1QVFY

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfY00
3CMAZ 1KD12 3G6E1 2QA4Z 1YIJZ 1VQ9Z 1VQN1 1Q812 1VQ91 1YIJ1 3CCJZ 3I55Z 1YJW1 1M1K1 1KQSY 1JJ2Y 3G6EZ 1NJI2 1Q861 3CD6Z 1KD11 1N8R1 1K732 1K9M2 2QEX1 1VQ41 1VQOZ 1Q7Y2 3CCUZ 1QVGY 3CD61 3CCEZ 2OTJ1 1VQNZ 3CCQ1 1W2BZ 3CXCZ 2QA41 1K8A2 3CC4Z 1M1K2 1Q822 3CCV1 2OTLZ 1QVFZ 3I551 1VQ51 1VQ7Z 1YI2Z 3CC71 3CXCY 1VQK1 1Q7Y1 1VQ81 1Q862 3CMA1 1M902 1S72Z 1K731 1KC81 1K9M1 3CME1 3CCR1 1VQPZ 1W2BY 1YITZ 3I561 1YJN1 3G4S1 3G711 1VQ6Z 1VQLZ 3CCLZ 1YHQZ 3CPWY 1VQL1 3CCMZ 1KC82 1KQSZ 3CCM1 3CCS1 3CPWZ 1VQ8Z 3CCSZ 3CC7Z 3CCL1 1YHQ1 1VQMZ 1VQKZ 1VQP1 3CCRZ 1VQM1 1Q811 1VQO1 3CC2Z 3CC41 1YJ9Z 1Q821 3CMEZ 1QVGZ 1YJ91 2QEXZ 3CC21 1YIT1 3OW2Z 3G4SZ 1VQ5Z 1S721 1JJ2Z 1VQ4Z 1YI21 3G71Z 1VQ71 3CCJ1 3CCU1 2OTL1 3I56Z 3CCVZ 3CCE1 2OTJZ 1QVFY 1M901 1NJI1 1VQ61 3OW2Y 3CCQZ 1YJWZ 1K8A1 1N8R2 1YJNZ
chains in the Genus database with same CATH superfamily
3I4NI 2HF1A 1USPA 4NB8A 1Q812 4S1TA 2QLVB 3CCJZ 5FLMI 5T64A 5LL6f 1JJ2Y 2KI7B 4CL1A 2RIQA 3NFZA 3GTJI 2F4MA 3HOXI 3IR7A 1K732 1K9M2 3S16I 2VF1A 2VPWA 4NBBA 2E7ZA 2NVYI 2EGTA 3CCUZ 1X3WA 2I3CA 4RVHA 1QVGY 3CCEZ 2BJOA 1VQNZ 3RZDI 2QA41 2JA7I 3M4OI 3CCV1 2OTLZ 1QVFZ 1QXFA 3I551 3CXCY 3D6WA 1Q862 3J80b 2M6NA 3CMA1 2R93I 1KC81 2E2JI 3CME1 4A3II 1Z01A 1YITZ 2R6MA 2QREB 3G4S1 2JR6A 2RT9A 5C44I 2B63I 1ML8A 1VQ6Z 3S14I 3PO2I 3CCLZ 3CCMZ 3GTMI 5T67A 5IT9b 3CPWZ 4QTUA 3CCL1 1VQMZ 3S1MI 1VQP1 4NBCA 3F3FC 1Q811 5FLXf 3CC41 3CMEZ 1SFOI 2RHBA 2V8IA 1YIT1 2V3VA 1Y1WI 3OW2Z 1USPB 1S721 4HGYA 1TWCI 1QYPA 4NBAA 4NBGA 3G71Z 5D1OA 2OTL1 2OZKA 1M901 1QF8A 2LEXA 3CCQZ 1YJNZ 1FDIA 2W04A 4BXXI 4MRIA 2JUBA 4NB9A 1VQ9Z 2GTIA 3JAMb 2M48A 2V8JA 5AN9F 4A3JI 4HH4A 1YJW1 2JIQA 1KQSY 1NJI2 1Q16A 3HOVI 1KD11 1N8R1 1L1OC 4MD9A 5IP9I 2DE7A 3GTOI 2R92I 4HGZA 1Q7Y2 3NH5A 3S1RI 2VPZA 2JIOA 3GCFA 1W2BZ 3VMHA 4MONA 4RVGA 