2E2JI

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI02
4MH4A 5C4XI 2J6AA 1NUIA 3HOXI 4NBDA 1R9TI 1QYPA 3GTMI 3Q87A 1I3QI 4NB9A 3PO3S 3S2HI 4BBSI 3HOUI 3I07A 2F4OA 2F4MA 1SFOI 3H0GI 4NBAA 5FLMI 5C3EI 2DE7A 3HOWI 2YU9I 2JR6A 3U50C 1I50I 1L1OC 1TWGI 1TWAI 3PO3I 4A93I 4NBEA 2KPIA 4A3LI 2JA6I 4BY1I 3GKQA 2RBLA 1TWFI 5IP7I 3I4MI 1I6HI 2R92I 4A3GI 2R7ZI 3GTJI 1ML8A 3S2DI 2JA7I 2BJOA 1N2FA 2DE5A 3M4OI 3H3VJ 2VUMI 5IP9I 1YUAA 1Y1VI 1LQLA 1DL6A 3I4NI 3M3YI 3S1RI 3VMGA 2E2JI 4A3EI 4NOZA 4A3BI 1RO4A 3ESWA 2JS4A 2JNYA 4Y7NI 3GTLI 1WW9A 2JA5I 2PK7A 3S14I 2DE6A 3VMIA 1ZB9A 3S15I 3GTQI 1K83I 4A3CI 3S16I 3RZOI 1X3WA 4NBGA 3VMHA 4A3MI 3FKII 3PO2I 3VB9A 4QTUA 1WCMI 1TWCI 3LUSA 4A3FI 3HOYI 3GTGI 1TWHI 4A3DI 4BBRI 3RZDI 4NBBA 1RLYA 3S17I 3S1QI 2E2II 5CM2M 4Y52I 4A3II 2HF1A 3GTMS 2NVTI 3GCFA 4NBFA 5C4JI 1PFTA 3CQZI 3GTPI 2NVYI 3S1NI 1USPB 4X6AI 3K7AI 2AKLA 2E2HI 1ZB8A 1X3ZA 2NVQI 3S1MI 4NBCA 5C44I 4NBHA 4XX2A 3D6WA 4A3KI 3GTOI 3GTKI 1Y1WI 4BY7I 2P3YA 2K5RA 4A3JI 2JA8I 1Y1VS 2NVXI 1VLAA 4BXXI 4NB8A 3HOVI 2R93I 1USPA 3HOZI 4QTTA 3EERA 1TFIA 2B63I
chains in the Genus database with same CATH superfamily
3CCUZ 1K9M2 1VQLZ 1NUIA 2GTIA 1YIJ1 2Y0SA 4NFRA 3GTMI 2JIPA 1Q862 1RO0A 2IZ3A 3HOUI 2F4OA 2F4MA 2W03A 1ZH1A 1VQO1 2DE7A 3CXCY 3CC2Z 1VQM1 2NAPA 4DK1A 1VQL1 1Q7Y1 3PO3I 2QR1B 3KIFA 2P28A 4MD8A 1YIT1 1P9NA 2JA6I 1S7MA 1YI2Z 4BY1I 3GKQA 3NDJA 1YJN1 1W2BZ 2R92I 1QF8A 4A3GI 2VUGA 3CC41 2DE5A 1YUAA 1Y1VI 3I4NI 1QVGY 3M3YI 1VQ7Z 2E2JI 4A3EI 1QXFA 2H85A 3ESWA 2R6MA 3BG0B 5T64A 2JNYA 4E2WA 1VQN1 4MD9A 3GTLI 2JA5I 2PK7A 3CCMZ 2DE6A 3VMIA 1VQ6Z 4E30A 1X3WA 3VMHA 1M1K1 2VPZA 3OW2Y 2V8KA 1VQKZ 2QRCB 3F3PC 3IFUA 4A3FI 1TWHI 2QEX1 3RZDI 1RLYA 5CM2M 2RIQA 4DGLA 2HU9A 5T6BA 3S1NI 4RVDA 2AKLA 1ZB8A 3I551 2OTL1 3CCV1 4XX2A 3CC7Z 2YADA 1KD12 1VQ41 2QEXZ 4E2XA 1VQMZ 2NVXI 3IF8A 3G6EZ 3J7A4 3NDIA 3HOZI 3G71Z 2QLVB 2JIQA 3S1QI 3CCJ1 5C4XI 1X0TA 2QA41 3CCS1 4DQYB 2LIYA 5AN9F 2W04A 3CPWY 3S2HI 2GU2A 3CCE1 1M1K2 1SFOI 3H0GI 5FLMI 3G4SZ 3U50C 3CCLZ 3J80f 2QA4Z 1N8R1 1TWAI 4A93I 4NBEA 2KPIA 3TDHB 4A3LI 2KI7B 1JJ2Y 2RBLA 3F3FC 1TWFI 1QVGZ 2QRDB 4TNUA 1JJ2Z 2R7ZI 1ML8A 1NJI2 3J80b 2AYDA 