1Q862

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86200
1Q7Y1 1VQ71 1VQMZ 3CC2Z 2OTLZ 3CCMZ 3CCE1 1YI21 1K9M2 2QA41 1Q822 2OTJZ 1K8A1 3I55Z 1YJ9Z 1VQ51 3CC21 1VQM1 2OTL1 3CCLZ 1VQ61 3CMAZ 3CCS1 1YHQZ 3CCRZ 3CME1 1VQP1 1VQPZ 2QEX1 1VQ9Z 3G711 3CXCY 3CCM1 1K9M1 3CMA1 3CXCZ 1YJN1 1VQO1 1JJ2Y 1NJI1 3CCV1 1VQK1 1Q812 1KD11 1VQLZ 3CC41 1Q862 3G6E1 1VQ7Z 3G4S1 1NJI2 1W2BY 1KC82 3OW2Z 1VQL1 1QVGY 3I551 1VQ4Z 1K8A2 3CD6Z 2QEXZ 1M901 1N8R2 1YHQ1 1QVGZ 1VQOZ 3CCL1 1Q861 3OW2Y 1QVFY 1Q811 1W2BZ 3CCU1 3CCUZ 3I561 1Q821 3CCQ1 3CC7Z 1YJWZ 1YJW1 1KQSY 2OTJ1 2QA4Z 1VQ6Z 1Q7Y2 3CCJ1 3CPWZ 1N8R1 3G4SZ 3CCQZ 3I56Z 1VQNZ 3G6EZ 1JJ2Z 1YITZ 1YIJZ 1K732 1YJNZ 1YJ91 1YIT1 3CD61 1VQ41 3CC4Z 3CPWY 1M1K2 1VQ81 3CMEZ 1K731 1KQSZ 1KC81 1YIJ1 3CCSZ 3CCVZ 3CCJZ 1QVFZ 1M902 1VQ8Z 1VQ5Z 1S72Z 1S721 3G71Z 3CC71 1KD12 1M1K1 1VQ91 1VQKZ 1VQN1 3CCEZ 3CCR1 1YI2Z
chains in the Genus database with same CATH superfamily
1Q7Y1 1VQMZ 3CC2Z 5A2Qb 3I07A 2QA41 5D1PA 2JIPA 2OTJZ 3GCFA 4NBDA 1YJ9Z 2E2II 3MONA 4A3DI 2JUBA 4AYBA 2OTL1 1Z03A 2VPZA 2JA5I 1TFIA 3CCS1 5AN9F 3GTMS 2RT9A 2OZKA 3CME1 3Q87A 3G711 3F3PC 3CCM1 1K9M1 2PM9A 3CMA1 1VQO1 3S17I 4A3MI 1VQK1 4A3KI 2NAPA 2VUGA 4RV9A 1R9TI 2JIQA 1YUAA 2P28A 2VPXA 1W2BY 2Y0SA 4E2YA 1KC82 2OOYB 3S1RI 2JA7I 1K83I 2GU2A 5T64A 1QVGY 3I551 1ZH1A 1VQ4Z 2ZAEB 3T4NB 3IF8A 4RVGA 4NBAA 2V8KA 3BG0B 1RO0A 2E7ZA 4DGLA 1VQOZ 3K7AI 4TNUA 4XX2A 3IR7A 1Q811 2JA6I 3S16I 3CCUZ 1YJWZ 5C44I 3CC7Z 2G2KA 4E31A 3GTJI 1RNIA 3JAMf 1S7MA 1Y1VS 2NVYI 4NBGA 1FDOA 3J80f 2RHBA 4QTTA 4BBSI 1YIJZ 3CPWY 4Y52I 3GKQA 5T67A 1M1K2 3TDHB 2E2HI 1KQSZ 1KC81 3NDJA 2W04A 2B63I 3J81f 3CCJZ 2V45A 5D1OA 1VQ8Z 1QYPA 2KI7B 4A93I 2F4OA 2K3RA 1VQ91 4MXUA 2JMOA 3PO3S 5D1OB 3VTNA 3IX0A 5FLXf 4S1TA 1SIWA 1N2FA 3CCE1 1YI21 1K9M2 1Q822 2HF1A 2IZ3A 4BBRI 1X3ZA 2VPWA 1USPA 1TWHI 4E30A 3CQZI 5IT9b 4A3GI 4MD9A 3EEDA 1YHQZ 1Y1VI 1VQPZ 3IFUA 3J7A4 3LUSA 4RVFA 1PFTA 4MD7A 1NJI1 4A3LI 3VMHA 3M3YI 1Q812 1WCMI 2O4HA 3CC41 1AA6A 1VQ7Z 1NJI2 2VF1A 2LEXA 2IV2X 3QWUA 3M4OI 4NH1C 3S14I 1VQL1 3GTMI 2RPRA 2F4MA 1K8A2 3CD6Z 5A2Qf 2PK7A 1QXFA 