2E2JI

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI02
3S1QI 4A3KI 2AKLA 2F4OA 1WW9A 3VMGA 1TWFI 1SFOI 3I07A 3GTGI 2JR6A 2JNYA 3GTMI 4NB8A 2E2JI 3S2HI 1Y1VI 5IP7I 3H3VJ 3ESWA 4X6AI 3HOWI 1USPA 3GKQA 3CQZI 2PK7A 3VB9A 3HOZI 3HOUI 1K83I 4BY1I 1NUIA 2R92I 3K7AI 1RLYA 3HOVI 2K5RA 3GTPI 3U50C 4BBRI 3FKII 2J6AA 3GTJI 2KPIA 4NBBA 4A3EI 2YU9I 3VMHA 1TWCI 2DE6A 2HF1A 3Q87A 1I50I 1DL6A 1I6HI 3HOXI 2NVTI 2JA6I 4BBSI 2P3YA 4MH4A 4XX2A 4A3MI 2RBLA 1TWHI 5C4JI 2E2II 4BY7I 1LQLA 3PO2I 1Y1WI 4A3DI 4A3LI 1I3QI 4Y52I 1USPB 4A93I 2VUMI 4A3BI 3GTKI 4A3II 2JA5I 4A3GI 2NVXI 3EERA 4NBHA 3H0GI 1TWAI 1VLAA 3M4OI 2JS4A 4NBAA 5FLMI 1R9TI 1QYPA 4NBGA 3S1NI 4NB9A 4A3CI 3GTMS 3D6WA 3HOYI 1TFIA 1L1OC 1ZB8A 1YUAA 1Y1VS 1X3ZA 2NVQI 2R93I 3RZOI 5C4XI 3GTQI 1N2FA 3PO3I 2DE7A 2JA7I 5CM2M 2R7ZI 1ML8A 2NVYI 5C44I 1ZB9A 3GTOI 3RZDI 3S1RI 4NBCA 4BXXI 2JA8I 3S15I 3I4NI 4NBEA 3VMIA 4QTUA 3S1MI 4QTTA 4NBDA 3S16I 3LUSA 4Y7NI 2E2HI 1RO4A 2F4MA 1TWGI 1X3WA 3I4MI 3S14I 4NOZA 5IP9I 3S17I 3GCFA 3PO3S 1WCMI 2BJOA 3S2DI 2B63I 2DE5A 5C3EI 4A3FI 3GTLI 1PFTA 4A3JI 3M3YI 4NBFA
chains in the Genus database with same CATH superfamily
3IFUA 4A3KI 1S721 2F4OA 2QREB 2QR1B 1WW9A 3VMGA 1KQSY 1QXFA 3I07A 3GTGI 3TDHB 2JNYA 3GTMI 4NB8A 3NH5A 4RV9A 1VQ61 2Q4ZA 2E2JI 3H3VJ 3ESWA 2WAQA 4X6AI 1USPA 3GKQA 1N8R1 1YJWZ 1K8A1 4DQYB 4RS4A 1QVFZ 2VF1A 4MONA 1YJW1 5IT9f 4BBRI 3FKII 5T67A 4A3EI 3VMHA 2DE6A 1I50I 1S7MA 5T64A 2OTJZ 1NP6A 1QVGZ 3F3PC 4AYBA 2E2II 3PO2I 1YI2Z 4A93I 2M48A 4MRIA 3GTKI 2PM9A 3CXCY 3T4NB 1Q812 2NVXI 2R6MA 3D9XA 1VLAA 2AYDA 3M4OI 2JS4A 3NDIA 5FLMI 1YHQZ 1QYPA 2O4HA 2H85A 2JIMA 2W03A 4EWCA 3FQQA 3CMEZ 1YHQ1 3BG1B 3TE5B 1YJNZ 2GTIA 2NVQI 2LIYA 2M6NA 1ML8A 2YADA 2ZAEB 1Q7Y2 1W2BY 1FDOA 3F3FC 3S1RI 1YUKA 3CCMZ 2G2KA 4NBDA 2JIPA 2KI7B 1X3WA 5AN9F 2GU2A 2VUGA 3PO3S 2BJOA 3CXCZ 2K3RA 1M902 4A3JI 1VQ51 3S1QI 4NBFA 1QVFY 1VQMZ 1K9M1 1SFOI 4HGZA 4S1TA 3EEDA 2QKDA 2OOXB 4HH4A 2QEXZ 1RQFA 3VB9A 4RVDA 3CCQZ 3HOZI 3CC2Z 1S72Z 2R92I 3CCQ1 3GTPI 2KPIA 4NBBA 3CC21 3CCUZ 1WIIA 1TWCI 3KIFA 1VQ6Z 3CCU1 2NVTI 1Q7Y1 4MH4A 4A3MI 3CCJ1 1VQ71 1TWHI 4NH1C 3CMA1 4BY7I 2OOYB 1VQP1 4A3LI 1USPB 1RO2A 2VPYA 4A3II 