2O4HA 2WAQA 2VPYA 4HGYA 3M4OI 3CME1 3NH8A 3BG1B 3VMGA 3KIHA 4A3BI 1RO4A 2ZAEB 2JUBA 5IT9b 3S15I 1Y8CA 1S721 4A3CI 3RZOI 2LFUA 3FKII 1VQ5Z 2EGTA 3VB9A 3JAMf 2QREB 2QKDA 3CCM1 1FDIA 2JIMA 3NH4A 3HOYI 3CXCZ 3GTGI 4BBRI 3S17I 1YJWZ 1WJ2A 2E2II 2PM9A 4Y52I 4NH1C 4MONA 3I561 2NVTI 3GCFA 4NBFA 3CCJZ 1PFTA 4AYBA 4X6AI 3CCR1 1KC81 1QVFY 2E2HI 3S1MI 5D1OA 4A3KI 3GTOI 3GTKI 1Y1WI 2E9HA 2P3YA 2RHBA 1M902 1Y1VS 3EERA 1VLAA 1YJNZ 3I55Z 3CCRZ 3CCQZ 2OOYB 1TFIA 2LEXA 2J6AA 4HH4A 2RT9A 5IT9f 3CPWZ 3HOXI 2JMOA 1I3QI 4NB9A 1KC82 3PO3S 3CMEZ 1VQNZ 4NBAA 1K732 2PMZA 1I50I 1RO2A 1YHQZ 4CL1A 4RVGA 1Q811 3CCEZ 2V8IA 3D2LA 1JWHC 1NJI1 2IZ4A 2G2KA 3CD6Z 3G4S1 3I4MI 3D9XA 2O53A 3GTJI 5D1PA 3S2DI 3MZLB 4RS4A 2BJOA 1N2FA 1YHQ1 3H3VJ 3IR7A 1LQLA 1DL6A 3CD61 1WZNA 2JS4A 4Y7NI 1W2BY 1WIIA 3OW2Z 3MONA 1ZB9A 2E7ZA 1VQ61 1NP6A 1Z01A 3T4NB 2V3VA 3S16I 4NBGA 4A3MI 1YITZ 3EEDA 1Q812 1KRLA 1RNIA 2OTJZ 5D1OB 3VTNA 3LUSA 1K731 1SIWA 4A3DI 4NBBA 2VF1A 2HF1A 1K8A1 1KQSZ 5C4JI 1RQFA 2JIOA 1YJW1 1Q7Y2 2GTHA 1USPB 4RVHA 3CMA1 4NBCA 4NBHA 4E2ZA 2K3RA 2OTJ1 2IV2X 1YJ9Z 4A3JI 4BXXI 4NB8A 1Z02A 3G6E1 3HOVI 1USPA 2R93I 2VPXA 4QTTA 1VQ81 1VQK1 2B63I 1N8R2 3G711 4MH4A 1VQ91 1S72Z 3J81f 1K8A2 3CCQ1 1Q822 4NBDA 1R9TI 1QYPA 4E2YA 3Q87A 1YJ91 2V45A 3CC21 4BBSI 3I07A 3IX0A 1YI21 1K9M1 1VQ8Z 5C3EI 4MRIA 3JAMb 3HOWI 4RV9A 2YU9I 2JR6A 3TE5B 2WB1A 3CCVZ 1L1OC 1TWGI 5FLXf 3CCL1 4HGZA 2JIRA 4EWCA 3P5JB 1AA6A 4E32A 3CCU1 3CC4Z 3HKZA 5IP7I 1YIJZ 1VQ71 1I6HI 2M6NA 1KD11 3FQMA 2JA7I 2VPWA 2OTLZ 2VUMI 5IP9I 4E33A 3S1RI 3NH5A 1VQPZ 4NOZA 2OOXB 3NFZA 1Q821 3J81b 4S1TA 1Q861 3FQQA 1WW9A 3S14I 3GTQI 1K83I 3CMAZ 5A2Qb 3CCSZ 3PO2I 5T67A 2RPRA 1VQ51 4QTUA 4E31A 1KQSY 1VQP1 5A2Qf 2OZKA 1WCMI 5FLXb 1Z03A 1TWCI 2V8JA 2Q4ZA 3QWUA 2Q51A 1M901 3I56Z 4A3II 3CC71 3GTMS 1Q16A 1VQ9Z 3CQZI 3GTPI 2NVYI 1FDOA 1YUKA 3K7AI 1X3ZA 2NVQI 5C44I 1VQ4Z 3D6WA 4BY7I 4MD7A 3MZKB 2M48A 2K5RA 1QVFZ 2JA8I 4RVFA 4MXUA 5LL6f 2I3CA 1VQOZ
chains in the Genus database with same CATH topology
