2E2JI

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI02
4A3BI 1TWGI 2RBLA 5IP9I 3HOUI 3HOYI 2E2HI 3GTQI 3I4NI 3VB9A 4NBDA 1USPB 4QTTA 1NUIA 4A3KI 3S16I 2JA5I 4NBFA 2P3YA 2BJOA 3S1QI 3ESWA 4A3FI 3K7AI 3EERA 3LUSA 3S14I 3M3YI 3GTKI 3GTOI 3FKII 3Q87A 2F4OA 5C4XI 4BY1I 1I50I 3PO3I 1Y1VS 3GTMS 2DE5A 2F4MA 3GTLI 2JR6A 4XX2A 1I6HI 2E2JI 2PK7A 2JA6I 1K83I 1I3QI 3HOVI 2KPIA 3M4OI 4A3EI 2K5RA 1QYPA 2DE6A 4NB9A 3GTPI 3HOWI 3I07A 1PFTA 4NBGA 1X3ZA 5C3EI 3S1MI 3H3VJ 2R93I 3S1RI 3S2DI 4A3CI 1WW9A 3U50C 3PO2I 1ZB8A 5IP7I 1RO4A 4NBCA 2NVYI 2AKLA 3CQZI 3GTJI 3HOXI 1X3WA 2E2II 2DE7A 2JS4A 4NB8A 4A3II 4BY7I 3S2HI 4A3MI 2R7ZI 2JA7I 1WCMI 1ML8A 3S17I 1LQLA 1ZB9A 3H0GI 4BXXI 4Y7NI 1USPA 2NVTI 3GTGI 3S15I 1R9TI 4BBRI 1TWAI 3GTMI 3D6WA 2J6AA 4NBHA 4BBSI 2NVQI 5CM2M 1YUAA 3VMHA 2NVXI 3VMIA 5FLMI 4A3DI 3PO3S 1DL6A 4NBBA 2JNYA 3HOZI 4NBEA 1TWHI 4A3GI 4QTUA 4A3JI 2VUMI 5C4JI 3S1NI 2HF1A 3GCFA 4Y52I 1VLAA 2R92I 4NBAA 3GKQA 3VMGA 4X6AI 1Y1VI 3RZDI 2JA8I 3RZOI 4A3LI 1L1OC 1TFIA 1RLYA 1Y1WI 2B63I 3I4MI 1TWCI 2YU9I 5C44I 1SFOI 4A93I 4NOZA 1N2FA 1TWFI 4MH4A
chains in the Genus database with same CATH superfamily
4A3BI 1VQ6Z 2RBLA 3IFUA 3GTQI 3I4NI 3CCVZ 1Y8CA 1QF8A 4NBFA 3I551 3G6E1 4DQYB 3S1QI 3ESWA 3K7AI 3EERA 4HH4A 1SIWA 2RHBA 4RVDA 2OTLZ 4RV9A 3Q87A 2F4OA 5C4XI 1I50I 1JWHC 3GTLI 2JR6A 1I6HI 2E2JI 3CCEZ 5LL6f 2KPIA 4MD9A 3M4OI 1WJ2A 2JIQA 3CCQ1 1YJN1 4NB9A 1QVGY 3GTPI 2OTJ1 4NBGA 1X3ZA 2VF1A 3CC21 3S2DI 1VQPZ 2O53A 3U50C 3PO2I 1KRLA 1RO4A 4DGLA 3OW2Z 2AKLA 1VQLZ 1QVFY 3HOXI 3I56Z 4S1TA 2R7ZI 3S17I 1ZB9A 3CMA1 2NVTI 2QA4Z 2IZ4A 1TWAI 3D6WA 3I55Z 2J6AA 1N8R2 4NBHA 3CCL1 1Q862 2VUGA 3VMHA 1K8A1 2V8KA 3G71Z 1M902 1NJI1 1VQ61 1Q7Y2 4NBEA 3CCV1 2VUMI 3S1NI 2HF1A 2EGTA 3GCFA 2NAPA 2LEXA 3CPWY 4NBAA 1Y1VI 5T6BA 2OTL1 2JA8I 3KIHA 1L1OC 1TFIA 1VQ5Z 1YJ91 1VQKZ 2OTJZ 5T64A 1VQNZ 3CC2Z 3CCRZ 5C44I 3G4SZ 2JUBA 5IT9f 4MD8A 3TDHB 3FQMA 2JMOA 3CME1 1S721 3TE5B 2E2HI 3VB9A 1USPB 2VPWA 2P3YA 2BJOA 5D1OA 4A3FI 2OZKA 2Q4ZA 1Q16A 4RVGA 1VQP1 3GTKI 3M3YI 4BY1I 1VQL1 3I561 2DE5A 2F4MA 2M6NA 3QWUA 1VQ8Z 3VTNA 4XX2A 3BG0B 3J80f 2JA6I 3HOVI 4HGZA 4A3EI 2QA41 2K5RA 3HOWI 2QREB 3S1MI 1VQ9Z 