4X6AI 1M901 4NB8A 2YU9I 1N8R2 3GTQI 3H0GI 4HGZA 2W03A 1QVFY 3FQMA 1Q821 2OTJ1 2EGTA 2QA4Z 5CM2M 1VQ6Z 4E2XA 3CPWZ 4RVDA 2WAQA 4NOZA 1TWGI 5C3EI 1NUIA 2Q51A 1YJ91 2AKLA 3CD61 1VQ41 3HOXI 2DE7A 3CC4Z 3CMEZ 3VMIA 3HOVI 3CCSZ 4HGYA 5IP9I 2V8JA 3NH8A 3NDIA 1M902 4CL1A 5C4XI 1NP6A 3G71Z 3CC71 1KD12 1M1K1 4NBBA 3P5JB 1TWCI 4E2ZA 1VQN1 2E2JI 1ZB9A 2E9HA 2JIMA 3CCMZ 2NVXI 2KPIA 4A3BI 1X0TA 5C4JI 1K8A1 2I3CA 4EWCA 3VB9A 2JIRA 1LQLA 3FKII 4NBEA 4A3JI 4QTUA 3CCRZ 4E33A 2BJOA 1RQFA 2QEX1 1VQ9Z 3CXCY 3S1MI 1X3WA 1YJN1 3RZDI 4NFRA 1JJ2Y 1RO2A 3NH4A 2GTIA 4A3EI 2P3YA 1VQLZ 2R93I 2M48A 3D2LA 3G6E1 2IZ4A 3G4S1 2R92I 3JAMb 1USPB 2WB1A 2LFUA 5LL6f 2QKDA 2RBLA 2QREB 2QEXZ 3MZLB 1QVGZ 2NVQI 3CCL1 3PO2I 3BG1B 4HH4A 5T6BA 1Q861 3S15I 3F3FC 3RZOI 2M6NA 3CCU1 1YJW1 1Y8CA 1KQSY 1RO4A 3GTGI 2VPYA 2JS4A 1Q7Y2 1I3QI 3CCJ1 1ML8A 2Q4ZA 1N8R1 1JWHC 2HU9A 2PMZA 3G4SZ 1DL6A 3NFZA 3CCQZ 3I56Z 3G6EZ 1JJ2Z 4A3II 3I4NI 1WW9A 3I4MI 1YITZ 1I50I 1K732 2RIQA 3GTLI 3S1QI 4BXXI 2O53A 3S2DI 2VUMI 3U50C 3H3VJ 5IP7I 1QVFZ 4BY7I 2JIOA 3S2HI 2JNYA 1VQ5Z 1S72Z 1S721 1VQKZ 2DE6A 2QR1B 3GTKI 4DQYB 2K5RA 1YUKA 1VQ71 3EERA 2OTLZ 2JR6A 2V8IA 4RS4A 3I55Z 1VQ51 4NBCA 3TE5B 3CC21 1VQM1 3HKZA 3CCLZ 3MZKB 1VQ61 4E2WA 2JA8I 3CMAZ 3HOUI 2R7ZI 3NH5A 4RVHA 1P9NA 1VQP1 1I6HI 3KIFA 5FLMI 3GTOI 3CXCZ 3HOZI 2DE5A 3FQQA 3CCV1 1QF8A 2GTHA 4MH4A 2V3VA 1KD11 1Q862 5FLXb 3KIHA 3J80b 3VMGA 2QLVB 2QRDB 2R6MA 3PO3I 3OW2Z 2NVTI 4A3FI 1Q16A 1Y1WI 2YADA 4DK1A 4MRIA 1FDIA 4NB9A 1YHQ1 2LIYA 3J81b 4NBFA 3OW2Y 1W2BZ 4A3CI 3D9XA 3I561 3CCQ1 1VLAA 1KRLA 3HOYI 1VQNZ 4MONA 3D6WA 1Z02A 3GTPI 1Z01A 5IT9f 3ESWA 1WZNA 1YJNZ 3HOWI 1YIT1 1WIIA 4NBHA 1TWAI 4Y7NI 1VQ81 1K731 1TWFI 2QRCB 1YIJ1 3CCVZ 2AYDA 2J6AA 1ZB8A 4E32A 4BY1I 1WJ2A 2OOXB 1L1OC 1RLYA 1SFOI 3S1NI 3CCEZ 3CCR1 1YI2Z 2H85A 4MD8A
chains in the Genus database with same CATH topology