3CCUZ 1K9M2 1VQLZ 1NUIA 2GTIA 1YIJ1 2Y0SA 4NFRA 3GTMI 1Q862 1RO0A 2IZ3A 3HOUI 2F4OA 2F4MA 2W03A 1ZH1A 1VQO1 2DE7A 3CXCY 3CC2Z 1VQM1 4DK1A 1VQL1 1Q7Y1 3PO3I 2QR1B 3KIFA 2P28A 4MD8A 1YIT1 1P9NA 2JA6I 1S7MA 1YI2Z 4BY1I 3GKQA 3NDJA 1YJN1 1W2BZ 2R92I 1QF8A 4A3GI 2VUGA 3CC41 2DE5A 1YUAA 1Y1VI 3I4NI 1QVGY 3M3YI 1VQ7Z 2E2JI 4A3EI 2H85A 3ESWA 2R6MA 3BG0B 5T64A 2JNYA 4E2WA 1VQN1 4MD9A 3GTLI 2JA5I 2PK7A 3CCMZ 2DE6A 3VMIA 1VQ6Z 4E30A 1X3WA 3VMHA 1M1K1 3OW2Y 2V8KA 1VQKZ 2QRCB 3F3PC 3IFUA 4A3FI 1TWHI 2QEX1 3RZDI 1RLYA 5CM2M 2RIQA 4DGLA 2HU9A 5T6BA 3S1NI 4RVDA 2AKLA 1ZB8A 3I551 2OTL1 3CCV1 4XX2A 3CC7Z 2YADA 1KD12 1VQ41 2QEXZ 4E2XA 1VQMZ 2NVXI 3IF8A 3G6EZ 3J7A4 3NDIA 3HOZI 3G71Z 2QLVB 3S1QI 3CCJ1 5C4XI 1X0TA 2QA41 3CCS1 4DQYB 2LIYA 5AN9F 2W04A 3CPWY 3S2HI 2GU2A 3CCE1 1M1K2 1SFOI 3H0GI 5FLMI 3G4SZ 3U50C 3CCLZ 3J80f 2QA4Z 1N8R1 1TWAI 4A93I 4NBEA 2KPIA 3TDHB 4A3LI 2KI7B 1JJ2Y 2RBLA 3F3FC 1TWFI 1QVGZ 2QRDB 4TNUA 1JJ2Z 2R7ZI 1ML8A 1NJI2 3J80b 2O4HA 2WAQA 4HGYA 3M4OI 3CME1 3NH8A 3BG1B 3VMGA 3KIHA 4A3BI 1RO4A 2ZAEB 2JUBA 5IT9b 3S15I 1S721 4A3CI 3RZOI 2LFUA 3FKII 1VQ5Z 2EGTA 3VB9A 3JAMf 2QREB 2QKDA 3CCM1 3NH4A 3HOYI 3CXCZ 3GTGI 4BBRI 3S17I 1YJWZ 2E2II 2PM9A 4Y52I 4NH1C 4MONA 3I561 2NVTI 3GCFA 4NBFA 3CCJZ 1PFTA 4AYBA 4X6AI 3CCR1 1KC81 1QVFY 2E2HI 3S1MI 5D1OA 4A3KI 3GTOI 3GTKI 1Y1WI 2E9HA 2P3YA 2RHBA 1M902 1Y1VS 3EERA 1VLAA 1YJNZ 3I55Z 3CCRZ 3CCQZ 2OOYB 1TFIA 2J6AA 4HH4A 2RT9A 5IT9f 3CPWZ 3HOXI 2JMOA 1I3QI 4NB9A 1KC82 3PO3S 3CMEZ 1VQNZ 4NBAA 1K732 2PMZA 1I50I 1RO2A 1YHQZ 4CL1A 4RVGA 1Q811 3CCEZ 2V8IA 1JWHC 1NJI1 2IZ4A 2G2KA 3CD6Z 3G4S1 3I4MI 3D9XA 2O53A 3GTJI 5D1PA 3S2DI 3MZLB 4RS4A 2BJOA 1N2FA 1YHQ1 3H3VJ 1LQLA 1DL6A 3CD61 2JS4A 4Y7NI 1W2BY 1WIIA 3OW2Z 3MONA 1ZB9A 1VQ61 1NP6A 1Z01A 3T4NB 3S16I 4NBGA 4A3MI 1YITZ 3EEDA 1Q812 1RNIA 1KRLA 2OTJZ 5D1OB 3VTNA 3LUSA 1K731 4A3DI 4NBBA 2VF1A 2HF1A 1K8A1 1KQSZ 5C4JI 1RQFA 1YJW1 1Q7Y2 2GTHA 1USPB 4RVHA 3CMA1 4NBCA 4NBHA 4E2ZA 2K3RA 2OTJ1 1YJ9Z 4A3JI 4BXXI 4NB8A 1Z02A 3G6E1 3HOVI 1USPA 2R93I 4QTTA 1VQ81 1VQK1 2B63I 1N8R2 3G711 4MH4A 1VQ91 1S72Z 3J81f 1K8A2 3CCQ1 1Q822 4NBDA 1R9TI 1QYPA 4E2YA 3Q87A 1YJ91 3CC21 4BBSI 3I07A 3IX0A 1YI21 1K9M1 1VQ8Z 5C3EI 4MRIA 3JAMb 3HOWI 4RV9A 2YU9I 2JR6A 3TE5B 2WB1A 3CCVZ 1L1OC 1TWGI 5FLXf 3CCL1 4HGZA 4EWCA 3P5JB 4E32A 3CCU1 3CC4Z 3HKZA 5IP7I 1YIJZ 1VQ71 