1QVGY

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgY00
1YHQZ 3CCL1 1VQ51 1Q861 1KD12 1YJN1 1VQ9Z 3CC71 2QEX1 3I561 1QVGY 3CPWZ 2OTJZ 1YJ91 3CMEZ 1M902 1YITZ 1K731 1NJI2 1QVGZ 3CCV1 3CCJZ 1KC82 1M1K2 2OTL1 1VQ81 1VQMZ 2QA4Z 3CC4Z 3G71Z 3CCQZ 1JJ2Z 1VQ41 3CCEZ 1VQ7Z 3CC2Z 1Q862 2QA41 3CC41 3CCSZ 1W2BY 1S72Z 1VQLZ 3CMAZ 1YI2Z 1YJWZ 1YHQ1 1Q821 3CCMZ 1W2BZ 1VQ91 1YIJZ 1K732 3CD6Z 1VQ6Z 2OTJ1 3CME1 1VQNZ 3CCUZ 3CCRZ 3I55Z 3CCM1 1YIT1 1Q812 3CCJ1 3CD61 1VQ61 1VQN1 1VQKZ 3CCU1 3CCR1 3I551 1VQM1 1Q7Y1 3G711 3G4SZ 1VQOZ 1N8R1 3CCQ1 1K9M1 1VQPZ 3CCE1 1VQ71 1Q822 3CC21 3CCLZ 1VQ5Z 3CCS1 1S721 1VQL1 1YI21 3CMA1 3CC7Z 1K8A1 2QEXZ 3I56Z 1YJW1 3G6EZ 3OW2Y 1KD11 1YIJ1 1QVFY 3CXCY 3CCVZ 3OW2Z 3G6E1 1M901 2OTLZ 1QVFZ 1Q7Y2 1VQ8Z 3CXCZ 1NJI1 1KC81 1N8R2 1KQSY 1K9M2 1M1K1 1VQK1 1VQ4Z 1YJNZ 1JJ2Y 3G4S1 1VQO1 1KQSZ 1Q811 1K8A2 1YJ9Z 1VQP1 3CPWY
chains in the Genus database with same CATH superfamily
3EEDA 2DE7A 1KD12 1I3QI 4NH1C 1NP6A 1YJ91 3QWUA 4MRIA 2F4OA 2QREB 4HH4A 3EERA 4BBRI 2JR6A 1QVGZ 1KC82 4NB8A 3J7A4 2K5RA 1I50I 1RO2A 1LQLA 2M48A 2VPZA 4MD7A 2R6MA 3FKII 4E31A 4RVGA 3CCEZ 1VQ7Z 1PFTA 2QLVB 4BXXI 5IP9I 2QA41 2AKLA 3CC41 4RS4A 1USPB 2DE6A 3CMAZ 5T67A 2NVXI 1TWAI 1YHQ1 2GTHA 3GCFA 4S1TA 3CCMZ 1W2BZ 1VQ91 1YIJZ 3MONA 1WZNA 2OTJ1 3CQZI 2NVTI 3CME1 3JAMf 2W04A 3GTMS 3CCUZ 4BY1I 3IF8A 1RQFA 1Q812 4BY7I 1WJ2A 5C4JI 4E33A 3HOXI 1ZB9A 2VPWA 4A3DI 3GTLI 5A2Qf 2YU9I 4A93I 4A3GI 4Y52I 1N8R1 4E2XA 4NBAA 3CCQ1 2V3VA 2R93I 5D1PA 1QXFA 1YUAA 1Q822 1VQ5Z 1VQL1 3RZDI 3S15I 3TE5B 3I56Z 3P5JB 1I6HI 3ESWA 1FDIA 1KD11 2VPXA 3TDHB 3JAMb 2WAQA 2OTLZ 2E7ZA 2YADA 4E2WA 4XX2A 4NBDA 1KC81 3H3VJ 2VPYA 3S14I 1VQ4Z 2OOXB 5A2Qb 3VMGA 2ZAEB 4DGLA 1ML8A 3J80f 3NDIA 1VQP1 3CCL1 3MZKB 3GTKI 3D6WA 1QF8A 1NUIA 4NOZA 1QVGY 2LFUA 2E2HI 2GU2A 2B63I 2JIMA 4A3BI 1Z03A 2VUGA 1VQ81 1X3WA 3G71Z 2JMOA 2PMZA 2V45A 2HF1A 3S16I 2H85A 3J81f 3CC2Z 1JWHC 1Q862 3CCSZ 1W2BY 3D9XA 4HGZA 2Q51A 1S72Z 2HU9A 1YI2Z 3J80b 1YJWZ 2G2KA 1WCMI 5C4XI 1Q821 2JA6I 1K732 3GKQA 4HGYA 1VQ6Z 2R92I 3Q87A 1DL6A 5AN9F 3KIFA 2RPRA 3BG0B 1WIIA 4AYBA 2JA8I 