1Q7Y1 1VQMZ 3CC2Z 5A2Qb 3I07A 2QA41 5D1PA 2OTJZ 3GCFA 4NBDA 1YJ9Z 2E2II 3MONA 4A3DI 2JUBA 4AYBA 2OTL1 1Z03A 2JA5I 1TFIA 3CCS1 5AN9F 3GTMS 2RT9A 2OZKA 3CME1 3Q87A 3G711 3F3PC 3CCM1 1K9M1 2PM9A 3CMA1 1VQO1 3S17I 4A3MI 1VQK1 4A3KI 4RV9A 2VUGA 1R9TI 1YUAA 2P28A 1W2BY 2Y0SA 4E2YA 1KC82 2OOYB 3S1RI 2JA7I 1K83I 2GU2A 5T64A 1QVGY 3I551 1ZH1A 1VQ4Z 2ZAEB 3T4NB 3IF8A 4RVGA 4NBAA 2V8KA 3BG0B 1RO0A 4DGLA 1VQOZ 3K7AI 4TNUA 4XX2A 1Q811 2JA6I 3S16I 3CCUZ 1YJWZ 5C44I 3CC7Z 2G2KA 4E31A 3GTJI 1RNIA 3JAMf 1S7MA 1Y1VS 2NVYI 4NBGA 3J80f 2RHBA 4QTTA 4BBSI 1YIJZ 3CPWY 4Y52I 3GKQA 5T67A 1M1K2 3TDHB 2E2HI 1KQSZ 1KC81 3NDJA 2W04A 2B63I 3J81f 3CCJZ 5D1OA 1VQ8Z 1QYPA 2KI7B 4A93I 2F4OA 2K3RA 1VQ91 4MXUA 2JMOA 3PO3S 5D1OB 3VTNA 3IX0A 5FLXf 4S1TA 1N2FA 3CCE1 1YI21 1K9M2 1Q822 2HF1A 2IZ3A 4BBRI 1X3ZA 1USPA 1TWHI 4E30A 3CQZI 5IT9b 4A3GI 4MD9A 3EEDA 1YHQZ 1Y1VI 1VQPZ 3IFUA 3J7A4 3LUSA 4RVFA 1PFTA 4MD7A 1NJI1 4A3LI 3VMHA 3M3YI 1Q812 1WCMI 2O4HA 3CC41 1VQ7Z 1NJI2 2VF1A 3QWUA 3M4OI 4NH1C 3S14I 1VQL1 3GTMI 2RPRA 2F4MA 1K8A2 3CD6Z 5A2Qf 2PK7A 4X6AI 1M901 4NB8A 2YU9I 1N8R2 3GTQI 3H0GI 4HGZA 2W03A 1QVFY 3FQMA 1Q821 2OTJ1 2EGTA 2QA4Z 5CM2M 1VQ6Z 4E2XA 3CPWZ 4RVDA 2WAQA 4NOZA 1TWGI 5C3EI 1NUIA 2Q51A 1YJ91 2AKLA 3CD61 1VQ41 3HOXI 2DE7A 3CC4Z 3CMEZ 3VMIA 3HOVI 3CCSZ 4HGYA 5IP9I 2V8JA 3NH8A 3NDIA 1M902 4CL1A 5C4XI 1NP6A 3G71Z 3CC71 1KD12 1M1K1 4NBBA 3P5JB 1TWCI 4E2ZA 1VQN1 2E2JI 1ZB9A 2E9HA 3CCMZ 2NVXI 2KPIA 4A3BI 1X0TA 5C4JI 1K8A1 2I3CA 4EWCA 3VB9A 1LQLA 3FKII 4NBEA 4A3JI 4QTUA 3CCRZ 4E33A 2BJOA 1RQFA 2QEX1 1VQ9Z 3CXCY 3S1MI 1X3WA 1YJN1 3RZDI 4NFRA 1JJ2Y 1RO2A 3NH4A 2GTIA 4A3EI 2P3YA 1VQLZ 2R93I 2M48A 3G6E1 2IZ4A 3G4S1 2R92I 3JAMb 1USPB 2WB1A 2LFUA 5LL6f 2QKDA 2RBLA 2QREB 2QEXZ 3MZLB 1QVGZ 2NVQI 3CCL1 3PO2I 3BG1B 4HH4A 5T6BA 1Q861 3S15I 3F3FC 3RZOI 2M6NA 1YJW1 3CCU1 1KQSY 1RO4A 3GTGI 2JS4A 1Q7Y2 1I3QI 3CCJ1 1ML8A 2Q4ZA 1N8R1 1JWHC 2HU9A 2PMZA 3G4SZ 1DL6A 3NFZA 3CCQZ 3I56Z 3G6EZ 1JJ2Z 4A3II 3I4NI 1WW9A 3I4MI 1YITZ 1I50I 1K732 2RIQA 3GTLI 3S1QI 4BXXI 2O53A 3S2DI 2VUMI 3U50C 3H3VJ 5IP7I 1QVFZ 4BY7I 3S2HI 2JNYA 1VQ5Z 1S72Z 1S721 1VQKZ 2DE6A 2QR1B 3GTKI 4DQYB 2K5RA 1YUKA 1VQ71 3EERA 2OTLZ 2JR6A 2V8IA 4RS4A 3I55Z 1VQ51 4NBCA 3TE5B 3CC21 1VQM1 3HKZA 3CCLZ 3MZKB 1VQ61 4E2WA 2JA8I 3CMAZ 3HOUI 2R7ZI 3NH5A 4RVHA 1P9NA 1VQP1 1I6HI 3KIFA 5FLMI 3GTOI 3CXCZ 