3CPW Y;  3PO3 S;  1KC8 1;  3CCQ 1;  3IR7 A;  2QEX 1;  1VQN Z;  3RZO I;  3OW2 Z;  1VQ5 1;  3LUS A;  2VPY A;  3U50 C;  2JA8 I;  1SIW A;  1LQL A;  1Q86 1;  3T4N B;  4E30 A;  1Z01 A;  2V8K A;  3PO2 I;  3GTM I;  1TWA I;  1S7M A;  1FDO A;  1W2B Y;  3CPW Z;  1TWC I;  2JMO A;  4E2X A;  2YU9 I;  4A93 I;  5T64 A;  1L1O C;  2OOX B;  2Q51 A;  1K9M 2;  1YUK A;  1SFO I;  3KIF A;  3CC4 1;  2JUB A;  4RVD A;  1NP6 A;  3F3F C;  2NVX I;  1Z02 A;  1KD1 1;  1NJI 1;  1VQK 1;  5LL6 f;  3CCL 1;  5A2Q b;  1W2B Z;  2O4H A;  4S1T A;  3J81 f;  1VQ7 Z;  1VLA A;  1VQM 1;  3NFZ A;  2J6A A;  5IP9 I;  2WB1 A;  2QLV B;  2Q4Z A;  3G4S Z;  2JA7 I;  2O53 A;  4NBH A;  2OTL Z;  2JA5 I;  3I56 Z;  3CCR 1;  3GTO I;  1YIT 1;  1P9N A;  4NFR A;  3TDH B;  1YIJ 1;  2DE6 A;  2LIY A;  4E32 A;  1Q82 1;  3GTQ I;  2NVT I;  3VMH A;  1VQL 1;  2VPW A;  4QTT A;  3G6E Z;  3GTL I;  1RQF A;  3I55 1;  1RO2 A;  2V8J A;  2BJO A;  1ZB9 A;  3BG1 B;  4NBC A;  3CD6 Z;  3VMG A;  2NAP A;  3S1Q I;  2IZ4 A;  4BBR I;  3IFU A;  1AA6 A;  3S16 I;  1QYP A;  3NH4 A;  3PO3 I;  4E2Y A;  2VUM I;  1I50 I;  4HGY A;  2YAD A;  3VMI A;  3MZK B;  2P3Y A;  2JIR A;  1KC8 2;  3EER A;  1RLY A;  3S14 I;  2HU9 A;  2B63 I;  3CMA Z;  5IT9 f;  1K73 1;  2M6N A;  1VQP Z;  1YHQ Z;  2RIQ A;  1TWH I;  1Q86 2;  3BG0 B;  3CCS Z;  3VTN A;  1VQ6 1;  3M4O I;  4A3M I;  2RPR A;  3H3V J;  2VPZ A;  3CCM Z;  2AKL A;  1VQ9 1;  3I07 A;  5D1O A;  4E2Z A;  1Y1W I;  4NBF A;  1VQ7 1;  1WW9 A;  2VUG A;  3HOY I;  3J80 b;  4RV9 A;  1X3Z A;  4BXX I;  3FQQ A;  1M1K 1;  4MH4 A;  2LFU A;  1YJW 1;  2V8I A;  3D9X A;  1X3W A;  5FLX f;  2M48 A;  4MD8 A;  3I56 1;  3M3Y I;  4X6A I;  3GKQ A;  1KD1 2;  1NJI 2;  4RVH A;  1Q81 1;  1RO4 A;  5CM2 M;  1K8A 1;  3CCV 1;  2PMZ A;  2QA4 1;  3G6E 1;  5C3E I;  2F4M A;  1YJN Z;  4EWC A;  3GTG I;  3S1R I;  3VB9 A;  5C4J I;  1USP A;  3TE5 B;  1I3Q I;  5IP7 I;  3D2L A;  2LEX A;  2KI7 B;  3CCE 1;  2JIQ A;  1VQO 1;  1VQ8 1;  1KRL A;  4NBB A;  3CCQ Z;  2QEX Z;  4RVF A;  3S1M I;  1VQ5 Z;  1TFI A;  4DGL A;  4A3I I;  3GCF A;  3FKI I;  1Q82 2;  3CMA 1;  1RNI A;  2W04 A;  2H85 A;  3CCU 1;  1X0T A;  2R93 I;  4HH4 A;  4E31 A;  1FDI A;  4NBA A;  3CME 1;  1JWH C;  3HOX I;  1VQN 1;  2JS4 A;  1N8R 1;  4BBS I;  2NVY I;  3NDI A;  3S15 I;  5T67 A;  2GTH A;  3CC7 Z;  2JIO A;  3MON A;  2K5R A;  2ZAE B;  