2E2JI

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2jI02
2JNYA 4A3EI 3GTKI 3M3YI 2JR6A 2RBLA 5FLMI 4A3JI 3RZDI 1PFTA 3S2HI 1K83I 4QTUA 1R9TI 1X3WA 3GTOI 3I07A 4A3FI 2P3YA 2AKLA 3K7AI 2J6AA 3H3VJ 3S1QI 4Y52I 4A93I 2JA8I 3HOWI 3GTMI 3PO3I 1N2FA 1TWFI 4XX2A 2R92I 2NVXI 3VB9A 2R93I 3S1MI 1VLAA 3CQZI 4NBCA 2JS4A 3I4NI 4NBGA 5IP7I 3HOUI 2NVTI 2YU9I 3GCFA 4X6AI 3S1NI 4A3LI 1TFIA 1I3QI 4A3DI 1ZB8A 2BJOA 5C4JI 2KPIA 3S14I 3S1RI 1NUIA 3D6WA 2E2HI 2NVQI 1TWAI 5CM2M 4A3MI 3FKII 3HOVI 1L1OC 1ML8A 2DE5A 4A3BI 3HOXI 1TWCI 1LQLA 4Y7NI 1WW9A 2K5RA 4BY1I 2HF1A 2F4MA 3GTPI 4A3GI 3VMHA 5C4XI 3GTLI 1X3ZA 1QYPA 1USPB 5IP9I 2E2JI 2JA6I 3GTJI 3GTQI 1TWGI 2DE6A 3S2DI 3M4OI 5C3EI 3ESWA 4BXXI 3S16I 4NB8A 1WCMI 4NBAA 4NBEA 4NBHA 4NB9A 1Y1VS 4A3KI 3H0GI 3GTGI 5C44I 1TWHI 3S15I 1I6HI 4NBFA 3S17I 3LUSA 4MH4A 1USPA 3VMIA 3PO2I 1ZB9A 2DE7A 3VMGA 2JA5I 2VUMI 1YUAA 4BY7I 1Y1WI 3I4MI 4NBBA 1DL6A 2PK7A 1Y1VI 4A3CI 4BBSI 3Q87A 3RZOI 4NBDA 2JA7I 1SFOI 3HOZI 3HOYI 4QTTA 2R7ZI 4A3II 2B63I 1I50I 4NOZA 4BBRI 2F4OA 1RLYA 3GKQA 2E2II 3U50C 3GTMS 3EERA 3PO3S 2NVYI 1RO4A
chains in the Genus database with same CATH superfamily
2K3RA 2JNYA 1P9NA 1RNIA 1K731 2QKDA 2O4HA 2OTJZ 2VPYA 2RHBA 1K83I 4QTUA 2QEXZ 3I07A 4A3FI 1QVGZ 1VQ81 1QXFA 5T6BA 1YJ91 2GU2A 3PO3I 3J7A4 2JIPA 5D1OA 1N2FA 4RVGA 4XX2A 3JAMb 3J81b 2R92I 2NVXI 1X0TA 1YIT1 1Q822 2R93I 2LIYA 3S1MI 2OZKA 3CC21 3CQZI 1ZH1A 4DQYB 1W2BZ 3CPWY 1WIIA 4NBCA 4NBGA 3CCU1 2YU9I 1VQ41 1TFIA 1KQSY 1VQMZ 1NP6A 2V8IA 3S1RI 1TWAI 2JUBA 4A3MI 3CD6Z 5IT9b 2DE5A 3CCR1 1YHQ1 1VQ61 1WJ2A 2QA4Z 2AYDA 3GTLI 1Z02A 1X3ZA 1YJN1 4DGLA 3I55Z 3NDJA 3IFUA 1YUKA 2JA6I 2GTHA 2DE6A 2V45A 1WZNA 5C3EI 4BXXI 2VPZA 1VQ6Z 1Y1VS 4A3KI 3IF8A 4MXUA 2VPXA 4NBFA 5FLXf 1VQOZ 3LUSA 4MH4A 3PO2I 1S7MA 5LL6f 3CC71 1YUAA 4BY7I 1JJ2Z 2IV2X 3F3FC 2RT9A 2H85A 2WB1A 1M902 1VQN1 4A3CI 3CC41 3CXCZ 4NBDA 3HOYI 4QTTA 4A3II 4E33A 4NOZA 3BG1B 2F4OA 2JIMA 3GKQA 2NVYI 4HGZA 4A3EI 3GTKI 3M3YI 3G6EZ 1RO0A 2JR6A 3D2LA 3RZDI 3CC4Z 1VQLZ 1YJW1 1Y8CA 4RV9A 3J80b 4E2ZA 2P3YA 1QVFZ 4A93I 2I3CA 4MD7A 2R6MA 2QEX1 3GTMI 2EGTA 2JMOA 3G4SZ 3TDHB 1JWHC 1K732 1VLAA 1VQKZ 2HU9A 2OOYB 3I56Z 4X6AI 3S1NI 