1QVGY

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgY00
1W2BZ 1VQ7Z 2OTJ1 1N8R2 1S721 3CCLZ 3CCL1 1KC82 3G4SZ 1QVGY 1NJI2 1VQMZ 3CCQZ 1VQ6Z 1VQM1 3CCMZ 3CCS1 3CCVZ 1K9M2 3CCV1 3CMAZ 1VQ5Z 1VQ51 3CC7Z 1VQK1 3CC71 1K9M1 1K732 3OW2Z 3CC2Z 1VQ71 1W2BY 1K731 1QVFZ 1Q862 1VQ8Z 1YI2Z 1YI21 1VQ81 1Q822 1QVFY 1KQSZ 1Q861 1N8R1 2OTLZ 3G4S1 3CC4Z 2OTL1 1Q7Y2 2QA4Z 3CC41 1KQSY 3CCJZ 2QA41 3CCQ1 1K8A2 1VQ61 3CCM1 1KC81 1NJI1 3G71Z 1KD12 3G711 3I55Z 3I551 3CMA1 1M902 1VQOZ 1YJNZ 1YJN1 3CCUZ 3CCU1 3I56Z 3CMEZ 3CC21 1JJ2Z 3OW2Y 3CCEZ 1YIJZ 1YIJ1 2QEXZ 2QEX1 1JJ2Y 3CCRZ 3CCR1 3CPWZ 1M1K2 1VQNZ 1VQN1 1Q821 1VQPZ 3CD6Z 3CCJ1 3G6EZ 1Q7Y1 1VQLZ 3G6E1 1VQL1 1K8A1 1Q812 1VQO1 2OTJZ 1KD11 1S72Z 1YITZ 1YIT1 1Q811 1M901 3I561 3CME1 1QVGZ 3CXCZ 1VQ4Z 1VQ41 3CCE1 1YJ9Z 1YJ91 1VQ9Z 3CXCY 1VQ91 3CCSZ 1YJWZ 1YJW1 1VQP1 3CD61 3CPWY 1M1K1 1YHQZ 1VQKZ 1YHQ1
chains in the Genus database with same CATH superfamily
1W2BZ 2E7ZA 2F4OA 3J81f 5D1OA 3S2HI 2RT9A 3GCFA 5C44I 1S721 2Q4ZA 1RLYA 3RZOI 4NH1C 5FLXb 2E2JI 1QVGY 4E30A 1NJI2 5IT9b 4HGZA 3CCQZ 2AKLA 3VB9A 5A2Qb 3MZKB 2DE7A 1I50I 2RIQA 3CC7Z 3CC71 4TNUA 1K9M1 4A3LI 2E2HI 3CC2Z 1VQ71 2VUMI 5T6BA 2BJOA 4A3EI 4EWCA 2NVXI 4MD8A 5D1OB 3TE5B 1QVFY 4A3II 2E9HA 1S7MA 3NFZA 3GKQA 1Z01A 3CC4Z 3CC41 1KQSY 3CCJZ 2NVQI 3CCM1 3GTOI 2QRDB 1RO0A 1USPA 1YJNZ 1WJ2A 1YJN1 5C4JI 3FQMA 1TWGI 1YIJZ 4E2YA 4BXXI 1YIJ1 3CCRZ 3CCR1 3M4OI 2JIQA 3IX0A 2B63I 2VPYA 3VTNA 5FLXf 1VQPZ 1I6HI 4HGYA 5IT9f 3J7A4 1ZH1A 1DL6A 1VQO1 1QF8A 2OTJZ 2QRCB 3IFUA 3I561 1QVGZ 1USPB 2K3RA 2JA5I 4QTUA 3CXCZ 5IP9I 1YJ9Z 3KIHA 4AYBA 5IP7I 1YJ91 4NBCA 1YJWZ 2PM9A 1YJW1 3CD61 1M1K1 1QYPA 4E2XA 3BG1B 4MONA 2HF1A 2IZ4A 2WB1A 4DK1A 3VMIA 1N8R2 4A3DI 1YUAA 2VPXA 3S1NI 2JIPA 3G4SZ 3JAMf 3NH5A 3TDHB 3HOZI 3NDJA 2P3YA 1VQ6Z 4MD7A 3CCS1 2DE5A 3LUSA 3CCVZ 3CCV1 2G2KA 4RVFA 3EERA 3CMAZ 3S14I 4E32A 3NH8A 1K732 1Y1WI 4BBSI 3HKZA 4A3KI 3S15I 5T67A 3MONA 1Q862 2VUGA 2OZKA 3EEDA 2JNYA 2EGTA 3MZLB 2V8IA 1Y1VS 2JA8I 1Q7Y2 2QA4Z 2WAQA 2QA41 4A3GI 3CCQ1 1K8A2 1TWFI 1KC81 3IR7A 1RO2A 2AYDA 1KD12 3I55Z 3I551 1M902 3H0GI 3CMEZ 3CC21 