3HOZI 2DE5A 3FQQA 3CCV1 1QF8A 2GTHA 4MH4A 1KD11 1Q862 5FLXb 3KIHA 3J80b 3VMGA 2QLVB 2QRDB 2R6MA 3PO3I 3OW2Z 2NVTI 4A3FI 1Y1WI 2YADA 4DK1A 4MRIA 4NB9A 1YHQ1 2LIYA 3J81b 4NBFA 3OW2Y 1W2BZ 4A3CI 3D9XA 3I561 3CCQ1 1VLAA 1KRLA 3HOYI 1VQNZ 4MONA 3D6WA 1Z02A 3GTPI 1Z01A 5IT9f 3ESWA 1YJNZ 3HOWI 1YIT1 1WIIA 4NBHA 1TWAI 4Y7NI 1VQ81 1K731 1TWFI 2QRCB 1YIJ1 3CCVZ 2J6AA 1ZB8A 4E32A 4BY1I 2OOXB 1L1OC 1RLYA 1SFOI 3S1NI 3CCEZ 3CCR1 1YI2Z 2H85A 4MD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 1;  1VQ7 1;  1VQM Z;  3CC2 Z;  2OTL Z;  3CCM Z;  3CCE 1;  1YI2 1;  1K9M 2;  2QA4 1;  1Q82 2;  2OTJ Z;  1K8A 1;  3I55 Z;  1YJ9 Z;  1VQ5 1;  3CC2 1;  1VQM 1;  2OTL 1;  3CCL Z;  1VQ6 1;  3CMA Z;  3CCS 1;  1YHQ Z;  3CCR Z;  3CME 1;  1VQP 1;  1VQP Z;  2QEX 1;  1VQ9 Z;  3G71 1;  3CXC Y;  3CCM 1;  1K9M 1;  3CMA 1;  3CXC Z;  1YJN 1;  1VQO 1;  1JJ2 Y;  1NJI 1;  3CCV 1;  1VQK 1;  1Q81 2;  1KD1 1;  1VQL Z;  3CC4 1;  1Q86 2;  3G6E 1;  1VQ7 Z;  3G4S 1;  1NJI 2;  1W2B Y;  1KC8 2;  3OW2 Z;  1VQL 1;  1QVG Y;  3I55 1;  1VQ4 Z;  1K8A 2;  3CD6 Z;  2QEX Z;  1M90 1;  1N8R 2;  1YHQ 1;  1QVG Z;  1VQO Z;  3CCL 1;  1Q86 1;  3OW2 Y;  1QVF Y;  1Q81 1;  1W2B Z;  3CCU 1;  3CCU Z;  3I56 1;  1Q82 1;  3CCQ 1;  3CC7 Z;  1YJW Z;  1YJW 1;  1KQS Y;  2OTJ 1;  2QA4 Z;  1VQ6 Z;  1Q7Y 2;  3CCJ 1;  3CPW Z;  1N8R 1;  3G4S Z;  3CCQ Z;  3I56 Z;  1VQN Z;  3G6E Z;  1JJ2 Z;  1YIT Z;  1YIJ Z;  1K73 2;  1YJN Z;  1YJ9 1;  1YIT 1;  3CD6 1;  1VQ4 1;  3CC4 Z;  3CPW Y;  1M1K 2;  1VQ8 1;  3CME Z;  1K73 1;  1KQS Z;  1KC8 1;  1YIJ 1;  3CCS Z;  3CCV Z;  3CCJ Z;  1QVF Z;  1M90 2;  1VQ8 Z;  1VQ5 Z;  1S72 Z;  1S72 1;  3G71 Z;  3CC7 1;  1KD1 2;  1M1K 1;  1VQ9 1;  1VQK Z;  1VQN 1;  3CCE Z;  3CCR 1;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  1VQM Z;  3CC2 Z;  5A2Q b;  3I07 A;  2QA4 1;  5D1P A;  2JIP A;  2OTJ Z;  3GCF A;  4NBD A;  1YJ9 Z;  2E2I I;  3MON A;  4A3D I;  2JUB A;  4AYB A;  2OTL 1;  1Z03 A;  2VPZ A;  2JA5 I;  1TFI A;  3CCS 1;  5AN9 F;  3GTM S;  2RT9 A;  2OZK A;  3CME 1;  3Q87 A;  3G71 1;  3F3P C;  3CCM 1;  1K9M 1;  2PM9 A;  3CMA 1;  1VQO 1;  