2E2JI

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI02
4XX2A 2PK7A 3GTGI 1WCMI 3K7AI 4NOZA 3Q87A 1Y1VI 3PO2I 3GTMS 3H0GI 4NB8A 2VUMI 5IP7I 2JA7I 1L1OC 1YUAA 2JS4A 3GTLI 4BBRI 2R92I 1DL6A 1TWFI 3U50C 5C4XI 3EERA 2DE5A 3GCFA 5C44I 3ESWA 4NBDA 5CM2M 2NVXI 3S1QI 4A3EI 4A3CI 1TWAI 4X6AI 1Y1VS 4NBBA 1TFIA 2F4MA 3D6WA 2NVQI 2F4OA 3GTQI 3GTJI 3H3VJ 1NUIA 2R7ZI 1SFOI 1LQLA 2JA5I 1QYPA 4NBHA 1K83I 1PFTA 4Y52I 4A3FI 3HOZI 1USPA 5FLMI 1I3QI 2E2JI 3M4OI 3LUSA 3HOYI 3S14I 2DE6A 3I4NI 3S16I 3VMHA 3S17I 3PO3S 4QTUA 1RO4A 1USPB 1R9TI 4A3KI 2JNYA 3GTMI 4A93I 1N2FA 2J6AA 2NVYI 2R93I 5IP9I 2HF1A 1X3WA 3GTPI 3S15I 1VLAA 4NBFA 5C4JI 3I4MI 3HOWI 4BY1I 4A3GI 4A3LI 2NVTI 4A3MI 3GTKI 1TWCI 3S1NI 2B63I 4A3II 1RLYA 1TWHI 4QTTA 3PO3I 4A3BI 4MH4A 2BJOA 3FKII 2KPIA 1WW9A 3RZDI 5C3EI 3S2DI 3S1MI 1ZB8A 4A3DI 1I6HI 2RBLA 1Y1WI 4NBAA 4NBEA 3GTOI 2JR6A 2K5RA 4NB9A 2YU9I 3RZOI 3M3YI 2P3YA 3HOVI 3VMIA 3S2HI 4NBGA 4BY7I 1TWGI 4A3JI 2JA6I 1I50I 3VMGA 2DE7A 3HOXI 3I07A 3S1RI 2JA8I 3CQZI 1ML8A 2E2HI 3GKQA 2AKLA 4Y7NI 1X3ZA 1ZB9A 4NBCA 4BXXI 3VB9A 2E2II 4BBSI 3HOUI
chains in the Genus database with same CATH superfamily
3CC21 3K7AI 3PO2I 3CCL1 3H0GI 3OW2Z 1L1OC 3KIHA 1QVFZ 1NJI2 2P28A 4E2ZA 2R92I 1DL6A 4EWCA 4E2YA 2GTHA 3CCQZ 5AN9F 2O4HA 3GCFA 1YJW1 1VQ6Z 1P9NA 2GU2A 2M6NA 4HGYA 3NFZA 2F4OA 4DK1A 3CCRZ 2QR1B 3CCJ1 1YJNZ 3H3VJ 2R7ZI 1YJ91 1SFOI 1M1K1 1YJ9Z 1QVGZ 1K83I 3FQQA 3M4OI 3F3FC 2VPXA 3IFUA 3S17I 3I4NI 2RHBA 3PO3S 4QTUA 1RO4A 4E32A 4RVFA 4A3KI 4MD7A 1YIJZ 4A93I 3CCMZ 2J6AA 5IP9I 4HGZA 1VLAA 5C4JI 3I4MI 3G6E1 2PMZA 3CXCY 4BY1I 4E2XA 3CCLZ 4A3GI 5IT9f 3IR7A 1TWCI 3S1NI 2B63I 3EEDA 3CCE1 3I55Z 4RVHA 1WW9A 3RZDI 3MONA 5C3EI 1VQ4Z 3D2LA 1WZNA 4A3DI 3CC7Z 1VQ91 4NBAA 4RVDA 2V45A 2LEXA 3CCU1 2IZ3A 1I50I 1KQSZ 3I07A 3F3PC 1X3ZA 1K9M2 4MD9A 2E2II 2PK7A 1SIWA 2YADA 1FDIA 3J80f 1RO2A 3G71Z 3Q87A 1Y1VI 4DQYB 1YHQ1 2M48A 4NB8A 4NFRA 3CCR1 2VUMI 1YI2Z 1Z03A 1Q7Y1 3P5JB 3TE5B 3G711 2RIQA 3I561 3FQMA 4AYBA 3EERA 2NAPA 1VQ9Z 1YIT1 2W04A 2OTJZ 3CMAZ 3S1QI 1VQ8Z 4E30A 2QREB 1Y1VS 1VQMZ 1VQ41 2F4MA 3NDIA 2NVQI 1RNIA 2K3RA 2LFUA 3GTQI 3GTJI 3MZLB 2JA5I 5T67A 1Q822 4NBHA 2GTIA 3CD6Z 4Y52I 