2QRC B;  2VPX A;  4NH1 C;  5C4X I;  3MZL B;  1R9T I;  3IX0 A;  2DE5 A;  3I4N I;  2AYD A;  3J81 b;  3KIH A;  4MON A;  3CC4 Z;  3HOW I;  2DE7 A;  4MD9 A;  2K3R A;  1K73 2;  1JJ2 Y;  2F4O A;  1VQK Z;  2RT9 A;  2QRD B;  2E2I I;  2KPI A;  4TNU A;  2EGT A;  3CCL Z;  2WAQ A;  5AN9 F;  2NVQ I;  3Q87 A;  3CC2 Z;  4A3K I;  4A3E I;  4NBD A;  3CCJ Z;  5D1O B; 
#chains in the Genus database with same CATH homology
 1YJN 1;  4MXU A;  3GTK I;  4A3G I;  5D1P A;  1KQS Y;  5FLM I;  1M90 1;  4AYB A;  2OTJ Z;  2E2H I;  3NDJ A;  3HKZ A;  3D6W A;  1M1K 2;  3H0G I;  4RS4 A;  1YI2 Z;  3S1N I;  1TWF I;  1JJ2 Z;  3CCR Z;  1YJ9 Z;  1YIT Z;  1Q7Y 1;  2GU2 A;  2W03 A;  1VQ4 Z;  1TWG I;  4A3B I;  2JR6 A;  3FQM A;  3GTJ I;  2G2K A;  3G4S 1;  3J7A 4;  1VQL Z;  2OOY B;  2OTL 1;  1Y1V I;  2R6M A;  3G71 Z;  1Q81 2;  5A2Q f;  3I55 Z;  3JAM b;  1K8A 2;  2GTI A;  1RO0 A;  4NOZ A;  3RZD I;  1KQS Z;  3S2H I;  1WCM I;  3K7A I;  2RBL A;  1USP B;  3GTP I;  4A3F I;  4A3D I;  5IT9 b;  2JNY A;  4RVG A;  2VF1 A;  4MRI A;  4DK1 A;  3CXC Y;  1PFT A;  1Y1V S;  3CC7 1;  5T6B A;  2Y0S A;  3I4M I;  3IF8 A;  1QF8 A;  2E9H A;  4BY7 I;  4A3L I;  1ZH1 A;  3CD6 1;  1S72 Z;  4HGZ A;  2JA6 I;  2P28 A;  2R7Z I;  3GTM S;  4QTU A;  1ML8 A;  2OZK A;  4BY1 I;  3ESW A;  1NUI A;  1VQ6 Z;  1K9M 1;  3F3P C;  1QVF Y;  4DQY B;  1Z03 A;  3CXC Z;  1N8R 2;  5FLX b;  4Y7N I;  4A3C I;  1VQ9 Z;  2HF1 A;  1VQP 1;  3CC2 1;  1YHQ 1;  4A3J I;  1K83 I;  4CL1 A;  3HOU I;  4E33 A;  3S2D I;  3CCJ 1;  2QRE B;  3CCS 1;  4Y52 I;  1YJW Z;  3QWU A;  4NB9 A;  2OTJ 1;  2I3C A;  2PK7 A;  3NH5 A;  1YI2 1;  3CCM 1;  1YJ9 1;  4NBG A;  2QKD A;  1VQ4 1;  1QVF Z;  2R92 I;  1YUA A;  2QR1 B;  3CCV Z;  4NBE A;  2QA4 Z;  2IZ3 A;  1QVG Y;  1ZB8 A;  4E2W A;  3NH8 A;  3G71 1;  1I6H I;  3HOZ I;  1N2F A;  3P5J B;  3J80 f;  3OW2 Y;  5C44 I;  1M90 2;  3EED A;  3CCE Z;  4MD7 A;  3CQZ I;  1DL6 A;  1VQO Z;  2E2J I;  1VQM Z;  1VQ8 Z;  4XX2 A;  3JAM f;  1Q7Y 2;  1WII A;  2RHB A;  1QVG Z;  1S72 1;  3CCU Z;  2PM9 A;  1YIJ Z;  3S17 I;  3HOV I;  3CME Z;  4NB8 A;  3CPW Y;  3PO3 S;  1KC8 1;  3CCQ 1;  2QEX 1;  1VQN Z;  3RZO I;  3OW2 Z;  1VQ5 1;  3LUS A;  3U50 C;  2JA8 I;  1LQL A;  1Q86 1;  3T4N B;  4E30 A;  1Z01 A;  2V8K A;  3PO2 I;  3GTM I;  1TWA I;  1S7M A;  1W2B Y;  3CPW Z;  1TWC I;  2JMO A;  4E2X A;  2YU9 I;  4A93 