3S17 I;  4A3M I;  1VQK 1;  4A3K I;  2NAP A;  2VUG A;  4RV9 A;  1R9T I;  2JIQ A;  1YUA A;  2P28 A;  2VPX A;  1W2B Y;  2Y0S A;  4E2Y A;  1KC8 2;  2OOY B;  3S1R I;  2JA7 I;  1K83 I;  2GU2 A;  5T64 A;  1QVG Y;  3I55 1;  1ZH1 A;  1VQ4 Z;  2ZAE B;  3T4N B;  3IF8 A;  4RVG A;  4NBA A;  2V8K A;  3BG0 B;  1RO0 A;  2E7Z A;  4DGL A;  1VQO Z;  3K7A I;  4TNU A;  4XX2 A;  3IR7 A;  1Q81 1;  2JA6 I;  3S16 I;  3CCU Z;  1YJW Z;  5C44 I;  3CC7 Z;  2G2K A;  4E31 A;  3GTJ I;  1RNI A;  3JAM f;  1S7M A;  1Y1V S;  2NVY I;  4NBG A;  1FDO A;  3J80 f;  2RHB A;  4QTT A;  4BBS I;  1YIJ Z;  3CPW Y;  4Y52 I;  3GKQ A;  5T67 A;  1M1K 2;  3TDH B;  2E2H I;  1KQS Z;  1KC8 1;  3NDJ A;  2W04 A;  2B63 I;  3J81 f;  3CCJ Z;  2V45 A;  5D1O A;  1VQ8 Z;  1QYP A;  2KI7 B;  4A93 I;  2F4O A;  2K3R A;  1VQ9 1;  4MXU A;  2JMO A;  3PO3 S;  5D1O B;  3VTN A;  3IX0 A;  5FLX f;  4S1T A;  1SIW A;  1N2F A;  3CCE 1;  1YI2 1;  1K9M 2;  1Q82 2;  2HF1 A;  2IZ3 A;  4BBR I;  1X3Z A;  2VPW A;  1USP A;  1TWH I;  4E30 A;  3CQZ I;  5IT9 b;  4A3G I;  4MD9 A;  3EED A;  1YHQ Z;  1Y1V I;  1VQP Z;  3IFU A;  3J7A 4;  3LUS A;  4RVF A;  1PFT A;  4MD7 A;  1NJI 1;  4A3L I;  3VMH A;  3M3Y I;  1Q81 2;  1WCM I;  2O4H A;  3CC4 1;  1AA6 A;  1VQ7 Z;  1NJI 2;  2VF1 A;  2LEX A;  2IV2 X;  3QWU A;  3M4O I;  4NH1 C;  3S14 I;  1VQL 1;  3GTM I;  2RPR A;  2F4M A;  1K8A 2;  3CD6 Z;  5A2Q f;  2PK7 A;  1QXF A;  4X6A I;  1M90 1;  4NB8 A;  2YU9 I;  1N8R 2;  3GTQ I;  3H0G I;  4HGZ A;  2W03 A;  1QVF Y;  3FQM A;  1Q82 1;  2OTJ 1;  2EGT A;  2QA4 Z;  5CM2 M;  1VQ6 Z;  4E2X A;  3CPW Z;  4RVD A;  2WAQ A;  4NOZ A;  1TWG I;  5C3E I;  1NUI A;  2Q51 A;  1YJ9 1;  2AKL A;  3CD6 1;  1VQ4 1;  3HOX I;  2DE7 A;  3CC4 Z;  3CME Z;  3VMI A;  3HOV I;  3CCS Z;  4HGY A;  5IP9 I;  2V8J A;  3NH8 A;  3NDI A;  1M90 2;  4CL1 A;  5C4X I;  1NP6 A;  3G71 Z;  3CC7 1;  1KD1 2;  1M1K 1;  4NBB A;  3P5J B;  1TWC I;  4E2Z A;  1VQN 1;  2E2J I;  1ZB9 A;  2E9H A;  2JIM A;  3CCM Z;  2NVX I;  2KPI A;  4A3B I;  1X0T A;  5C4J I;  1K8A 1;  2I3C A;  4EWC A;  3VB9 A;  2JIR A;  1LQL A;  3FKI I;  4NBE A;  4A3J I;  