3EERA 2K5RA 4A3DI 3H0GI 3IX0A 1PFTA 2H85A 1VQ51 1TWGI 2WB1A 1WJ2A 3HOWI 4MH4A 1K731 4BBSI 1K9M1 2E9HA 3CQZI 3NH4A 2P28A 4RVDA 1YJN1 1Z03A 3JAMf 1TWAI 3IF8A 3G711 2RBLA 5D1OB 4QTTA 1I3QI 1I50I 1VQLZ 1YHQZ 3GTMS 3CPWY 3GTKI 3GTQI 1RO2A 4E2ZA 3S15I 3CCS1 2OOXB 2G2KA 3I07A 1YHQ1 4A3LI 1VQM1 1YJ9Z 5IT9f 2QEXZ 5C4XI 4RS4A 1ZB8A 3NDJA 3G4SZ 1I6HI 3I4MI 2J6AA 1WIIA 3BG1B 2IZ3A 2IZ4A 4E31A 3S1QI 3CCJ1 2DE6A 3CCU1 1Z02A 3U50C 3I56Z 1TWHI 3CCE1 1N2FA 5T6BA 1QVFY 3VMIA 2NVXI 3J81f 3OW2Y 4E30A 1YJWZ 1NUIA 3VB9A 1TWFI 4RVFA 1ZB9A 3HOUI 4AYBA 4A3EI 2WAQA 1YIJZ 4A3CI 2VPXA 2AKLA 3HOYI 2PM9A 1VQN1 3M3YI 1M1K1 3D2LA 3MONA 1FDOA 2GTHA 5IP7I 4MXUA 2VPYA 2JS4A 3S2DI 1Y8CA 2QEX1 1VQ41 1SIWA 4A3FI 1VQOZ 2JA8I 2GU2A 4RV9A 1LQLA 1RLYA 3CD61 2OTJ1 3K7AI 3Q87A 5A2Qb 2Q4ZA 1VLAA 5D1PA 3CXCZ 1K8A2 3CC4Z 4Y7NI 3F3PC 1ZH1A 1RO0A 5A2Qf 4NBEA 2JA5I 1AA6A 3TDHB 1M902 1S72Z 1VQPZ 1W2BY 4MD7A 4E2WA 3S17I 2R7ZI 5C4JI 1K83I 1DL6A 3GTLI 2QR1B 2JIMA 2O53A 1TFIA 3P5JB 1KC82 4DGLA 3CCM1 2QRCB 1KRLA 3HOZI 2HU9A 1RNIA 3ESWA 2Q51A 3PO3I 2PK7A 1Y1VS 1VQO1 3CC2Z 4X6AI 1Q821 2P3YA 1QVGZ 2YU9I 3GTGI 4XX2A 2NVTI 1VQ5Z 1P9NA 3VMGA 2E2II 4BY7I 1YUKA 3S2HI 2VUGA 2LIYA 1VQ71 3VTNA 1NP6A 4BBRI 2NVQI 1WW9A 3J7A4 3QWUA 1VQ61 3FQMA 2VUMI 3D9XA 1K8A1 4EWCA 4A3BI 3CMAZ 3S1NI 1KD12 3G6E1 2K3RA 3KIFA 1R9TI 2QA4Z 3TE5B 1VQ91 1YIJ1 2YADA 3MZKB 3I55Z 3GTPI 1X0TA 2NAPA 2ZAEB 3KIHA 3G6EZ 4NBDA 3NH8A 2JIPA 1Q861 3CD6Z 1WCMI 3BG0B 4NFRA 4A93I 2QKDA 4NBHA 5C3EI 5FLXb 2E2HI 4TNUA 4NOZA 3CCQ1 3J80f 1Y1VI 3NDIA 3MZLB 3PO3S 1M1K2 1Q822 3GKQA 1VQ7Z 2F4OA 1YI2Z 2JNYA 3CC71 1VQK1 1Q7Y1 2JA6I 1VQ81 3HKZA 3IFUA 2LFUA 3J81b 4MD8A 4A3MI 2PMZA 2RPRA 3T4NB 3CCR1 2Y0SA 2O4HA 3I561 4A3KI 2IV2X 4DQYB 1X3ZA 4Y52I 4A3GI 4NBFA 2DE5A 4E32A 2QRDB 1VQL1 2KPIA 1KQSZ 4DK1A 1VQ8Z 3H3VJ 4NH1C 3CCSZ 4E2YA 2JIRA 1S7MA 4E33A 3CC7Z 1VQKZ 3CCRZ 2OOYB 2V45A 3RZOI 1RO4A 4BY1I 1JWHC 1YJ91 3CC21 4E2XA 2W03A 3FQQA 1RQFA 3LUSA 2AYDA 1JJ2Z 1VQ4Z 1YI21 2V8KA 3EEDA 2JMOA 3CCVZ 3FKII 2OTJZ 1WZNA 1NJI1 1YUAA 5CM2M 1N8R2