1VQL1 5FLMI 2V8KA 3HKZA 1QVGY 1YITZ 2OTJ1 2WB1A 3S16I 1RO0A 2G2KA 2JMOA 2AYDA 3CC4Z 2QEXZ 2JNYA 2NVYI 1Q812 1K732 2R93I 2JIRA 1X3WA 3S15I 1RQFA 4S1TA 1VQ7Z 2JIMA 2QLVB 3J7A4 1JJ2Z 1RLYA 3I56Z 3NH5A 2JIOA 4MONA 1VQM1 3J80b 2V8IA 1YI21 4MH4A 1QXFA 2QKDA 1FDOA 2R6MA 1NP6A 1W2BY 3J81f 2H85A 3NH4A 1M901 3CC71 4MD8A 2YU9I 1VQLZ 2OOXB 1KQSY 1TWGI 4A3JI 2JA6I 2IZ4A 1K8A1 5T64A 3S1RI 3IX0A 2I3CA 2V8JA 3CQZI 3CC41 2QA41 1ML8A 2E2HI 4NBCA 4BXXI 1YIJ1 3CMA1 1K9M1 3GTGI 1WCMI 2ZAEB 3CCVZ 3G6EZ 3CCUZ 5D1OA 1Y8CA 3I551 3D9XA 1VQNZ 2V3VA 1YUAA 2Q4ZA 2LIYA 4E33A 1TWFI 5C4XI 1VQPZ 2RT9A 2JIQA 3ESWA 3CCS1 2JIPA 5CM2M 1AA6A 4A3EI 4A3CI 4X6AI 3BG1B 4NBBA 1K731 3CCEZ 1KD11 4RVGA 2VUGA 1NUIA 3CCJZ 3T4NB 3IF8A 1M1K2 3G4SZ 1QYPA 1PFTA 4A3FI 3HOZI 2E9HA 1S721 3BG0B 1ZH1A 3VMHA 2OOYB 4RV9A 3CME1 2KI7B 1USPB 3GTMI 5A2Qf 1N2FA 1KC81 4MXUA 1Q7Y2 3HOWI 4TNUA 2Q51A 4A3LI 2NVTI 3JAMf 1M902 1N8R1 3CPWZ 4A3II 3KIFA 1TWHI 4QTTA 3PO3I 3OW2Y 1VQN1 1JJ2Y 2W03A 2VF1A 2KPIA 1K8A2 1VQ5Z 2HU9A 5A2Qb 1VQOZ 1ZB8A 3MZKB 1I6HI 2RBLA 1Y1WI 1VQ81 1YUKA 1W2BZ 4NBEA 3GTOI 4NH1C 2K5RA 3JAMb 3RZOI 3S2HI 3HOVI 3VMIA 4NBGA 4BY7I 1Z01A 4E2WA 3CC2Z 3CCM1 3HOXI 1Z02A 2JA8I 1WJ2A 3J81b 1YHQZ 2AKLA 4Y7NI 2VPWA 4BBSI 3HOUI 4RS4A 4XX2A 5T6BA 2OTL1 1N8R2 3NH8A 4NOZA 3GTMS 1VQP1 2IV2X 5IP7I 2JA7I 2JS4A 2PM9A 3GTLI 4BBRI 1Q811 2OTLZ 3U50C 3CPWY 1VQKZ 1QF8A 2DE5A 2EGTA 5C44I 4NBDA 4CL1A 2NVXI 1TWAI 3TDHB 1VQ51 1TFIA 3D6WA 1KC82 2E7ZA 1LQLA 1YJWZ 1USPA 1I3QI 2OZKA 2E2JI 3LUSA 3HOYI 3CD61 3S14I 2DE6A 2QA4Z 1S72Z 2O53A 5FLXf 5D1PA 1R9TI 2QRCB 3NDJA 5D1OB 4MRIA 2HF1A 1KRLA 2JUBA 3GTPI 4NBFA 3G4S1 1X0TA 2Y0SA 3CMEZ 1QVFY 4A3MI 1WIIA 4HH4A 1Q861 3GTKI 1S7MA 3QWUA 1NJI1 4A3BI 1Q16A 1Q821 1JWHC 2BJOA 3FKII 1KD12 1YJN1 5FLXb 3S2DI 2VPYA 3S1MI 1VQK1 2QEX1 1Q862 4DGLA 5LL6f 3CCSZ 2VPZA 1VQ61 1VQ71 1VQO1 2JR6A 4NB9A 3M3YI 3CCQ1 2P3YA 2QRDB 3VMGA 2DE7A 5IT9b 3CCV1 3VTNA 4E31A 3GKQA 1ZB9A 3VB9A 2RPRA 2WAQA 3CXCZ
chains in the Genus database with same CATH topology