2JA5I 4A3GI 3G711 1Q861 2O53A 1VQ4Z 4NBHA 1VQOZ 3NH8A 1Z03A 2GTHA 4RVGA 1VQ41 1VQNZ 1VQO1 3MONA 1M901 3D6WA 1VQN1 3CC41 5D1OA 1YUAA 1Y1VS 5D1OB 4DK1A 5C4XI 3IR7A 4E2WA 1VQK1 5C44I 1ZB9A 3GTOI 4RVFA 3I561 2JA8I 2P28A 3S15I 2LEXA 3I4NI 2RT9A 1M1K1 4QTTA 2WB1A 2E7ZA 3LUSA 2IZ4A 2F4MA 5IP9I 3GCFA 1K732 1WCMI 1Z01A 3S2DI 2B63I 5C3EI 3QWUA 4NFRA 4A3FI 1VQ81 4E2ZA 2Y0SA 3M3YI 2V8JA 2IV2X 3MZLB 2QLVB 1Z02A 4MD8A 1KC82 2JR6A 3J81f 3S2HI 2VPXA 1Y1VI 5IP7I 1VQ5Z 3HOUI 1YIJ1 4BY1I 1NUIA 2V8KA 1JJ2Y 1RLYA 2K5RA 2V3VA 2J6AA 1N8R2 4E32A 1ZH1A 4E2YA 5LL6f 2HF1A 3Q87A 1DL6A 2EGTA 2W04A 2P3YA 4XX2A 1Q811 5C4JI 1LQLA 3CCRZ 1I3QI 4Y52I 2V8IA 4A3BI 1FDIA 3CCR1 1KRLA 1AA6A 1KD12 4DGLA 3H0GI 3J7A4 2OTLZ 1Y8CA 3CPWY 4NBAA 2QRDB 1RNIA 3D2LA 3J81b 3S1NI 3CCJZ 1VQ7Z 2OTL1 4NB9A 4A3CI 3CMAZ 1VQPZ 3FQMA 3CCVZ 1ZB8A 1X3ZA 3J80f 1KC81 3CCV1 1N2FA 3PO3I 2JA7I 3G71Z 2RPRA 5CM2M 1JJ2Z 1YIT1 3CCL1 3I551 5A2Qb 3CCE1 3G6EZ 3CCS1 3IF8A 2JIRA 3CC71 3G6E1 2JIQA 2E9HA 3IX0A 4NBEA 3VMIA 4QTUA 3CC4Z 4E31A 1JWHC 2Q51A 4TNUA 2VPWA 4E33A 4Y7NI 1Q822 2E2HI 1RO4A 3BG0B 1VQKZ 4HGYA 4NOZA 3S17I 5T6BA 2IZ3A 2DE5A 2QRCB 3GTLI 3I56Z 1WZNA 3CPWZ 4MD9A 2AKLA 4CL1A 1TWFI 5FLXb 2OTJ1 4E30A 1KD11 3J80b 3HOWI 1K9M2 2JUBA 3CQZI 2PK7A 3OW2Y 1VQ8Z 3NFZA 1NJI2 1K83I 1YI21 1Q16A 3K7AI 5D1PA 1KQSZ 3HOVI 3U50C 3GTJI 2YU9I 2V45A 4MD7A 1WJ2A 2JIOA 1I6HI 3HOXI 2JA6I 4RVHA 4BBSI 1VQLZ 2RBLA 2HU9A 3CME1 2VPZA 4A3DI 1YIJZ 1Y1WI 3JAMf 1YJN1 1VQL1 4E2XA 2VUMI 4MXUA 5IT9b 3CD6Z 1X0TA 1P9NA 3NDJA 2QA4Z 1VQ9Z 3VTNA 1SIWA 3EERA 2I3CA 5A2Qf 1TWAI 1Q821 3CD61 2QA41 1VQ91 2OZKA 1R9TI 2RHBA 4NBGA 1K8A2 1Q862 3GTMS 3MZKB 3HOYI 1TFIA 2NAPA 3OW2Z 2LFUA 1L1OC 2PMZA 2R93I 3CCM1 1YJ9Z 3RZOI 3GTQI 2DE7A 2R7ZI 3P5JB 2NVYI 1YJ91 3RZDI 3G4SZ 4NBCA 4BXXI 2JMOA 1NJI1 1K731 1RO0A 3G4S1 3NH4A 1VQM1 3S1MI 5FLXf 3KIHA 3S16I 3HKZA 1QVGY 3JAMb 1TWGI 3I4MI 1QF8A 3S14I 1YITZ 3CCLZ 1W2BZ 3I55Z 3CCEZ 2QEX1 3CCSZ 1M1K2 1PFTA 3CC7Z 2RIQA
chains in the Genus database with same CATH topology