chains in the Genus database with same CATH topology
3I4NI 2HF1A 1USPA 4NB8A 1Q812 4S1TA 2QLVB 3CCJZ 5FLMI 5T64A 5LL6f 1JJ2Y 2KI7B 4CL1A 2RIQA 3NFZA 3GTJI 2F4MA 3HOXI 1K732 1K9M2 3S16I 2VF1A 4NBBA 2NVYI 2EGTA 3CCUZ 1X3WA 2I3CA 4RVHA 1QVGY 3CCEZ 2BJOA 1VQNZ 3RZDI 2QA41 2JA7I 3M4OI 3CCV1 2OTLZ 1QVFZ 3I551 3CXCY 3D6WA 1Q862 3J80b 2M6NA 3CMA1 2R93I 1KC81 2E2JI 3CME1 4A3II 1Z01A 1YITZ 2R6MA 2QREB 3G4S1 2JR6A 2RT9A 5C44I 2B63I 1ML8A 1VQ6Z 3S14I 3PO2I 3CCLZ 3CCMZ 3GTMI 5T67A 5IT9b 3CPWZ 4QTUA 3CCL1 1VQMZ 3S1MI 1VQP1 4NBCA 3F3FC 1Q811 5FLXf 3CC41 3CMEZ 1SFOI 2RHBA 2V8IA 1YIT1 1Y1WI 3OW2Z 1USPB 1S721 4HGYA 1TWCI 1QYPA 4NBAA 4NBGA 3G71Z 5D1OA 2OTL1 2OZKA 1M901 1QF8A 3CCQZ 1YJNZ 2W04A 4BXXI 4MRIA 2JUBA 4NB9A 1VQ9Z 2GTIA 3JAMb 2M48A 2V8JA 5AN9F 4A3JI 4HH4A 1YJW1 1KQSY 1NJI2 3HOVI 1KD11 1N8R1 1L1OC 4MD9A 5IP9I 2DE7A 3GTOI 2R92I 4HGZA 1Q7Y2 3NH5A 3S1RI 3GCFA 1W2BZ 3VMHA 4MONA 4RVGA 3EERA 2K5RA 4A3DI 3H0GI 3IX0A 1PFTA 2H85A 1VQ51 1TWGI 2WB1A 3HOWI 4MH4A 1K731 4BBSI 1K9M1 2E9HA 3CQZI 3NH4A 2P28A 4RVDA 1YJN1 1Z03A 3JAMf 1TWAI 3IF8A 3G711 2RBLA 5D1OB 4QTTA 1I3QI 1I50I 1VQLZ 1YHQZ 3GTMS 3CPWY 3GTKI 3GTQI 1RO2A 4E2ZA 3S15I 3CCS1 2OOXB 2G2KA 3I07A 1YHQ1 4A3LI 1VQM1 1YJ9Z 5IT9f 2QEXZ 5C4XI 4RS4A 1ZB8A 3NDJA 3G4SZ 1I6HI 3I4MI 2J6AA 1WIIA 3BG1B 2IZ3A 2IZ4A 4E31A 3S1QI 3CCJ1 2DE6A 3CCU1 1Z02A 3U50C 3I56Z 1TWHI 3CCE1 1N2FA 5T6BA 1QVFY 3VMIA 2NVXI 3J81f 3OW2Y 4E30A 1YJWZ 1NUIA 3VB9A 1TWFI 4RVFA 1ZB9A 3HOUI 4AYBA 4A3EI 2WAQA 1YIJZ 4A3CI 2AKLA 3HOYI 2PM9A 1VQN1 3M3YI 1M1K1 3MONA 2GTHA 5IP7I 4MXUA 2JS4A 3S2DI 2QEX1 1VQ41 4A3FI 1VQOZ 2JA8I 2GU2A 4RV9A 1LQLA 1RLYA 3CD61 2OTJ1 3K7AI 3Q87A 5A2Qb 2Q4ZA 1VLAA 5D1PA 3CXCZ 1K8A2 3CC4Z 4Y7NI 3F3PC 1ZH1A 1RO0A 