1N8R1 4TNUA 3J80b 3S1RI 3CC71 2OOXB 1WW9A 1YJ9Z 1ZB8A 3BG1B 5IP7I 1Q861 3G711 1KD12 3GTJI 1X3WA 2GTHA 2RT9A 3OW2Y 1M901 4A3II 2V8JA 1Q7Y1 1WIIA 2JA7I 1WCMI 4MXUA 4E30A 2LIYA 2PMZA 3H0GI 3CXCZ 3CMEZ 1S72Z 3GTGI 2VPXA 4BBRI 1VQ51 1R9TI 2H85A 1VQK1 3F3PC 1VQN1 1Z03A 3P5JB 4RS4A 3FQQA 3CCR1 1QXFA 2JIOA 2NVQI 1RO2A 1X0TA 3G4S1 4DK1A 1Z02A 1K9M2 3VMIA 4A3DI 3PO3S 1RQFA 2IZ3A 3CCJZ 1TWHI 4A3GI 2E9HA 1Q812 4QTUA 3CD6Z 1KC82 5C4JI 2V8IA 1K732 1VLAA 1YJW1 4E2WA 1VQMZ 4CL1A 5A2Qf 1VQOZ 3IX0A 1Y1WI 5D1PA 2JIRA 2B63I 4HGYA 1VQ81 3CC7Z 2G2KA 1ZH1A 1TWFI 5A2Qb 2V45A 1Q822 3HOYI 3J7A4 2GTIA 4NBDA 4QTTA 3T4NB 1NUIA 2Q51A 2JA5I 2QLVB 1YI2Z 1AA6A 1VQ91 3LUSA 3S14I 3GTOI 4E32A 3FKII 3CC4Z 3PO3I 2K3RA 3F3FC 1KD11 3GTMS 2AYDA 2W03A 4NFRA 1VQ4Z 3J81f 2KI7B 2PK7A 1K83I 1I3QI 2V3VA 3NH5A 1QYPA 3IF8A 4NH1C 2QRCB 3I07A 1YJWZ 1PFTA 3J81b 2HU9A 5C3EI 3H3VJ 5IT9b 1KQSZ 2R93I 4A3CI 4E2XA 4E31A 2NVYI 1FDOA 1M1K2 3CCJ1 2QEX1 1K9M1 2E2II 4NB8A 3CD61 2ZAEB 2PM9A 2Y0SA 4A3MI 1KC81 4EWCA 1LQLA 3JAMf 1VQM1 1USPA 2WB1A 2R6MA 3CXCY 1VQO1 3GTMI 2JIMA 1YIT1 1YUKA 4BBSI 4MONA 3JAMb 1W2BZ 3NH8A 5FLMI 4RVFA 1VQ71 1DL6A 4NBBA 1YHQZ 3EEDA 1JJ2Z 2OOYB 1Q821 3NDIA 2LFUA 3HKZA 1YI21 2I3CA 3GKQA 1YIJZ 3VMGA 4A3LI 3CC41 1RLYA 1TWCI 3KIFA 3CCMZ 1VQ41 3CCUZ 4A93I 3NFZA 1N2FA 3MZKB 2QEXZ 2W04A 2P28A 1TWGI 2QR1B 5IP9I 3MZLB 3HOUI 4A3KI 3S16I 4RVHA 2M48A 3CCS1 1Y1VS 1YITZ 1M1K1 3MONA 5FLXf 1VQ7Z 1RNIA 5AN9F 1QVGZ 2DE6A 3G6EZ 3D9XA 5FLXb 1KQSY 1QVFZ 4NBCA 3CQZI 2VPYA 1YHQ1 4E2YA 2DE7A 2JS4A 3NH4A 4BY7I 3S2HI 1ML8A 3NDJA 1YIJ1 4BXXI 5D1OB 4Y7NI 2QRDB 1FDIA 3S15I 3CCQZ 1YJNZ 1Z01A 2RIQA 2GU2A 3D2LA 2QKDA 3CCM1 1WZNA 1RO0A 5CM2M 3CCSZ 3CCU1 1YUAA 2NVXI 3CCE1 2JNYA 1W2BY 3HOZI 5T67A 1Q811 1JJ2Y 4A3JI 2IV2X 3CPWZ 1P9NA 2JIPA 4Y52I 1K731 4MD7A 2R92I 4X6AI 2O4HA 3RZDI 2YADA 4E2ZA 3CMAZ 4MRIA 3RZOI 3IR7A 2E7ZA 3I4MI 1NP6A 3CCLZ 2YU9I 2WAQA 1SFOI 1K8A2 4NOZA 1NJI2 1S7MA 4E33A 2VPZA 4AYBA 2RPRA 4MH4A
chains in the Genus database with same CATH topology
