1QVFY

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfY00
1K731 1VQN1 3CCQ1 1K732 1VQP1 3I55Z 1VQ91 3CC41 1VQLZ 1Q811 3G6EZ 1VQ51 2QEX1 1Q812 1YJ9Z 1W2BY 1VQOZ 1YJWZ 3G71Z 3OW2Z 1VQKZ 3CXCY 1YHQ1 3CMEZ 1Q822 3CCM1 2QA41 1S72Z 1YITZ 3CPWY 2OTJ1 3CCUZ 1VQ41 3CCVZ 1YIJ1 1KC81 2OTLZ 1JJ2Y 1M901 1VQMZ 3CD61 1YI21 1KC82 1Q861 1M902 3CCJZ 1VQNZ 1W2BZ 3I56Z 3CC71 1VQ8Z 1Q7Y1 1Q862 3CMAZ 3CXCZ 3CCS1 1KQSZ 1Q7Y2 1YJNZ 1Q821 3CPWZ 3CCLZ 1QVFY 1VQ9Z 3I551 1QVGY 1KD12 2QEXZ 3CCRZ 1VQ7Z 1K8A1 3CC2Z 1YJ91 1VQO1 1YJW1 1VQ6Z 1VQ4Z 1K8A2 3CME1 3G4S1 1S721 3CCQZ 1YIT1 3CCE1 1VQPZ 3CCU1 1YI2Z 1QVGZ 3CCV1 1N8R2 2OTL1 3CC4Z 1VQM1 1KD11 3CCSZ 3CCJ1 1VQ5Z 3I561 1JJ2Z 1VQ81 3CMA1 1VQL1 1YHQZ 3G6E1 1YJN1 3CCMZ 2QA4Z 3CCL1 3G711 1K9M1 1VQK1 2OTJZ 1M1K1 1K9M2 1YIJZ 1QVFZ 1M1K2 3CD6Z 1N8R1 3CCR1 1KQSY 1NJI1 1VQ71 3G4SZ 3CC21 1VQ61 3CC7Z 3CCEZ 1NJI2 3OW2Y
chains in the Genus database with same CATH superfamily
2E2HI 3CCQ1 2BJOA 2G2KA 1Y1VS 2LFUA 1TWGI 5C4XI 2JA7I 2GTIA 4NBAA 1VQ91 4NB9A 4BY7I 2VPWA 1Q811 5IP7I 1PFTA 1VQ51 4E2XA 2LEXA 1Q812 1SIWA 3G71Z 2JA6I 4NBGA 2VF1A 3CPWY 2R92I 4DK1A 3JAMf 3S15I 1KC81 3GTKI 2F4OA 5T64A 1VQMZ 3CD61 2PMZA 1KC82 2M6NA 1TWAI 1Q7Y1 3H0GI 1KQSZ 2E7ZA 2J6AA 1Q7Y2 3S1NI 1SFOI 5IT9f 2QEXZ 4NBHA 4Y7NI 3CCRZ 1TFIA 2OOXB 3I4MI 1K8A1 1VQ6Z 4A3BI 1K8A2 3VB9A 3GTJI 3PO3S 4AYBA 3ESWA 1VQPZ 1YI2Z 4QTUA 1AA6A 3M4OI 4MD9A 3GTOI 2NVQI 3P5JB 3CC4Z 1VQM1 1KD11 1WZNA 3T4NB 3VMHA 2R6MA 2R7ZI 3S16I 1VQL1 1I50I 3G6E1 3CCMZ 1P9NA 2AYDA 2QA4Z 1VQK1 4NBDA 1M1K1 1YIJZ 4RS4A 1M1K2 3CCR1 2V8JA 4E2WA 1FDOA 3G4SZ 4A3CI 2QRCB 1VQ61 3CC7Z 1I6HI 4RVDA 3CCEZ 1NUIA 1K731 3GTPI 4E2ZA 1K732 2YU9I 2QRDB 2HU9A 2W03A 4NFRA 3IX0A 1VQP1 3F3PC 1ML8A 3I55Z 3CC41 3J81b 2V8KA 2KI7B 1Y1WI 4E2YA 4RVHA 5C3EI 2VPYA 1ZB9A 1YJ9Z 1W2BY 1YJWZ 3OW2Z 2JA5I 5A2Qb 3CMEZ 3CCM1 2QA41 2V45A 5FLMI 2QLVB 2DE6A 3CCUZ 1YIJ1 3IF8A 3S1MI 3HOVI 3D9XA 3NH5A 3FQQA 1I3QI 4NH1C 4BY1I 1WW9A 2JIMA 3CCJZ 1VQNZ 3I56Z 3CC71 1VQ8Z 1FDIA 3GTQI 4S1TA 2GTHA 3CPWZ 3HOYI 1QVFY 4MONA 5T67A 4A3MI 3RZOI 2K5RA 3I551 4EWCA 3PO3I 3D2LA 3NDIA 2IZ3A 3RZDI 2RBLA 