4DQYB 3OW2Y 2R7ZI 3PO3I 2QEXZ 2H85A 2QEX1 1JJ2Y 2M6NA 2LEXA 2KI7B 3D2LA 1VQNZ 1VQN1 1K83I 1Q821 3J80b 3CCJ1 2JA6I 2VPWA 3HOUI 2JMOA 1Z02A 3G6EZ 4RVHA 3G6E1 4RS4A 2F4MA 4MRIA 1Y1VI 1YITZ 2O53A 1YIT1 3HOXI 4A93I 2KPIA 5D1PA 4CL1A 2ZAEB 4RV9A 1VLAA 3S1RI 1VQP1 2JA7I 3GTPI 4MH4A 2QLVB 4E33A 3VMGA 1VQKZ 2R93I 4MXUA 4QTTA 5A2Qf 4NBBA 4A3BI 2OTJ1 4E2ZA 4RVDA 1X3ZA 1P9NA 1X3WA 2LFUA 3S2DI 2W03A 2V45A 1QXFA 3K7AI 1NP6A 3S16I 2K5RA 4NBDA 3PO2I 4A3FI 2YADA 3J80f 4A3CI 1WW9A 3OW2Z 3NH4A 1ZB9A 4Y52I 2GU2A 4NB9A 1K731 1QVFZ 4A3JI 3Q87A 3P5JB 1VQ8Z 1VQ81 1TFIA 2OOYB 1KQSZ 1Q861 3GTJI 1RNIA 3F3PC 3HOYI 4XX2A 3G4S1 4DGLA 2Q51A 1VQ61 2JS4A 1FDIA 1NJI1 3G71Z 2JR6A 3G711 3CMA1 3S1QI 1PFTA 3CCUZ 1KRLA 3CCU1 3RZDI 1ML8A 3CCEZ 1WIIA 4NBHA 2PK7A 2QREB 4BBRI 3S17I 2JIMA 1M1K2 2JIOA 4X6AI 2JIRA 4A3MI 3I4NI 2DE6A 1VQLZ 1VQL1 3GTQI 3FQQA 1Q812 2RPRA 1Z03A 2QR1B 1S72Z 2VF1A 2GTIA 2GTHA 3CME1 4NB8A 4BY7I 5LL6f 3M3YI 3CXCY 5AN9F 4NBGA 1FDOA 2R6MA 2NVTI 3GTGI 3D6WA 3S1MI 3CPWY 2JUBA 1YHQZ 3T4NB 1YHQ1 1LQLA 1VQ7Z 1JWHC 4NOZA 2PMZA 4BY1I 4NFRA 2J6AA 4NBAA 3NDIA 3HOWI 2V8JA 1RO4A 3CCLZ 3CCL1 1KC82 1VQMZ 3I07A 1VQM1 3CCMZ 1AA6A 2E2II 2OOXB 4Y7NI 2RBLA 1SIWA 3HOVI 1K9M2 1SFOI 1VQ5Z 3FKII 1VQ51 1VQK1 2R92I 2QKDA 4HH4A 1I3QI 3JAMb 1W2BY 1TWAI 3BG0B 5T64A 1YI2Z 1YI21 2I3CA 4S1TA 3CQZI 5FLMI 1Q822 1Y8CA 2Y0SA 1N8R1 1WZNA 3I4MI 2OTLZ 2OTL1 1RQFA 1NUIA 3GTMS 3J81b 2V3VA 3GTLI 3ESWA 1L1OC 1VQOZ 2NVYI 1TWCI 2IZ3A 3I56Z 1N2FA 1JJ2Z 3GTKI 4E2WA 2YU9I 2NAPA 3VMHA 2RHBA 4E31A 3KIFA 3CPWZ 2W04A 3U50C 4NBFA 2M48A 1WCMI 3F3FC 3QWUA 3CD6Z 2IV2X 4RVGA 3D9XA 2HU9A 1Q7Y1 1K8A1 3IF8A 1KD11 1X0TA 4MD9A 1Q811 1M901 2O4HA 3GTMI 1VQ4Z 5C4XI 1VQ41 3CCE1 5CM2M 1VQ9Z 1ZB8A 2LIYA 1VQ91 1R9TI 3H3VJ 2V8KA 3CCSZ 1YUKA 2VPZA 5C3EI 4NBEA 3PO3S 1Q16A 2P28A 1TWHI
chains in the Genus database with same CATH topology