3IFUA 4A3KI 1S721 2F4OA 2QREB 2QR1B 1WW9A 3VMGA 1KQSY 3I07A 3GTGI 3TDHB 2JNYA 3GTMI 4NB8A 3NH5A 4RV9A 1VQ61 2Q4ZA 2E2JI 3H3VJ 3ESWA 2WAQA 4X6AI 1USPA 3GKQA 1N8R1 1YJWZ 1K8A1 4DQYB 4RS4A 1QVFZ 2VF1A 4MONA 1YJW1 5IT9f 4BBRI 3FKII 5T67A 4A3EI 3VMHA 2DE6A 1I50I 1S7MA 5T64A 2OTJZ 1NP6A 1QVGZ 3F3PC 4AYBA 2E2II 3PO2I 1YI2Z 4A93I 2M48A 4MRIA 3GTKI 2PM9A 3CXCY 3T4NB 1Q812 2NVXI 2R6MA 3D9XA 1VLAA 3M4OI 2JS4A 3NDIA 5FLMI 1YHQZ 1QYPA 2O4HA 2H85A 2W03A 4EWCA 3FQQA 3CMEZ 1YHQ1 3BG1B 3TE5B 1YJNZ 2GTIA 2NVQI 2LIYA 2M6NA 1ML8A 2YADA 2ZAEB 1Q7Y2 1W2BY 3F3FC 3S1RI 1YUKA 3CCMZ 2G2KA 4NBDA 2KI7B 1X3WA 5AN9F 2GU2A 2VUGA 3PO3S 2BJOA 3CXCZ 2K3RA 1M902 1VQ51 4A3JI 3S1QI 4NBFA 1QVFY 1VQMZ 1K9M1 1SFOI 4HGZA 4S1TA 3EEDA 2QKDA 2OOXB 4HH4A 2QEXZ 1RQFA 3VB9A 4RVDA 3CCQZ 3HOZI 3CC2Z 1S72Z 2R92I 3CCQ1 3GTPI 2KPIA 4NBBA 3CC21 3CCUZ 1WIIA 1TWCI 3KIFA 1VQ6Z 3CCU1 2NVTI 1Q7Y1 4MH4A 4A3MI 3CCJ1 1VQ71 1TWHI 4NH1C 3CMA1 4BY7I 2OOYB 1VQP1 4A3LI 1USPB 1RO2A 4A3II 2JA5I 4A3GI 3G711 1Q861 2O53A 1VQ4Z 4NBHA 1VQOZ 3NH8A 1Z03A 2GTHA 4RVGA 1VQ41 1VQNZ 1VQO1 3MONA 1M901 3D6WA 1VQN1 3CC41 5D1OA 1YUAA 1Y1VS 5D1OB 4DK1A 5C4XI 4E2WA 1VQK1 5C44I 1ZB9A 3GTOI 4RVFA 3I561 2JA8I 2P28A 3S15I 3I4NI 2RT9A 1M1K1 4QTTA 2WB1A 3LUSA 2IZ4A 2F4MA 5IP9I 3GCFA 1K732 1WCMI 1Z01A 3S2DI 2B63I 5C3EI 3QWUA 4NFRA 4A3FI 1VQ81 4E2ZA 2Y0SA 3M3YI 2V8JA 3MZLB 2QLVB 1Z02A 4MD8A 1KC82 2JR6A 3J81f 3S2HI 1Y1VI 5IP7I 1VQ5Z 3HOUI 1YIJ1 4BY1I 1NUIA 2V8KA 1JJ2Y 1RLYA 2K5RA 2J6AA 1N8R2 4E32A 1ZH1A 4E2YA 5LL6f 2HF1A 3Q87A 1DL6A 2EGTA 2W04A 2P3YA 4XX2A 1Q811 5C4JI 1LQLA 3CCRZ 1I3QI 4Y52I 2V8IA 4A3BI 3CCR1 1KRLA 1KD12 4DGLA 3H0GI 3J7A4 2OTLZ 3CPWY 4NBAA 2QRDB 1RNIA 3J81b 3S1NI 3CCJZ 1VQ7Z 2OTL1 4NB9A 4A3CI 3CMAZ 1VQPZ 3FQMA 3CCVZ 1ZB8A 1X3ZA 3J80f 1KC81 3CCV1 1N2FA 3PO3I 2JA7I 3G71Z 2RPRA 5CM2M 1JJ2Z 1YIT1 3CCL1 3I551 5A2Qb 3CCE1 3G6EZ 3CCS1 3IF8A 3CC71 3G6E1 2E9HA 3IX0A 4NBEA 3VMIA 4QTUA 3CC4Z 4E31A 1JWHC 2Q51A 4TNUA 4Y7NI 4E33A 1Q822 2E2HI 1RO4A 3BG0B 1VQKZ 4HGYA 4NOZA 3S17I 5T6BA 2IZ3A 2DE5A 2QRCB 3GTLI 3I56Z 3CPWZ 4MD9A 2AKLA 4CL1A 1TWFI 5FLXb 2OTJ1 4E30A 1KD11 3J80b 3HOWI 1K9M2 2JUBA 3CQZI 2PK7A 3OW2Y 1VQ8Z 3NFZA 1NJI2 1K83I 1YI21 3K7AI 5D1PA 1KQSZ 3HOVI 3U50C 3GTJI 2YU9I 4MD7A 1I6HI 3HOXI 2JA6I 4RVHA 4BBSI 1VQLZ 2RBLA 2HU9A 3CME1 4A3DI 1YIJZ 1Y1WI 3JAMf 1YJN1 1VQL1 4E2XA 2VUMI 4MXUA 