4A3BI 1VQ6Z 2RBLA 3IFUA 3GTQI 3I4NI 3CCVZ 1QF8A 4NBFA 3I551 3G6E1 4DQYB 3S1QI 3ESWA 3K7AI 3EERA 4HH4A 2RHBA 4RVDA 2OTLZ 4RV9A 3Q87A 2F4OA 5C4XI 1I50I 1JWHC 3GTLI 2JR6A 1I6HI 2E2JI 3CCEZ 5LL6f 2KPIA 4MD9A 3M4OI 3CCQ1 1YJN1 4NB9A 1QVGY 3GTPI 2OTJ1 4NBGA 1X3ZA 2VF1A 3CC21 3S2DI 1VQPZ 2O53A 3U50C 3PO2I 1KRLA 1RO4A 4DGLA 3OW2Z 2AKLA 1VQLZ 1QVFY 3HOXI 3I56Z 4S1TA 2R7ZI 3S17I 1ZB9A 3CMA1 2NVTI 2QA4Z 2IZ4A 1TWAI 3D6WA 3I55Z 2J6AA 1N8R2 4NBHA 3CCL1 1Q862 2VUGA 3VMHA 1K8A1 2V8KA 3G71Z 1M902 1NJI1 1VQ61 1Q7Y2 4NBEA 3CCV1 2VUMI 3S1NI 2HF1A 2EGTA 3GCFA 3CPWY 4NBAA 1Y1VI 5T6BA 2OTL1 2JA8I 3KIHA 1L1OC 1TFIA 1VQ5Z 1YJ91 1VQKZ 2OTJZ 5T64A 1VQNZ 3CC2Z 3CCRZ 5C44I 3G4SZ 2JUBA 5IT9f 4MD8A 3TDHB 3FQMA 2JMOA 3CME1 1S721 3TE5B 2E2HI 3VB9A 1USPB 2P3YA 2BJOA 5D1OA 4A3FI 2OZKA 2Q4ZA 4RVGA 1VQP1 3GTKI 3M3YI 4BY1I 1VQL1 3I561 2DE5A 2F4MA 2M6NA 3QWUA 1VQ8Z 3VTNA 4XX2A 3BG0B 3J80f 2JA6I 3HOVI 4HGZA 4A3EI 2QA41 2K5RA 3HOWI 2QREB 3S1MI 1VQ9Z 1N8R1 4TNUA 3J80b 3S1RI 3CC71 2OOXB 1WW9A 1YJ9Z 1ZB8A 3BG1B 5IP7I 1Q861 3G711 1KD12 3GTJI 1X3WA 2GTHA 2RT9A 3OW2Y 1M901 4A3II 2V8JA 1Q7Y1 1WIIA 2JA7I 1WCMI 4MXUA 4E30A 2LIYA 2PMZA 3H0GI 3CXCZ 3CMEZ 1S72Z 3GTGI 1R9TI 4BBRI 1VQ51 2H85A 1VQK1 3F3PC 1VQN1 1Z03A 3P5JB 4RS4A 3FQQA 3CCR1 2NVQI 1RO2A 1X0TA 3G4S1 4DK1A 1Z02A 1K9M2 3VMIA 4A3DI 3PO3S 1RQFA 2IZ3A 3CCJZ 1TWHI 4A3GI 2E9HA 1Q812 4QTUA 3CD6Z 1KC82 5C4JI 2V8IA 1K732 1VLAA 1YJW1 4E2WA 1VQMZ 4CL1A 5A2Qf 1VQOZ 3IX0A 1Y1WI 5D1PA 2B63I 4HGYA 1VQ81 3CC7Z 2G2KA 1ZH1A 1TWFI 5A2Qb 1Q822 3HOYI 3J7A4 2GTIA 4NBDA 4QTTA 3T4NB 1NUIA 2Q51A 2JA5I 2QLVB 1YI2Z 1VQ91 3LUSA 3S14I 3GTOI 4E32A 3FKII 3CC4Z 3PO3I 2K3RA 3F3FC 1KD11 3GTMS 2W03A 4NFRA 1VQ4Z 3J81f 2KI7B 2PK7A 1K83I 1I3QI 3NH5A 1QYPA 3IF8A 4NH1C 2QRCB 3I07A 1YJWZ 1PFTA 3J81b 2HU9A 5C3EI 3H3VJ 5IT9b 1KQSZ 2R93I 4A3CI 4E2XA 4E31A 2NVYI 1M1K2 3CCJ1 2QEX1 1K9M1 2E2II 4NB8A 3CD61 2ZAEB 2PM9A 2Y0SA 4A3MI 1KC81 4EWCA 1LQLA 3JAMf 1VQM1 1USPA 2WB1A 2R6MA 3CXCY 1VQO1 3GTMI 1YIT1 1YUKA 4BBSI 4MONA 3JAMb 1W2BZ 3NH8A 5FLMI 4RVFA 1VQ71 1DL6A 4NBBA 1YHQZ 3EEDA 1JJ2Z 2OOYB 1Q821 3NDIA 2LFUA 3HKZA 1YI21 2I3CA 3GKQA 1YIJZ 3VMGA 4A3LI 3CC41 1RLYA 1TWCI 3KIFA 3CCMZ 1VQ41 3CCUZ 4A93I 3NFZA 1N2FA 3MZKB 2QEXZ 2W04A 2P28A 1TWGI 2QR1B 5IP9I 3MZLB 3HOUI 4A3KI 3S16I 4RVHA 2M48A 3CCS1 1Y1VS 1YITZ 1M1K1 3MONA 5FLXf 1VQ7Z 1RNIA 5AN9F 