I;  5T64 A;  1L1O C;  2OOX B;  2Q51 A;  1K9M 2;  1YUK A;  1SFO I;  3KIF A;  3CC4 1;  2JUB A;  4RVD A;  1NP6 A;  3F3F C;  2NVX I;  1Z02 A;  1KD1 1;  1NJI 1;  1VQK 1;  5LL6 f;  3CCL 1;  5A2Q b;  1W2B Z;  2O4H A;  4S1T A;  3J81 f;  1VQ7 Z;  1VLA A;  1VQM 1;  3NFZ A;  2J6A A;  5IP9 I;  2WB1 A;  2QLV B;  2Q4Z A;  3G4S Z;  2JA7 I;  2O53 A;  4NBH A;  2OTL Z;  2JA5 I;  3I56 Z;  3CCR 1;  3GTO I;  1YIT 1;  1P9N A;  4NFR A;  3TDH B;  1YIJ 1;  2DE6 A;  2LIY A;  4E32 A;  1Q82 1;  3GTQ I;  2NVT I;  3VMH A;  1VQL 1;  4QTT A;  3G6E Z;  3GTL I;  1RQF A;  3I55 1;  1RO2 A;  2V8J A;  2BJO A;  1ZB9 A;  3BG1 B;  4NBC A;  3CD6 Z;  3VMG A;  3S1Q I;  2IZ4 A;  4BBR I;  3IFU A;  3S16 I;  1QYP A;  3NH4 A;  3PO3 I;  4E2Y A;  2VUM I;  1I50 I;  4HGY A;  2YAD A;  3VMI A;  3MZK B;  2P3Y A;  1KC8 2;  3EER A;  1RLY A;  3S14 I;  2HU9 A;  2B63 I;  3CMA Z;  5IT9 f;  1K73 1;  2M6N A;  1VQP Z;  1YHQ Z;  2RIQ A;  1TWH I;  1Q86 2;  3BG0 B;  3CCS Z;  3VTN A;  1VQ6 1;  3M4O I;  4A3M I;  2RPR A;  3H3V J;  3CCM Z;  2AKL A;  1VQ9 1;  3I07 A;  5D1O A;  4E2Z A;  1Y1W I;  4NBF A;  1VQ7 1;  1WW9 A;  2VUG A;  3HOY I;  3J80 b;  4RV9 A;  1X3Z A;  4BXX I;  3FQQ A;  1M1K 1;  4MH4 A;  2LFU A;  1YJW 1;  2V8I A;  3D9X A;  1X3W A;  5FLX f;  2M48 A;  4MD8 A;  3I56 1;  3M3Y I;  4X6A I;  3GKQ A;  1KD1 2;  1NJI 2;  4RVH A;  1Q81 1;  1RO4 A;  5CM2 M;  1K8A 1;  3CCV 1;  2PMZ A;  2QA4 1;  3G6E 1;  5C3E I;  2F4M A;  1YJN Z;  4EWC A;  3GTG I;  3S1R I;  3VB9 A;  5C4J I;  1USP A;  3TE5 B;  1I3Q I;  5IP7 I;  2KI7 B;  3CCE 1;  1VQO 1;  1VQ8 1;  1KRL A;  4NBB A;  3CCQ Z;  2QEX Z;  4RVF A;  3S1M I;  1VQ5 Z;  1TFI A;  4DGL A;  4A3I I;  3GCF A;  3FKI I;  1Q82 2;  3CMA 1;  1RNI A;  2W04 A;  2H85 A;  3CCU 1;  1X0T A;  2R93 I;  4HH4 A;  4E31 A;  4NBA A;  3CME 1;  1JWH C;  3HOX I;  1VQN 1;  2JS4 A;  1N8R 1;  4BBS I;  2NVY I;  3NDI A;  3S15 I;  5T67 A;  2GTH A;  3CC7 Z;  3MON A;  2K5R A;  2ZAE B;  2QRC B;  4NH1 C;  5C4X I;  3MZL B;  1R9T I;  3IX0 A;  2DE5 A;  3I4N I;  3J81 b;  3KIH A;  4MON A;  3CC4 Z;  3HOW I;  2DE7 A;  4MD9 A;  2K3R A;  1K73 2;  1JJ2 Y;  2F4O A;  1VQK Z;  2RT9 A;  2QRD B;  2E2I I;  2KPI A;  4TNU A;  2EGT A;  3CCL Z;  2WAQ A;  5AN9 F;  2NVQ I;  3Q87 A;  3CC2 Z;  4A3K I;  4A3E I;  4NBD A;  3CCJ Z;  5D1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...