1I6HI 2M6NA 1KD11 3FQMA 2JA7I 2OTLZ 2VUMI 5IP9I 4E33A 3S1RI 3NH5A 1VQPZ 4NOZA 2OOXB 3NFZA 1Q821 3J81b 4S1TA 1Q861 3FQQA 1WW9A 3S14I 3GTQI 1K83I 3CMAZ 5A2Qb 3CCSZ 3PO2I 5T67A 2RPRA 1VQ51 4QTUA 4E31A 1KQSY 1VQP1 5A2Qf 2OZKA 1WCMI 5FLXb 1Z03A 1TWCI 2V8JA 2Q4ZA 3QWUA 2Q51A 1M901 3I56Z 4A3II 3CC71 3GTMS 1VQ9Z 3CQZI 3GTPI 2NVYI 1YUKA 3K7AI 1X3ZA 2NVQI 5C44I 1VQ4Z 3D6WA 4BY7I 4MD7A 3MZKB 2M48A 2K5RA 1QVFZ 2JA8I 4RVFA 4MXUA 5LL6f 2I3CA 1VQOZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  5C4X I;  2J6A A;  1NUI A;  3HOX I;  4NBD A;  1R9T I;  1QYP A;  3GTM I;  3Q87 A;  1I3Q I;  4NB9 A;  3PO3 S;  3S2H I;  4BBS I;  3HOU I;  3I07 A;  2F4O A;  2F4M A;  1SFO I;  3H0G I;  4NBA A;  5FLM I;  5C3E I;  2DE7 A;  3HOW I;  2YU9 I;  2JR6 A;  3U50 C;  1I50 I;  1L1O C;  1TWG I;  1TWA I;  3PO3 I;  4A93 I;  4NBE A;  2KPI A;  4A3L I;  2JA6 I;  4BY1 I;  3GKQ A;  2RBL A;  1TWF I;  5IP7 I;  3I4M I;  1I6H I;  2R92 I;  4A3G I;  2R7Z I;  3GTJ I;  1ML8 A;  3S2D I;  2JA7 I;  2BJO A;  1N2F A;  2DE5 A;  3M4O I;  3H3V J;  2VUM I;  5IP9 I;  1YUA A;  1Y1V I;  1LQL A;  1DL6 A;  3I4N I;  3M3Y I;  3S1R I;  3VMG A;  2E2J I;  4A3E I;  4NOZ A;  4A3B I;  1RO4 A;  3ESW A;  2JS4 A;  2JNY A;  4Y7N I;  3GTL I;  1WW9 A;  2JA5 I;  2PK7 A;  3S14 I;  2DE6 A;  3VMI A;  1ZB9 A;  3S15 I;  3GTQ I;  1K83 I;  4A3C I;  3S16 I;  3RZO I;  1X3W A;  4NBG A;  3VMH A;  4A3M I;  3FKI I;  3PO2 I;  3VB9 A;  4QTU A;  1WCM I;  1TWC I;  3LUS A;  4A3F I;  3HOY I;  3GTG I;  1TWH I;  4A3D I;  4BBR I;  3RZD I;  4NBB A;  1RLY A;  3S17 I;  3S1Q I;  2E2I I;  5CM2 M;  4Y52 I;  4A3I I;  2HF1 A;  3GTM S;  2NVT I;  3GCF A;  4NBF A;  5C4J I;  1PFT A;  3CQZ I;  3GTP I;  2NVY I;  3S1N I;  1USP B;  4X6A I;  3K7A I;  2AKL A;  2E2H I;  1ZB8 A;  1X3Z A;  2NVQ I;  3S1M I;  4NBC A;  5C44 I;  4NBH A;  4XX2 A;  3D6W A;  4A3K I;  3GTO I;  3GTK I;  1Y1W I;  4BY7 I;  2P3Y A;  2K5R A;  4A3J I;  2JA8 I;  1Y1V S;  2NVX I;  1VLA A;  4BXX I;  4NB8 A;  3HOV I;  2R93 I;  1USP A;  3HOZ I;  4QTT A;  3EER A;  1TFI A;  2B63 I; 
#chains in the Genus database with same CATH topology