2QRDB 3I55Z 3CCRZ 4RVDA 3CCM1 1YIT1 4RV9A 3CCJ1 3GTQI 4RVHA 3CCU1 1VQM1 3GTOI 1SIWA 3G4SZ 3HOUI 3F3PC 4MD9A 3J81b 1N2FA 2NAPA 3HKZA 3KIHA 1TWFI 2O53A 3HOZI 5D1OB 4X6AI 3NH8A 3S1RI 4CL1A 3PO3S 3OW2Z 3LUSA 1YUKA 1Q7Y2 2P28A 3GTMI 1TWGI 3CXCZ 3M3YI 1K9M2 1FDOA 4MONA 3H0GI 1VQK1 1YJNZ 1VLAA 2W03A 1VQO1 1KQSZ 3S2HI 1K8A2 2VF1A 3VB9A 4QTTA 1YHQZ 2JIOA 4A3KI 4A3MI 1Q861 1VQ9Z 2Q4ZA 4MD8A 3CC71 2QEX1 1TWHI 2K3RA 3CPWZ 2OTJZ 3CMEZ 5FLXf 3NH5A 2IV2X 1M902 3I07A 3RZOI 3S2DI 1K731 1NJI2 5T64A 3CCV1 1WW9A 3IX0A 4A3JI 2OOYB 4NBBA 2RT9A 3FQQA 4EWCA 3CCQZ 3GTPI 1VQLZ 2JA5I 4QTUA 2R7ZI 1USPA 3NH4A 4E30A 1Y1VI 3CD6Z 2M6NA 5LL6f 1VQNZ 5FLXb 1SFOI 2P3YA 3FQMA 3VMHA 2Y0SA 1X3ZA 1VQ61 4A3LI 1ZB8A 3CCR1 3I551 1Q7Y1 2EGTA 2OZKA 3F3FC 5CM2M 1K9M1 1VQPZ 2GTIA 3HOWI 4Y7NI 2V8JA 1TFIA 3CCE1 1VQ71 3PO2I 3CCLZ 2IZ4A 2VUMI 2JIQA 3CMA1 2JNYA 2JUBA 1K8A1 3G6EZ 3OW2Y 3GTGI 2JIPA 2PM9A 3U50C 1YIJ1 2RBLA 1X0TA 3GTJI 3S17I 2QR1B 1KRLA 2O4HA 3CXCY 1ZH1A 2LIYA 5FLMI 5C3EI 1M901 3BG1B 1AA6A 1VQ8Z 1P9NA 1QVFZ 4MH4A 4NBEA 4E2ZA 3NFZA 1NJI1 2E9HA 1KQSY 2J6AA 2E2II 4A3EI 1L1OC 1JJ2Y 2KPIA 3T4NB 1YJ9Z 4A3FI 3CPWY 4DK1A 3MZLB 5IP7I 1VQ51 1YJN1 2RIQA 3I561 4E2YA 1R9TI 2LEXA 4A3CI 3HOYI 1YITZ 1Y1WI 2DE5A 3CCJZ 3S1NI 3K7AI 2IZ3A 1M1K2 1RNIA 3PO3I 2OTL1 2QKDA 1VQMZ 2QA4Z 3CC4Z 2JS4A 2JA7I 3S1MI 3IFUA 1JJ2Z 3VMIA 1VQ41 1Y8CA 1Z02A 2KI7B 2JIRA 5IT9f 2E2JI 2I3CA 3M4OI 3IR7A 3I4NI 4MXUA 1S7MA 2PK7A 3HOVI 2NVYI 3CD61 1QYPA 3I4MI 1VQN1 2BJOA 1VQKZ 5C44I 2AYDA 2F4MA 1RO4A 3G711 1VQOZ 4DQYB 4E32A 1Q16A 1TWCI 4A3II 4TNUA 3CC21 3CCS1 4NBFA 4NBCA 1S721 4RVFA 1YI21 3CC7Z 2QEXZ 1YJW1 2NVQI 5IT9b 3VTNA 5D1OA 1Y1VS 1QVFY 3NDJA 3CCVZ 3G6E1 1RO0A 2WB1A 4NB9A 2QRCB 2V8KA 5T6BA 1N8R2 1M1K1 4BBSI 4NFRA 1Z01A 1K83I 3D2LA 1RLYA 3G4S1 2RHBA 3S1QI 4NBGA 1Q811 4NBHA 2V8IA
chains in the Genus database with same CATH topology