3NFZA 5D1OB 2JA8I 4NBCA 1YJ91 1YJW1 3CME1 3S2HI 4MH4A 3CCU1 2JIPA 1N8R2 3CCSZ 3CCJ1 1RQFA 3I561 1JJ2Z 1VQ81 5LL6f 2NVYI 3KIFA 1X3WA 4NBEA 2H85A 3HOZI 4A3EI 5IT9b 1DL6A 3G711 1K9M1 4RV9A 2PM9A 2W04A 2OTJZ 1LQLA 2QR1B 1K9M2 2HF1A 3TE5B 2JIOA 5C4JI 1KQSY 2VPZA 1TWHI 3BG0B 5D1OA 4BXXI 3EERA 3BG1B 4HGYA 1QXFA 3MONA 3NH8A 3TDHB 1USPB 2JNYA 2OOYB 2VUMI 3U50C 4A3FI 2P28A 2QEX1 4BBSI 3LUSA 1NJI2 2QKDA 1VQOZ 3CXCY 2WAQA 4DGLA 1Q822 1S72Z 2YADA 2OTJ1 3S1QI 2F4MA 2M48A 2ZAEB 4NOZA 3IFUA 3CCVZ 2IV2X 2KPIA 3J80f 2OTLZ 1RLYA 4MRIA 4A3GI 1YI21 2NVTI 3HOXI 2E2JI 2O53A 1KRLA 2LIYA 1W2BZ 2OZKA 4E30A 1WIIA 1JWHC 3D6WA 5FLXf 3CCLZ 1VQ9Z 1RO4A 1Z01A 1QVGY 2RT9A 3MZLB 2JR6A 3J81f 2AKLA 2V3VA 1VQ7Z 5CM2M 3CC2Z 1VQO1 3GCFA 1VQ4Z 1USPA 5A2Qf 3G4S1 1S721 3CCE1 1ZH1A 3CCV1 2OTL1 2Q51A 4HH4A 4BBRI 1QF8A 4A3LI 1YHQZ 3Q87A 3IR7A 1WCMI 1RO2A 3VMGA 3MZKB 2VUGA 3CCL1 3I4NI 1K83I 3S14I 3JAMb 2RHBA 4CL1A 1N8R1 4XX2A 4A93I 1VQ71 3CC21 2DE5A 5D1PA 1TWCI 3HOUI 1VQ41 3F3FC 1YUAA 4MD8A 1VQN1 1QYPA 2E9HA 5AN9F 3GTGI 2RPRA 2NAPA 4Y52I 1VQLZ 2PK7A 1VLAA 3KIHA 3GTMS 3G6EZ 2RIQA 2JS4A 1VQKZ 1WJ2A 1YHQ1 1X3ZA 3HOWI 4QTTA 4RVFA 3CQZI 4MD7A 2IZ4A 1YITZ 1L1OC 4DQYB 2GU2A 1X0TA 1S7MA 2V8IA 4NBFA 5T6BA 2JIRA 1M901 1JJ2Y 4A3II 1Q861 1TWFI 1N2FA 2EGTA 1M902 3S1RI 3S17I 1Q862 4E32A 3CMAZ 3VTNA 3CXCZ 3CCS1 1RNIA 5IP9I 1YJNZ 4TNUA 1Q821 3PO2I 3GKQA 3GTLI 1KD12 3HKZA 1NP6A 3QWUA 3S2DI 3I07A 1Q16A 2I3CA 1Y8CA 4X6AI 4NB8A 3K7AI 2JIQA 1YUKA 1Z02A 4A3JI 2P3YA 2DE7A 2B63I 1Y1VI 3J80b 3EEDA 3CCQZ 1YIT1 1Z03A 3H3VJ 2E2II 1QVGZ 4NBBA 4RVGA 3FQMA 2WB1A 3M3YI 4E33A 1ZB8A 2JMOA 4A3DI 1R9TI 3FKII 1VQ5Z 5FLXb 2QREB 3CMA1 4E31A 4A3KI 1YJN1 3NDJA 2VPXA 2K3RA 2Q4ZA 2R93I 1QVFZ 4HGZA 3J7A4 3CD6Z 2Y0SA 2O4HA 2NVXI 1NJI1 5C44I 3NH4A 2JUBA 3GTMI 4MXUA 3OW2Y 3VMIA 1RO0A
chains in the Genus database with same CATH topology