 3CCU Z;  1K9M 2;  1VQL Z;  1NUI A;  2GTI A;  1YIJ 1;  2Y0S A;  4NFR A;  3GTM I;  2JIP A;  1Q86 2;  1RO0 A;  2IZ3 A;  3HOU I;  2F4O A;  2F4M A;  2W03 A;  1ZH1 A;  1VQO 1;  2DE7 A;  3CXC Y;  3CC2 Z;  1VQM 1;  2NAP A;  4DK1 A;  1VQL 1;  1Q7Y 1;  3PO3 I;  2QR1 B;  3KIF A;  2P28 A;  4MD8 A;  1YIT 1;  1P9N A;  2JA6 I;  1S7M A;  1YI2 Z;  4BY1 I;  3GKQ A;  3NDJ A;  1YJN 1;  1W2B Z;  2R92 I;  1QF8 A;  4A3G I;  2VUG A;  3CC4 1;  2DE5 A;  1YUA A;  1Y1V I;  3I4N I;  1QVG Y;  3M3Y I;  1VQ7 Z;  2E2J I;  4A3E I;  1QXF A;  2H85 A;  3ESW A;  2R6M A;  3BG0 B;  5T64 A;  2JNY A;  4E2W A;  1VQN 1;  4MD9 A;  3GTL I;  2JA5 I;  2PK7 A;  3CCM Z;  2DE6 A;  3VMI A;  1VQ6 Z;  4E30 A;  1X3W A;  3VMH A;  1M1K 1;  2VPZ A;  3OW2 Y;  2V8K A;  1VQK Z;  2QRC B;  3F3P C;  3IFU A;  4A3F I;  1TWH I;  2QEX 1;  3RZD I;  1RLY A;  5CM2 M;  2RIQ A;  4DGL A;  2HU9 A;  5T6B A;  3S1N I;  4RVD A;  2AKL A;  1ZB8 A;  3I55 1;  2OTL 1;  3CCV 1;  4XX2 A;  3CC7 Z;  2YAD A;  1KD1 2;  1VQ4 1;  2QEX Z;  4E2X A;  1VQM Z;  2NVX I;  3IF8 A;  3G6E Z;  3J7A 4;  3NDI A;  3HOZ I;  3G71 Z;  2QLV B;  2JIQ A;  3S1Q I;  3CCJ 1;  5C4X I;  1X0T A;  2QA4 1;  3CCS 1;  4DQY B;  2LIY A;  5AN9 F;  2W04 A;  3CPW Y;  3S2H I;  2GU2 A;  3CCE 1;  1M1K 2;  1SFO I;  3H0G I;  5FLM I;  3G4S Z;  3U50 C;  3CCL Z;  3J80 f;  2QA4 Z;  1N8R 1;  1TWA I;  4A93 I;  4NBE A;  2KPI A;  3TDH B;  4A3L I;  2KI7 B;  1JJ2 Y;  2RBL A;  3F3F C;  1TWF I;  1QVG Z;  2QRD B;  4TNU A;  1JJ2 Z;  2R7Z I;  1ML8 A;  1NJI 2;  3J80 b;  2AYD A;  2O4H A;  2WAQ A;  2VPY A;  4HGY A;  3M4O I;  3CME 1;  3NH8 A;  3BG1 B;  3VMG A;  3KIH A;  4A3B I;  1RO4 A;  2ZAE B;  2JUB A;  5IT9 b;  3S15 I;  1Y8C A;  1S72 1;  4A3C I;  3RZO I;  2LFU A;  3FKI I;  1VQ5 Z;  2EGT A;  3VB9 A;  3JAM f;  2QRE B;  2QKD A;  3CCM 1;  1FDI A;  2JIM A;  3NH4 A;  3HOY I;  3CXC Z;  3GTG I;  4BBR I;  3S17 I;  1YJW Z;  1WJ2 A;  2E2I I;  2PM9 A;  4Y52 I;  4NH1 C;  4MON A;  3I56 1;  2NVT I;  3GCF A;  4NBF A;  3CCJ Z;  1PFT A;  4AYB A;  4X6A I;  3CCR 1;  1KC8 1;  1QVF Y;  2E2H I;  3S1M I;  5D1O A;  4A3K I;  3GTO I;  3GTK I;  1Y1W I;  2E9H A;  2P3Y A;  2RHB A;  1M90 2;  1Y1V S;  3EER A;  1VLA A;  1YJN Z;  3I55 Z;  3CCR Z;  3CCQ Z;  2OOY B;  1TFI A;  2LEX A;  