5A2Qf 4NBEA 2JA5I 3TDHB 1M902 1S72Z 1VQPZ 1W2BY 4MD7A 4E2WA 3S17I 2R7ZI 5C4JI 1K83I 1DL6A 3GTLI 2QR1B 2O53A 1TFIA 3P5JB 1KC82 4DGLA 3CCM1 2QRCB 1KRLA 3HOZI 2HU9A 1RNIA 3ESWA 2Q51A 3PO3I 2PK7A 1Y1VS 1VQO1 3CC2Z 4X6AI 1Q821 2P3YA 1QVGZ 2YU9I 3GTGI 4XX2A 2NVTI 1VQ5Z 1P9NA 3VMGA 2E2II 4BY7I 1YUKA 3S2HI 2VUGA 2LIYA 1VQ71 3VTNA 1NP6A 4BBRI 2NVQI 1WW9A 3J7A4 3QWUA 1VQ61 3FQMA 2VUMI 3D9XA 1K8A1 4EWCA 4A3BI 3CMAZ 3S1NI 1KD12 3G6E1 2K3RA 3KIFA 1R9TI 2QA4Z 3TE5B 1VQ91 1YIJ1 2YADA 3MZKB 3I55Z 3GTPI 1X0TA 2ZAEB 3KIHA 3G6EZ 4NBDA 3NH8A 1Q861 3CD6Z 1WCMI 3BG0B 4NFRA 4A93I 2QKDA 4NBHA 5C3EI 5FLXb 2E2HI 4TNUA 4NOZA 3CCQ1 3J80f 1Y1VI 3NDIA 3MZLB 3PO3S 1M1K2 1Q822 3GKQA 1VQ7Z 2F4OA 1YI2Z 2JNYA 3CC71 1VQK1 1Q7Y1 2JA6I 1VQ81 3HKZA 3IFUA 2LFUA 3J81b 4MD8A 4A3MI 2PMZA 2RPRA 3T4NB 3CCR1 2Y0SA 2O4HA 3I561 4A3KI 4DQYB 1X3ZA 4Y52I 4A3GI 4NBFA 2DE5A 4E32A 2QRDB 1VQL1 2KPIA 1KQSZ 4DK1A 1VQ8Z 3H3VJ 4NH1C 3CCSZ 4E2YA 1S7MA 4E33A 3CC7Z 1VQKZ 3CCRZ 2OOYB 3RZOI 1RO4A 4BY1I 1JWHC 1YJ91 3CC21 4E2XA 2W03A 3FQQA 1RQFA 3LUSA 1JJ2Z 1VQ4Z 1YI21 2V8KA 3EEDA 2JMOA 3FKII 3CCVZ 2OTJZ 1NJI1 1YUAA 5CM2M 1N8R2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Z;  1KD1 2;  3G6E 1;  2QA4 Z;  1YIJ Z;  1VQ9 Z;  1VQN 1;  1Q81 2;  1VQ9 1;  1YIJ 1;  3CCJ Z;  3I55 Z;  1YJW 1;  1M1K 1;  1KQS Y;  1JJ2 Y;  3G6E Z;  1NJI 2;  1Q86 1;  3CD6 Z;  1KD1 1;  1N8R 1;  1K73 2;  1K9M 2;  2QEX 1;  1VQ4 1;  1VQO Z;  1Q7Y 2;  3CCU Z;  1QVG Y;  3CD6 1;  3CCE Z;  2OTJ 1;  1VQN Z;  3CCQ 1;  1W2B Z;  3CXC Z;  2QA4 1;  1K8A 2;  3CC4 Z;  1M1K 2;  1Q82 2;  3CCV 1;  2OTL Z;  1QVF Z;  3I55 1;  1VQ5 1;  1VQ7 Z;  1YI2 Z;  3CC7 1;  3CXC Y;  1VQK 1;  1Q7Y 1;  1VQ8 1;  1Q86 2;  3CMA 1;  1M90 2;  1S72 Z;  1K73 1;  1KC8 1;  1K9M 1;  3CME 1;  3CCR 1;  1VQP Z;  1W2B Y;  1YIT Z;  3I56 1;  1YJN 1;  3G4S 1;  3G71 1;  1VQ6 Z;  1VQL Z;  3CCL Z;  1YHQ Z;  