1W2BZ 2F4OA 3J81f 5D1OA 3S2HI 2RT9A 3GCFA 5C44I 1S721 2Q4ZA 1RLYA 3RZOI 4NH1C 5FLXb 2E2JI 1QVGY 4E30A 1NJI2 5IT9b 4HGZA 3CCQZ 2AKLA 3VB9A 5A2Qb 3MZKB 2DE7A 1I50I 2RIQA 3CC7Z 3CC71 4TNUA 1K9M1 4A3LI 2E2HI 3CC2Z 1VQ71 2VUMI 5T6BA 2BJOA 4A3EI 4EWCA 2NVXI 4MD8A 5D1OB 3TE5B 1QVFY 4A3II 2E9HA 1S7MA 3NFZA 3GKQA 1Z01A 3CC4Z 3CC41 1KQSY 3CCJZ 2NVQI 3CCM1 3GTOI 2QRDB 1RO0A 1USPA 1YJNZ 1YJN1 5C4JI 3FQMA 1TWGI 1YIJZ 4E2YA 4BXXI 1YIJ1 3CCRZ 3CCR1 3M4OI 3IX0A 2B63I 3VTNA 5FLXf 1VQPZ 1I6HI 4HGYA 5IT9f 3J7A4 1ZH1A 1DL6A 1VQO1 1QF8A 2OTJZ 2QRCB 3IFUA 3I561 1QVGZ 1USPB 2K3RA 2JA5I 4QTUA 3CXCZ 5IP9I 1YJ9Z 3KIHA 4AYBA 5IP7I 1YJ91 4NBCA 1YJWZ 2PM9A 1YJW1 3CD61 1M1K1 1QYPA 4E2XA 3BG1B 4MONA 2HF1A 2IZ4A 2WB1A 4DK1A 3VMIA 1N8R2 4A3DI 1YUAA 3S1NI 3G4SZ 3JAMf 3NH5A 3TDHB 3HOZI 3NDJA 2P3YA 1VQ6Z 4MD7A 3CCS1 2DE5A 3LUSA 3CCVZ 3CCV1 2G2KA 4RVFA 3EERA 3CMAZ 3S14I 4E32A 3NH8A 1K732 1Y1WI 4BBSI 3HKZA 4A3KI 3S15I 5T67A 3MONA 1Q862 2VUGA 2OZKA 3EEDA 2JNYA 2EGTA 3MZLB 2V8IA 1Y1VS 2JA8I 1Q7Y2 2QA4Z 2WAQA 2QA41 4A3GI 3CCQ1 1K8A2 1TWFI 1KC81 1RO2A 1KD12 3I55Z 3I551 1M902 3H0GI 3CMEZ 3CC21 4DQYB 3OW2Y 2R7ZI 3PO3I 2QEXZ 2H85A 2QEX1 1JJ2Y 2M6NA 2KI7B 1VQNZ 1VQN1 1K83I 1Q821 3J80b 3CCJ1 2JA6I 3HOUI 2JMOA 1Z02A 3G6EZ 4RVHA 3G6E1 4RS4A 2F4MA 4MRIA 1Y1VI 1YITZ 2O53A 1YIT1 3HOXI 4A93I 2KPIA 5D1PA 4CL1A 2ZAEB 4RV9A 1VLAA 3S1RI 1VQP1 2JA7I 3GTPI 4MH4A 2QLVB 4E33A 3VMGA 1VQKZ 2R93I 4MXUA 4QTTA 5A2Qf 4NBBA 4A3BI 2OTJ1 4E2ZA 4RVDA 1X3ZA 1P9NA 1X3WA 2LFUA 3S2DI 2W03A 3K7AI 1NP6A 3S16I 2K5RA 4NBDA 3PO2I 4A3FI 2YADA 3J80f 4A3CI 1WW9A 3OW2Z 3NH4A 1ZB9A 2GU2A 4NB9A 1K731 1QVFZ 4A3JI 3Q87A 3P5JB 1VQ8Z 1VQ81 1TFIA 2OOYB 1KQSZ 1Q861 3GTJI 1RNIA 3F3PC 3HOYI 4XX2A 3G4S1 4DGLA 2Q51A 1VQ61 2JS4A 1NJI1 3G71Z 2JR6A 3G711 3CMA1 3S1QI 1PFTA 3CCUZ 1KRLA 3CCU1 3RZDI 1ML8A 3CCEZ 1WIIA 4NBHA 2PK7A 2QREB 4BBRI 3S17I 1M1K2 4X6AI 4A3MI 3I4NI 2DE6A 1VQLZ 1VQL1 3GTQI 3FQQA 1Q812 2RPRA 1Z03A 2QR1B 1S72Z 2VF1A 2GTIA 2GTHA 3CME1 4NB8A 4BY7I 5LL6f 3M3YI 3CXCY 5AN9F 4NBGA 2R6MA 2NVTI 3GTGI 3D6WA 3S1MI 3CPWY 2JUBA 1YHQZ 3T4NB 1YHQ1 1LQLA 1VQ7Z 1JWHC 4NOZA 2PMZA 4BY1I 4NFRA 2J6AA 4NBAA 3NDIA 3HOWI 2V8JA 1RO4A 3CCLZ 3CCL1 1KC82 1VQMZ 3I07A 1VQM1 3CCMZ 2E2II 2OOXB 4Y7NI 2RBLA 3HOVI 1K9M2 1SFOI 1VQ5Z 3FKII 1VQ51 1VQK1 2R92I 2QKDA 4HH4A 1I3QI 3JAMb 1W2BY 1TWAI 3BG0B 5T64A 1YI2Z 1YI21 2I3CA 4S1TA 