2E2HI 3CCQ1 2BJOA 2G2KA 1Y1VS 2LFUA 1TWGI 5C4XI 2JA7I 2GTIA 4NBAA 1VQ91 4NB9A 4BY7I 1Q811 5IP7I 1PFTA 1VQ51 4E2XA 1Q812 3G71Z 2JA6I 4NBGA 2VF1A 3CPWY 2R92I 4DK1A 3JAMf 3S15I 1KC81 3GTKI 2F4OA 5T64A 1VQMZ 3CD61 2PMZA 1KC82 2M6NA 1TWAI 1Q7Y1 3H0GI 1KQSZ 2J6AA 1Q7Y2 3S1NI 1SFOI 5IT9f 2QEXZ 4NBHA 4Y7NI 3CCRZ 1TFIA 2OOXB 3I4MI 1K8A1 1VQ6Z 4A3BI 1K8A2 3VB9A 3GTJI 3PO3S 4AYBA 3ESWA 1VQPZ 1YI2Z 4QTUA 3M4OI 4MD9A 3GTOI 2NVQI 3P5JB 3CC4Z 1VQM1 1KD11 3T4NB 3VMHA 2R6MA 2R7ZI 3S16I 1VQL1 1I50I 3G6E1 3CCMZ 1P9NA 2QA4Z 1VQK1 4NBDA 1M1K1 1YIJZ 4RS4A 1M1K2 3CCR1 2V8JA 4E2WA 3G4SZ 4A3CI 2QRCB 1VQ61 3CC7Z 1I6HI 4RVDA 3CCEZ 1NUIA 1K731 3GTPI 4E2ZA 1K732 2YU9I 2QRDB 2HU9A 2W03A 4NFRA 3IX0A 1VQP1 3F3PC 1ML8A 3I55Z 3CC41 3J81b 2V8KA 2KI7B 1Y1WI 4E2YA 4RVHA 5C3EI 1ZB9A 1YJ9Z 1W2BY 1YJWZ 3OW2Z 2JA5I 5A2Qb 3CMEZ 3CCM1 2QA41 5FLMI 2QLVB 2DE6A 3CCUZ 1YIJ1 3IF8A 3S1MI 3HOVI 3D9XA 3NH5A 3FQQA 1I3QI 4NH1C 4BY1I 1WW9A 3CCJZ 1VQNZ 3I56Z 3CC71 1VQ8Z 3GTQI 4S1TA 2GTHA 3CPWZ 3HOYI 1QVFY 4MONA 5T67A 4A3MI 3RZOI 2K5RA 3I551 4EWCA 3PO3I 3NDIA 2IZ3A 3RZDI 2RBLA 3NFZA 5D1OB 2JA8I 4NBCA 1YJ91 1YJW1 3CME1 3S2HI 4MH4A 3CCU1 1N8R2 3CCSZ 3CCJ1 1RQFA 3I561 1JJ2Z 1VQ81 5LL6f 2NVYI 3KIFA 1X3WA 4NBEA 2H85A 3HOZI 4A3EI 5IT9b 1DL6A 3G711 1K9M1 4RV9A 2PM9A 2W04A 2OTJZ 1LQLA 2QR1B 1K9M2 2HF1A 3TE5B 5C4JI 1KQSY 1TWHI 3BG0B 5D1OA 4BXXI 3EERA 3BG1B 4HGYA 3MONA 3NH8A 3TDHB 1USPB 2JNYA 2OOYB 2VUMI 3U50C 4A3FI 2P28A 2QEX1 4BBSI 3LUSA 1NJI2 2QKDA 1VQOZ 3CXCY 2WAQA 4DGLA 1Q822 1S72Z 2YADA 2OTJ1 3S1QI 2F4MA 2M48A 2ZAEB 4NOZA 3IFUA 3CCVZ 2KPIA 3J80f 2OTLZ 1RLYA 4MRIA 4A3GI 1YI21 2NVTI 3HOXI 2E2JI 2O53A 1KRLA 2LIYA 1W2BZ 2OZKA 4E30A 1WIIA 1JWHC 3D6WA 5FLXf 3CCLZ 1VQ9Z 1RO4A 1Z01A 1QVGY 2RT9A 3MZLB 2JR6A 3J81f 2AKLA 1VQ7Z 5CM2M 3CC2Z 1VQO1 3GCFA 1VQ4Z 1USPA 5A2Qf 3G4S1 1S721 3CCE1 1ZH1A 3CCV1 2OTL1 2Q51A 4HH4A 4BBRI 1QF8A 4A3LI 1YHQZ 3Q87A 1WCMI 1RO2A 3VMGA 3MZKB 2VUGA 3CCL1 3I4NI 1K83I 3S14I 3JAMb 2RHBA 4CL1A 1N8R1 4XX2A 4A93I 1VQ71 3CC21 2DE5A 5D1PA 1TWCI 3HOUI 1VQ41 3F3FC 1YUAA 4MD8A 1VQN1 1QYPA 2E9HA 5AN9F 3GTGI 2RPRA 4Y52I 1VQLZ 2PK7A 1VLAA 3KIHA 3GTMS 3G6EZ 2RIQA 2JS4A 1VQKZ 1YHQ1 1X3ZA 3HOWI 4QTTA 4RVFA 3CQZI 4MD7A 2IZ4A 1YITZ 1L1OC 4DQYB 2GU2A 1X0TA 1S7MA 2V8IA 4NBFA 5T6BA 1JJ2Y 1M901 4A3II 1Q861 1TWFI 1N2FA 2EGTA 1M902 3S1RI 3S17I 1Q862 4E32A 3CMAZ 3VTNA 3CXCZ 3CCS1 