5IT9b 3CD6Z 1X0TA 1P9NA 3NDJA 2QA4Z 1VQ9Z 3VTNA 3EERA 2I3CA 5A2Qf 1TWAI 1Q821 3CD61 2QA41 1VQ91 2OZKA 1R9TI 2RHBA 4NBGA 1K8A2 1Q862 3GTMS 3MZKB 3HOYI 1TFIA 3OW2Z 2LFUA 1L1OC 2PMZA 2R93I 3CCM1 1YJ9Z 3RZOI 3GTQI 2DE7A 2R7ZI 3P5JB 2NVYI 1YJ91 3RZDI 3G4SZ 4NBCA 4BXXI 2JMOA 1NJI1 1K731 1RO0A 3G4S1 3NH4A 1VQM1 3S1MI 5FLXf 3KIHA 3S16I 3HKZA 1QVGY 3JAMb 1TWGI 3I4MI 1QF8A 3S14I 1YITZ 3CCLZ 1W2BZ 3I55Z 3CCEZ 2QEX1 3CCSZ 1M1K2 1PFTA 3CC7Z 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q I;  4A3K I;  2AKL A;  2F4O A;  1WW9 A;  3VMG A;  1TWF I;  1SFO I;  3I07 A;  3GTG I;  2JR6 A;  2JNY A;  3GTM I;  4NB8 A;  2E2J I;  3S2H I;  1Y1V I;  5IP7 I;  3H3V J;  3ESW A;  4X6A I;  3HOW I;  1USP A;  3GKQ A;  3CQZ I;  2PK7 A;  3VB9 A;  3HOZ I;  3HOU I;  1K83 I;  4BY1 I;  1NUI A;  2R92 I;  3K7A I;  1RLY A;  3HOV I;  2K5R A;  3GTP I;  3U50 C;  4BBR I;  3FKI I;  2J6A A;  3GTJ I;  2KPI A;  4NBB A;  4A3E I;  2YU9 I;  3VMH A;  1TWC I;  2DE6 A;  2HF1 A;  3Q87 A;  1I50 I;  1DL6 A;  1I6H I;  3HOX I;  2NVT I;  2JA6 I;  4BBS I;  2P3Y A;  4MH4 A;  4XX2 A;  4A3M I;  2RBL A;  1TWH I;  5C4J I;  2E2I I;  4BY7 I;  1LQL A;  3PO2 I;  1Y1W I;  4A3D I;  4A3L I;  1I3Q I;  4Y52 I;  1USP B;  4A93 I;  2VUM I;  4A3B I;  3GTK I;  4A3I I;  2JA5 I;  4A3G I;  2NVX I;  3EER A;  4NBH A;  3H0G I;  1TWA I;  1VLA A;  3M4O I;  2JS4 A;  4NBA A;  5FLM I;  1R9T I;  1QYP A;  4NBG A;  3S1N I;  4NB9 A;  4A3C I;  3GTM S;  3D6W A;  3HOY I;  1TFI A;  1L1O C;  1ZB8 A;  1YUA A;  1Y1V S;  1X3Z A;  2NVQ I;  2R93 I;  3RZO I;  5C4X I;  3GTQ I;  1N2F A;  3PO3 I;  2DE7 A;  2JA7 I;  5CM2 M;  2R7Z I;  1ML8 A;  2NVY I;  5C44 I;  1ZB9 A;  3GTO I;  3RZD I;  3S1R I;  4NBC A;  4BXX I;  2JA8 I;  3S15 I;  3I4N I;  4NBE A;  3VMI A;  4QTU A;  3S1M I;  4QTT A;  4NBD A;  3S16 I;  3LUS A;  4Y7N I;  2E2H I;  1RO4 A;  2F4M A;  1TWG I;  1X3W A;  3I4M I;  3S14 I;  4NOZ A;  5IP9 I;  3S17 I;  3GCF A;  3PO3 S;  1WCM I;  2BJO A;  3S2D I;  2B63 I;  2DE5 A;  5C3E I;  4A3F I;  3GTL I;  1PFT A;  4A3J I;  3M3Y I;  4NBF A; 
#chains in the Genus database with same CATH topology