3CQZI 5FLMI 1Q822 2Y0SA 1N8R1 3I4MI 2OTLZ 2OTL1 1RQFA 1NUIA 3GTMS 3J81b 3GTLI 3ESWA 1L1OC 1VQOZ 2NVYI 1TWCI 2IZ3A 3I56Z 1N2FA 1JJ2Z 3GTKI 4E2WA 2YU9I 3VMHA 2RHBA 4E31A 3KIFA 3CPWZ 2W04A 3U50C 4NBFA 2M48A 1WCMI 3F3FC 3QWUA 3CD6Z 4RVGA 3D9XA 2HU9A 1Q7Y1 1K8A1 3IF8A 1KD11 1X0TA 4MD9A 1Q811 1M901 2O4HA 3GTMI 1VQ4Z 5C4XI 1VQ41 3CCE1 5CM2M 1VQ9Z 1ZB8A 2LIYA 1VQ91 1R9TI 3H3VJ 2V8KA 3CCSZ 1YUKA 5C3EI 4NBEA 3PO3S 4Y52I 2P28A 1TWHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Z;  1VQ7 Z;  2OTJ 1;  1N8R 2;  1S72 1;  3CCL Z;  3CCL 1;  1KC8 2;  3G4S Z;  1QVG Y;  1NJI 2;  1VQM Z;  3CCQ Z;  1VQ6 Z;  1VQM 1;  3CCM Z;  3CCS 1;  3CCV Z;  1K9M 2;  3CCV 1;  3CMA Z;  1VQ5 Z;  1VQ5 1;  3CC7 Z;  1VQK 1;  3CC7 1;  1K9M 1;  1K73 2;  3OW2 Z;  3CC2 Z;  1VQ7 1;  1W2B Y;  1K73 1;  1QVF Z;  1Q86 2;  1VQ8 Z;  1YI2 Z;  1YI2 1;  1VQ8 1;  1Q82 2;  1QVF Y;  1KQS Z;  1Q86 1;  1N8R 1;  2OTL Z;  3G4S 1;  3CC4 Z;  2OTL 1;  1Q7Y 2;  2QA4 Z;  3CC4 1;  1KQS Y;  3CCJ Z;  2QA4 1;  3CCQ 1;  1K8A 2;  1VQ6 1;  3CCM 1;  1KC8 1;  1NJI 1;  3G71 Z;  1KD1 2;  3G71 1;  3I55 Z;  3I55 1;  3CMA 1;  1M90 2;  1VQO Z;  1YJN Z;  1YJN 1;  3CCU Z;  3CCU 1;  3I56 Z;  3CME Z;  3CC2 1;  1JJ2 Z;  3OW2 Y;  3CCE Z;  1YIJ Z;  1YIJ 1;  2QEX Z;  2QEX 1;  1JJ2 Y;  3CCR Z;  3CCR 1;  3CPW Z;  1M1K 2;  1VQN Z;  1VQN 1;  1Q82 1;  1VQP Z;  3CD6 Z;  3CCJ 1;  3G6E Z;  1Q7Y 1;  1VQL Z;  3G6E 1;  1VQL 1;  1K8A 1;  1Q81 2;  1VQO 1;  2OTJ Z;  1KD1 1;  1S72 Z;  1YIT Z;  1YIT 1;  1Q81 1;  1M90 1;  3I56 1;  3CME 1;  1QVG Z;  3CXC Z;  1VQ4 Z;  1VQ4 1;  3CCE 1;  1YJ9 Z;  1YJ9 1;  1VQ9 Z;  3CXC Y;  1VQ9 1;  3CCS Z;  1YJW Z;  1YJW 1;  1VQP 1;  3CD6 1;  3CPW Y;  1M1K 1;  1YHQ Z;  1VQK Z;  1YHQ 1; 
#chains in the Genus database with same CATH topology
 1W2B Z;  2E7Z A;  2F4O A;  3J81 f;  5D1O A;  3S2H I;  2RT9 A;  3GCF A;  5C44 I;  1S72 1;  2Q4Z A;  1RLY A;  3RZO I;  4NH1 C;  5FLX b;  2E2J I;  1QVG Y;  4E30 A;  1NJI 2;  5IT9 b;  4HGZ A;  3CCQ Z;  2AKL A;  3VB9 A;  5A2Q b;  3MZK B;  2DE7 A;  1I50 I;  2RIQ A;  3CC7 Z;  3CC7 1;  4TNU A;  1K9M 1;  4A3L I;  2E2H I;  3CC2 