2Q51A 1I3QI 4A3DI 1ZB8A 2BJOA 2KPIA 3D6WA 1VQM1 2OTLZ 4MD8A 2RIQA 1ML8A 4A3BI 1LQLA 1N8R1 2OOXB 1Q7Y1 1WW9A 4E32A 3CD61 4E31A 4A3GI 3CCMZ 3VMHA 5C4XI 3NH4A 2QA41 2E2JI 3NH8A 3GTJI 3GTQI 1TWGI 2W03A 3CMEZ 2KI7B 3EEDA 1Q811 4AYBA 3QWUA 1QF8A 1WCMI 1VQ9Z 3I551 3MZKB 2V8KA 1TWHI 5A2Qf 1M1K1 3S17I 1K8A1 1NJI1 2DE7A 3T4NB 3J81f 3CMAZ 1Q861 3I4MI 1VQO1 3CCLZ 4NBBA 1K9M1 2PMZA 3KIFA 3OW2Y 2PK7A 3G71Z 1Y1VI 3Q87A 5FLXb 4HH4A 2Q4ZA 4E2YA 1SFOI 4EWCA 1I50I 3NFZA 4BBRI 2E2II 3U50C 1TWCI 3CCSZ 1S72Z 3FQMA 5IT9f 1QVGY 4TNUA 1PFTA 3GTOI 2WAQA 3G6E1 4NFRA 2E7ZA 3K7AI 3MONA 1VQL1 3KIHA 3IR7A 2ZAEB 1W2BY 2JA8I 3HOWI 3F3PC 1RQFA 1KRLA 1VQPZ 4HGYA 1YIJZ 3G4S1 2JS4A 3VTNA 5IP7I 3HOUI 2NVTI 2G2KA 3GCFA 1Q16A 1YI2Z 4A3LI 3NH5A 1Z03A 1VQK1 5C4JI 3CCQZ 3S14I 1NUIA 2QRCB 3I561 2E2HI 2RPRA 4S1TA 2NVQI 3CPWZ 4MONA 1FDIA 2M6NA 2V8JA 1KQSZ 4Y7NI 2VPWA 2M48A 2QR1B 2K5RA 2VUGA 2QRDB 1AA6A 4BY1I 2F4MA 4RVDA 2OTL1 3HKZA 3CCJZ 2YADA 2O53A 1RO2A 3CCM1 1KC81 3M4OI 3S16I 4NBAA 4NBEA 3J80f 4NB9A 1JJ2Y 1KD11 3OW2Z 3H0GI 3CME1 2NAPA 1N8R2 1VQ91 3VMIA 1Q7Y2 3CCVZ 1ZB9A 3CXCY 1VQ7Z 2JA5I 4CL1A 5D1OB 1Y1WI 1DL6A 1VQ5Z 5T64A 2GTIA 4MD9A 3CCEZ 4BBSI 3CMA1 1Q812 3P5JB 3CCL1 5A2Qb 3RZOI 3HOZI 4E2WA 3G711 1RLYA 2Y0SA 3BG0B 1M1K2 1K8A2 4E2XA 3PO3S 1NJI2 1Q821 1QVFY 2RBLA 3JAMf 2JIOA 5FLMI 4A3JI 1VQ8Z 1Q862 3S2HI 1K9M2 3CCS1 1S721 1R9TI 1X3WA 1YJ9Z 2P28A 2AKLA 2J6AA 3H3VJ 3S1QI 4Y52I 2JIQA 1YITZ 3TE5B 3CC2Z 3IX0A 2PM9A 1TWFI 2LFUA 3CCUZ 3VB9A 2QLVB 1VQ4Z 1VQP1 2W04A 4DK1A 3I4NI 4MRIA 1Z01A 1YIJ1 3CCRZ 1YHQZ 4E30A 3FQQA 1YI21 5CM2M 3FKII 3HOVI 1L1OC 3CCQ1 2V3VA 3HOXI 1YJNZ 2HF1A 5D1PA 3GTPI 2E9HA 1QYPA 3NDIA 1USPB 5IP9I 1M901 3S2DI 2QREB 2IZ4A 3CCJ1 3ESWA 4NB8A 2IZ3A 4NBHA 3GTGI 5C44I 4NH1C 3S15I 3CC7Z 1I6HI 3MZLB 1USPA 3VMGA 1VQNZ 1FDOA 2LEXA 2VUMI 3CCV1 5AN9F 1VQ71 2OTJ1 1KC82 4RVFA 2JIRA 1VQ51 1SIWA 2JA7I 4RS4A 4RVHA 2R7ZI 1KD12 2B63I 3CCE1 3D9XA 2VF1A 5T67A 3GTMS 3EERA 1YJWZ 1RO4A
chains in the Genus database with same CATH topology