1RNIA 5IP9I 1YJNZ 4TNUA 1Q821 3PO2I 3GKQA 3GTLI 1KD12 3HKZA 1NP6A 3QWUA 3S2DI 3I07A 2I3CA 4X6AI 4NB8A 3K7AI 1YUKA 1Z02A 4A3JI 2P3YA 2DE7A 2B63I 1Y1VI 3J80b 3EEDA 3CCQZ 1YIT1 1Z03A 3H3VJ 2E2II 1QVGZ 4NBBA 4RVGA 3FQMA 2WB1A 3M3YI 4E33A 1ZB8A 2JMOA 4A3DI 1R9TI 3FKII 1VQ5Z 5FLXb 2QREB 3CMA1 4E31A 4A3KI 1YJN1 3NDJA 2K3RA 2Q4ZA 2R93I 1QVFZ 4HGZA 3J7A4 3CD6Z 2Y0SA 2O4HA 2NVXI 1NJI1 5C44I 3NH4A 2JUBA 3GTMI 4MXUA 3OW2Y 3VMIA 1RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 1;  1VQN 1;  3CCQ 1;  1K73 2;  1VQP 1;  3I55 Z;  1VQ9 1;  3CC4 1;  1VQL Z;  1Q81 1;  3G6E Z;  1VQ5 1;  2QEX 1;  1Q81 2;  1YJ9 Z;  1W2B Y;  1VQO Z;  1YJW Z;  3G71 Z;  3OW2 Z;  1VQK Z;  3CXC Y;  1YHQ 1;  3CME Z;  1Q82 2;  3CCM 1;  2QA4 1;  1S72 Z;  1YIT Z;  3CPW Y;  2OTJ 1;  3CCU Z;  1VQ4 1;  3CCV Z;  1YIJ 1;  1KC8 1;  2OTL Z;  1JJ2 Y;  1M90 1;  1VQM Z;  3CD6 1;  1YI2 1;  1KC8 2;  1Q86 1;  1M90 2;  3CCJ Z;  1VQN Z;  1W2B Z;  3I56 Z;  3CC7 1;  1VQ8 Z;  1Q7Y 1;  1Q86 2;  3CMA Z;  3CXC Z;  3CCS 1;  1KQS Z;  1Q7Y 2;  1YJN Z;  1Q82 1;  3CPW Z;  3CCL Z;  1QVF Y;  1VQ9 Z;  3I55 1;  1QVG Y;  1KD1 2;  2QEX Z;  3CCR Z;  1VQ7 Z;  1K8A 1;  3CC2 Z;  1YJ9 1;  1VQO 1;  1YJW 1;  1VQ6 Z;  1VQ4 Z;  1K8A 2;  3CME 1;  3G4S 1;  1S72 1;  3CCQ Z;  1YIT 1;  3CCE 1;  1VQP Z;  3CCU 1;  1YI2 Z;  1QVG Z;  3CCV 1;  1N8R 2;  2OTL 1;  3CC4 Z;  1VQM 1;  1KD1 1;  3CCS Z;  3CCJ 1;  1VQ5 Z;  3I56 1;  1JJ2 Z;  1VQ8 1;  3CMA 1;  1VQL 1;  1YHQ Z;  3G6E 1;  1YJN 1;  3CCM Z;  2QA4 Z;  3CCL 1;  3G71 1;  1K9M 1;  1VQK 1;  2OTJ Z;  1M1K 1;  1K9M 2;  1YIJ Z;  1QVF Z;  1M1K 2;  3CD6 Z;  1N8R 1;  3CCR 1;  1KQS Y;  1NJI 1;  1VQ7 1;  3G4S Z;  3CC2 1;  1VQ6 1;  3CC7 Z;  3CCE Z;  1NJI 2;  3OW2 Y; 
#chains in the Genus database with same CATH topology
 2E2H I;  3CCQ 1;  2BJO A;  2G2K A;  1Y1V S;  2LFU A;  1TWG I;  5C4X I;  2JA7 I;  2GTI A;  4NBA A;  1VQ9 1;  4NB9 A;  4BY7 I;  2VPW A;  1Q81 1;  5IP7 I;  1PFT A;  1VQ5 1;  4E2X A;  2LEX A;  1Q81 2;  1SIW A;  3G71 Z;  2JA6 I;  4NBG A;  2VF1 A;  3CPW Y;  2R92 I;  4DK1 A;  3JAM f;  3S15 I;  1KC8 1;  3GTK I;  2F4O A;  5T64 