3CC21 3K7AI 3PO2I 3CCL1 3H0GI 3OW2Z 1L1OC 3KIHA 1QVFZ 1NJI2 2P28A 4E2ZA 2R92I 1DL6A 4EWCA 4E2YA 2GTHA 3CCQZ 5AN9F 2O4HA 3GCFA 1YJW1 1VQ6Z 1P9NA 2GU2A 2M6NA 4HGYA 3NFZA 2F4OA 4DK1A 3CCRZ 2QR1B 3CCJ1 1YJNZ 3H3VJ 2R7ZI 1YJ91 1SFOI 1M1K1 1YJ9Z 1QVGZ 1K83I 3FQQA 3M4OI 3F3FC 3IFUA 3S17I 3I4NI 2RHBA 3PO3S 4QTUA 1RO4A 4E32A 4RVFA 4A3KI 4MD7A 1YIJZ 4A93I 3CCMZ 2J6AA 5IP9I 4HGZA 1VLAA 5C4JI 3I4MI 3G6E1 2PMZA 3CXCY 4BY1I 4E2XA 3CCLZ 4A3GI 5IT9f 1TWCI 3S1NI 2B63I 3EEDA 3CCE1 3I55Z 4RVHA 1WW9A 3RZDI 3MONA 5C3EI 1VQ4Z 4A3DI 3CC7Z 1VQ91 4NBAA 4RVDA 3CCU1 2IZ3A 1I50I 1KQSZ 3I07A 3F3PC 1X3ZA 1K9M2 4MD9A 2E2II 2PK7A 2YADA 3J80f 1RO2A 3G71Z 3Q87A 1Y1VI 4DQYB 1YHQ1 2M48A 4NB8A 4NFRA 3CCR1 2VUMI 1YI2Z 1Z03A 1Q7Y1 3P5JB 3TE5B 3G711 2RIQA 3I561 3FQMA 4AYBA 3EERA 1VQ9Z 1YIT1 2W04A 2OTJZ 3CMAZ 3S1QI 1VQ8Z 4E30A 2QREB 1Y1VS 1VQMZ 1VQ41 2F4MA 3NDIA 2NVQI 1RNIA 2K3RA 2LFUA 3GTQI 3GTJI 3MZLB 2JA5I 5T67A 1Q822 4NBHA 2GTIA 3CD6Z 4Y52I 1VQL1 5FLMI 2V8KA 3HKZA 1QVGY 1YITZ 2OTJ1 2WB1A 3S16I 1RO0A 2G2KA 2JMOA 3CC4Z 2QEXZ 2JNYA 2NVYI 1Q812 1K732 2R93I 1X3WA 3S15I 1RQFA 4S1TA 1VQ7Z 2QLVB 3J7A4 1JJ2Z 1RLYA 3I56Z 3NH5A 4MONA 1VQM1 3J80b 2V8IA 1YI21 4MH4A 2QKDA 2R6MA 1NP6A 1W2BY 3J81f 2H85A 3NH4A 1M901 3CC71 4MD8A 2YU9I 1VQLZ 2OOXB 1KQSY 1TWGI 4A3JI 2JA6I 2IZ4A 1K8A1 5T64A 3S1RI 3IX0A 2I3CA 2V8JA 3CQZI 3CC41 2QA41 1ML8A 2E2HI 4NBCA 4BXXI 1YIJ1 3CMA1 1K9M1 3GTGI 1WCMI 2ZAEB 3CCVZ 3G6EZ 3CCUZ 5D1OA 3I551 3D9XA 1VQNZ 1YUAA 2Q4ZA 2LIYA 4E33A 1TWFI 5C4XI 1VQPZ 2RT9A 3ESWA 3CCS1 5CM2M 4A3EI 4A3CI 4X6AI 3BG1B 4NBBA 1K731 3CCEZ 1KD11 4RVGA 2VUGA 1NUIA 3CCJZ 3T4NB 3IF8A 1M1K2 3G4SZ 1QYPA 1PFTA 4A3FI 3HOZI 2E9HA 1S721 3BG0B 1ZH1A 3VMHA 2OOYB 4RV9A 3CME1 2KI7B 1USPB 3GTMI 5A2Qf 1N2FA 1KC81 4MXUA 1Q7Y2 3HOWI 4TNUA 2Q51A 4A3LI 2NVTI 3JAMf 1M902 1N8R1 3CPWZ 4A3II 3KIFA 1TWHI 4QTTA 3PO3I 3OW2Y 1VQN1 1JJ2Y 2W03A 2VF1A 2KPIA 1K8A2 1VQ5Z 2HU9A 5A2Qb 1VQOZ 1ZB8A 3MZKB 1I6HI 2RBLA 1Y1WI 1VQ81 1YUKA 1W2BZ 4NBEA 3GTOI 4NH1C 2K5RA 3JAMb 3RZOI 3S2HI 3HOVI 3VMIA 4NBGA 4BY7I 1Z01A 4E2WA 3CC2Z 3CCM1 3HOXI 1Z02A 2JA8I 3J81b 1YHQZ 2AKLA 4Y7NI 4BBSI 3HOUI 4RS4A 4XX2A 5T6BA 2OTL1 1N8R2 3NH8A 4NOZA 3GTMS 1VQP1 5IP7I 2JA7I 2JS4A 2PM9A 3GTLI 4BBRI 1Q811 2OTLZ 3U50C 3CPWY 1VQKZ 1QF8A 2DE5A 2EGTA 5C44I 4NBDA 4CL1A 2NVXI 1TWAI 3TDHB 1VQ51 1TFIA 3D6WA 1KC82 1LQLA 1YJWZ 1USPA 