2K3RA 2JNYA 1P9NA 1RNIA 1K731 2QKDA 2O4HA 2OTJZ 2RHBA 1K83I 4QTUA 2QEXZ 3I07A 4A3FI 1QVGZ 1VQ81 5T6BA 1YJ91 2GU2A 3PO3I 3J7A4 5D1OA 1N2FA 4RVGA 4XX2A 3JAMb 3J81b 2R92I 2NVXI 1X0TA 1YIT1 1Q822 2R93I 2LIYA 3S1MI 2OZKA 3CC21 3CQZI 1ZH1A 4DQYB 1W2BZ 3CPWY 1WIIA 4NBCA 4NBGA 3CCU1 2YU9I 1VQ41 1TFIA 1KQSY 1VQMZ 1NP6A 2V8IA 3S1RI 1TWAI 2JUBA 4A3MI 3CD6Z 5IT9b 2DE5A 3CCR1 1YHQ1 1VQ61 2QA4Z 3GTLI 1Z02A 1X3ZA 1YJN1 4DGLA 3I55Z 3NDJA 3IFUA 1YUKA 2JA6I 2GTHA 2DE6A 5C3EI 4BXXI 1VQ6Z 1Y1VS 4A3KI 3IF8A 4MXUA 4NBFA 5FLXf 1VQOZ 3LUSA 4MH4A 3PO2I 1S7MA 5LL6f 3CC71 1YUAA 4BY7I 1JJ2Z 3F3FC 2RT9A 2H85A 2WB1A 1M902 1VQN1 4A3CI 3CC41 3CXCZ 4NBDA 3HOYI 4QTTA 4A3II 4E33A 4NOZA 3BG1B 2F4OA 3GKQA 2NVYI 4HGZA 4A3EI 3GTKI 3M3YI 3G6EZ 1RO0A 2JR6A 3RZDI 3CC4Z 1VQLZ 1YJW1 4RV9A 3J80b 4E2ZA 2P3YA 1QVFZ 4A93I 2I3CA 4MD7A 2R6MA 2QEX1 3GTMI 2EGTA 2JMOA 3G4SZ 3TDHB 1JWHC 1K732 1VLAA 1VQKZ 2HU9A 2OOYB 3I56Z 4X6AI 3S1NI 2Q51A 1I3QI 4A3DI 1ZB8A 2BJOA 2KPIA 3D6WA 1VQM1 2OTLZ 4MD8A 2RIQA 1ML8A 4A3BI 1LQLA 1N8R1 2OOXB 1Q7Y1 1WW9A 4E32A 3CD61 4E31A 4A3GI 3CCMZ 3VMHA 5C4XI 3NH4A 2QA41 2E2JI 3NH8A 3GTJI 3GTQI 1TWGI 2W03A 3CMEZ 2KI7B 3EEDA 1Q811 4AYBA 3QWUA 1QF8A 1WCMI 1VQ9Z 3I551 3MZKB 2V8KA 1TWHI 5A2Qf 1M1K1 3S17I 1K8A1 1NJI1 2DE7A 3T4NB 3J81f 3CMAZ 1Q861 3I4MI 1VQO1 3CCLZ 4NBBA 1K9M1 2PMZA 3KIFA 3OW2Y 2PK7A 3G71Z 1Y1VI 3Q87A 5FLXb 4HH4A 2Q4ZA 4E2YA 1SFOI 4EWCA 1I50I 3NFZA 4BBRI 2E2II 3U50C 1TWCI 3CCSZ 1S72Z 3FQMA 5IT9f 1QVGY 4TNUA 1PFTA 3GTOI 2WAQA 3G6E1 4NFRA 3K7AI 3MONA 1VQL1 3KIHA 2ZAEB 1W2BY 2JA8I 3HOWI 3F3PC 1RQFA 1KRLA 1VQPZ 4HGYA 1YIJZ 3G4S1 2JS4A 3VTNA 5IP7I 3HOUI 2NVTI 2G2KA 3GCFA 1YI2Z 4A3LI 3NH5A 1Z03A 1VQK1 5C4JI 3CCQZ 3S14I 1NUIA 2QRCB 3I561 2E2HI 2RPRA 4S1TA 2NVQI 3CPWZ 4MONA 2M6NA 2V8JA 1KQSZ 4Y7NI 2M48A 2QR1B 2K5RA 2VUGA 2QRDB 4BY1I 2F4MA 4RVDA 2OTL1 3HKZA 3CCJZ 2YADA 2O53A 1RO2A 3CCM1 1KC81 3M4OI 3S16I 4NBAA 4NBEA 3J80f 4NB9A 1JJ2Y 1KD11 3OW2Z 3H0GI 3CME1 1N8R2 1VQ91 3VMIA 1Q7Y2 3CCVZ 1ZB9A 3CXCY 1VQ7Z 2JA5I 4CL1A 5D1OB 1Y1WI 1DL6A 1VQ5Z 5T64A 2GTIA 4MD9A 3CCEZ 4BBSI 3CMA1 1Q812 3P5JB 3CCL1 5A2Qb 3RZOI 3HOZI 4E2WA 3G711 1RLYA 2Y0SA 3BG0B 1M1K2 1K8A2 4E2XA 3PO3S 1NJI2 1Q821 1QVFY 2RBLA 3JAMf 5FLMI 4A3JI 1VQ8Z 1Q862 3S2HI 1K9M2 3CCS1 1S721 1R9TI 1X3WA 1YJ9Z 2P28A 2AKLA 2J6AA 3H3VJ 3S1QI 4Y52I 1YITZ 3TE5B 3CC2Z 3IX0A 2PM9A 1TWFI 