 3IFU A;  4A3K I;  1S72 1;  2F4O A;  2QRE B;  2QR1 B;  1WW9 A;  3VMG A;  1KQS Y;  1QXF A;  3I07 A;  3GTG I;  3TDH B;  2JNY A;  3GTM I;  4NB8 A;  3NH5 A;  4RV9 A;  1VQ6 1;  2Q4Z A;  2E2J I;  3H3V J;  3ESW A;  2WAQ A;  4X6A I;  1USP A;  3GKQ A;  1N8R 1;  1YJW Z;  1K8A 1;  4DQY B;  4RS4 A;  1QVF Z;  2VF1 A;  4MON A;  1YJW 1;  5IT9 f;  4BBR I;  3FKI I;  5T67 A;  4A3E I;  3VMH A;  2DE6 A;  1I50 I;  1S7M A;  5T64 A;  2OTJ Z;  1NP6 A;  1QVG Z;  3F3P C;  4AYB A;  2E2I I;  3PO2 I;  1YI2 Z;  4A93 I;  2M48 A;  4MRI A;  3GTK I;  2PM9 A;  3CXC Y;  3T4N B;  1Q81 2;  2NVX I;  2R6M A;  3D9X A;  1VLA A;  2AYD A;  3M4O I;  2JS4 A;  3NDI A;  5FLM I;  1YHQ Z;  1QYP A;  2O4H A;  2H85 A;  2JIM A;  2W03 A;  4EWC A;  3FQQ A;  3CME Z;  1YHQ 1;  3BG1 B;  3TE5 B;  1YJN Z;  2GTI A;  2NVQ I;  2LIY A;  2M6N A;  1ML8 A;  2YAD A;  2ZAE B;  1Q7Y 2;  1W2B Y;  1FDO A;  3F3F C;  3S1R I;  1YUK A;  3CCM Z;  2G2K A;  4NBD A;  2JIP A;  2KI7 B;  1X3W A;  5AN9 F;  2GU2 A;  2VUG A;  3PO3 S;  2BJO A;  3CXC Z;  2K3R A;  1M90 2;  4A3J I;  1VQ5 1;  3S1Q I;  4NBF A;  1QVF Y;  1VQM Z;  1K9M 1;  1SFO I;  4HGZ A;  4S1T A;  3EED A;  2QKD A;  2OOX B;  4HH4 A;  2QEX Z;  1RQF A;  3VB9 A;  4RVD A;  3CCQ Z;  3HOZ I;  3CC2 Z;  1S72 Z;  2R92 I;  3CCQ 1;  3GTP I;  2KPI A;  4NBB A;  3CC2 1;  3CCU Z;  1WII A;  1TWC I;  3KIF A;  1VQ6 Z;  3CCU 1;  2NVT I;  1Q7Y 1;  4MH4 A;  4A3M I;  3CCJ 1;  1VQ7 1;  1TWH I;  4NH1 C;  3CMA 1;  4BY7 I;  2OOY B;  1VQP 1;  4A3L I;  1USP B;  1RO2 A;  2VPY A;  4A3I I;  2JA5 I;  4A3G I;  3G71 1;  1Q86 1;  2O53 A;  1VQ4 Z;  4NBH A;  1VQO Z;  3NH8 A;  1Z03 A;  2GTH A;  4RVG A;  1VQ4 1;  1VQN Z;  1VQO 1;  3MON A;  1M90 1;  3D6W A;  1VQN 1;  3CC4 1;  5D1O A;  1YUA A;  1Y1V S;  5D1O B;  4DK1 A;  5C4X I;  3IR7 A;  4E2W A;  1VQK 1;  5C44 I;  1ZB9 A;  3GTO I;  4RVF A;  3I56 1;  2JA8 I;  2P28 A;  3S15 I;  2LEX A;  3I4N I;  2RT9 A;  1M1K 1;  4QTT A;  2WB1 A;  2E7Z A;  3LUS A;  2IZ4 A;  2F4M A;  5IP9 I;  3GCF A;  1K73 2;  1WCM I;  1Z01 A;  3S2D I;  2B63 I;  5C3E I;  3QWU A;  4NFR A;  4A3F I;  1VQ8 1;  4E2Z A;  2Y0S A;  3M3Y I;  2V8J A;  2IV2 X;  3MZL B;  2QLV B;  1Z02 A;  4MD8 A;  1KC8 2;  2JR6 A;  3J81 f;  3S2H I;  2VPX A;  1Y1V I;  5IP7 I;  1VQ5 