3CPW Y;  1VQL 1;  3CCM Z;  1KC8 2;  1KQS Z;  3CCM 1;  3CCS 1;  3CPW Z;  1VQ8 Z;  3CCS Z;  3CC7 Z;  3CCL 1;  1YHQ 1;  1VQM Z;  1VQK Z;  1VQP 1;  3CCR Z;  1VQM 1;  1Q81 1;  1VQO 1;  3CC2 Z;  3CC4 1;  1YJ9 Z;  1Q82 1;  3CME Z;  1QVG Z;  1YJ9 1;  2QEX Z;  3CC2 1;  1YIT 1;  3OW2 Z;  3G4S Z;  1VQ5 Z;  1S72 1;  1JJ2 Z;  1VQ4 Z;  1YI2 1;  3G71 Z;  1VQ7 1;  3CCJ 1;  3CCU 1;  2OTL 1;  3I56 Z;  3CCV Z;  3CCE 1;  2OTJ Z;  1QVF Y;  1M90 1;  1NJI 1;  1VQ6 1;  3OW2 Y;  3CCQ Z;  1YJW Z;  1K8A 1;  1N8R 2;  1YJN Z; 
#chains in the Genus database with same CATH topology
 3I4N I;  2HF1 A;  1USP A;  4NB8 A;  1Q81 2;  4S1T A;  2QLV B;  3CCJ Z;  5FLM I;  5T64 A;  5LL6 f;  1JJ2 Y;  2KI7 B;  4CL1 A;  2RIQ A;  3NFZ A;  3GTJ I;  2F4M A;  3HOX I;  3IR7 A;  1K73 2;  1K9M 2;  3S16 I;  2VF1 A;  2VPW A;  4NBB A;  2E7Z A;  2NVY I;  2EGT A;  3CCU Z;  1X3W A;  2I3C A;  4RVH A;  1QVG Y;  3CCE Z;  2BJO A;  1VQN Z;  3RZD I;  2QA4 1;  2JA7 I;  3M4O I;  3CCV 1;  2OTL Z;  1QVF Z;  1QXF A;  3I55 1;  3CXC Y;  3D6W A;  1Q86 2;  3J80 b;  2M6N A;  3CMA 1;  2R93 I;  1KC8 1;  2E2J I;  3CME 1;  4A3I I;  1Z01 A;  1YIT Z;  2R6M A;  2QRE B;  3G4S 1;  2JR6 A;  2RT9 A;  5C44 I;  2B63 I;  1ML8 A;  1VQ6 Z;  3S14 I;  3PO2 I;  3CCL Z;  3CCM Z;  3GTM I;  5T67 A;  5IT9 b;  3CPW Z;  4QTU A;  3CCL 1;  1VQM Z;  3S1M I;  1VQP 1;  4NBC A;  3F3F C;  1Q81 1;  5FLX f;  3CC4 1;  3CME Z;  1SFO I;  2RHB A;  2V8I A;  1YIT 1;  2V3V A;  1Y1W I;  3OW2 Z;  1USP B;  1S72 1;  4HGY A;  1TWC I;  1QYP A;  4NBA A;  4NBG A;  3G71 Z;  5D1O A;  2OTL 1;  2OZK A;  1M90 1;  1QF8 A;  2LEX A;  3CCQ Z;  1YJN Z;  1FDI A;  2W04 A;  4BXX I;  4MRI A;  2JUB A;  4NB9 A;  1VQ9 Z;  2GTI A;  3JAM b;  2M48 A;  2V8J A;  5AN9 F;  4A3J I;  4HH4 A;  1YJW 1;  2JIQ A;  1KQS Y;  1NJI 2;  1Q16 A;  3HOV I;  1KD1 1;  1N8R 1;  1L1O C;  4MD9 A;  5IP9 I;  2DE7 A;  3GTO I;  2R92 