4QTU A;  3CCR Z;  4E33 A;  2BJO A;  1RQF A;  2QEX 1;  1VQ9 Z;  3CXC Y;  3S1M I;  1X3W A;  1YJN 1;  3RZD I;  4NFR A;  1JJ2 Y;  1RO2 A;  3NH4 A;  2GTI A;  4A3E I;  2P3Y A;  1VQL Z;  2R93 I;  2M48 A;  3D2L A;  3G6E 1;  2IZ4 A;  3G4S 1;  2R92 I;  3JAM b;  1USP B;  2WB1 A;  2LFU A;  5LL6 f;  2QKD A;  2RBL A;  2QRE B;  2QEX Z;  3MZL B;  1QVG Z;  2NVQ I;  3CCL 1;  3PO2 I;  3BG1 B;  4HH4 A;  5T6B A;  1Q86 1;  3S15 I;  3F3F C;  3RZO I;  2M6N A;  3CCU 1;  1YJW 1;  1Y8C A;  1KQS Y;  1RO4 A;  3GTG I;  2VPY A;  2JS4 A;  1Q7Y 2;  1I3Q I;  3CCJ 1;  1ML8 A;  2Q4Z A;  1N8R 1;  1JWH C;  2HU9 A;  2PMZ A;  3G4S Z;  1DL6 A;  3NFZ A;  3CCQ Z;  3I56 Z;  3G6E Z;  1JJ2 Z;  4A3I I;  3I4N I;  1WW9 A;  3I4M I;  1YIT Z;  1I50 I;  1K73 2;  2RIQ A;  3GTL I;  3S1Q I;  4BXX I;  2O53 A;  3S2D I;  2VUM I;  3U50 C;  3H3V J;  5IP7 I;  1QVF Z;  4BY7 I;  2JIO A;  3S2H I;  2JNY A;  1VQ5 Z;  1S72 Z;  1S72 1;  1VQK Z;  2DE6 A;  2QR1 B;  3GTK I;  4DQY B;  2K5R A;  1YUK A;  1VQ7 1;  3EER A;  2OTL Z;  2JR6 A;  2V8I A;  4RS4 A;  3I55 Z;  1VQ5 1;  4NBC A;  3TE5 B;  3CC2 1;  1VQM 1;  3HKZ A;  3CCL Z;  3MZK B;  1VQ6 1;  4E2W A;  2JA8 I;  3CMA Z;  3HOU I;  2R7Z I;  3NH5 A;  4RVH A;  1P9N A;  1VQP 1;  1I6H I;  3KIF A;  5FLM I;  3GTO I;  3CXC Z;  3HOZ I;  2DE5 A;  3FQQ A;  3CCV 1;  1QF8 A;  2GTH A;  4MH4 A;  2V3V A;  1KD1 1;  1Q86 2;  5FLX b;  3KIH A;  3J80 b;  3VMG A;  2QLV B;  2QRD B;  2R6M A;  3PO3 I;  3OW2 Z;  2NVT I;  4A3F I;  1Q16 A;  1Y1W I;  2YAD A;  4DK1 A;  4MRI A;  1FDI A;  4NB9 A;  1YHQ 1;  2LIY A;  3J81 b;  4NBF A;  3OW2 Y;  1W2B Z;  4A3C I;  3D9X A;  3I56 1;  3CCQ 1;  1VLA A;  1KRL A;  3HOY I;  1VQN Z;  4MON A;  3D6W A;  1Z02 A;  3GTP I;  1Z01 A;  5IT9 f;  3ESW A;  1WZN A;  1YJN Z;  3HOW I;  1YIT 1;  1WII A;  4NBH A;  1TWA I;  4Y7N I;  1VQ8 1;  1K73 1;  1TWF I;  2QRC B;  1YIJ 1;  3CCV Z;  2AYD A;  2J6A A;  1ZB8 A;  4E32 A;  4BY1 I;  1WJ2 A;  2OOX B;  1L1O C;  1RLY A;  1SFO I;  3S1N I;  3CCE Z;  3CCR 1;  1YI2 Z;  2H85 A;  4MD8 A; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  1VQM Z;  3CC2 Z;  5A2Q b;  3I07 