3EEDA 2DE7A 1KD12 1I3QI 4NH1C 1NP6A 1YJ91 3QWUA 4MRIA 2F4OA 2QREB 4HH4A 3EERA 4BBRI 2JR6A 1QVGZ 1KC82 4NB8A 3J7A4 2K5RA 1I50I 1RO2A 1LQLA 2M48A 4MD7A 2R6MA 3FKII 4E31A 4RVGA 3CCEZ 1VQ7Z 1PFTA 2QLVB 4BXXI 5IP9I 2QA41 2AKLA 3CC41 4RS4A 1USPB 2DE6A 3CMAZ 5T67A 2NVXI 1TWAI 1YHQ1 2GTHA 3GCFA 4S1TA 3CCMZ 1W2BZ 1VQ91 1YIJZ 3MONA 2OTJ1 3CQZI 2NVTI 3CME1 3JAMf 2W04A 3GTMS 3CCUZ 4BY1I 3IF8A 1RQFA 1Q812 4BY7I 5C4JI 4E33A 3HOXI 1ZB9A 4A3DI 3GTLI 5A2Qf 2YU9I 4A93I 4A3GI 4Y52I 1N8R1 4E2XA 4NBAA 3CCQ1 2R93I 5D1PA 1YUAA 1Q822 1VQ5Z 1VQL1 3RZDI 3S15I 3TE5B 3I56Z 3P5JB 1I6HI 3ESWA 1KD11 3TDHB 3JAMb 2WAQA 2OTLZ 2YADA 4E2WA 4XX2A 4NBDA 1KC81 3H3VJ 3S14I 1VQ4Z 2OOXB 5A2Qb 3VMGA 2ZAEB 4DGLA 1ML8A 3J80f 3NDIA 1VQP1 3CCL1 3MZKB 3GTKI 3D6WA 1QF8A 1NUIA 4NOZA 1QVGY 2LFUA 2E2HI 2GU2A 2B63I 4A3BI 1Z03A 2VUGA 1VQ81 1X3WA 3G71Z 2JMOA 2PMZA 2HF1A 3S16I 2H85A 3J81f 3CC2Z 1JWHC 1Q862 3CCSZ 1W2BY 3D9XA 4HGZA 2Q51A 1S72Z 2HU9A 1YI2Z 3J80b 1YJWZ 2G2KA 1WCMI 5C4XI 1Q821 2JA6I 1K732 3GKQA 4HGYA 1VQ6Z 2R92I 3Q87A 1DL6A 5AN9F 3KIFA 2RPRA 3BG0B 1WIIA 4AYBA 2JA8I 2QRDB 3I55Z 3CCRZ 4RVDA 3CCM1 1YIT1 4RV9A 3CCJ1 3GTQI 4RVHA 3CCU1 1VQM1 3GTOI 3G4SZ 3HOUI 3F3PC 4MD9A 3J81b 1N2FA 3HKZA 3KIHA 1TWFI 2O53A 3HOZI 5D1OB 4X6AI 3NH8A 3S1RI 4CL1A 3PO3S 3OW2Z 3LUSA 1YUKA 1Q7Y2 2P28A 3GTMI 1TWGI 3CXCZ 3M3YI 1K9M2 4MONA 3H0GI 1VQK1 1YJNZ 1VLAA 2W03A 1VQO1 1KQSZ 3S2HI 1K8A2 2VF1A 3VB9A 4QTTA 1YHQZ 4A3KI 4A3MI 1Q861 1VQ9Z 2Q4ZA 4MD8A 3CC71 2QEX1 1TWHI 2K3RA 3CPWZ 2OTJZ 3CMEZ 5FLXf 3NH5A 1M902 3I07A 3RZOI 3S2DI 1K731 1NJI2 5T64A 3CCV1 1WW9A 3IX0A 4A3JI 2OOYB 4NBBA 2RT9A 3FQQA 4EWCA 3CCQZ 3GTPI 1VQLZ 2JA5I 4QTUA 2R7ZI 1USPA 3NH4A 4E30A 1Y1VI 3CD6Z 2M6NA 5LL6f 1VQNZ 5FLXb 1SFOI 2P3YA 3FQMA 3VMHA 2Y0SA 1X3ZA 1VQ61 4A3LI 1ZB8A 3CCR1 3I551 1Q7Y1 2EGTA 2OZKA 3F3FC 5CM2M 1K9M1 1VQPZ 2GTIA 3HOWI 4Y7NI 2V8JA 1TFIA 3CCE1 1VQ71 3PO2I 3CCLZ 2IZ4A 2VUMI 3CMA1 2JNYA 2JUBA 1K8A1 3G6EZ 3OW2Y 3GTGI 2PM9A 3U50C 1YIJ1 2RBLA 1X0TA 3GTJI 3S17I 2QR1B 1KRLA 2O4HA 3CXCY 1ZH1A 2LIYA 5FLMI 5C3EI 1M901 3BG1B 1QVFZ 1VQ8Z 1P9NA 4MH4A 4NBEA 4E2ZA 3NFZA 1NJI1 2E9HA 1KQSY 2J6AA 2E2II 4A3EI 1L1OC 1JJ2Y 2KPIA 3T4NB 1YJ9Z 4A3FI 3CPWY 4DK1A 3MZLB 5IP7I 1VQ51 1YJN1 2RIQA 3I561 4E2YA 1R9TI 4A3CI 3HOYI 1YITZ 1Y1WI 2DE5A 3CCJZ 3S1NI 3K7AI 2IZ3A 1M1K2 1RNIA 3PO3I 2OTL1 2QKDA 1VQMZ 2QA4Z 3CC4Z 2JS4A 2JA7I 3S1MI 