Z;  1VQ7 1;  2VUM I;  5T6B A;  2BJO A;  4A3E I;  4EWC A;  2NVX I;  4MD8 A;  5D1O B;  3TE5 B;  1QVF Y;  4A3I I;  2E9H A;  1S7M A;  3NFZ A;  3GKQ A;  1Z01 A;  3CC4 Z;  3CC4 1;  1KQS Y;  3CCJ Z;  2NVQ I;  3CCM 1;  3GTO I;  2QRD B;  1RO0 A;  1USP A;  1YJN Z;  1WJ2 A;  1YJN 1;  5C4J I;  3FQM A;  1TWG I;  1YIJ Z;  4E2Y A;  4BXX I;  1YIJ 1;  3CCR Z;  3CCR 1;  3M4O I;  2JIQ A;  3IX0 A;  2B63 I;  2VPY A;  3VTN A;  5FLX f;  1VQP Z;  1I6H I;  4HGY A;  5IT9 f;  3J7A 4;  1ZH1 A;  1DL6 A;  1VQO 1;  1QF8 A;  2OTJ Z;  2QRC B;  3IFU A;  3I56 1;  1QVG Z;  1USP B;  2K3R A;  2JA5 I;  4QTU A;  3CXC Z;  5IP9 I;  1YJ9 Z;  3KIH A;  4AYB A;  5IP7 I;  1YJ9 1;  4NBC A;  1YJW Z;  2PM9 A;  1YJW 1;  3CD6 1;  1M1K 1;  1QYP A;  4E2X A;  3BG1 B;  4MON A;  2HF1 A;  2IZ4 A;  2WB1 A;  4DK1 A;  3VMI A;  1N8R 2;  4A3D I;  1YUA A;  2VPX A;  3S1N I;  2JIP A;  3G4S Z;  3JAM f;  3NH5 A;  3TDH B;  3HOZ I;  3NDJ A;  2P3Y A;  1VQ6 Z;  4MD7 A;  3CCS 1;  2DE5 A;  3LUS A;  3CCV Z;  3CCV 1;  2G2K A;  4RVF A;  3EER A;  3CMA Z;  3S14 I;  4E32 A;  3NH8 A;  1K73 2;  1Y1W I;  4BBS I;  3HKZ A;  4A3K I;  3S15 I;  5T67 A;  3MON A;  1Q86 2;  2VUG A;  2OZK A;  3EED A;  2JNY A;  2EGT A;  3MZL B;  2V8I A;  1Y1V S;  2JA8 I;  1Q7Y 2;  2QA4 Z;  2WAQ A;  2QA4 1;  4A3G I;  3CCQ 1;  1K8A 2;  1TWF I;  1KC8 1;  3IR7 A;  1RO2 A;  2AYD A;  1KD1 2;  3I55 Z;  3I55 1;  1M90 2;  3H0G I;  3CME Z;  3CC2 1;  4DQY B;  3OW2 Y;  2R7Z I;  3PO3 I;  2QEX Z;  2H85 A;  2QEX 1;  1JJ2 Y;  2M6N A;  2LEX A;  2KI7 B;  3D2L A;  1VQN Z;  1VQN 1;  1K83 I;  1Q82 1;  3J80 b;  3CCJ 1;  2JA6 I;  2VPW A;  3HOU I;  2JMO A;  1Z02 A;  3G6E Z;  4RVH A;  3G6E 1;  4RS4 A;  2F4M A;  4MRI A;  1Y1V I;  1YIT Z;  2O53 A;  1YIT 1;  3HOX I;  4A93 I;  2KPI A;  5D1P A;  4CL1 A;  2ZAE B;  4RV9 A;  1VLA A;  3S1R I;  1VQP 1;  2JA7 I;  3GTP I;  4MH4 A;  2QLV B;  4E33 A;  3VMG A;  1VQK Z;  2R93 I;  4MXU A;  4QTT A;  5A2Q f;  4NBB A;  4A3B I;  2OTJ 1;  4E2Z A;  4RVD A;  1X3Z A;  1P9N A;  1X3W A;  2LFU A;  3S2D I;  2W03 A;  2V45 A;  1QXF A;  3K7A I;  1NP6 A;  3S16 I;  2K5R A;  4NBD A;  3PO2 I;  