2J6A A;  4HH4 A;  2RT9 A;  5IT9 f;  3CPW Z;  3HOX I;  2JMO A;  1I3Q I;  4NB9 A;  1KC8 2;  3PO3 S;  3CME Z;  1VQN Z;  4NBA A;  1K73 2;  2PMZ A;  1I50 I;  1RO2 A;  1YHQ Z;  4CL1 A;  4RVG A;  1Q81 1;  3CCE Z;  2V8I A;  3D2L A;  1JWH C;  1NJI 1;  2IZ4 A;  2G2K A;  3CD6 Z;  3G4S 1;  3I4M I;  3D9X A;  2O53 A;  3GTJ I;  5D1P A;  3S2D I;  3MZL B;  4RS4 A;  2BJO A;  1N2F A;  1YHQ 1;  3H3V J;  3IR7 A;  1LQL A;  1DL6 A;  3CD6 1;  1WZN A;  2JS4 A;  4Y7N I;  1W2B Y;  1WII A;  3OW2 Z;  3MON A;  1ZB9 A;  2E7Z A;  1VQ6 1;  1NP6 A;  1Z01 A;  3T4N B;  2V3V A;  3S16 I;  4NBG A;  4A3M I;  1YIT Z;  3EED A;  1Q81 2;  1KRL A;  1RNI A;  2OTJ Z;  5D1O B;  3VTN A;  3LUS A;  1K73 1;  1SIW A;  4A3D I;  4NBB A;  2VF1 A;  2HF1 A;  1K8A 1;  1KQS Z;  5C4J I;  1RQF A;  2JIO A;  1YJW 1;  1Q7Y 2;  2GTH A;  1USP B;  4RVH A;  3CMA 1;  4NBC A;  4NBH A;  4E2Z A;  2K3R A;  2OTJ 1;  2IV2 X;  1YJ9 Z;  4A3J I;  4BXX I;  4NB8 A;  1Z02 A;  3G6E 1;  3HOV I;  1USP A;  2R93 I;  2VPX A;  4QTT A;  1VQ8 1;  1VQK 1;  2B63 I;  1N8R 2;  3G71 1;  4MH4 A;  1VQ9 1;  1S72 Z;  3J81 f;  1K8A 2;  3CCQ 1;  1Q82 2;  4NBD A;  1R9T I;  1QYP A;  4E2Y A;  3Q87 A;  1YJ9 1;  2V45 A;  3CC2 1;  4BBS I;  3I07 A;  3IX0 A;  1YI2 1;  1K9M 1;  1VQ8 Z;  5C3E I;  4MRI A;  3JAM b;  3HOW I;  4RV9 A;  2YU9 I;  2JR6 A;  3TE5 B;  2WB1 A;  3CCV Z;  1L1O C;  1TWG I;  5FLX f;  3CCL 1;  4HGZ A;  2JIR A;  4EWC A;  3P5J B;  1AA6 A;  4E32 A;  3CCU 1;  3CC4 Z;  3HKZ A;  5IP7 I;  1YIJ Z;  1VQ7 1;  1I6H I;  2M6N A;  1KD1 1;  3FQM A;  2JA7 I;  2VPW A;  2OTL Z;  2VUM I;  5IP9 I;  4E33 A;  3S1R I;  3NH5 A;  1VQP Z;  4NOZ A;  2OOX B;  3NFZ A;  1Q82 1;  3J81 b;  4S1T A;  1Q86 1;  3FQQ A;  1WW9 A;  3S14 I;  3GTQ I;  1K83 I;  3CMA Z;  5A2Q b;  3CCS Z;  3PO2 I;  5T67 A;  2RPR A;  1VQ5 1;  4QTU A;  4E31 A;  1KQS Y;  1VQP 1;  5A2Q f;  2OZK A;  1WCM I;  5FLX b;  1Z03 A;  1TWC I;  2V8J A;  2Q4Z A;  3QWU A;  2Q51 A;  1M90 1;  3I56 Z;  4A3I I;  3CC7 1;  3GTM S;  1Q16 A;  1VQ9 Z;  3CQZ I;  3GTP I;  2NVY I;  1FDO A;  1YUK A;  3K7A I;  1X3Z A;  2NVQ I;  5C44 I;  1VQ4 Z;  3D6W A;  4BY7 I;  4MD7 A;  3MZK B;  2M48 A;  2K5R A;  1QVF Z;  2JA8 I;  4RVF A;  4MXU A;  5LL6 f;  2I3C A;  1VQO Z; 