3IFUA 1JJ2Z 3VMIA 1VQ41 1Z02A 2KI7B 5IT9f 2E2JI 2I3CA 3M4OI 3I4NI 4MXUA 1S7MA 2PK7A 3HOVI 2NVYI 3CD61 1QYPA 3I4MI 1VQN1 2BJOA 1VQKZ 5C44I 2F4MA 1RO4A 3G711 1VQOZ 4DQYB 4E32A 1TWCI 4A3II 4TNUA 3CC21 3CCS1 4NBFA 4NBCA 1S721 4RVFA 1YI21 3CC7Z 2QEXZ 1YJW1 2NVQI 5IT9b 3VTNA 5D1OA 1Y1VS 1QVFY 3NDJA 3CCVZ 3G6E1 1RO0A 2WB1A 4NB9A 2QRCB 2V8KA 5T6BA 1N8R2 1M1K1 4BBSI 4NFRA 1Z01A 1K83I 1RLYA 3G4S1 2RHBA 3S1QI 4NBGA 1Q811 4NBHA 2V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Z;  3CCL 1;  1VQ5 1;  1Q86 1;  1KD1 2;  1YJN 1;  1VQ9 Z;  3CC7 1;  2QEX 1;  3I56 1;  1QVG Y;  3CPW Z;  2OTJ Z;  1YJ9 1;  3CME Z;  1M90 2;  1YIT Z;  1K73 1;  1NJI 2;  1QVG Z;  3CCV 1;  3CCJ Z;  1KC8 2;  1M1K 2;  2OTL 1;  1VQ8 1;  1VQM Z;  2QA4 Z;  3CC4 Z;  3G71 Z;  3CCQ Z;  1JJ2 Z;  1VQ4 1;  3CCE Z;  1VQ7 Z;  3CC2 Z;  1Q86 2;  2QA4 1;  3CC4 1;  3CCS Z;  1W2B Y;  1S72 Z;  1VQL Z;  3CMA Z;  1YI2 Z;  1YJW Z;  1YHQ 1;  1Q82 1;  3CCM Z;  1W2B Z;  1VQ9 1;  1YIJ Z;  1K73 2;  3CD6 Z;  1VQ6 Z;  2OTJ 1;  3CME 1;  1VQN Z;  3CCU Z;  3CCR Z;  3I55 Z;  3CCM 1;  1YIT 1;  1Q81 2;  3CCJ 1;  3CD6 1;  1VQ6 1;  1VQN 1;  1VQK Z;  3CCU 1;  3CCR 1;  3I55 1;  1VQM 1;  1Q7Y 1;  3G71 1;  3G4S Z;  1VQO Z;  1N8R 1;  3CCQ 1;  1K9M 1;  1VQP Z;  3CCE 1;  1VQ7 1;  1Q82 2;  3CC2 1;  3CCL Z;  1VQ5 Z;  3CCS 1;  1S72 1;  1VQL 1;  1YI2 1;  3CMA 1;  3CC7 Z;  1K8A 1;  2QEX Z;  3I56 Z;  1YJW 1;  3G6E Z;  3OW2 Y;  1KD1 1;  1YIJ 1;  1QVF Y;  3CXC Y;  3CCV Z;  3OW2 Z;  3G6E 1;  1M90 1;  2OTL Z;  1QVF Z;  1Q7Y 2;  1VQ8 Z;  3CXC Z;  1NJI 1;  1KC8 1;  1N8R 2;  1KQS Y;  1K9M 2;  1M1K 1;  1VQK 1;  1VQ4 Z;  1YJN Z;  1JJ2 Y;  3G4S 1;  1VQO 1;  1KQS Z;  1Q81 1;  1K8A 2;  1YJ9 Z;  1VQP 1;  3CPW Y; 
#chains in the Genus database with same CATH topology
 3EED A;  2DE7 A;  1KD1 2;  1I3Q I;  4NH1 C;  1NP6 A;  1YJ9 1;  3QWU A;  4MRI A;  2F4O A;  2QRE B;  4HH4 A;  3EER A;  4BBR I;  2JR6 A;  1QVG Z;  1KC8 2;  4NB8 A;  3J7A 4;  2K5R A;  1I50 I;  1RO2 A;  1LQL A;  2M48 A;  2VPZ A;  4MD7 A;  2R6M A;  3FKI I;  4E31 A;  4RVG A;  3CCE Z;  1VQ7 Z;  1PFT A;  2QLV B;  4BXX I;  5IP9 