1QVGZ 2DE6A 3G6EZ 3D9XA 5FLXb 1KQSY 1QVFZ 4NBCA 3CQZI 1YHQ1 4E2YA 2DE7A 2JS4A 3NH4A 4BY7I 3S2HI 1ML8A 3NDJA 1YIJ1 4BXXI 5D1OB 4Y7NI 2QRDB 3S15I 3CCQZ 1YJNZ 1Z01A 2RIQA 2GU2A 2QKDA 3CCM1 1RO0A 5CM2M 3CCSZ 3CCU1 1YUAA 2NVXI 3CCE1 2JNYA 1W2BY 3HOZI 5T67A 1Q811 1JJ2Y 4A3JI 3CPWZ 1P9NA 4Y52I 1K731 4MD7A 2R92I 4X6AI 2O4HA 3RZDI 2YADA 4E2ZA 3CMAZ 4MRIA 3RZOI 3I4MI 1NP6A 3CCLZ 2YU9I 2WAQA 1SFOI 1K8A2 4NOZA 1NJI2 1S7MA 4E33A 4AYBA 2RPRA 4MH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B I;  1TWG I;  2RBL A;  5IP9 I;  3HOU I;  3HOY I;  2E2H I;  3GTQ I;  3I4N I;  3VB9 A;  4NBD A;  1USP B;  4QTT A;  1NUI A;  4A3K I;  3S16 I;  2JA5 I;  4NBF A;  2P3Y A;  2BJO A;  3S1Q I;  3ESW A;  4A3F I;  3K7A I;  3EER A;  3LUS A;  3S14 I;  3M3Y I;  3GTK I;  3GTO I;  3FKI I;  3Q87 A;  2F4O A;  5C4X I;  4BY1 I;  1I50 I;  3PO3 I;  1Y1V S;  3GTM S;  2DE5 A;  2F4M A;  3GTL I;  2JR6 A;  4XX2 A;  1I6H I;  2E2J I;  2PK7 A;  2JA6 I;  1K83 I;  1I3Q I;  3HOV I;  2KPI A;  3M4O I;  4A3E I;  2K5R A;  1QYP A;  2DE6 A;  4NB9 A;  3GTP I;  3HOW I;  3I07 A;  1PFT A;  4NBG A;  1X3Z A;  5C3E I;  3S1M I;  3H3V J;  2R93 I;  3S1R I;  3S2D I;  4A3C I;  1WW9 A;  3U50 C;  3PO2 I;  1ZB8 A;  5IP7 I;  1RO4 A;  4NBC A;  2NVY I;  2AKL A;  3CQZ I;  3GTJ I;  3HOX I;  1X3W A;  2E2I I;  2DE7 A;  2JS4 A;  4NB8 A;  4A3I I;  4BY7 I;  3S2H I;  4A3M I;  2R7Z I;  2JA7 I;  1WCM I;  1ML8 A;  3S17 I;  1LQL A;  1ZB9 A;  3H0G I;  4BXX I;  4Y7N I;  1USP A;  2NVT I;  3GTG I;  3S15 I;  1R9T I;  4BBR I;  1TWA I;  3GTM I;  3D6W A;  2J6A A;  4NBH A;  4BBS I;  2NVQ I;  5CM2 M;  1YUA A;  3VMH A;  2NVX I;  3VMI A;  5FLM I;  4A3D I;  3PO3 S;  1DL6 A;  4NBB A;  2JNY A;  3HOZ I;  4NBE A;  1TWH I;  4A3G I;  4QTU A;  4A3J I;  2VUM I;  5C4J I;  3S1N I;  2HF1 A;  3GCF A;  4Y52 I;  1VLA A;  2R92 I;  4NBA A;  3GKQ A;  3VMG A;  4X6A I;  1Y1V I;  3RZD I;  2JA8 I;  3RZO I;  4A3L I;  1L1O C;  1TFI A;  1RLY A;  1Y1W I;  2B63 I;  3I4M I;  1TWC I;  2YU9 I;  5C44 I;  1SFO I;  4A93 I;  4NOZ A;  1N2F A;  1TWF I;  4MH4 A; 
#chains in the Genus database with same CATH topology