Z;  3HOU I;  1YIJ 1;  4BY1 I;  1NUI A;  2V8K A;  1JJ2 Y;  1RLY A;  2K5R A;  2V3V A;  2J6A A;  1N8R 2;  4E32 A;  1ZH1 A;  4E2Y A;  5LL6 f;  2HF1 A;  3Q87 A;  1DL6 A;  2EGT A;  2W04 A;  2P3Y A;  4XX2 A;  1Q81 1;  5C4J I;  1LQL A;  3CCR Z;  1I3Q I;  4Y52 I;  2V8I A;  4A3B I;  1FDI A;  3CCR 1;  1KRL A;  1AA6 A;  1KD1 2;  4DGL A;  3H0G I;  3J7A 4;  2OTL Z;  1Y8C A;  3CPW Y;  4NBA A;  2QRD B;  1RNI A;  3D2L A;  3J81 b;  3S1N I;  3CCJ Z;  1VQ7 Z;  2OTL 1;  4NB9 A;  4A3C I;  3CMA Z;  1VQP Z;  3FQM A;  3CCV Z;  1ZB8 A;  1X3Z A;  3J80 f;  1KC8 1;  3CCV 1;  1N2F A;  3PO3 I;  2JA7 I;  3G71 Z;  2RPR A;  5CM2 M;  1JJ2 Z;  1YIT 1;  3CCL 1;  3I55 1;  5A2Q b;  3CCE 1;  3G6E Z;  3CCS 1;  3IF8 A;  2JIR A;  3CC7 1;  3G6E 1;  2JIQ A;  2E9H A;  3IX0 A;  4NBE A;  3VMI A;  4QTU A;  3CC4 Z;  4E31 A;  1JWH C;  2Q51 A;  4TNU A;  2VPW A;  4E33 A;  4Y7N I;  1Q82 2;  2E2H I;  1RO4 A;  3BG0 B;  1VQK Z;  4HGY A;  4NOZ A;  3S17 I;  5T6B A;  2IZ3 A;  2DE5 A;  2QRC B;  3GTL I;  3I56 Z;  1WZN A;  3CPW Z;  4MD9 A;  2AKL A;  4CL1 A;  1TWF I;  5FLX b;  2OTJ 1;  4E30 A;  1KD1 1;  3J80 b;  3HOW I;  1K9M 2;  2JUB A;  3CQZ I;  2PK7 A;  3OW2 Y;  1VQ8 Z;  3NFZ A;  1NJI 2;  1K83 I;  1YI2 1;  1Q16 A;  3K7A I;  5D1P A;  1KQS Z;  3HOV I;  3U50 C;  3GTJ I;  2YU9 I;  2V45 A;  4MD7 A;  1WJ2 A;  2JIO A;  1I6H I;  3HOX I;  2JA6 I;  4RVH A;  4BBS I;  1VQL Z;  2RBL A;  2HU9 A;  3CME 1;  2VPZ A;  4A3D I;  1YIJ Z;  1Y1W I;  3JAM f;  1YJN 1;  1VQL 1;  4E2X A;  2VUM I;  4MXU A;  5IT9 b;  3CD6 Z;  1X0T A;  1P9N A;  3NDJ A;  2QA4 Z;  1VQ9 Z;  3VTN A;  1SIW A;  3EER A;  2I3C A;  5A2Q f;  1TWA I;  1Q82 1;  3CD6 1;  2QA4 1;  1VQ9 1;  2OZK A;  1R9T I;  2RHB A;  4NBG A;  1K8A 2;  1Q86 2;  3GTM S;  3MZK B;  3HOY I;  1TFI A;  2NAP A;  3OW2 Z;  2LFU A;  1L1O C;  2PMZ A;  2R93 I;  3CCM 1;  1YJ9 Z;  3RZO I;  3GTQ I;  2DE7 A;  2R7Z I;  3P5J B;  2NVY I;  1YJ9 1;  3RZD I;  3G4S Z;  4NBC A;  4BXX I;  2JMO A;  1NJI 1;  1K73 1;  1RO0 A;  3G4S 1;  3NH4 A;  1VQM 1;  3S1M I;  5FLX f;  3KIH A;  3S16 I;  3HKZ A;  1QVG Y;  3JAM b;  1TWG I;  3I4M I;  1QF8 A;  3S14 I;  1YIT Z;  3CCL Z;  1W2B Z;  3I55 Z;  3CCE Z;  2QEX 1;  3CCS Z;  1M1K 2;  1PFT A;  3CC7 Z;  2RIQ A; 