I;  2QA4 1;  2AKL A;  3CC4 1;  4RS4 A;  1USP B;  2DE6 A;  3CMA Z;  5T67 A;  2NVX I;  1TWA I;  1YHQ 1;  2GTH A;  3GCF A;  4S1T A;  3CCM Z;  1W2B Z;  1VQ9 1;  1YIJ Z;  3MON A;  1WZN A;  2OTJ 1;  3CQZ I;  2NVT I;  3CME 1;  3JAM f;  2W04 A;  3GTM S;  3CCU Z;  4BY1 I;  3IF8 A;  1RQF A;  1Q81 2;  4BY7 I;  1WJ2 A;  5C4J I;  4E33 A;  3HOX I;  1ZB9 A;  2VPW A;  4A3D I;  3GTL I;  5A2Q f;  2YU9 I;  4A93 I;  4A3G I;  4Y52 I;  1N8R 1;  4E2X A;  4NBA A;  3CCQ 1;  2V3V A;  2R93 I;  5D1P A;  1QXF A;  1YUA A;  1Q82 2;  1VQ5 Z;  1VQL 1;  3RZD I;  3S15 I;  3TE5 B;  3I56 Z;  3P5J B;  1I6H I;  3ESW A;  1FDI A;  1KD1 1;  2VPX A;  3TDH B;  3JAM b;  2WAQ A;  2OTL Z;  2E7Z A;  2YAD A;  4E2W A;  4XX2 A;  4NBD A;  1KC8 1;  3H3V J;  2VPY A;  3S14 I;  1VQ4 Z;  2OOX B;  5A2Q b;  3VMG A;  2ZAE B;  4DGL A;  1ML8 A;  3J80 f;  3NDI A;  1VQP 1;  3CCL 1;  3MZK B;  3GTK I;  3D6W A;  1QF8 A;  1NUI A;  4NOZ A;  1QVG Y;  2LFU A;  2E2H I;  2GU2 A;  2B63 I;  2JIM A;  4A3B I;  1Z03 A;  2VUG A;  1VQ8 1;  1X3W A;  3G71 Z;  2JMO A;  2PMZ A;  2V45 A;  2HF1 A;  3S16 I;  2H85 A;  3J81 f;  3CC2 Z;  1JWH C;  1Q86 2;  3CCS Z;  1W2B Y;  3D9X A;  4HGZ A;  2Q51 A;  1S72 Z;  2HU9 A;  1YI2 Z;  3J80 b;  1YJW Z;  2G2K A;  1WCM I;  5C4X I;  1Q82 1;  2JA6 I;  1K73 2;  3GKQ A;  4HGY A;  1VQ6 Z;  2R92 I;  3Q87 A;  1DL6 A;  5AN9 F;  3KIF A;  2RPR A;  3BG0 B;  1WII A;  4AYB A;  2JA8 I;  2QRD B;  3I55 Z;  3CCR Z;  4RVD A;  3CCM 1;  1YIT 1;  4RV9 A;  3CCJ 1;  3GTQ I;  4RVH A;  3CCU 1;  1VQM 1;  3GTO I;  1SIW A;  3G4S Z;  3HOU I;  3F3P C;  4MD9 A;  3J81 b;  1N2F A;  2NAP A;  3HKZ A;  3KIH A;  1TWF I;  2O53 A;  3HOZ I;  5D1O B;  4X6A I;  3NH8 A;  3S1R I;  4CL1 A;  3PO3 S;  3OW2 Z;  3LUS A;  1YUK A;  1Q7Y 2;  2P28 A;  3GTM I;  1TWG I;  3CXC Z;  3M3Y I;  1K9M 2;  1FDO A;  4MON A;  3H0G I;  1VQK 1;  1YJN Z;  1VLA A;  2W03 A;  1VQO 1;  1KQS Z;  3S2H I;  1K8A 2;  2VF1 A;  3VB9 A;  4QTT A;  1YHQ Z;  2JIO A;  4A3K I;  4A3M I;  1Q86 1;  1VQ9 Z;  2Q4Z A;  4MD8 A;  3CC7 1;  2QEX 1;  1TWH I;  2K3R A;  3CPW Z;  2OTJ Z;  3CME Z;  5FLX f;  3NH5 A;  2IV2 X;  