 4A3B I;  1VQ6 Z;  2RBL A;  3IFU A;  3GTQ I;  3I4N I;  3CCV Z;  1Y8C A;  1QF8 A;  4NBF A;  3I55 1;  3G6E 1;  4DQY B;  3S1Q I;  3ESW A;  3K7A I;  3EER A;  4HH4 A;  1SIW A;  2RHB A;  4RVD A;  2OTL Z;  4RV9 A;  3Q87 A;  2F4O A;  5C4X I;  1I50 I;  1JWH C;  3GTL I;  2JR6 A;  1I6H I;  2E2J I;  3CCE Z;  5LL6 f;  2KPI A;  4MD9 A;  3M4O I;  1WJ2 A;  2JIQ A;  3CCQ 1;  1YJN 1;  4NB9 A;  1QVG Y;  3GTP I;  2OTJ 1;  4NBG A;  1X3Z A;  2VF1 A;  3CC2 1;  3S2D I;  1VQP Z;  2O53 A;  3U50 C;  3PO2 I;  1KRL A;  1RO4 A;  4DGL A;  3OW2 Z;  2AKL A;  1VQL Z;  1QVF Y;  3HOX I;  3I56 Z;  4S1T A;  2R7Z I;  3S17 I;  1ZB9 A;  3CMA 1;  2NVT I;  2QA4 Z;  2IZ4 A;  1TWA I;  3D6W A;  3I55 Z;  2J6A A;  1N8R 2;  4NBH A;  3CCL 1;  1Q86 2;  2VUG A;  3VMH A;  1K8A 1;  2V8K A;  3G71 Z;  1M90 2;  1NJI 1;  1VQ6 1;  1Q7Y 2;  4NBE A;  3CCV 1;  2VUM I;  3S1N I;  2HF1 A;  2EGT A;  3GCF A;  2NAP A;  2LEX A;  3CPW Y;  4NBA A;  1Y1V I;  5T6B A;  2OTL 1;  2JA8 I;  3KIH A;  1L1O C;  1TFI A;  1VQ5 Z;  1YJ9 1;  1VQK Z;  2OTJ Z;  5T64 A;  1VQN Z;  3CC2 Z;  3CCR Z;  5C44 I;  3G4S Z;  2JUB A;  5IT9 f;  4MD8 A;  3TDH B;  3FQM A;  2JMO A;  3CME 1;  1S72 1;  3TE5 B;  2E2H I;  3VB9 A;  1USP B;  2VPW A;  2P3Y A;  2BJO A;  5D1O A;  4A3F I;  2OZK A;  2Q4Z A;  1Q16 A;  4RVG A;  1VQP 1;  3GTK I;  3M3Y I;  4BY1 I;  1VQL 1;  3I56 1;  2DE5 A;  2F4M A;  2M6N A;  3QWU A;  1VQ8 Z;  3VTN A;  4XX2 A;  3BG0 B;  3J80 f;  2JA6 I;  3HOV I;  4HGZ A;  4A3E I;  2QA4 1;  2K5R A;  3HOW I;  2QRE B;  3S1M I;  1VQ9 Z;  1N8R 1;  4TNU A;  3J80 b;  3S1R I;  3CC7 1;  2OOX B;  1WW9 A;  1YJ9 Z;  1ZB8 A;  3BG1 B;  5IP7 I;  1Q86 1;  3G71 1;  1KD1 2;  3GTJ I;  1X3W A;  2GTH A;  2RT9 A;  3OW2 Y;  1M90 1;  4A3I I;  2V8J A;  1Q7Y 1;  1WII A;  2JA7 I;  1WCM I;  4MXU A;  4E30 A;  2LIY A;  2PMZ A;  3H0G I;  3CXC Z;  3CME Z;  1S72 Z;  3GTG I;  2VPX A;  4BBR I;  1VQ5 1;  1R9T I;  2H85 A;  1VQK 1;  3F3P C;  1VQN 1;  1Z03 A;  3P5J B;  4RS4 A;  3FQQ A;  3CCR 1;  1QXF A;  2JIO A;  2NVQ I;  1RO2 A;  1X0T A;  3G4S 1;  4DK1 A;  1Z02 A;  1K9M 2;  3VMI A;  4A3D I;  3PO3 S;  1RQF A;  2IZ3 A;  3CCJ Z;  1TWH I;  4A3G I;  2E9H A;  1Q81 2;  4QTU A;  3CD6 Z;  1KC8 2;  5C4J I;  2V8I A;  1K73 2;  1VLA A;  1YJW 1;  4E2W A;  