4A3F I;  2YAD A;  3J80 f;  4A3C I;  1WW9 A;  3OW2 Z;  3NH4 A;  1ZB9 A;  4Y52 I;  2GU2 A;  4NB9 A;  1K73 1;  1QVF Z;  4A3J I;  3Q87 A;  3P5J B;  1VQ8 Z;  1VQ8 1;  1TFI A;  2OOY B;  1KQS Z;  1Q86 1;  3GTJ I;  1RNI A;  3F3P C;  3HOY I;  4XX2 A;  3G4S 1;  4DGL A;  2Q51 A;  1VQ6 1;  2JS4 A;  1FDI A;  1NJI 1;  3G71 Z;  2JR6 A;  3G71 1;  3CMA 1;  3S1Q I;  1PFT A;  3CCU Z;  1KRL A;  3CCU 1;  3RZD I;  1ML8 A;  3CCE Z;  1WII A;  4NBH A;  2PK7 A;  2QRE B;  4BBR I;  3S17 I;  2JIM A;  1M1K 2;  2JIO A;  4X6A I;  2JIR A;  4A3M I;  3I4N I;  2DE6 A;  1VQL Z;  1VQL 1;  3GTQ I;  3FQQ A;  1Q81 2;  2RPR A;  1Z03 A;  2QR1 B;  1S72 Z;  2VF1 A;  2GTI A;  2GTH A;  3CME 1;  4NB8 A;  4BY7 I;  5LL6 f;  3M3Y I;  3CXC Y;  5AN9 F;  4NBG A;  1FDO A;  2R6M A;  2NVT I;  3GTG I;  3D6W A;  3S1M I;  3CPW Y;  2JUB A;  1YHQ Z;  3T4N B;  1YHQ 1;  1LQL A;  1VQ7 Z;  1JWH C;  4NOZ A;  2PMZ A;  4BY1 I;  4NFR A;  2J6A A;  4NBA A;  3NDI A;  3HOW I;  2V8J A;  1RO4 A;  3CCL Z;  3CCL 1;  1KC8 2;  1VQM Z;  3I07 A;  1VQM 1;  3CCM Z;  1AA6 A;  2E2I I;  2OOX B;  4Y7N I;  2RBL A;  1SIW A;  3HOV I;  1K9M 2;  1SFO I;  1VQ5 Z;  3FKI I;  1VQ5 1;  1VQK 1;  2R92 I;  2QKD A;  4HH4 A;  1I3Q I;  3JAM b;  1W2B Y;  1TWA I;  3BG0 B;  5T64 A;  1YI2 Z;  1YI2 1;  2I3C A;  4S1T A;  3CQZ I;  5FLM I;  1Q82 2;  1Y8C A;  2Y0S A;  1N8R 1;  1WZN A;  3I4M I;  2OTL Z;  2OTL 1;  1RQF A;  1NUI A;  3GTM S;  3J81 b;  2V3V A;  3GTL I;  3ESW A;  1L1O C;  1VQO Z;  2NVY I;  1TWC I;  2IZ3 A;  3I56 Z;  1N2F A;  1JJ2 Z;  3GTK I;  4E2W A;  2YU9 I;  2NAP A;  3VMH A;  2RHB A;  4E31 A;  3KIF A;  3CPW Z;  2W04 A;  3U50 C;  4NBF A;  2M48 A;  1WCM I;  3F3F C;  3QWU A;  3CD6 Z;  2IV2 X;  4RVG A;  3D9X A;  2HU9 A;  1Q7Y 1;  1K8A 1;  3IF8 A;  1KD1 1;  1X0T A;  4MD9 A;  1Q81 1;  1M90 1;  2O4H A;  3GTM I;  1VQ4 Z;  5C4X I;  1VQ4 1;  3CCE 1;  5CM2 M;  1VQ9 Z;  1ZB8 A;  2LIY A;  1VQ9 1;  1R9T I;  3H3V J;  2V8K A;  3CCS Z;  1YUK A;  2VPZ A;  5C3E I;  4NBE A;  3PO3 S;  1Q16 A;  2P28 A;  1TWH I; 
#chains in the Genus database with same CATH homology