2LFUA 3CCUZ 3VB9A 2QLVB 1VQ4Z 1VQP1 2W04A 4DK1A 3I4NI 4MRIA 1Z01A 1YIJ1 3CCRZ 1YHQZ 4E30A 3FQQA 1YI21 5CM2M 3FKII 3HOVI 1L1OC 3CCQ1 3HOXI 1YJNZ 2HF1A 5D1PA 3GTPI 2E9HA 1QYPA 3NDIA 1USPB 5IP9I 1M901 3S2DI 2QREB 2IZ4A 3CCJ1 3ESWA 4NB8A 2IZ3A 4NBHA 3GTGI 5C44I 4NH1C 3S15I 3CC7Z 1I6HI 3MZLB 1USPA 3VMGA 1VQNZ 2VUMI 3CCV1 5AN9F 1VQ71 2OTJ1 1KC82 4RVFA 1VQ51 2JA7I 4RS4A 4RVHA 2R7ZI 1KD12 2B63I 3CCE1 3D9XA 2VF1A 5T67A 3GTMS 3EERA 1YJWZ 1RO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNY A;  4A3E I;  3GTK I;  3M3Y I;  2JR6 A;  2RBL A;  5FLM I;  4A3J I;  3RZD I;  1PFT A;  3S2H I;  1K83 I;  4QTU A;  1R9T I;  1X3W A;  3GTO I;  3I07 A;  4A3F I;  2P3Y A;  2AKL A;  3K7A I;  2J6A A;  3H3V J;  3S1Q I;  4Y52 I;  4A93 I;  2JA8 I;  3HOW I;  3GTM I;  3PO3 I;  1N2F A;  1TWF I;  4XX2 A;  2R92 I;  2NVX I;  3VB9 A;  2R93 I;  3S1M I;  1VLA A;  3CQZ I;  4NBC A;  2JS4 A;  3I4N I;  4NBG A;  5IP7 I;  3HOU I;  2NVT I;  2YU9 I;  3GCF A;  4X6A I;  3S1N I;  4A3L I;  1TFI A;  1I3Q I;  4A3D I;  1ZB8 A;  2BJO A;  5C4J I;  2KPI A;  3S14 I;  3S1R I;  1NUI A;  3D6W A;  2E2H I;  2NVQ I;  1TWA I;  5CM2 M;  4A3M I;  3FKI I;  3HOV I;  1L1O C;  1ML8 A;  2DE5 A;  4A3B I;  3HOX I;  1TWC I;  1LQL A;  4Y7N I;  1WW9 A;  2K5R A;  4BY1 I;  2HF1 A;  2F4M A;  3GTP I;  4A3G I;  3VMH A;  5C4X I;  3GTL I;  1X3Z A;  1QYP A;  1USP B;  5IP9 I;  2E2J I;  2JA6 I;  3GTJ I;  3GTQ I;  1TWG I;  2DE6 A;  3S2D I;  3M4O I;  5C3E I;  3ESW A;  4BXX I;  3S16 I;  4NB8 A;  1WCM I;  4NBA A;  4NBE A;  4NBH A;  4NB9 A;  1Y1V S;  4A3K I;  3H0G I;  3GTG I;  5C44 I;  1TWH I;  3S15 I;  1I6H I;  4NBF A;  3S17 I;  3LUS A;  4MH4 A;  1USP A;  3VMI A;  3PO2 I;  1ZB9 A;  2DE7 A;  3VMG A;  2JA5 I;  2VUM I;  1YUA A;  4BY7 I;  1Y1W I;  3I4M I;  4NBB A;  1DL6 A;  2PK7 A;  1Y1V I;  4A3C I;  4BBS I;  3Q87 A;  3RZO I;  4NBD A;  2JA7 I;  1SFO I;  3HOZ I;  3HOY I;  4QTT A;  2R7Z I;  4A3I I;  2B63 I;  1I50 I;  4NOZ A;  4BBR I;  2F4O A;  1RLY A;  3GKQ A;  2E2I I;  3U50 C;  3GTM S;  3EER A;  3PO3 S;  2NVY I;  1RO4 A; 
#chains in the Genus database with same CATH topology