A;  1VQM Z;  3CD6 1;  2PMZ A;  1KC8 2;  2M6N A;  1TWA I;  1Q7Y 1;  3H0G I;  1KQS Z;  2E7Z A;  2J6A A;  1Q7Y 2;  3S1N I;  1SFO I;  5IT9 f;  2QEX Z;  4NBH A;  4Y7N I;  3CCR Z;  1TFI A;  2OOX B;  3I4M I;  1K8A 1;  1VQ6 Z;  4A3B I;  1K8A 2;  3VB9 A;  3GTJ I;  3PO3 S;  4AYB A;  3ESW A;  1VQP Z;  1YI2 Z;  4QTU A;  1AA6 A;  3M4O I;  4MD9 A;  3GTO I;  2NVQ I;  3P5J B;  3CC4 Z;  1VQM 1;  1KD1 1;  1WZN A;  3T4N B;  3VMH A;  2R6M A;  2R7Z I;  3S16 I;  1VQL 1;  1I50 I;  3G6E 1;  3CCM Z;  1P9N A;  2AYD A;  2QA4 Z;  1VQK 1;  4NBD A;  1M1K 1;  1YIJ Z;  4RS4 A;  1M1K 2;  3CCR 1;  2V8J A;  4E2W A;  1FDO A;  3G4S Z;  4A3C I;  2QRC B;  1VQ6 1;  3CC7 Z;  1I6H I;  4RVD A;  3CCE Z;  1NUI A;  1K73 1;  3GTP I;  4E2Z A;  1K73 2;  2YU9 I;  2QRD B;  2HU9 A;  2W03 A;  4NFR A;  3IX0 A;  1VQP 1;  3F3P C;  1ML8 A;  3I55 Z;  3CC4 1;  3J81 b;  2V8K A;  2KI7 B;  1Y1W I;  4E2Y A;  4RVH A;  5C3E I;  2VPY A;  1ZB9 A;  1YJ9 Z;  1W2B Y;  1YJW Z;  3OW2 Z;  2JA5 I;  5A2Q b;  3CME Z;  3CCM 1;  2QA4 1;  2V45 A;  5FLM I;  2QLV B;  2DE6 A;  3CCU Z;  1YIJ 1;  3IF8 A;  3S1M I;  3HOV I;  3D9X A;  3NH5 A;  3FQQ A;  1I3Q I;  4NH1 C;  4BY1 I;  1WW9 A;  2JIM A;  3CCJ Z;  1VQN Z;  3I56 Z;  3CC7 1;  1VQ8 Z;  1FDI A;  3GTQ I;  4S1T A;  2GTH A;  3CPW Z;  3HOY I;  1QVF Y;  4MON A;  5T67 A;  4A3M I;  3RZO I;  2K5R A;  3I55 1;  4EWC A;  3PO3 I;  3D2L A;  3NDI A;  2IZ3 A;  3RZD I;  2RBL A;  3NFZ A;  5D1O B;  2JA8 I;  4NBC A;  1YJ9 1;  1YJW 1;  3CME 1;  3S2H I;  4MH4 A;  3CCU 1;  2JIP A;  1N8R 2;  3CCS Z;  3CCJ 1;  1RQF A;  3I56 1;  1JJ2 Z;  1VQ8 1;  5LL6 f;  2NVY I;  3KIF A;  1X3W A;  4NBE A;  2H85 A;  3HOZ I;  4A3E I;  5IT9 b;  1DL6 A;  3G71 1;  1K9M 1;  4RV9 A;  2PM9 A;  2W04 A;  2OTJ Z;  1LQL A;  2QR1 B;  1K9M 2;  2HF1 A;  3TE5 B;  2JIO A;  5C4J I;  1KQS Y;  2VPZ A;  1TWH I;  3BG0 B;  5D1O A;  4BXX I;  3EER A;  3BG1 B;  4HGY A;  1QXF A;  3MON A;  3NH8 A;  3TDH B;  1USP B;  2JNY A;  2OOY B;  2VUM I;  3U50 C;  4A3F I;  2P28 A;  2QEX 1;  4BBS I;  3LUS A;  1NJI 2;  2QKD A;  1VQO Z;  3CXC Y;  2WAQ A;  4DGL A;  1Q82 2;  1S72 Z;  2YAD A;  