1I3QI 2OZKA 2E2JI 3LUSA 3HOYI 3CD61 3S14I 2DE6A 2QA4Z 1S72Z 2O53A 5FLXf 5D1PA 1R9TI 2QRCB 3NDJA 5D1OB 4MRIA 2HF1A 1KRLA 2JUBA 3GTPI 4NBFA 3G4S1 1X0TA 2Y0SA 3CMEZ 1QVFY 4A3MI 1WIIA 4HH4A 1Q861 3GTKI 1S7MA 3QWUA 1NJI1 4A3BI 1Q821 1JWHC 2BJOA 3FKII 1KD12 1YJN1 5FLXb 3S2DI 3S1MI 1VQK1 2QEX1 1Q862 4DGLA 5LL6f 3CCSZ 1VQ61 1VQ71 1VQO1 2JR6A 4NB9A 3M3YI 3CCQ1 2P3YA 2QRDB 3VMGA 2DE7A 5IT9b 3CCV1 3VTNA 4E31A 3GKQA 1ZB9A 3VB9A 2RPRA 2WAQA 3CXCZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX2 A;  2PK7 A;  3GTG I;  1WCM I;  3K7A I;  4NOZ A;  3Q87 A;  1Y1V I;  3PO2 I;  3GTM S;  3H0G I;  4NB8 A;  2VUM I;  5IP7 I;  2JA7 I;  1L1O C;  1YUA A;  2JS4 A;  3GTL I;  4BBR I;  2R92 I;  1DL6 A;  1TWF I;  3U50 C;  5C4X I;  3EER A;  2DE5 A;  3GCF A;  5C44 I;  3ESW A;  4NBD A;  5CM2 M;  2NVX I;  3S1Q I;  4A3E I;  4A3C I;  1TWA I;  4X6A I;  1Y1V S;  4NBB A;  1TFI A;  2F4M A;  3D6W A;  2NVQ I;  2F4O A;  3GTQ I;  3GTJ I;  3H3V J;  1NUI A;  2R7Z I;  1SFO I;  1LQL A;  2JA5 I;  1QYP A;  4NBH A;  1K83 I;  1PFT A;  4Y52 I;  4A3F I;  3HOZ I;  1USP A;  5FLM I;  1I3Q I;  2E2J I;  3M4O I;  3LUS A;  3HOY I;  3S14 I;  2DE6 A;  3I4N I;  3S16 I;  3VMH A;  3S17 I;  3PO3 S;  4QTU A;  1RO4 A;  1USP B;  1R9T I;  4A3K I;  2JNY A;  3GTM I;  4A93 I;  1N2F A;  2J6A A;  2NVY I;  2R93 I;  5IP9 I;  2HF1 A;  1X3W A;  3GTP I;  3S15 I;  1VLA A;  4NBF A;  5C4J I;  3I4M I;  3HOW I;  4BY1 I;  4A3G I;  4A3L I;  2NVT I;  4A3M I;  3GTK I;  1TWC I;  3S1N I;  2B63 I;  4A3I I;  1RLY A;  1TWH I;  4QTT A;  3PO3 I;  4A3B I;  4MH4 A;  2BJO A;  3FKI I;  2KPI A;  1WW9 A;  3RZD I;  5C3E I;  3S2D I;  3S1M I;  1ZB8 A;  4A3D I;  1I6H I;  2RBL A;  1Y1W I;  4NBA A;  4NBE A;  3GTO I;  2JR6 A;  2K5R A;  4NB9 A;  2YU9 I;  3RZO I;  3M3Y I;  2P3Y A;  3HOV I;  3VMI A;  3S2H I;  4NBG A;  4BY7 I;  1TWG I;  4A3J I;  2JA6 I;  1I50 I;  3VMG A;  2DE7 A;  3HOX I;  3I07 A;  3S1R I;  2JA8 I;  3CQZ I;  1ML8 A;  2E2H I;  3GKQ A;  2AKL A;  4Y7N I;  1X3Z A;  1ZB9 A;  4NBC A;  4BXX I;  3VB9 A;  2E2I I;  4BBS I;  3HOU I; 
#chains in the Genus database with same CATH topology