 1W2B Z;  2F4O A;  3J81 f;  5D1O A;  3S2H I;  2RT9 A;  3GCF A;  5C44 I;  1S72 1;  2Q4Z A;  1RLY A;  3RZO I;  4NH1 C;  5FLX b;  2E2J I;  1QVG Y;  4E30 A;  1NJI 2;  5IT9 b;  4HGZ A;  3CCQ Z;  2AKL A;  3VB9 A;  5A2Q b;  3MZK B;  2DE7 A;  1I50 I;  2RIQ A;  3CC7 Z;  3CC7 1;  4TNU A;  1K9M 1;  4A3L I;  2E2H I;  3CC2 Z;  1VQ7 1;  2VUM I;  5T6B A;  2BJO A;  4A3E I;  4EWC A;  2NVX I;  4MD8 A;  5D1O B;  3TE5 B;  1QVF Y;  4A3I I;  2E9H A;  1S7M A;  3NFZ A;  3GKQ A;  1Z01 A;  3CC4 Z;  3CC4 1;  1KQS Y;  3CCJ Z;  2NVQ I;  3CCM 1;  3GTO I;  2QRD B;  1RO0 A;  1USP A;  1YJN Z;  1YJN 1;  5C4J I;  3FQM A;  1TWG I;  1YIJ Z;  4E2Y A;  4BXX I;  1YIJ 1;  3CCR Z;  3CCR 1;  3M4O I;  3IX0 A;  2B63 I;  3VTN A;  5FLX f;  1VQP Z;  1I6H I;  4HGY A;  5IT9 f;  3J7A 4;  1ZH1 A;  1DL6 A;  1VQO 1;  1QF8 A;  2OTJ Z;  2QRC B;  3IFU A;  3I56 1;  1QVG Z;  1USP B;  2K3R A;  2JA5 I;  4QTU A;  3CXC Z;  5IP9 I;  1YJ9 Z;  3KIH A;  4AYB A;  5IP7 I;  1YJ9 1;  4NBC A;  1YJW Z;  2PM9 A;  1YJW 1;  3CD6 1;  1M1K 1;  1QYP A;  4E2X A;  3BG1 B;  4MON A;  2HF1 A;  2IZ4 A;  2WB1 A;  4DK1 A;  3VMI A;  1N8R 2;  4A3D I;  1YUA A;  3S1N I;  3G4S Z;  3JAM f;  3NH5 A;  3TDH B;  3HOZ I;  3NDJ A;  2P3Y A;  1VQ6 Z;  4MD7 A;  3CCS 1;  2DE5 A;  3LUS A;  3CCV Z;  3CCV 1;  2G2K A;  4RVF A;  3EER A;  3CMA Z;  3S14 I;  4E32 A;  3NH8 A;  1K73 2;  1Y1W I;  4BBS I;  3HKZ A;  4A3K I;  3S15 I;  5T67 A;  3MON A;  1Q86 2;  2VUG A;  2OZK A;  3EED A;  2JNY A;  2EGT A;  3MZL B;  2V8I A;  1Y1V S;  2JA8 I;  1Q7Y 2;  2QA4 Z;  2WAQ A;  2QA4 1;  4A3G I;  3CCQ 1;  1K8A 2;  1TWF I;  1KC8 1;  1RO2 A;  1KD1 2;  3I55 Z;  3I55 1;  1M90 2;  3H0G I;  3CME Z;  3CC2 1;  4DQY B;  3OW2 Y;  2R7Z I;  3PO3 I;  2QEX Z;  2H85 A;  2QEX 1;  1JJ2 Y;  2M6N A;  2KI7 B;  1VQN Z;  1VQN 1;  1K83 I;  1Q82 1;  3J80 b;  3CCJ 1;  2JA6 I;  3HOU I;  2JMO A;  1Z02 A;  3G6E Z;  4RVH A;  3G6E 1;  4RS4 A;  2F4M A;  4MRI A;  1Y1V I;  1YIT Z;  2O53 A;  1YIT 1;  3HOX I;  4A93 I;  2KPI A;  5D1P A;  4CL1 A;  2ZAE B;  4RV9 A;  1VLA A;  3S1R I;  1VQP 1;  2JA7 I;  3GTP I;  4MH4 A;  2QLV B;  4E33 A;  3VMG A;  1VQK Z;  2R93 I;  4MXU A;  4QTT A;  