 2K3R A;  2JNY A;  1P9N A;  1RNI A;  1K73 1;  2QKD A;  2O4H A;  2OTJ Z;  2VPY A;  2RHB A;  1K83 I;  4QTU A;  2QEX Z;  3I07 A;  4A3F I;  1QVG Z;  1VQ8 1;  1QXF A;  5T6B A;  1YJ9 1;  2GU2 A;  3PO3 I;  3J7A 4;  2JIP A;  5D1O A;  1N2F A;  4RVG A;  4XX2 A;  3JAM b;  3J81 b;  2R92 I;  2NVX I;  1X0T A;  1YIT 1;  1Q82 2;  2R93 I;  2LIY A;  3S1M I;  2OZK A;  3CC2 1;  3CQZ I;  1ZH1 A;  4DQY B;  1W2B Z;  3CPW Y;  1WII A;  4NBC A;  4NBG A;  3CCU 1;  2YU9 I;  1VQ4 1;  1TFI A;  1KQS Y;  1VQM Z;  1NP6 A;  2V8I A;  3S1R I;  1TWA I;  2JUB A;  4A3M I;  3CD6 Z;  5IT9 b;  2DE5 A;  3CCR 1;  1YHQ 1;  1VQ6 1;  1WJ2 A;  2QA4 Z;  2AYD A;  3GTL I;  1Z02 A;  1X3Z A;  1YJN 1;  4DGL A;  3I55 Z;  3NDJ A;  3IFU A;  1YUK A;  2JA6 I;  2GTH A;  2DE6 A;  2V45 A;  1WZN A;  5C3E I;  4BXX I;  2VPZ A;  1VQ6 Z;  1Y1V S;  4A3K I;  3IF8 A;  4MXU A;  2VPX A;  4NBF A;  5FLX f;  1VQO Z;  3LUS A;  4MH4 A;  3PO2 I;  1S7M A;  5LL6 f;  3CC7 1;  1YUA A;  4BY7 I;  1JJ2 Z;  2IV2 X;  3F3F C;  2RT9 A;  2H85 A;  2WB1 A;  1M90 2;  1VQN 1;  4A3C I;  3CC4 1;  3CXC Z;  4NBD A;  3HOY I;  4QTT A;  4A3I I;  4E33 A;  4NOZ A;  3BG1 B;  2F4O A;  2JIM A;  3GKQ A;  2NVY I;  4HGZ A;  4A3E I;  3GTK I;  3M3Y I;  3G6E Z;  1RO0 A;  2JR6 A;  3D2L A;  3RZD I;  3CC4 Z;  1VQL Z;  1YJW 1;  1Y8C A;  4RV9 A;  3J80 b;  4E2Z A;  2P3Y A;  1QVF Z;  4A93 I;  2I3C A;  4MD7 A;  2R6M A;  2QEX 1;  3GTM I;  2EGT A;  2JMO A;  3G4S Z;  3TDH B;  1JWH C;  1K73 2;  1VLA A;  1VQK Z;  2HU9 A;  2OOY B;  3I56 Z;  4X6A I;  3S1N I;  2Q51 A;  1I3Q I;  4A3D I;  1ZB8 A;  2BJO A;  2KPI A;  3D6W A;  1VQM 1;  2OTL Z;  4MD8 A;  2RIQ A;  1ML8 A;  4A3B I;  1LQL A;  1N8R 1;  2OOX B;  1Q7Y 1;  1WW9 A;  4E32 A;  3CD6 1;  4E31 A;  4A3G I;  3CCM Z;  3VMH A;  5C4X I;  3NH4 A;  2QA4 1;  2E2J I;  3NH8 A;  3GTJ I;  3GTQ I;  1TWG I;  2W03 A;  3CME Z;  2KI7 B;  3EED A;  1Q81 1;  4AYB A;  3QWU A;  1QF8 A;  1WCM I;  1VQ9 Z;  3I55 1;  3MZK B;  2V8K A;  1TWH I;  5A2Q f;  1M1K 1;  3S17 I;  1K8A 1;  1NJI 1;  2DE7 A;  3T4N B;  3J81 f;  3CMA Z;  1Q86 1;  3I4M I;  1VQO 1;  3CCL Z;  4NBB A;  1K9M 1;  2PMZ A;  3KIF A;  3OW2 Y;  2PK7 A;  3G71 Z;  1Y1V I;  3Q87 A;  5FLX b;  4HH4 A;  2Q4Z A;  4E2Y A;  1SFO I;  4EWC A;  1I50 I;  3NFZ A;  