2OTJ 1;  3S1Q I;  2F4M A;  2M48 A;  2ZAE B;  4NOZ A;  3IFU A;  3CCV Z;  2IV2 X;  2KPI A;  3J80 f;  2OTL Z;  1RLY A;  4MRI A;  4A3G I;  1YI2 1;  2NVT I;  3HOX I;  2E2J I;  2O53 A;  1KRL A;  2LIY A;  1W2B Z;  2OZK A;  4E30 A;  1WII A;  1JWH C;  3D6W A;  5FLX f;  3CCL Z;  1VQ9 Z;  1RO4 A;  1Z01 A;  1QVG Y;  2RT9 A;  3MZL B;  2JR6 A;  3J81 f;  2AKL A;  2V3V A;  1VQ7 Z;  5CM2 M;  3CC2 Z;  1VQO 1;  3GCF A;  1VQ4 Z;  1USP A;  5A2Q f;  3G4S 1;  1S72 1;  3CCE 1;  1ZH1 A;  3CCV 1;  2OTL 1;  2Q51 A;  4HH4 A;  4BBR I;  1QF8 A;  4A3L I;  1YHQ Z;  3Q87 A;  3IR7 A;  1WCM I;  1RO2 A;  3VMG A;  3MZK B;  2VUG A;  3CCL 1;  3I4N I;  1K83 I;  3S14 I;  3JAM b;  2RHB A;  4CL1 A;  1N8R 1;  4XX2 A;  4A93 I;  1VQ7 1;  3CC2 1;  2DE5 A;  5D1P A;  1TWC I;  3HOU I;  1VQ4 1;  3F3F C;  1YUA A;  4MD8 A;  1VQN 1;  1QYP A;  2E9H A;  5AN9 F;  3GTG I;  2RPR A;  2NAP A;  4Y52 I;  1VQL Z;  2PK7 A;  1VLA A;  3KIH A;  3GTM S;  3G6E Z;  2RIQ A;  2JS4 A;  1VQK Z;  1WJ2 A;  1YHQ 1;  1X3Z A;  3HOW I;  4QTT A;  4RVF A;  3CQZ I;  4MD7 A;  2IZ4 A;  1YIT Z;  1L1O C;  4DQY B;  2GU2 A;  1X0T A;  1S7M A;  2V8I A;  4NBF A;  5T6B A;  2JIR A;  1M90 1;  1JJ2 Y;  4A3I I;  1Q86 1;  1TWF I;  1N2F A;  2EGT A;  1M90 2;  3S1R I;  3S17 I;  1Q86 2;  4E32 A;  3CMA Z;  3VTN A;  3CXC Z;  3CCS 1;  1RNI A;  5IP9 I;  1YJN Z;  4TNU A;  1Q82 1;  3PO2 I;  3GKQ A;  3GTL I;  1KD1 2;  3HKZ A;  1NP6 A;  3QWU A;  3S2D I;  3I07 A;  1Q16 A;  2I3C A;  1Y8C A;  4X6A I;  4NB8 A;  3K7A I;  2JIQ A;  1YUK A;  1Z02 A;  4A3J I;  2P3Y A;  2DE7 A;  2B63 I;  1Y1V I;  3J80 b;  3EED A;  3CCQ Z;  1YIT 1;  1Z03 A;  3H3V J;  2E2I I;  1QVG Z;  4NBB A;  4RVG A;  3FQM A;  2WB1 A;  3M3Y I;  4E33 A;  1ZB8 A;  2JMO A;  4A3D I;  1R9T I;  3FKI I;  1VQ5 Z;  5FLX b;  2QRE B;  3CMA 1;  4E31 A;  4A3K I;  1YJN 1;  3NDJ A;  2VPX A;  2K3R A;  2Q4Z A;  2R93 I;  1QVF Z;  4HGZ A;  3J7A 4;  3CD6 Z;  2Y0S A;  2O4H A;  2NVX I;  1NJI 1;  5C44 I;  3NH4 A;  2JUB A;  3GTM I;  4MXU A;  3OW2 Y;  3VMI A;  1RO0 A; 
#chains in the Genus database with same CATH homology