1M90 2;  3I07 A;  3RZO I;  3S2D I;  1K73 1;  1NJI 2;  5T64 A;  3CCV 1;  1WW9 A;  3IX0 A;  4A3J I;  2OOY B;  4NBB A;  2RT9 A;  3FQQ A;  4EWC A;  3CCQ Z;  3GTP I;  1VQL Z;  2JA5 I;  4QTU A;  2R7Z I;  1USP A;  3NH4 A;  4E30 A;  1Y1V I;  3CD6 Z;  2M6N A;  5LL6 f;  1VQN Z;  5FLX b;  1SFO I;  2P3Y A;  3FQM A;  3VMH A;  2Y0S A;  1X3Z A;  1VQ6 1;  4A3L I;  1ZB8 A;  3CCR 1;  3I55 1;  1Q7Y 1;  2EGT A;  2OZK A;  3F3F C;  5CM2 M;  1K9M 1;  1VQP Z;  2GTI A;  3HOW I;  4Y7N I;  2V8J A;  1TFI A;  3CCE 1;  1VQ7 1;  3PO2 I;  3CCL Z;  2IZ4 A;  2VUM I;  2JIQ A;  3CMA 1;  2JNY A;  2JUB A;  1K8A 1;  3G6E Z;  3OW2 Y;  3GTG I;  2JIP A;  2PM9 A;  3U50 C;  1YIJ 1;  2RBL A;  1X0T A;  3GTJ I;  3S17 I;  2QR1 B;  1KRL A;  2O4H A;  3CXC Y;  1ZH1 A;  2LIY A;  5FLM I;  5C3E I;  1M90 1;  3BG1 B;  1AA6 A;  1VQ8 Z;  1P9N A;  1QVF Z;  4MH4 A;  4NBE A;  4E2Z A;  3NFZ A;  1NJI 1;  2E9H A;  1KQS Y;  2J6A A;  2E2I I;  4A3E I;  1L1O C;  1JJ2 Y;  2KPI A;  3T4N B;  1YJ9 Z;  4A3F I;  3CPW Y;  4DK1 A;  3MZL B;  5IP7 I;  1VQ5 1;  1YJN 1;  2RIQ A;  3I56 1;  4E2Y A;  1R9T I;  2LEX A;  4A3C I;  3HOY I;  1YIT Z;  1Y1W I;  2DE5 A;  3CCJ Z;  3S1N I;  3K7A I;  2IZ3 A;  1M1K 2;  1RNI A;  3PO3 I;  2OTL 1;  2QKD A;  1VQM Z;  2QA4 Z;  3CC4 Z;  2JS4 A;  2JA7 I;  3S1M I;  3IFU A;  1JJ2 Z;  3VMI A;  1VQ4 1;  1Y8C A;  1Z02 A;  2KI7 B;  2JIR A;  5IT9 f;  2E2J I;  2I3C A;  3M4O I;  3IR7 A;  3I4N I;  4MXU A;  1S7M A;  2PK7 A;  3HOV I;  2NVY I;  3CD6 1;  1QYP A;  3I4M I;  1VQN 1;  2BJO A;  1VQK Z;  5C44 I;  2AYD A;  2F4M A;  1RO4 A;  3G71 1;  1VQO Z;  4DQY B;  4E32 A;  1Q16 A;  1TWC I;  4A3I I;  4TNU A;  3CC2 1;  3CCS 1;  4NBF A;  4NBC A;  1S72 1;  4RVF A;  1YI2 1;  3CC7 Z;  2QEX Z;  1YJW 1;  2NVQ I;  5IT9 b;  3VTN A;  5D1O A;  1Y1V S;  1QVF Y;  3NDJ A;  3CCV Z;  3G6E 1;  1RO0 A;  2WB1 A;  4NB9 A;  2QRC B;  2V8K A;  5T6B A;  1N8R 2;  1M1K 1;  4BBS I;  4NFR A;  1Z01 A;  1K83 I;  3D2L A;  1RLY A;  3G4S 1;  2RHB A;  3S1Q I;  4NBG A;  1Q81 1;  4NBH A;  2V8I A; 
#chains in the Genus database with same CATH homology