4BBR I;  2E2I I;  3U50 C;  1TWC I;  3CCS Z;  1S72 Z;  3FQM A;  5IT9 f;  1QVG Y;  4TNU A;  1PFT A;  3GTO I;  2WAQ A;  3G6E 1;  4NFR A;  2E7Z A;  3K7A I;  3MON A;  1VQL 1;  3KIH A;  3IR7 A;  2ZAE B;  1W2B Y;  2JA8 I;  3HOW I;  3F3P C;  1RQF A;  1KRL A;  1VQP Z;  4HGY A;  1YIJ Z;  3G4S 1;  2JS4 A;  3VTN A;  5IP7 I;  3HOU I;  2NVT I;  2G2K A;  3GCF A;  1Q16 A;  1YI2 Z;  4A3L I;  3NH5 A;  1Z03 A;  1VQK 1;  5C4J I;  3CCQ Z;  3S14 I;  1NUI A;  2QRC B;  3I56 1;  2E2H I;  2RPR A;  4S1T A;  2NVQ I;  3CPW Z;  4MON A;  1FDI A;  2M6N A;  2V8J A;  1KQS Z;  4Y7N I;  2VPW A;  2M48 A;  2QR1 B;  2K5R A;  2VUG A;  2QRD B;  1AA6 A;  4BY1 I;  2F4M A;  4RVD A;  2OTL 1;  3HKZ A;  3CCJ Z;  2YAD A;  2O53 A;  1RO2 A;  3CCM 1;  1KC8 1;  3M4O I;  3S16 I;  4NBA A;  4NBE A;  3J80 f;  4NB9 A;  1JJ2 Y;  1KD1 1;  3OW2 Z;  3H0G I;  3CME 1;  2NAP A;  1N8R 2;  1VQ9 1;  3VMI A;  1Q7Y 2;  3CCV Z;  1ZB9 A;  3CXC Y;  1VQ7 Z;  2JA5 I;  4CL1 A;  5D1O B;  1Y1W I;  1DL6 A;  1VQ5 Z;  5T64 A;  2GTI A;  4MD9 A;  3CCE Z;  4BBS I;  3CMA 1;  1Q81 2;  3P5J B;  3CCL 1;  5A2Q b;  3RZO I;  3HOZ I;  4E2W A;  3G71 1;  1RLY A;  2Y0S A;  3BG0 B;  1M1K 2;  1K8A 2;  4E2X A;  3PO3 S;  1NJI 2;  1Q82 1;  1QVF Y;  2RBL A;  3JAM f;  2JIO A;  5FLM I;  4A3J I;  1VQ8 Z;  1Q86 2;  3S2H I;  1K9M 2;  3CCS 1;  1S72 1;  1R9T I;  1X3W A;  1YJ9 Z;  2P28 A;  2AKL A;  2J6A A;  3H3V J;  3S1Q I;  4Y52 I;  2JIQ A;  1YIT Z;  3TE5 B;  3CC2 Z;  3IX0 A;  2PM9 A;  1TWF I;  2LFU A;  3CCU Z;  3VB9 A;  2QLV B;  1VQ4 Z;  1VQP 1;  2W04 A;  4DK1 A;  3I4N I;  4MRI A;  1Z01 A;  1YIJ 1;  3CCR Z;  1YHQ Z;  4E30 A;  3FQQ A;  1YI2 1;  5CM2 M;  3FKI I;  3HOV I;  1L1O C;  3CCQ 1;  2V3V A;  3HOX I;  1YJN Z;  2HF1 A;  5D1P A;  3GTP I;  2E9H A;  1QYP A;  3NDI A;  1USP B;  5IP9 I;  1M90 1;  3S2D I;  2QRE B;  2IZ4 A;  3CCJ 1;  3ESW A;  4NB8 A;  2IZ3 A;  4NBH A;  3GTG I;  5C44 I;  4NH1 C;  3S15 I;  3CC7 Z;  1I6H I;  3MZL B;  1USP A;  3VMG A;  1VQN Z;  1FDO A;  2LEX A;  2VUM I;  3CCV 1;  5AN9 F;  1VQ7 1;  2OTJ 1;  1KC8 2;  4RVF A;  2JIR A;  1VQ5 1;  1SIW A;  2JA7 I;  4RS4 A;  4RVH A;  2R7Z I;  1KD1 2;  2B63 I;  3CCE 1;  3D9X A;  2VF1 A;  5T67 A;  3GTM S;  3EER A;  1YJW Z;  1RO4 A; 