#chains in the Genus database with same CATH homology
 3CCU Z;  1K9M 2;  1VQL Z;  1NUI A;  2GTI A;  1YIJ 1;  2Y0S A;  4NFR A;  3GTM I;  1Q86 2;  1RO0 A;  2IZ3 A;  3HOU I;  2F4O A;  2F4M A;  2W03 A;  1ZH1 A;  1VQO 1;  2DE7 A;  3CXC Y;  3CC2 Z;  1VQM 1;  4DK1 A;  1VQL 1;  1Q7Y 1;  3PO3 I;  2QR1 B;  3KIF A;  2P28 A;  4MD8 A;  1YIT 1;  1P9N A;  2JA6 I;  1S7M A;  1YI2 Z;  4BY1 I;  3GKQ A;  3NDJ A;  1YJN 1;  1W2B Z;  2R92 I;  1QF8 A;  4A3G I;  2VUG A;  3CC4 1;  2DE5 A;  1YUA A;  1Y1V I;  3I4N I;  1QVG Y;  3M3Y I;  1VQ7 Z;  2E2J I;  4A3E I;  2H85 A;  3ESW A;  2R6M A;  3BG0 B;  5T64 A;  2JNY A;  4E2W A;  1VQN 1;  4MD9 A;  3GTL I;  2JA5 I;  2PK7 A;  3CCM Z;  2DE6 A;  3VMI A;  1VQ6 Z;  4E30 A;  1X3W A;  3VMH A;  1M1K 1;  3OW2 Y;  2V8K A;  1VQK Z;  2QRC B;  3F3P C;  3IFU A;  4A3F I;  1TWH I;  2QEX 1;  3RZD I;  1RLY A;  5CM2 M;  2RIQ A;  4DGL A;  2HU9 A;  5T6B A;  3S1N I;  4RVD A;  2AKL A;  1ZB8 A;  3I55 1;  2OTL 1;  3CCV 1;  4XX2 A;  3CC7 Z;  2YAD A;  1KD1 2;  1VQ4 1;  2QEX Z;  4E2X A;  1VQM Z;  2NVX I;  3IF8 A;  3G6E Z;  3J7A 4;  3NDI A;  3HOZ I;  3G71 Z;  2QLV B;  3S1Q I;  3CCJ 1;  5C4X I;  1X0T A;  2QA4 1;  3CCS 1;  4DQY B;  2LIY A;  5AN9 F;  2W04 A;  3CPW Y;  3S2H I;  2GU2 A;  3CCE 1;  1M1K 2;  1SFO I;  3H0G I;  5FLM I;  3G4S Z;  3U50 C;  3CCL Z;  3J80 f;  2QA4 Z;  1N8R 1;  1TWA I;  4A93 I;  4NBE A;  2KPI A;  3TDH B;  4A3L I;  2KI7 B;  1JJ2 Y;  2RBL A;  3F3F C;  1TWF I;  1QVG Z;  2QRD B;  4TNU A;  1JJ2 Z;  2R7Z I;  1ML8 A;  1NJI 2;  3J80 b;  2O4H A;  2WAQ A;  4HGY A;  3M4O I;  3CME 1;  3NH8 A;  3BG1 B;  3VMG A;  3KIH A;  4A3B I;  1RO4 A;  2ZAE B;  2JUB A;  5IT9 b;  3S15 I;  1S72 1;  4A3C I;  3RZO I;  2LFU A;  3FKI I;  1VQ5 Z;  2EGT A;  3VB9 A;  3JAM f;  2QRE B;  2QKD A;  3CCM 1;  3NH4 A;  3HOY I;  3CXC Z;  3GTG I;  4BBR I;  3S17 I;  1YJW Z;  2E2I I;  2PM9 A;  4Y52 I;  4NH1 C;  4MON A;  3I56 1;  2NVT I;  3GCF A;  4NBF A;  3CCJ Z;  1PFT A;  4AYB A;  4X6A I;  3CCR 1;  1KC8 1;  1QVF Y;  2E2H I;  3S1M I;  5D1O A;  4A3K I;  3GTO I;  3GTK I;  1Y1W I;  2E9H A;  2P3Y A;  2RHB A;  1M90 2;  1Y1V S;  3EER A;  1VLA A;  1YJN