A;  2QA4 1;  5D1P A;  2OTJ Z;  3GCF A;  4NBD A;  1YJ9 Z;  2E2I I;  3MON A;  4A3D I;  2JUB A;  4AYB A;  2OTL 1;  1Z03 A;  2JA5 I;  1TFI A;  3CCS 1;  5AN9 F;  3GTM S;  2RT9 A;  2OZK A;  3CME 1;  3Q87 A;  3G71 1;  3F3P C;  3CCM 1;  1K9M 1;  2PM9 A;  3CMA 1;  1VQO 1;  3S17 I;  4A3M I;  1VQK 1;  4A3K I;  4RV9 A;  2VUG A;  1R9T I;  1YUA A;  2P28 A;  1W2B Y;  2Y0S A;  4E2Y A;  1KC8 2;  2OOY B;  3S1R I;  2JA7 I;  1K83 I;  2GU2 A;  5T64 A;  1QVG Y;  3I55 1;  1ZH1 A;  1VQ4 Z;  2ZAE B;  3T4N B;  3IF8 A;  4RVG A;  4NBA A;  2V8K A;  3BG0 B;  1RO0 A;  4DGL A;  1VQO Z;  3K7A I;  4TNU A;  4XX2 A;  1Q81 1;  2JA6 I;  3S16 I;  3CCU Z;  1YJW Z;  5C44 I;  3CC7 Z;  2G2K A;  4E31 A;  3GTJ I;  1RNI A;  3JAM f;  1S7M A;  1Y1V S;  2NVY I;  4NBG A;  3J80 f;  2RHB A;  4QTT A;  4BBS I;  1YIJ Z;  3CPW Y;  4Y52 I;  3GKQ A;  5T67 A;  1M1K 2;  3TDH B;  2E2H I;  1KQS Z;  1KC8 1;  3NDJ A;  2W04 A;  2B63 I;  3J81 f;  3CCJ Z;  5D1O A;  1VQ8 Z;  1QYP A;  2KI7 B;  4A93 I;  2F4O A;  2K3R A;  1VQ9 1;  4MXU A;  2JMO A;  3PO3 S;  5D1O B;  3VTN A;  3IX0 A;  5FLX f;  4S1T A;  1N2F A;  3CCE 1;  1YI2 1;  1K9M 2;  1Q82 2;  2HF1 A;  2IZ3 A;  4BBR I;  1X3Z A;  1USP A;  1TWH I;  4E30 A;  3CQZ I;  5IT9 b;  4A3G I;  4MD9 A;  3EED A;  1YHQ Z;  1Y1V I;  1VQP Z;  3IFU A;  3J7A 4;  3LUS A;  4RVF A;  1PFT A;  4MD7 A;  1NJI 1;  4A3L I;  3VMH A;  3M3Y I;  1Q81 2;  1WCM I;  2O4H A;  3CC4 1;  1VQ7 Z;  1NJI 2;  2VF1 A;  3QWU A;  3M4O I;  4NH1 C;  3S14 I;  1VQL 1;  3GTM I;  2RPR A;  2F4M A;  1K8A 2;  3CD6 Z;  5A2Q f;  2PK7 A;  4X6A I;  1M90 1;  4NB8 A;  2YU9 I;  1N8R 2;  3GTQ I;  3H0G I;  4HGZ A;  2W03 A;  1QVF Y;  3FQM A;  1Q82 1;  2OTJ 1;  2EGT A;  2QA4 Z;  5CM2 M;  1VQ6 Z;  4E2X A;  3CPW Z;  4RVD A;  2WAQ A;  4NOZ A;  1TWG I;  5C3E I;  1NUI A;  2Q51 A;  1YJ9 1;  2AKL A;  3CD6 1;  1VQ4 1;  3HOX I;  2DE7 A;  3CC4 Z;  3CME Z;  3VMI A;  3HOV I;  3CCS Z;  4HGY A;  5IP9 I;  2V8J A;  3NH8 A;  3NDI A;  1M90 2;  4CL1 A;  5C4X I;  1NP6 A;  3G71 Z;  3CC7 1;  1KD1 2;  1M1K 1;  4NBB A;  3P5J B;  1TWC I;  4E2Z A;  1VQN 1;  2E2J I;  1ZB9 A;  2E9H A;  