#chains in the Genus database with same CATH homology
 3IFU A;  4A3K I;  1S72 1;  2F4O A;  2QRE B;  2QR1 B;  1WW9 A;  3VMG A;  1KQS Y;  3I07 A;  3GTG I;  3TDH B;  2JNY A;  3GTM I;  4NB8 A;  3NH5 A;  4RV9 A;  1VQ6 1;  2Q4Z A;  2E2J I;  3H3V J;  3ESW A;  2WAQ A;  4X6A I;  1USP A;  3GKQ A;  1N8R 1;  1YJW Z;  1K8A 1;  4DQY B;  4RS4 A;  1QVF Z;  2VF1 A;  4MON A;  1YJW 1;  5IT9 f;  4BBR I;  3FKI I;  5T67 A;  4A3E I;  3VMH A;  2DE6 A;  1I50 I;  1S7M A;  5T64 A;  2OTJ Z;  1NP6 A;  1QVG Z;  3F3P C;  4AYB A;  2E2I I;  3PO2 I;  1YI2 Z;  4A93 I;  2M48 A;  4MRI A;  3GTK I;  2PM9 A;  3CXC Y;  3T4N B;  1Q81 2;  2NVX I;  2R6M A;  3D9X A;  1VLA A;  3M4O I;  2JS4 A;  3NDI A;  5FLM I;  1YHQ Z;  1QYP A;  2O4H A;  2H85 A;  2W03 A;  4EWC A;  3FQQ A;  3CME Z;  1YHQ 1;  3BG1 B;  3TE5 B;  1YJN Z;  2GTI A;  2NVQ I;  2LIY A;  2M6N A;  1ML8 A;  2YAD A;  2ZAE B;  1Q7Y 2;  1W2B Y;  3F3F C;  3S1R I;  1YUK A;  3CCM Z;  2G2K A;  4NBD A;  2KI7 B;  1X3W A;  5AN9 F;  2GU2 A;  2VUG A;  3PO3 S;  2BJO A;  3CXC Z;  2K3R A;  1M90 2;  1VQ5 1;  4A3J I;  3S1Q I;  4NBF A;  1QVF Y;  1VQM Z;  1K9M 1;  1SFO I;  4HGZ A;  4S1T A;  3EED A;  2QKD A;  2OOX B;  4HH4 A;  2QEX Z;  1RQF A;  3VB9 A;  4RVD A;  3CCQ Z;  3HOZ I;  3CC2 Z;  1S72 Z;  2R92 I;  3CCQ 1;  3GTP I;  2KPI A;  4NBB A;  3CC2 1;  3CCU Z;  1WII A;  1TWC I;  3KIF A;  1VQ6 Z;  3CCU 1;  2NVT I;  1Q7Y 1;  4MH4 A;  4A3M I;  3CCJ 1;  1VQ7 1;  1TWH I;  4NH1 C;  3CMA 1;  4BY7 I;  2OOY B;  1VQP 1;  4A3L I;  1USP B;  1RO2 A;  4A3I I;  2JA5 I;  4A3G I;  3G71 1;  1Q86 1;  2O53 A;  1VQ4 Z;  4NBH A;  1VQO Z;  3NH8 A;  1Z03 A;  2GTH A;  4RVG A;  1VQ4 1;  1VQN Z;  1VQO 1;  3MON A;  1M90 1;  3D6W A;  1VQN 1;  3CC4 1;  5D1O A;  1YUA A;  1Y1V S;  5D1O B;  4DK1 A;  5C4X I;  4E2W A;  1VQK 1;  5C44 I;  1ZB9 A;  3GTO I;  4RVF A;  3I56 1;  2JA8 I;  2P28 A;  3S15 I;  3I4N I;  2RT9 A;  1M1K 1;  4QTT A;  2WB1 A;  3LUS A;  2IZ4 A;  2F4M A;  5IP9 I;  3GCF A;  1K73 2;  1WCM I;  1Z01 A;  3S2D I;  2B63 I;  5C3E I;  3QWU A;  4NFR A;  4A3F I;  1VQ8 1;  4E2Z A;  2Y0S A;  3M3Y I;  2V8J A;  3MZL B;  2QLV B;  1Z02 A;  4MD8 A;  