 2E2H I;  3CCQ 1;  2BJO A;  2G2K A;  1Y1V S;  2LFU A;  1TWG I;  5C4X I;  2JA7 I;  2GTI A;  4NBA A;  1VQ9 1;  4NB9 A;  4BY7 I;  1Q81 1;  5IP7 I;  1PFT A;  1VQ5 1;  4E2X A;  1Q81 2;  3G71 Z;  2JA6 I;  4NBG A;  2VF1 A;  3CPW Y;  2R92 I;  4DK1 A;  3JAM f;  3S15 I;  1KC8 1;  3GTK I;  2F4O A;  5T64 A;  1VQM Z;  3CD6 1;  2PMZ A;  1KC8 2;  2M6N A;  1TWA I;  1Q7Y 1;  3H0G I;  1KQS Z;  2J6A A;  1Q7Y 2;  3S1N I;  1SFO I;  5IT9 f;  2QEX Z;  4NBH A;  4Y7N I;  3CCR Z;  1TFI A;  2OOX B;  3I4M I;  1K8A 1;  1VQ6 Z;  4A3B I;  1K8A 2;  3VB9 A;  3GTJ I;  3PO3 S;  4AYB A;  3ESW A;  1VQP Z;  1YI2 Z;  4QTU A;  3M4O I;  4MD9 A;  3GTO I;  2NVQ I;  3P5J B;  3CC4 Z;  1VQM 1;  1KD1 1;  3T4N B;  3VMH A;  2R6M A;  2R7Z I;  3S16 I;  1VQL 1;  1I50 I;  3G6E 1;  3CCM Z;  1P9N A;  2QA4 Z;  1VQK 1;  4NBD A;  1M1K 1;  1YIJ Z;  4RS4 A;  1M1K 2;  3CCR 1;  2V8J A;  4E2W A;  3G4S Z;  4A3C I;  2QRC B;  1VQ6 1;  3CC7 Z;  1I6H I;  4RVD A;  3CCE Z;  1NUI A;  1K73 1;  3GTP I;  4E2Z A;  1K73 2;  2YU9 I;  2QRD B;  2HU9 A;  2W03 A;  4NFR A;  3IX0 A;  1VQP 1;  3F3P C;  1ML8 A;  3I55 Z;  3CC4 1;  3J81 b;  2V8K A;  2KI7 B;  1Y1W I;  4E2Y A;  4RVH A;  5C3E I;  1ZB9 A;  1YJ9 Z;  1W2B Y;  1YJW Z;  3OW2 Z;  2JA5 I;  5A2Q b;  3CME Z;  3CCM 1;  2QA4 1;  5FLM I;  2QLV B;  2DE6 A;  3CCU Z;  1YIJ 1;  3IF8 A;  3S1M I;  3HOV I;  3D9X A;  3NH5 A;  3FQQ A;  1I3Q I;  4NH1 C;  4BY1 I;  1WW9 A;  3CCJ Z;  1VQN Z;  3I56 Z;  3CC7 1;  1VQ8 Z;  3GTQ I;  4S1T A;  2GTH A;  3CPW Z;  3HOY I;  1QVF Y;  4MON A;  5T67 A;  4A3M I;  3RZO I;  2K5R A;  3I55 1;  4EWC A;  3PO3 I;  3NDI A;  2IZ3 A;  3RZD I;  2RBL A;  3NFZ A;  5D1O B;  2JA8 I;  4NBC A;  1YJ9 1;  1YJW 1;  3CME 1;  3S2H I;  4MH4 A;  3CCU 1;  1N8R 2;  3CCS Z;  3CCJ 1;  1RQF A;  3I56 1;  1JJ2 Z;  1VQ8 1;  5LL6 f;  2NVY I;  3KIF A;  1X3W A;  4NBE A;  2H85 A;  3HOZ I;  4A3E I;  5IT9 b;  1DL6 A;  3G71 1;  1K9M 1;  4RV9 A;  2PM9 A;  2W04 A;  2OTJ Z;  1LQL A;  2QR1 B;  1K9M 2;  2HF1 A;  3TE5 B;  5C4J I;  1KQS Y;  1TWH I;  3BG0 B;  5D1O A;  4BXX I;  3EER A;  3BG1 B;  4HGY A;  3MON A;  3NH8 A;  3TDH B;  1USP B;  2JNY A;  2OOY B;  2VUM I;  3U50 