#chains in the Genus database with same CATH homology
 2K3R A;  2JNY A;  1P9N A;  1RNI A;  1K73 1;  2QKD A;  2O4H A;  2OTJ Z;  2RHB A;  1K83 I;  4QTU A;  2QEX Z;  3I07 A;  4A3F I;  1QVG Z;  1VQ8 1;  5T6B A;  1YJ9 1;  2GU2 A;  3PO3 I;  3J7A 4;  5D1O A;  1N2F A;  4RVG A;  4XX2 A;  3JAM b;  3J81 b;  2R92 I;  2NVX I;  1X0T A;  1YIT 1;  1Q82 2;  2R93 I;  2LIY A;  3S1M I;  2OZK A;  3CC2 1;  3CQZ I;  1ZH1 A;  4DQY B;  1W2B Z;  3CPW Y;  1WII A;  4NBC A;  4NBG A;  3CCU 1;  2YU9 I;  1VQ4 1;  1TFI A;  1KQS Y;  1VQM Z;  1NP6 A;  2V8I A;  3S1R I;  1TWA I;  2JUB A;  4A3M I;  3CD6 Z;  5IT9 b;  2DE5 A;  3CCR 1;  1YHQ 1;  1VQ6 1;  2QA4 Z;  3GTL I;  1Z02 A;  1X3Z A;  1YJN 1;  4DGL A;  3I55 Z;  3NDJ A;  3IFU A;  1YUK A;  2JA6 I;  2GTH A;  2DE6 A;  5C3E I;  4BXX I;  1VQ6 Z;  1Y1V S;  4A3K I;  3IF8 A;  4MXU A;  4NBF A;  5FLX f;  1VQO Z;  3LUS A;  4MH4 A;  3PO2 I;  1S7M A;  5LL6 f;  3CC7 1;  1YUA A;  4BY7 I;  1JJ2 Z;  3F3F C;  2RT9 A;  2H85 A;  2WB1 A;  1M90 2;  1VQN 1;  4A3C I;  3CC4 1;  3CXC Z;  4NBD A;  3HOY I;  4QTT A;  4A3I I;  4E33 A;  4NOZ A;  3BG1 B;  2F4O A;  3GKQ A;  2NVY I;  4HGZ A;  4A3E I;  3GTK I;  3M3Y I;  3G6E Z;  1RO0 A;  2JR6 A;  3RZD I;  3CC4 Z;  1VQL Z;  1YJW 1;  4RV9 A;  3J80 b;  4E2Z A;  2P3Y A;  1QVF Z;  4A93 I;  2I3C A;  4MD7 A;  2R6M A;  2QEX 1;  3GTM I;  2EGT A;  2JMO A;  3G4S Z;  3TDH B;  1JWH C;  1K73 2;  1VLA A;  1VQK Z;  2HU9 A;  2OOY B;  3I56 Z;  4X6A I;  3S1N I;  2Q51 A;  1I3Q I;  4A3D I;  1ZB8 A;  2BJO A;  2KPI A;  3D6W A;  1VQM 1;  2OTL Z;  4MD8 A;  2RIQ A;  1ML8 A;  4A3B I;  1LQL A;  1N8R 1;  2OOX B;  1Q7Y 1;  1WW9 A;  4E32 A;  3CD6 1;  4E31 A;  4A3G I;  3CCM Z;  3VMH A;  5C4X I;  3NH4 A;  2QA4 1;  2E2J I;  3NH8 A;  3GTJ I;  3GTQ I;  1TWG I;  2W03 A;  3CME Z;  2KI7 B;  3EED A;  1Q81 1;  4AYB A;  3QWU A;  1QF8 A;  1WCM I;  1VQ9 Z;  3I55 1;  3MZK B;  2V8K A;  1TWH I;  5A2Q f;  1M1K 1;  3S17 I;  1K8A 1;  1NJI 1;  2DE7 A;  3T4N B;  3J81 f;  3CMA Z;  1Q86 1;  3I4M I;  1VQO 1;  3CCL Z;  4NBB A;  1K9M 1;  2PMZ A;  3KIF A;  3OW2 Y;  2PK7 A;  3G71 Z;  1Y1V I;  3Q87 A;  5FLX b;  4HH4 A;  2Q4Z A;  4E2Y