 3CC2 1;  3K7A I;  3PO2 I;  3CCL 1;  3H0G I;  3OW2 Z;  1L1O C;  3KIH A;  1QVF Z;  1NJI 2;  2P28 A;  4E2Z A;  2R92 I;  1DL6 A;  4EWC A;  4E2Y A;  2GTH A;  3CCQ Z;  5AN9 F;  2O4H A;  3GCF A;  1YJW 1;  1VQ6 Z;  1P9N A;  2GU2 A;  2M6N A;  4HGY A;  3NFZ A;  2F4O A;  4DK1 A;  3CCR Z;  2QR1 B;  3CCJ 1;  1YJN Z;  3H3V J;  2R7Z I;  1YJ9 1;  1SFO I;  1M1K 1;  1YJ9 Z;  1QVG Z;  1K83 I;  3FQQ A;  3M4O I;  3F3F C;  2VPX A;  3IFU A;  3S17 I;  3I4N I;  2RHB A;  3PO3 S;  4QTU A;  1RO4 A;  4E32 A;  4RVF A;  4A3K I;  4MD7 A;  1YIJ Z;  4A93 I;  3CCM Z;  2J6A A;  5IP9 I;  4HGZ A;  1VLA A;  5C4J I;  3I4M I;  3G6E 1;  2PMZ A;  3CXC Y;  4BY1 I;  4E2X A;  3CCL Z;  4A3G I;  5IT9 f;  3IR7 A;  1TWC I;  3S1N I;  2B63 I;  3EED A;  3CCE 1;  3I55 Z;  4RVH A;  1WW9 A;  3RZD I;  3MON A;  5C3E I;  1VQ4 Z;  3D2L A;  1WZN A;  4A3D I;  3CC7 Z;  1VQ9 1;  4NBA A;  4RVD A;  2V45 A;  2LEX A;  3CCU 1;  2IZ3 A;  1I50 I;  1KQS Z;  3I07 A;  3F3P C;  1X3Z A;  1K9M 2;  4MD9 A;  2E2I I;  2PK7 A;  1SIW A;  2YAD A;  1FDI A;  3J80 f;  1RO2 A;  3G71 Z;  3Q87 A;  1Y1V I;  4DQY B;  1YHQ 1;  2M48 A;  4NB8 A;  4NFR A;  3CCR 1;  2VUM I;  1YI2 Z;  1Z03 A;  1Q7Y 1;  3P5J B;  3TE5 B;  3G71 1;  2RIQ A;  3I56 1;  3FQM A;  4AYB A;  3EER A;  2NAP A;  1VQ9 Z;  1YIT 1;  2W04 A;  2OTJ Z;  3CMA Z;  3S1Q I;  1VQ8 Z;  4E30 A;  2QRE B;  1Y1V S;  1VQM Z;  1VQ4 1;  2F4M A;  3NDI A;  2NVQ I;  1RNI A;  2K3R A;  2LFU A;  3GTQ I;  3GTJ I;  3MZL B;  2JA5 I;  5T67 A;  1Q82 2;  4NBH A;  2GTI A;  3CD6 Z;  4Y52 I;  1VQL 1;  5FLM I;  2V8K A;  3HKZ A;  1QVG Y;  1YIT Z;  2OTJ 1;  2WB1 A;  3S16 I;  1RO0 A;  2G2K A;  2JMO A;  2AYD A;  3CC4 Z;  2QEX Z;  2JNY A;  2NVY I;  1Q81 2;  1K73 2;  2R93 I;  2JIR A;  1X3W A;  3S15 I;  1RQF A;  4S1T A;  1VQ7 Z;  2JIM A;  2QLV B;  3J7A 4;  1JJ2 Z;  1RLY A;  3I56 Z;  3NH5 A;  2JIO A;  4MON A;  1VQM 1;  3J80 b;  2V8I A;  1YI2 1;  4MH4 A;  1QXF A;  2QKD A;  1FDO A;  2R6M A;  1NP6 A;  1W2B Y;  3J81 f;  2H85 A;  3NH4 A;  1M90 1;  3CC7 1;  4MD8 A;  2YU9 I;  1VQL Z;  2OOX B;  1KQS Y;  1TWG I;  4A3J I;  2JA6 I;  2IZ4 A;  1K8A 1;  5T64 A;  3S1R I;  3IX0 A;  2I3C A;  2V8J A;  3CQZ I;  3CC4 1;  2QA4 1;  1ML8 A;  2E2H I;  4NBC A;  4BXX I;  1YIJ 1;  3CMA 1;  1K9M 1;  