3CCM Z;  2NVX I;  2KPI A;  4A3B I;  1X0T A;  5C4J I;  1K8A 1;  2I3C A;  4EWC A;  3VB9 A;  1LQL A;  3FKI I;  4NBE A;  4A3J I;  4QTU A;  3CCR Z;  4E33 A;  2BJO A;  1RQF A;  2QEX 1;  1VQ9 Z;  3CXC Y;  3S1M I;  1X3W A;  1YJN 1;  3RZD I;  4NFR A;  1JJ2 Y;  1RO2 A;  3NH4 A;  2GTI A;  4A3E I;  2P3Y A;  1VQL Z;  2R93 I;  2M48 A;  3G6E 1;  2IZ4 A;  3G4S 1;  2R92 I;  3JAM b;  1USP B;  2WB1 A;  2LFU A;  5LL6 f;  2QKD A;  2RBL A;  2QRE B;  2QEX Z;  3MZL B;  1QVG Z;  2NVQ I;  3CCL 1;  3PO2 I;  3BG1 B;  4HH4 A;  5T6B A;  1Q86 1;  3S15 I;  3F3F C;  3RZO I;  2M6N A;  1YJW 1;  3CCU 1;  1KQS Y;  1RO4 A;  3GTG I;  2JS4 A;  1Q7Y 2;  1I3Q I;  3CCJ 1;  1ML8 A;  2Q4Z A;  1N8R 1;  1JWH C;  2HU9 A;  2PMZ A;  3G4S Z;  1DL6 A;  3NFZ A;  3CCQ Z;  3I56 Z;  3G6E Z;  1JJ2 Z;  4A3I I;  3I4N I;  1WW9 A;  3I4M I;  1YIT Z;  1I50 I;  1K73 2;  2RIQ A;  3GTL I;  3S1Q I;  4BXX I;  2O53 A;  3S2D I;  2VUM I;  3U50 C;  3H3V J;  5IP7 I;  1QVF Z;  4BY7 I;  3S2H I;  2JNY A;  1VQ5 Z;  1S72 Z;  1S72 1;  1VQK Z;  2DE6 A;  2QR1 B;  3GTK I;  4DQY B;  2K5R A;  1YUK A;  1VQ7 1;  3EER A;  2OTL Z;  2JR6 A;  2V8I A;  4RS4 A;  3I55 Z;  1VQ5 1;  4NBC A;  3TE5 B;  3CC2 1;  1VQM 1;  3HKZ A;  3CCL Z;  3MZK B;  1VQ6 1;  4E2W A;  2JA8 I;  3CMA Z;  3HOU I;  2R7Z I;  3NH5 A;  4RVH A;  1P9N A;  1VQP 1;  1I6H I;  3KIF A;  5FLM I;  3GTO I;  3CXC Z;  3HOZ I;  2DE5 A;  3FQQ A;  3CCV 1;  1QF8 A;  2GTH A;  4MH4 A;  1KD1 1;  1Q86 2;  5FLX b;  3KIH A;  3J80 b;  3VMG A;  2QLV B;  2QRD B;  2R6M A;  3PO3 I;  3OW2 Z;  2NVT I;  4A3F I;  1Y1W I;  2YAD A;  4DK1 A;  4MRI A;  4NB9 A;  1YHQ 1;  2LIY A;  3J81 b;  4NBF A;  3OW2 Y;  1W2B Z;  4A3C I;  3D9X A;  3I56 1;  3CCQ 1;  1VLA A;  1KRL A;  3HOY I;  1VQN Z;  4MON A;  3D6W A;  1Z02 A;  3GTP I;  1Z01 A;  5IT9 f;  3ESW A;  1YJN Z;  3HOW I;  1YIT 1;  1WII A;  4NBH A;  1TWA I;  4Y7N I;  1VQ8 1;  1K73 1;  1TWF I;  2QRC B;  1YIJ 1;  3CCV Z;  2J6A A;  1ZB8 A;  4E32 A;  4BY1 I;  2OOX B;  1L1O C;  1RLY A;  1SFO I;  3S1N I;  3CCE Z;  3CCR 1;  1YI2 Z;  2H85 A;  4MD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...