1VQM Z;  4CL1 A;  5A2Q f;  1VQO Z;  3IX0 A;  1Y1W I;  5D1P A;  2JIR A;  2B63 I;  4HGY A;  1VQ8 1;  3CC7 Z;  2G2K A;  1ZH1 A;  1TWF I;  5A2Q b;  2V45 A;  1Q82 2;  3HOY I;  3J7A 4;  2GTI A;  4NBD A;  4QTT A;  3T4N B;  1NUI A;  2Q51 A;  2JA5 I;  2QLV B;  1YI2 Z;  1AA6 A;  1VQ9 1;  3LUS A;  3S14 I;  3GTO I;  4E32 A;  3FKI I;  3CC4 Z;  3PO3 I;  2K3R A;  3F3F C;  1KD1 1;  3GTM S;  2AYD A;  2W03 A;  4NFR A;  1VQ4 Z;  3J81 f;  2KI7 B;  2PK7 A;  1K83 I;  1I3Q I;  2V3V A;  3NH5 A;  1QYP A;  3IF8 A;  4NH1 C;  2QRC B;  3I07 A;  1YJW Z;  1PFT A;  3J81 b;  2HU9 A;  5C3E I;  3H3V J;  5IT9 b;  1KQS Z;  2R93 I;  4A3C I;  4E2X A;  4E31 A;  2NVY I;  1FDO A;  1M1K 2;  3CCJ 1;  2QEX 1;  1K9M 1;  2E2I I;  4NB8 A;  3CD6 1;  2ZAE B;  2PM9 A;  2Y0S A;  4A3M I;  1KC8 1;  4EWC A;  1LQL A;  3JAM f;  1VQM 1;  1USP A;  2WB1 A;  2R6M A;  3CXC Y;  1VQO 1;  3GTM I;  2JIM A;  1YIT 1;  1YUK A;  4BBS I;  4MON A;  3JAM b;  1W2B Z;  3NH8 A;  5FLM I;  4RVF A;  1VQ7 1;  1DL6 A;  4NBB A;  1YHQ Z;  3EED A;  1JJ2 Z;  2OOY B;  1Q82 1;  3NDI A;  2LFU A;  3HKZ A;  1YI2 1;  2I3C A;  3GKQ A;  1YIJ Z;  3VMG A;  4A3L I;  3CC4 1;  1RLY A;  1TWC I;  3KIF A;  3CCM Z;  1VQ4 1;  3CCU Z;  4A93 I;  3NFZ A;  1N2F A;  3MZK B;  2QEX Z;  2W04 A;  2P28 A;  1TWG I;  2QR1 B;  5IP9 I;  3MZL B;  3HOU I;  4A3K I;  3S16 I;  4RVH A;  2M48 A;  3CCS 1;  1Y1V S;  1YIT Z;  1M1K 1;  3MON A;  5FLX f;  1VQ7 Z;  1RNI A;  5AN9 F;  1QVG Z;  2DE6 A;  3G6E Z;  3D9X A;  5FLX b;  1KQS Y;  1QVF Z;  4NBC A;  3CQZ I;  2VPY A;  1YHQ 1;  4E2Y A;  2DE7 A;  2JS4 A;  3NH4 A;  4BY7 I;  3S2H I;  1ML8 A;  3NDJ A;  1YIJ 1;  4BXX I;  5D1O B;  4Y7N I;  2QRD B;  1FDI A;  3S15 I;  3CCQ Z;  1YJN Z;  1Z01 A;  2RIQ A;  2GU2 A;  3D2L A;  2QKD A;  3CCM 1;  1WZN A;  1RO0 A;  5CM2 M;  3CCS Z;  3CCU 1;  1YUA A;  2NVX I;  3CCE 1;  2JNY A;  1W2B Y;  3HOZ I;  5T67 A;  1Q81 1;  1JJ2 Y;  4A3J I;  2IV2 X;  3CPW Z;  1P9N A;  2JIP A;  4Y52 I;  1K73 1;  4MD7 A;  2R92 I;  4X6A I;  2O4H A;  3RZD I;  2YAD A;  4E2Z A;  3CMA Z;  4MRI A;  3RZO I;  3IR7 A;  2E7Z A;  3I4M I;  1NP6 A;  3CCL Z;  2YU9 I;  2WAQ A;  1SFO I;  1K8A 2;  4NOZ A;  1NJI 2;  1S7M A;  4E33 A;  2VPZ A;  4AYB A;  2RPR A;  4MH4 A; 