 3EED A;  2DE7 A;  1KD1 2;  1I3Q I;  4NH1 C;  1NP6 A;  1YJ9 1;  3QWU A;  4MRI A;  2F4O A;  2QRE B;  4HH4 A;  3EER A;  4BBR I;  2JR6 A;  1QVG Z;  1KC8 2;  4NB8 A;  3J7A 4;  2K5R A;  1I50 I;  1RO2 A;  1LQL A;  2M48 A;  4MD7 A;  2R6M A;  3FKI I;  4E31 A;  4RVG A;  3CCE Z;  1VQ7 Z;  1PFT A;  2QLV B;  4BXX I;  5IP9 I;  2QA4 1;  2AKL A;  3CC4 1;  4RS4 A;  1USP B;  2DE6 A;  3CMA Z;  5T67 A;  2NVX I;  1TWA I;  1YHQ 1;  2GTH A;  3GCF A;  4S1T A;  3CCM Z;  1W2B Z;  1VQ9 1;  1YIJ Z;  3MON A;  2OTJ 1;  3CQZ I;  2NVT I;  3CME 1;  3JAM f;  2W04 A;  3GTM S;  3CCU Z;  4BY1 I;  3IF8 A;  1RQF A;  1Q81 2;  4BY7 I;  5C4J I;  4E33 A;  3HOX I;  1ZB9 A;  4A3D I;  3GTL I;  5A2Q f;  2YU9 I;  4A93 I;  4A3G I;  4Y52 I;  1N8R 1;  4E2X A;  4NBA A;  3CCQ 1;  2R93 I;  5D1P A;  1YUA A;  1Q82 2;  1VQ5 Z;  1VQL 1;  3RZD I;  3S15 I;  3TE5 B;  3I56 Z;  3P5J B;  1I6H I;  3ESW A;  1KD1 1;  3TDH B;  3JAM b;  2WAQ A;  2OTL Z;  2YAD A;  4E2W A;  4XX2 A;  4NBD A;  1KC8 1;  3H3V J;  3S14 I;  1VQ4 Z;  2OOX B;  5A2Q b;  3VMG A;  2ZAE B;  4DGL A;  1ML8 A;  3J80 f;  3NDI A;  1VQP 1;  3CCL 1;  3MZK B;  3GTK I;  3D6W A;  1QF8 A;  1NUI A;  4NOZ A;  1QVG Y;  2LFU A;  2E2H I;  2GU2 A;  2B63 I;  4A3B I;  1Z03 A;  2VUG A;  1VQ8 1;  1X3W A;  3G71 Z;  2JMO A;  2PMZ A;  2HF1 A;  3S16 I;  2H85 A;  3J81 f;  3CC2 Z;  1JWH C;  1Q86 2;  3CCS Z;  1W2B Y;  3D9X A;  4HGZ A;  2Q51 A;  1S72 Z;  2HU9 A;  1YI2 Z;  3J80 b;  1YJW Z;  2G2K A;  1WCM I;  5C4X I;  1Q82 1;  2JA6 I;  1K73 2;  3GKQ A;  4HGY A;  1VQ6 Z;  2R92 I;  3Q87 A;  1DL6 A;  5AN9 F;  3KIF A;  2RPR A;  3BG0 B;  1WII A;  4AYB A;  2JA8 I;  2QRD B;  3I55 Z;  3CCR Z;  4RVD A;  3CCM 1;  1YIT 1;  4RV9 A;  3CCJ 1;  3GTQ I;  4RVH A;  3CCU 1;  1VQM 1;  3GTO I;  3G4S Z;  3HOU I;  3F3P C;  4MD9 A;  3J81 b;  1N2F A;  3HKZ A;  3KIH A;  1TWF I;  2O53 A;  3HOZ I;  5D1O B;  4X6A I;  3NH8 A;  3S1R I;  4CL1 A;  3PO3 S;  3OW2 Z;  3LUS A;  1YUK A;  1Q7Y 2;  2P28 A;  3GTM I;  1TWG I;  3CXC Z;  3M3Y I;  1K9M 2;  4MON A;  3H0G I;  1VQK 1;  1YJN Z;  1VLA A;  2W03 A;  1VQO 1;  1KQS Z;  3S2H I;  1K8A 2;  2VF1 A;  3VB9 A;  4QTT A;  1YHQ Z;  4A3K