5A2Q f;  4NBB A;  4A3B I;  2OTJ 1;  4E2Z A;  4RVD A;  1X3Z A;  1P9N A;  1X3W A;  2LFU A;  3S2D I;  2W03 A;  3K7A I;  1NP6 A;  3S16 I;  2K5R A;  4NBD A;  3PO2 I;  4A3F I;  2YAD A;  3J80 f;  4A3C I;  1WW9 A;  3OW2 Z;  3NH4 A;  1ZB9 A;  2GU2 A;  4NB9 A;  1K73 1;  1QVF Z;  4A3J I;  3Q87 A;  3P5J B;  1VQ8 Z;  1VQ8 1;  1TFI A;  2OOY B;  1KQS Z;  1Q86 1;  3GTJ I;  1RNI A;  3F3P C;  3HOY I;  4XX2 A;  3G4S 1;  4DGL A;  2Q51 A;  1VQ6 1;  2JS4 A;  1NJI 1;  3G71 Z;  2JR6 A;  3G71 1;  3CMA 1;  3S1Q I;  1PFT A;  3CCU Z;  1KRL A;  3CCU 1;  3RZD I;  1ML8 A;  3CCE Z;  1WII A;  4NBH A;  2PK7 A;  2QRE B;  4BBR I;  3S17 I;  1M1K 2;  4X6A I;  4A3M I;  3I4N I;  2DE6 A;  1VQL Z;  1VQL 1;  3GTQ I;  3FQQ A;  1Q81 2;  2RPR A;  1Z03 A;  2QR1 B;  1S72 Z;  2VF1 A;  2GTI A;  2GTH A;  3CME 1;  4NB8 A;  4BY7 I;  5LL6 f;  3M3Y I;  3CXC Y;  5AN9 F;  4NBG A;  2R6M A;  2NVT I;  3GTG I;  3D6W A;  3S1M I;  3CPW Y;  2JUB A;  1YHQ Z;  3T4N B;  1YHQ 1;  1LQL A;  1VQ7 Z;  1JWH C;  4NOZ A;  2PMZ A;  4BY1 I;  4NFR A;  2J6A A;  4NBA A;  3NDI A;  3HOW I;  2V8J A;  1RO4 A;  3CCL Z;  3CCL 1;  1KC8 2;  1VQM Z;  3I07 A;  1VQM 1;  3CCM Z;  2E2I I;  2OOX B;  4Y7N I;  2RBL A;  3HOV I;  1K9M 2;  1SFO I;  1VQ5 Z;  3FKI I;  1VQ5 1;  1VQK 1;  2R92 I;  2QKD A;  4HH4 A;  1I3Q I;  3JAM b;  1W2B Y;  1TWA I;  3BG0 B;  5T64 A;  1YI2 Z;  1YI2 1;  2I3C A;  4S1T A;  3CQZ I;  5FLM I;  1Q82 2;  2Y0S A;  1N8R 1;  3I4M I;  2OTL Z;  2OTL 1;  1RQF A;  1NUI A;  3GTM S;  3J81 b;  3GTL I;  3ESW A;  1L1O C;  1VQO Z;  2NVY I;  1TWC I;  2IZ3 A;  3I56 Z;  1N2F A;  1JJ2 Z;  3GTK I;  4E2W A;  2YU9 I;  3VMH A;  2RHB A;  4E31 A;  3KIF A;  3CPW Z;  2W04 A;  3U50 C;  4NBF A;  2M48 A;  1WCM I;  3F3F C;  3QWU A;  3CD6 Z;  4RVG A;  3D9X A;  2HU9 A;  1Q7Y 1;  1K8A 1;  3IF8 A;  1KD1 1;  1X0T A;  4MD9 A;  1Q81 1;  1M90 1;  2O4H A;  3GTM I;  1VQ4 Z;  5C4X I;  1VQ4 1;  3CCE 1;  5CM2 M;  1VQ9 Z;  1ZB8 A;  2LIY A;  1VQ9 1;  1R9T I;  3H3V J;  2V8K A;  3CCS Z;  1YUK A;  5C3E I;  4NBE A;  3PO3 S;  4Y52 I;  2P28 A;  1TWH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...