#chains in the Genus database with same CATH homology
 4A3B I;  1VQ6 Z;  2RBL A;  3IFU A;  3GTQ I;  3I4N I;  3CCV Z;  1QF8 A;  4NBF A;  3I55 1;  3G6E 1;  4DQY B;  3S1Q I;  3ESW A;  3K7A I;  3EER A;  4HH4 A;  2RHB A;  4RVD A;  2OTL Z;  4RV9 A;  3Q87 A;  2F4O A;  5C4X I;  1I50 I;  1JWH C;  3GTL I;  2JR6 A;  1I6H I;  2E2J I;  3CCE Z;  5LL6 f;  2KPI A;  4MD9 A;  3M4O I;  3CCQ 1;  1YJN 1;  4NB9 A;  1QVG Y;  3GTP I;  2OTJ 1;  4NBG A;  1X3Z A;  2VF1 A;  3CC2 1;  3S2D I;  1VQP Z;  2O53 A;  3U50 C;  3PO2 I;  1KRL A;  1RO4 A;  4DGL A;  3OW2 Z;  2AKL A;  1VQL Z;  1QVF Y;  3HOX I;  3I56 Z;  4S1T A;  2R7Z I;  3S17 I;  1ZB9 A;  3CMA 1;  2NVT I;  2QA4 Z;  2IZ4 A;  1TWA I;  3D6W A;  3I55 Z;  2J6A A;  1N8R 2;  4NBH A;  3CCL 1;  1Q86 2;  2VUG A;  3VMH A;  1K8A 1;  2V8K A;  3G71 Z;  1M90 2;  1NJI 1;  1VQ6 1;  1Q7Y 2;  4NBE A;  3CCV 1;  2VUM I;  3S1N I;  2HF1 A;  2EGT A;  3GCF A;  3CPW Y;  4NBA A;  1Y1V I;  5T6B A;  2OTL 1;  2JA8 I;  3KIH A;  1L1O C;  1TFI A;  1VQ5 Z;  1YJ9 1;  1VQK Z;  2OTJ Z;  5T64 A;  1VQN Z;  3CC2 Z;  3CCR Z;  5C44 I;  3G4S Z;  2JUB A;  5IT9 f;  4MD8 A;  3TDH B;  3FQM A;  2JMO A;  3CME 1;  1S72 1;  3TE5 B;  2E2H I;  3VB9 A;  1USP B;  2P3Y A;  2BJO A;  5D1O A;  4A3F I;  2OZK A;  2Q4Z A;  4RVG A;  1VQP 1;  3GTK I;  3M3Y I;  4BY1 I;  1VQL 1;  3I56 1;  2DE5 A;  2F4M A;  2M6N A;  3QWU A;  1VQ8 Z;  3VTN A;  4XX2 A;  3BG0 B;  3J80 f;  2JA6 I;  3HOV I;  4HGZ A;  4A3E I;  2QA4 1;  2K5R A;  3HOW I;  2QRE B;  3S1M I;  1VQ9 Z;  1N8R 1;  4TNU A;  3J80 b;  3S1R I;  3CC7 1;  2OOX B;  1WW9 A;  1YJ9 Z;  1ZB8 A;  3BG1 B;  5IP7 I;  1Q86 1;  3G71 1;  1KD1 2;  3GTJ I;  1X3W A;  2GTH A;  2RT9 A;  3OW2 Y;  1M90 1;  4A3I I;  2V8J A;  1Q7Y 1;  1WII A;  2JA7 I;  1WCM I;  4MXU A;  4E30 A;  2LIY A;  2PMZ A;  3H0G I;  3CXC Z;  3CME Z;  1S72 Z;  3GTG I;  1R9T I;  4BBR I;  1VQ5 1;  2H85 A;  1VQK 1;  3F3P C;  1VQN 1;  1Z03 A;  3P5J B;  4RS4 A;  3FQQ A;  3CCR 1;  2NVQ I;  1RO2 A;  1X0T A;  3G4S 1;  4DK1 A;  1Z02 A;  1K9M 2;  3VMI A;  4A3D I;  3PO3 S;  1RQF A;  2IZ3 A;  3CCJ Z;  1TWH I;  4A3G I;  2E9H A;  1Q81 2;  4QTU A;  3CD6 Z;  1KC8 