1KC8 2;  2JR6 A;  3J81 f;  3S2H I;  1Y1V I;  5IP7 I;  1VQ5 Z;  3HOU I;  1YIJ 1;  4BY1 I;  1NUI A;  2V8K A;  1JJ2 Y;  1RLY A;  2K5R A;  2J6A A;  1N8R 2;  4E32 A;  1ZH1 A;  4E2Y A;  5LL6 f;  2HF1 A;  3Q87 A;  1DL6 A;  2EGT A;  2W04 A;  2P3Y A;  4XX2 A;  1Q81 1;  5C4J I;  1LQL A;  3CCR Z;  1I3Q I;  4Y52 I;  2V8I A;  4A3B I;  3CCR 1;  1KRL A;  1KD1 2;  4DGL A;  3H0G I;  3J7A 4;  2OTL Z;  3CPW Y;  4NBA A;  2QRD B;  1RNI A;  3J81 b;  3S1N I;  3CCJ Z;  1VQ7 Z;  2OTL 1;  4NB9 A;  4A3C I;  3CMA Z;  1VQP Z;  3FQM A;  3CCV Z;  1ZB8 A;  1X3Z A;  3J80 f;  1KC8 1;  3CCV 1;  1N2F A;  3PO3 I;  2JA7 I;  3G71 Z;  2RPR A;  5CM2 M;  1JJ2 Z;  1YIT 1;  3CCL 1;  3I55 1;  5A2Q b;  3CCE 1;  3G6E Z;  3CCS 1;  3IF8 A;  3CC7 1;  3G6E 1;  2E9H A;  3IX0 A;  4NBE A;  3VMI A;  4QTU A;  3CC4 Z;  4E31 A;  1JWH C;  2Q51 A;  4TNU A;  4Y7N I;  4E33 A;  1Q82 2;  2E2H I;  1RO4 A;  3BG0 B;  1VQK Z;  4HGY A;  4NOZ A;  3S17 I;  5T6B A;  2IZ3 A;  2DE5 A;  2QRC B;  3GTL I;  3I56 Z;  3CPW Z;  4MD9 A;  2AKL A;  4CL1 A;  1TWF I;  5FLX b;  2OTJ 1;  4E30 A;  1KD1 1;  3J80 b;  3HOW I;  1K9M 2;  2JUB A;  3CQZ I;  2PK7 A;  3OW2 Y;  1VQ8 Z;  3NFZ A;  1NJI 2;  1K83 I;  1YI2 1;  3K7A I;  5D1P A;  1KQS Z;  3HOV I;  3U50 C;  3GTJ I;  2YU9 I;  4MD7 A;  1I6H I;  3HOX I;  2JA6 I;  4RVH A;  4BBS I;  1VQL Z;  2RBL A;  2HU9 A;  3CME 1;  4A3D I;  1YIJ Z;  1Y1W I;  3JAM f;  1YJN 1;  1VQL 1;  4E2X A;  2VUM I;  4MXU A;  5IT9 b;  3CD6 Z;  1X0T A;  1P9N A;  3NDJ A;  2QA4 Z;  1VQ9 Z;  3VTN A;  3EER A;  2I3C A;  5A2Q f;  1TWA I;  1Q82 1;  3CD6 1;  2QA4 1;  1VQ9 1;  2OZK A;  1R9T I;  2RHB A;  4NBG A;  1K8A 2;  1Q86 2;  3GTM S;  3MZK B;  3HOY I;  1TFI A;  3OW2 Z;  2LFU A;  1L1O C;  2PMZ A;  2R93 I;  3CCM 1;  1YJ9 Z;  3RZO I;  3GTQ I;  2DE7 A;  2R7Z I;  3P5J B;  2NVY I;  1YJ9 1;  3RZD I;  3G4S Z;  4NBC A;  4BXX I;  2JMO A;  1NJI 1;  1K73 1;  1RO0 A;  3G4S 1;  3NH4 A;  1VQM 1;  3S1M I;  5FLX f;  3KIH A;  3S16 I;  3HKZ A;  1QVG Y;  3JAM b;  1TWG I;  3I4M I;  1QF8 A;  3S14 I;  1YIT Z;  3CCL Z;  1W2B Z;  3I55 Z;  3CCE Z;  2QEX 1;  3CCS Z;  1M1K 2;  1PFT A;  3CC7 Z;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...