I;  4A3M I;  1Q86 1;  1VQ9 Z;  2Q4Z A;  4MD8 A;  3CC7 1;  2QEX 1;  1TWH I;  2K3R A;  3CPW Z;  2OTJ Z;  3CME Z;  5FLX f;  3NH5 A;  1M90 2;  3I07 A;  3RZO I;  3S2D I;  1K73 1;  1NJI 2;  5T64 A;  3CCV 1;  1WW9 A;  3IX0 A;  4A3J I;  2OOY B;  4NBB A;  2RT9 A;  3FQQ A;  4EWC A;  3CCQ Z;  3GTP I;  1VQL Z;  2JA5 I;  4QTU A;  2R7Z I;  1USP A;  3NH4 A;  4E30 A;  1Y1V I;  3CD6 Z;  2M6N A;  5LL6 f;  1VQN Z;  5FLX b;  1SFO I;  2P3Y A;  3FQM A;  3VMH A;  2Y0S A;  1X3Z A;  1VQ6 1;  4A3L I;  1ZB8 A;  3CCR 1;  3I55 1;  1Q7Y 1;  2EGT A;  2OZK A;  3F3F C;  5CM2 M;  1K9M 1;  1VQP Z;  2GTI A;  3HOW I;  4Y7N I;  2V8J A;  1TFI A;  3CCE 1;  1VQ7 1;  3PO2 I;  3CCL Z;  2IZ4 A;  2VUM I;  3CMA 1;  2JNY A;  2JUB A;  1K8A 1;  3G6E Z;  3OW2 Y;  3GTG I;  2PM9 A;  3U50 C;  1YIJ 1;  2RBL A;  1X0T A;  3GTJ I;  3S17 I;  2QR1 B;  1KRL A;  2O4H A;  3CXC Y;  1ZH1 A;  2LIY A;  5FLM I;  5C3E I;  1M90 1;  3BG1 B;  1QVF Z;  1VQ8 Z;  1P9N A;  4MH4 A;  4NBE A;  4E2Z A;  3NFZ A;  1NJI 1;  2E9H A;  1KQS Y;  2J6A A;  2E2I I;  4A3E I;  1L1O C;  1JJ2 Y;  2KPI A;  3T4N B;  1YJ9 Z;  4A3F I;  3CPW Y;  4DK1 A;  3MZL B;  5IP7 I;  1VQ5 1;  1YJN 1;  2RIQ A;  3I56 1;  4E2Y A;  1R9T I;  4A3C I;  3HOY I;  1YIT Z;  1Y1W I;  2DE5 A;  3CCJ Z;  3S1N I;  3K7A I;  2IZ3 A;  1M1K 2;  1RNI A;  3PO3 I;  2OTL 1;  2QKD A;  1VQM Z;  2QA4 Z;  3CC4 Z;  2JS4 A;  2JA7 I;  3S1M I;  3IFU A;  1JJ2 Z;  3VMI A;  1VQ4 1;  1Z02 A;  2KI7 B;  5IT9 f;  2E2J I;  2I3C A;  3M4O I;  3I4N I;  4MXU A;  1S7M A;  2PK7 A;  3HOV I;  2NVY I;  3CD6 1;  1QYP A;  3I4M I;  1VQN 1;  2BJO A;  1VQK Z;  5C44 I;  2F4M A;  1RO4 A;  3G71 1;  1VQO Z;  4DQY B;  4E32 A;  1TWC I;  4A3I I;  4TNU A;  3CC2 1;  3CCS 1;  4NBF A;  4NBC A;  1S72 1;  4RVF A;  1YI2 1;  3CC7 Z;  2QEX Z;  1YJW 1;  2NVQ I;  5IT9 b;  3VTN A;  5D1O A;  1Y1V S;  1QVF Y;  3NDJ A;  3CCV Z;  3G6E 1;  1RO0 A;  2WB1 A;  4NB9 A;  2QRC B;  2V8K A;  5T6B A;  1N8R 2;  1M1K 1;  4BBS I;  4NFR A;  1Z01 A;  1K83 I;  1RLY A;  3G4S 1;  2RHB A;  3S1Q I;  4NBG A;  1Q81 1;  4NBH A;  2V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...