3GTG I;  1WCM I;  2ZAE B;  3CCV Z;  3G6E Z;  3CCU Z;  5D1O A;  1Y8C A;  3I55 1;  3D9X A;  1VQN Z;  2V3V A;  1YUA A;  2Q4Z A;  2LIY A;  4E33 A;  1TWF I;  5C4X I;  1VQP Z;  2RT9 A;  2JIQ A;  3ESW A;  3CCS 1;  2JIP A;  5CM2 M;  1AA6 A;  4A3E I;  4A3C I;  4X6A I;  3BG1 B;  4NBB A;  1K73 1;  3CCE Z;  1KD1 1;  4RVG A;  2VUG A;  1NUI A;  3CCJ Z;  3T4N B;  3IF8 A;  1M1K 2;  3G4S Z;  1QYP A;  1PFT A;  4A3F I;  3HOZ I;  2E9H A;  1S72 1;  3BG0 B;  1ZH1 A;  3VMH A;  2OOY B;  4RV9 A;  3CME 1;  2KI7 B;  1USP B;  3GTM I;  5A2Q f;  1N2F A;  1KC8 1;  4MXU A;  1Q7Y 2;  3HOW I;  4TNU A;  2Q51 A;  4A3L I;  2NVT I;  3JAM f;  1M90 2;  1N8R 1;  3CPW Z;  4A3I I;  3KIF A;  1TWH I;  4QTT A;  3PO3 I;  3OW2 Y;  1VQN 1;  1JJ2 Y;  2W03 A;  2VF1 A;  2KPI A;  1K8A 2;  1VQ5 Z;  2HU9 A;  5A2Q b;  1VQO Z;  1ZB8 A;  3MZK B;  1I6H I;  2RBL A;  1Y1W I;  1VQ8 1;  1YUK A;  1W2B Z;  4NBE A;  3GTO I;  4NH1 C;  2K5R A;  3JAM b;  3RZO I;  3S2H I;  3HOV I;  3VMI A;  4NBG A;  4BY7 I;  1Z01 A;  4E2W A;  3CC2 Z;  3CCM 1;  3HOX I;  1Z02 A;  2JA8 I;  1WJ2 A;  3J81 b;  1YHQ Z;  2AKL A;  4Y7N I;  2VPW A;  4BBS I;  3HOU I;  4RS4 A;  4XX2 A;  5T6B A;  2OTL 1;  1N8R 2;  3NH8 A;  4NOZ A;  3GTM S;  1VQP 1;  2IV2 X;  5IP7 I;  2JA7 I;  2JS4 A;  2PM9 A;  3GTL I;  4BBR I;  1Q81 1;  2OTL Z;  3U50 C;  3CPW Y;  1VQK Z;  1QF8 A;  2DE5 A;  2EGT A;  5C44 I;  4NBD A;  4CL1 A;  2NVX I;  1TWA I;  3TDH B;  1VQ5 1;  1TFI A;  3D6W A;  1KC8 2;  2E7Z A;  1LQL A;  1YJW Z;  1USP A;  1I3Q I;  2OZK A;  2E2J I;  3LUS A;  3HOY I;  3CD6 1;  3S14 I;  2DE6 A;  2QA4 Z;  1S72 Z;  2O53 A;  5FLX f;  5D1P A;  1R9T I;  2QRC B;  3NDJ A;  5D1O B;  4MRI A;  2HF1 A;  1KRL A;  2JUB A;  3GTP I;  4NBF A;  3G4S 1;  1X0T A;  2Y0S A;  3CME Z;  1QVF Y;  4A3M I;  1WII A;  4HH4 A;  1Q86 1;  3GTK I;  1S7M A;  3QWU A;  1NJI 1;  4A3B I;  1Q16 A;  1Q82 1;  1JWH C;  2BJO A;  3FKI I;  1KD1 2;  1YJN 1;  5FLX b;  3S2D I;  2VPY A;  3S1M I;  1VQK 1;  2QEX 1;  1Q86 2;  4DGL A;  5LL6 f;  3CCS Z;  2VPZ A;  1VQ6 1;  1VQ7 1;  1VQO 1;  2JR6 A;  4NB9 A;  3M3Y I;  3CCQ 1;  2P3Y A;  2QRD B;  3VMG A;  2DE7 A;  5IT9 b;  3CCV 1;  3VTN A;  4E31 A;  3GKQ A;  1ZB9 A;  3VB9 A;  2RPR A;  2WAQ A;  3CXC Z; 