2;  5C4J I;  2V8I A;  1K73 2;  1VLA A;  1YJW 1;  4E2W A;  1VQM Z;  4CL1 A;  5A2Q f;  1VQO Z;  3IX0 A;  1Y1W I;  5D1P A;  2B63 I;  4HGY A;  1VQ8 1;  3CC7 Z;  2G2K A;  1ZH1 A;  1TWF I;  5A2Q b;  1Q82 2;  3HOY I;  3J7A 4;  2GTI A;  4NBD A;  4QTT A;  3T4N B;  1NUI A;  2Q51 A;  2JA5 I;  2QLV B;  1YI2 Z;  1VQ9 1;  3LUS A;  3S14 I;  3GTO I;  4E32 A;  3FKI I;  3CC4 Z;  3PO3 I;  2K3R A;  3F3F C;  1KD1 1;  3GTM S;  2W03 A;  4NFR A;  1VQ4 Z;  3J81 f;  2KI7 B;  2PK7 A;  1K83 I;  1I3Q I;  3NH5 A;  1QYP A;  3IF8 A;  4NH1 C;  2QRC B;  3I07 A;  1YJW Z;  1PFT A;  3J81 b;  2HU9 A;  5C3E I;  3H3V J;  5IT9 b;  1KQS Z;  2R93 I;  4A3C I;  4E2X A;  4E31 A;  2NVY I;  1M1K 2;  3CCJ 1;  2QEX 1;  1K9M 1;  2E2I I;  4NB8 A;  3CD6 1;  2ZAE B;  2PM9 A;  2Y0S A;  4A3M I;  1KC8 1;  4EWC A;  1LQL A;  3JAM f;  1VQM 1;  1USP A;  2WB1 A;  2R6M A;  3CXC Y;  1VQO 1;  3GTM I;  1YIT 1;  1YUK A;  4BBS I;  4MON A;  3JAM b;  1W2B Z;  3NH8 A;  5FLM I;  4RVF A;  1VQ7 1;  1DL6 A;  4NBB A;  1YHQ Z;  3EED A;  1JJ2 Z;  2OOY B;  1Q82 1;  3NDI A;  2LFU A;  3HKZ A;  1YI2 1;  2I3C A;  3GKQ A;  1YIJ Z;  3VMG A;  4A3L I;  3CC4 1;  1RLY A;  1TWC I;  3KIF A;  3CCM Z;  1VQ4 1;  3CCU Z;  4A93 I;  3NFZ A;  1N2F A;  3MZK B;  2QEX Z;  2W04 A;  2P28 A;  1TWG I;  2QR1 B;  5IP9 I;  3MZL B;  3HOU I;  4A3K I;  3S16 I;  4RVH A;  2M48 A;  3CCS 1;  1Y1V S;  1YIT Z;  1M1K 1;  3MON A;  5FLX f;  1VQ7 Z;  1RNI A;  5AN9 F;  1QVG Z;  2DE6 A;  3G6E Z;  3D9X A;  5FLX b;  1KQS Y;  1QVF Z;  4NBC A;  3CQZ I;  1YHQ 1;  4E2Y A;  2DE7 A;  2JS4 A;  3NH4 A;  4BY7 I;  3S2H I;  1ML8 A;  3NDJ A;  1YIJ 1;  4BXX I;  5D1O B;  4Y7N I;  2QRD B;  3S15 I;  3CCQ Z;  1YJN Z;  1Z01 A;  2RIQ A;  2GU2 A;  2QKD A;  3CCM 1;  1RO0 A;  5CM2 M;  3CCS Z;  3CCU 1;  1YUA A;  2NVX I;  3CCE 1;  2JNY A;  1W2B Y;  3HOZ I;  5T67 A;  1Q81 1;  1JJ2 Y;  4A3J I;  3CPW Z;  1P9N A;  4Y52 I;  1K73 1;  4MD7 A;  2R92 I;  4X6A I;  2O4H A;  3RZD I;  2YAD A;  4E2Z A;  3CMA Z;  4MRI A;  3RZO I;  3I4M I;  1NP6 A;  3CCL Z;  2YU9 I;  2WAQ A;  1SFO I;  1K8A 2;  4NOZ A;  1NJI 2;  1S7M A;  4E33 A;  4AYB A;  2RPR A;  4MH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...