Z;  3I55 Z;  3CCR Z;  3CCQ Z;  2OOY B;  1TFI A;  2J6A A;  4HH4 A;  2RT9 A;  5IT9 f;  3CPW Z;  3HOX I;  2JMO A;  1I3Q I;  4NB9 A;  1KC8 2;  3PO3 S;  3CME Z;  1VQN Z;  4NBA A;  1K73 2;  2PMZ A;  1I50 I;  1RO2 A;  1YHQ Z;  4CL1 A;  4RVG A;  1Q81 1;  3CCE Z;  2V8I A;  1JWH C;  1NJI 1;  2IZ4 A;  2G2K A;  3CD6 Z;  3G4S 1;  3I4M I;  3D9X A;  2O53 A;  3GTJ I;  5D1P A;  3S2D I;  3MZL B;  4RS4 A;  2BJO A;  1N2F A;  1YHQ 1;  3H3V J;  1LQL A;  1DL6 A;  3CD6 1;  2JS4 A;  4Y7N I;  1W2B Y;  1WII A;  3OW2 Z;  3MON A;  1ZB9 A;  1VQ6 1;  1NP6 A;  1Z01 A;  3T4N B;  3S16 I;  4NBG A;  4A3M I;  1YIT Z;  3EED A;  1Q81 2;  1RNI A;  1KRL A;  2OTJ Z;  5D1O B;  3VTN A;  3LUS A;  1K73 1;  4A3D I;  4NBB A;  2VF1 A;  2HF1 A;  1K8A 1;  1KQS Z;  5C4J I;  1RQF A;  1YJW 1;  1Q7Y 2;  2GTH A;  1USP B;  4RVH A;  3CMA 1;  4NBC A;  4NBH A;  4E2Z A;  2K3R A;  2OTJ 1;  1YJ9 Z;  4A3J I;  4BXX I;  4NB8 A;  1Z02 A;  3G6E 1;  3HOV I;  1USP A;  2R93 I;  4QTT A;  1VQ8 1;  1VQK 1;  2B63 I;  1N8R 2;  3G71 1;  4MH4 A;  1VQ9 1;  1S72 Z;  3J81 f;  1K8A 2;  3CCQ 1;  1Q82 2;  4NBD A;  1R9T I;  1QYP A;  4E2Y A;  3Q87 A;  1YJ9 1;  3CC2 1;  4BBS I;  3I07 A;  3IX0 A;  1YI2 1;  1K9M 1;  1VQ8 Z;  5C3E I;  4MRI A;  3JAM b;  3HOW I;  4RV9 A;  2YU9 I;  2JR6 A;  3TE5 B;  2WB1 A;  3CCV Z;  1L1O C;  1TWG I;  5FLX f;  3CCL 1;  4HGZ A;  4EWC A;  3P5J B;  4E32 A;  3CCU 1;  3CC4 Z;  3HKZ A;  5IP7 I;  1YIJ Z;  1VQ7 1;  1I6H I;  2M6N A;  1KD1 1;  3FQM A;  2JA7 I;  2OTL Z;  2VUM I;  5IP9 I;  4E33 A;  3S1R I;  3NH5 A;  1VQP Z;  4NOZ A;  2OOX B;  3NFZ A;  1Q82 1;  3J81 b;  4S1T A;  1Q86 1;  3FQQ A;  1WW9 A;  3S14 I;  3GTQ I;  1K83 I;  3CMA Z;  5A2Q b;  3CCS Z;  3PO2 I;  5T67 A;  2RPR A;  1VQ5 1;  4QTU A;  4E31 A;  1KQS Y;  1VQP 1;  5A2Q f;  2OZK A;  1WCM I;  5FLX b;  1Z03 A;  1TWC I;  2V8J A;  2Q4Z A;  3QWU A;  2Q51 A;  1M90 1;  3I56 Z;  4A3I I;  3CC7 1;  3GTM S;  1VQ9 Z;  3CQZ I;  3GTP I;  2NVY I;  1YUK A;  3K7A I;  1X3Z A;  2NVQ I;  5C44 I;  1VQ4 Z;  3D6W A;  4BY7 I;  4MD7 A;  3MZK B;  2M48 A;  2K5R A;  1QVF Z;  2JA8 I;  4RVF A;  4MXU A;  5LL6 f;  2I3C A;  1VQO Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...