A;  1SFO I;  4EWC A;  1I50 I;  3NFZ A;  4BBR I;  2E2I I;  3U50 C;  1TWC I;  3CCS Z;  1S72 Z;  3FQM A;  5IT9 f;  1QVG Y;  4TNU A;  1PFT A;  3GTO I;  2WAQ A;  3G6E 1;  4NFR A;  3K7A I;  3MON A;  1VQL 1;  3KIH A;  2ZAE B;  1W2B Y;  2JA8 I;  3HOW I;  3F3P C;  1RQF A;  1KRL A;  1VQP Z;  4HGY A;  1YIJ Z;  3G4S 1;  2JS4 A;  3VTN A;  5IP7 I;  3HOU I;  2NVT I;  2G2K A;  3GCF A;  1YI2 Z;  4A3L I;  3NH5 A;  1Z03 A;  1VQK 1;  5C4J I;  3CCQ Z;  3S14 I;  1NUI A;  2QRC B;  3I56 1;  2E2H I;  2RPR A;  4S1T A;  2NVQ I;  3CPW Z;  4MON A;  2M6N A;  2V8J A;  1KQS Z;  4Y7N I;  2M48 A;  2QR1 B;  2K5R A;  2VUG A;  2QRD B;  4BY1 I;  2F4M A;  4RVD A;  2OTL 1;  3HKZ A;  3CCJ Z;  2YAD A;  2O53 A;  1RO2 A;  3CCM 1;  1KC8 1;  3M4O I;  3S16 I;  4NBA A;  4NBE A;  3J80 f;  4NB9 A;  1JJ2 Y;  1KD1 1;  3OW2 Z;  3H0G I;  3CME 1;  1N8R 2;  1VQ9 1;  3VMI A;  1Q7Y 2;  3CCV Z;  1ZB9 A;  3CXC Y;  1VQ7 Z;  2JA5 I;  4CL1 A;  5D1O B;  1Y1W I;  1DL6 A;  1VQ5 Z;  5T64 A;  2GTI A;  4MD9 A;  3CCE Z;  4BBS I;  3CMA 1;  1Q81 2;  3P5J B;  3CCL 1;  5A2Q b;  3RZO I;  3HOZ I;  4E2W A;  3G71 1;  1RLY A;  2Y0S A;  3BG0 B;  1M1K 2;  1K8A 2;  4E2X A;  3PO3 S;  1NJI 2;  1Q82 1;  1QVF Y;  2RBL A;  3JAM f;  5FLM I;  4A3J I;  1VQ8 Z;  1Q86 2;  3S2H I;  1K9M 2;  3CCS 1;  1S72 1;  1R9T I;  1X3W A;  1YJ9 Z;  2P28 A;  2AKL A;  2J6A A;  3H3V J;  3S1Q I;  4Y52 I;  1YIT Z;  3TE5 B;  3CC2 Z;  3IX0 A;  2PM9 A;  1TWF I;  2LFU A;  3CCU Z;  3VB9 A;  2QLV B;  1VQ4 Z;  1VQP 1;  2W04 A;  4DK1 A;  3I4N I;  4MRI A;  1Z01 A;  1YIJ 1;  3CCR Z;  1YHQ Z;  4E30 A;  3FQQ A;  1YI2 1;  5CM2 M;  3FKI I;  3HOV I;  1L1O C;  3CCQ 1;  3HOX I;  1YJN Z;  2HF1 A;  5D1P A;  3GTP I;  2E9H A;  1QYP A;  3NDI A;  1USP B;  5IP9 I;  1M90 1;  3S2D I;  2QRE B;  2IZ4 A;  3CCJ 1;  3ESW A;  4NB8 A;  2IZ3 A;  4NBH A;  3GTG I;  5C44 I;  4NH1 C;  3S15 I;  3CC7 Z;  1I6H I;  3MZL B;  1USP A;  3VMG A;  1VQN Z;  2VUM I;  3CCV 1;  5AN9 F;  1VQ7 1;  2OTJ 1;  1KC8 2;  4RVF A;  1VQ5 1;  2JA7 I;  4RS4 A;  4RVH A;  2R7Z I;  1KD1 2;  2B63 I;  3CCE 1;  3D9X A;  2VF1 A;  5T67 A;  3GTM S;  3EER A;  1YJW Z;  1RO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...