C;  4A3F I;  2P28 A;  2QEX 1;  4BBS I;  3LUS A;  1NJI 2;  2QKD A;  1VQO Z;  3CXC Y;  2WAQ A;  4DGL A;  1Q82 2;  1S72 Z;  2YAD A;  2OTJ 1;  3S1Q I;  2F4M A;  2M48 A;  2ZAE B;  4NOZ A;  3IFU A;  3CCV Z;  2KPI A;  3J80 f;  2OTL Z;  1RLY A;  4MRI A;  4A3G I;  1YI2 1;  2NVT I;  3HOX I;  2E2J I;  2O53 A;  1KRL A;  2LIY A;  1W2B Z;  2OZK A;  4E30 A;  1WII A;  1JWH C;  3D6W A;  5FLX f;  3CCL Z;  1VQ9 Z;  1RO4 A;  1Z01 A;  1QVG Y;  2RT9 A;  3MZL B;  2JR6 A;  3J81 f;  2AKL A;  1VQ7 Z;  5CM2 M;  3CC2 Z;  1VQO 1;  3GCF A;  1VQ4 Z;  1USP A;  5A2Q f;  3G4S 1;  1S72 1;  3CCE 1;  1ZH1 A;  3CCV 1;  2OTL 1;  2Q51 A;  4HH4 A;  4BBR I;  1QF8 A;  4A3L I;  1YHQ Z;  3Q87 A;  1WCM I;  1RO2 A;  3VMG A;  3MZK B;  2VUG A;  3CCL 1;  3I4N I;  1K83 I;  3S14 I;  3JAM b;  2RHB A;  4CL1 A;  1N8R 1;  4XX2 A;  4A93 I;  1VQ7 1;  3CC2 1;  2DE5 A;  5D1P A;  1TWC I;  3HOU I;  1VQ4 1;  3F3F C;  1YUA A;  4MD8 A;  1VQN 1;  1QYP A;  2E9H A;  5AN9 F;  3GTG I;  2RPR A;  4Y52 I;  1VQL Z;  2PK7 A;  1VLA A;  3KIH A;  3GTM S;  3G6E Z;  2RIQ A;  2JS4 A;  1VQK Z;  1YHQ 1;  1X3Z A;  3HOW I;  4QTT A;  4RVF A;  3CQZ I;  4MD7 A;  2IZ4 A;  1YIT Z;  1L1O C;  4DQY B;  2GU2 A;  1X0T A;  1S7M A;  2V8I A;  4NBF A;  5T6B A;  1JJ2 Y;  1M90 1;  4A3I I;  1Q86 1;  1TWF I;  1N2F A;  2EGT A;  1M90 2;  3S1R I;  3S17 I;  1Q86 2;  4E32 A;  3CMA Z;  3VTN A;  3CXC Z;  3CCS 1;  1RNI A;  5IP9 I;  1YJN Z;  4TNU A;  1Q82 1;  3PO2 I;  3GKQ A;  3GTL I;  1KD1 2;  3HKZ A;  1NP6 A;  3QWU A;  3S2D I;  3I07 A;  2I3C A;  4X6A I;  4NB8 A;  3K7A I;  1YUK A;  1Z02 A;  4A3J I;  2P3Y A;  2DE7 A;  2B63 I;  1Y1V I;  3J80 b;  3EED A;  3CCQ Z;  1YIT 1;  1Z03 A;  3H3V J;  2E2I I;  1QVG Z;  4NBB A;  4RVG A;  3FQM A;  2WB1 A;  3M3Y I;  4E33 A;  1ZB8 A;  2JMO A;  4A3D I;  1R9T I;  3FKI I;  1VQ5 Z;  5FLX b;  2QRE B;  3CMA 1;  4E31 A;  4A3K I;  1YJN 1;  3NDJ A;  2K3R A;  2Q4Z A;  2R93 I;  1QVF Z;  4HGZ A;  3J7A 4;  3CD6 Z;  2Y0S A;  2O4H A;  2NVX I;  1NJI 1;  5C44 I;  3NH4 A;  2JUB A;  3GTM I;  4MXU A;  3OW2 Y;  3VMI A;  1RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...