#chains in the Genus database with same CATH homology
 3CC2 1;  3K7A I;  3PO2 I;  3CCL 1;  3H0G I;  3OW2 Z;  1L1O C;  3KIH A;  1QVF Z;  1NJI 2;  2P28 A;  4E2Z A;  2R92 I;  1DL6 A;  4EWC A;  4E2Y A;  2GTH A;  3CCQ Z;  5AN9 F;  2O4H A;  3GCF A;  1YJW 1;  1VQ6 Z;  1P9N A;  2GU2 A;  2M6N A;  4HGY A;  3NFZ A;  2F4O A;  4DK1 A;  3CCR Z;  2QR1 B;  3CCJ 1;  1YJN Z;  3H3V J;  2R7Z I;  1YJ9 1;  1SFO I;  1M1K 1;  1YJ9 Z;  1QVG Z;  1K83 I;  3FQQ A;  3M4O I;  3F3F C;  3IFU A;  3S17 I;  3I4N I;  2RHB A;  3PO3 S;  4QTU A;  1RO4 A;  4E32 A;  4RVF A;  4A3K I;  4MD7 A;  1YIJ Z;  4A93 I;  3CCM Z;  2J6A A;  5IP9 I;  4HGZ A;  1VLA A;  5C4J I;  3I4M I;  3G6E 1;  2PMZ A;  3CXC Y;  4BY1 I;  4E2X A;  3CCL Z;  4A3G I;  5IT9 f;  1TWC I;  3S1N I;  2B63 I;  3EED A;  3CCE 1;  3I55 Z;  4RVH A;  1WW9 A;  3RZD I;  3MON A;  5C3E I;  1VQ4 Z;  4A3D I;  3CC7 Z;  1VQ9 1;  4NBA A;  4RVD A;  3CCU 1;  2IZ3 A;  1I50 I;  1KQS Z;  3I07 A;  3F3P C;  1X3Z A;  1K9M 2;  4MD9 A;  2E2I I;  2PK7 A;  2YAD A;  3J80 f;  1RO2 A;  3G71 Z;  3Q87 A;  1Y1V I;  4DQY B;  1YHQ 1;  2M48 A;  4NB8 A;  4NFR A;  3CCR 1;  2VUM I;  1YI2 Z;  1Z03 A;  1Q7Y 1;  3P5J B;  3TE5 B;  3G71 1;  2RIQ A;  3I56 1;  3FQM A;  4AYB A;  3EER A;  1VQ9 Z;  1YIT 1;  2W04 A;  2OTJ Z;  3CMA Z;  3S1Q I;  1VQ8 Z;  4E30 A;  2QRE B;  1Y1V S;  1VQM Z;  1VQ4 1;  2F4M A;  3NDI A;  2NVQ I;  1RNI A;  2K3R A;  2LFU A;  3GTQ I;  3GTJ I;  3MZL B;  2JA5 I;  5T67 A;  1Q82 2;  4NBH A;  2GTI A;  3CD6 Z;  4Y52 I;  1VQL 1;  5FLM I;  2V8K A;  3HKZ A;  1QVG Y;  1YIT Z;  2OTJ 1;  2WB1 A;  3S16 I;  1RO0 A;  2G2K A;  2JMO A;  3CC4 Z;  2QEX Z;  2JNY A;  2NVY I;  1Q81 2;  1K73 2;  2R93 I;  1X3W A;  3S15 I;  1RQF A;  4S1T A;  1VQ7 Z;  2QLV B;  3J7A 4;  1JJ2 Z;  1RLY A;  3I56 Z;  3NH5 A;  4MON A;  1VQM 1;  3J80 b;  2V8I A;  1YI2 1;  4MH4 A;  2QKD A;  2R6M A;  1NP6 A;  1W2B Y;  3J81 f;  2H85 A;  3NH4 A;  1M90 1;  3CC7 1;  4MD8 A;  2YU9 I;  1VQL Z;  2OOX B;  1KQS Y;  1TWG I;  4A3J I;  2JA6 I;  2IZ4 A;  1K8A 1;  5T64 A;  3S1R I;  3IX0 A;  2I3C A;  2V8J A;  3CQZ I;  3CC4 1;  2QA4 1;  1ML8 A;  2E2H I;  4NBC A;  4BXX I;  1YIJ 1;  3CMA 1;  1K9M 1;  3GTG I;  1WCM I;  2ZAE B;  3CCV Z;  3G6E Z;  3CCU Z;  5D1O A;  3I55 1;  3D9X A;  1VQN Z;  1YUA A;  2Q4Z A;  2LIY A;  4E33 A;  1TWF I;  5C4X I;  1VQP Z;  2RT9 A;  3ESW A;  3CCS 1;  5CM2 M;  4A3E I;  4A3C I;  4X6A I;  3BG1 B;  4NBB A;  1K73 1;  3CCE Z;  1KD1 1;  4RVG A;  2VUG A;  1NUI A;  3CCJ Z;  3T4N B;  3IF8 A;  1M1K 2;  3G4S Z;  1QYP A;  1PFT A;  4A3F I;  3HOZ I;  2E9H A;  1S72 1;  3BG0 B;  1ZH1 A;  3VMH A;  2OOY B;  4RV9 A;  3CME 1;  2KI7 B;  1USP B;  3GTM I;  5A2Q f;  1N2F A;  1KC8 1;  4MXU A;  1Q7Y 2;  3HOW I;  4TNU A;  2Q51 A;  4A3L I;  2NVT I;  3JAM f;  1M90 2;  1N8R 1;  3CPW Z;  4A3I I;  3KIF A;  1TWH I;  4QTT A;  3PO3 I;  3OW2 Y;  1VQN 1;  1JJ2 Y;  2W03 A;  2VF1 A;  2KPI A;  1K8A 2;  1VQ5 Z;  2HU9 A;  5A2Q b;  1VQO Z;  1ZB8 A;  3MZK B;  1I6H I;  2RBL A;  1Y1W I;  1VQ8 1;  1YUK A;  1W2B Z;  4NBE A;  3GTO I;  4NH1 C;  2K5R A;  3JAM b;  3RZO I;  3S2H I;  3HOV I;  3VMI A;  4NBG A;  4BY7 I;  1Z01 A;  4E2W A;  3CC2 Z;  3CCM 1;  3HOX I;  1Z02 A;  2JA8 I;  3J81 b;  1YHQ Z;  2AKL A;  4Y7N I;  4BBS I;  3HOU I;  4RS4 A;  4XX2 A;  5T6B A;  2OTL 1;  1N8R 2;  3NH8 A;  4NOZ A;  3GTM S;  1VQP 1;  5IP7 I;  2JA7 I;  2JS4 A;  2PM9 A;  3GTL I;  4BBR I;  1Q81 1;  2OTL Z;  3U50 C;  3CPW Y;  1VQK Z;  1QF8 A;  2DE5 A;  2EGT A;  5C44 I;  4NBD A;  4CL1 A;  2NVX I;  1TWA I;  3TDH B;  1VQ5 1;  1TFI A;  3D6W A;  1KC8 2;  1LQL A;  1YJW Z;  1USP A;  1I3Q I;  2OZK A;  2E2J I;  3LUS A;  3HOY I;  3CD6 1;  3S14 I;  2DE6 A;  2QA4 Z;  1S72 Z;  2O53 A;  5FLX f;  5D1P A;  1R9T I;  2QRC B;  3NDJ A;  5D1O B;  4MRI A;  2HF1 A;  1KRL A;  2JUB A;  3GTP I;  4NBF A;  3G4S 1;  1X0T A;  2Y0S A;  3CME Z;  1QVF Y;  4A3M I;  1WII A;  4HH4 A;  1Q86 1;  3GTK I;  1S7M A;  3QWU A;  1NJI 1;  4A3B I;  1Q82 1;  1JWH C;  2BJO A;  3FKI I;  1KD1 2;  1YJN 1;  5FLX b;  3S2D I;  3S1M I;  1VQK 1;  2QEX 1;  1Q86 2;  4DGL A;  5LL6 f;  3CCS Z;  1VQ6 1;  1VQ7 1;  1VQO 1;  2JR6 A;  4NB9 A;  3M3Y I;  3CCQ 1;  2P3Y A;  2QRD B;  3VMG A;  2DE7 A;  5IT9 b;  3CCV 1;  3VTN A;  4E31 A;  3GKQ A;  1ZB9 A;  3VB9 A;  2RPR A;  2WAQ A;  3CXC Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...