I;  4HGZ A;  1Q7Y 2;  3NH5 A;  3S1R I;  2VPZ A;  2JIO A;  3GCF A;  1W2B Z;  3VMH A;  4MON A;  4RVG A;  3EER A;  2K5R A;  4A3D I;  3H0G I;  3IX0 A;  1PFT A;  2H85 A;  1VQ5 1;  1TWG I;  2WB1 A;  1WJ2 A;  3HOW I;  4MH4 A;  1K73 1;  4BBS I;  1K9M 1;  2E9H A;  3CQZ I;  3NH4 A;  2P28 A;  4RVD A;  1YJN 1;  1Z03 A;  3JAM f;  1TWA I;  3IF8 A;  3G71 1;  2RBL A;  5D1O B;  4QTT A;  1I3Q I;  1I50 I;  1VQL Z;  1YHQ Z;  3GTM S;  3CPW Y;  3GTK I;  3GTQ I;  1RO2 A;  4E2Z A;  3S15 I;  3CCS 1;  2OOX B;  2G2K A;  3I07 A;  1YHQ 1;  4A3L I;  1VQM 1;  1YJ9 Z;  5IT9 f;  2QEX Z;  5C4X I;  4RS4 A;  1ZB8 A;  3NDJ A;  3G4S Z;  1I6H I;  3I4M I;  2J6A A;  1WII A;  3BG1 B;  2IZ3 A;  2IZ4 A;  4E31 A;  3S1Q I;  3CCJ 1;  2DE6 A;  3CCU 1;  1Z02 A;  3U50 C;  3I56 Z;  1TWH I;  3CCE 1;  1N2F A;  5T6B A;  1QVF Y;  3VMI A;  2NVX I;  3J81 f;  3OW2 Y;  4E30 A;  1YJW Z;  1NUI A;  3VB9 A;  1TWF I;  4RVF A;  1ZB9 A;  3HOU I;  4AYB A;  4A3E I;  2WAQ A;  1YIJ Z;  4A3C I;  2VPX A;  2AKL A;  3HOY I;  2PM9 A;  1VQN 1;  3M3Y I;  1M1K 1;  3D2L A;  3MON A;  1FDO A;  2GTH A;  5IP7 I;  4MXU A;  2VPY A;  2JS4 A;  3S2D I;  1Y8C A;  2QEX 1;  1VQ4 1;  1SIW A;  4A3F I;  1VQO Z;  2JA8 I;  2GU2 A;  4RV9 A;  1LQL A;  1RLY A;  3CD6 1;  2OTJ 1;  3K7A I;  3Q87 A;  5A2Q b;  2Q4Z A;  1VLA A;  5D1P A;  3CXC Z;  1K8A 2;  3CC4 Z;  4Y7N I;  3F3P C;  1ZH1 A;  1RO0 A;  5A2Q f;  4NBE A;  2JA5 I;  1AA6 A;  3TDH B;  1M90 2;  1S72 Z;  1VQP Z;  1W2B Y;  4MD7 A;  4E2W A;  3S17 I;  2R7Z I;  5C4J I;  1K83 I;  1DL6 A;  3GTL I;  2QR1 B;  2JIM A;  2O53 A;  1TFI A;  3P5J B;  1KC8 2;  4DGL A;  3CCM 1;  2QRC B;  1KRL A;  3HOZ I;  2HU9 A;  1RNI A;  3ESW A;  2Q51 A;  3PO3 I;  2PK7 A;  1Y1V S;  1VQO 1;  3CC2 Z;  4X6A I;  1Q82 1;  2P3Y A;  1QVG Z;  2YU9 I;  3GTG I;  4XX2 A;  2NVT I;  1VQ5 Z;  1P9N A;  3VMG A;  2E2I I;  4BY7 I;  1YUK A;  3S2H I;  2VUG A;  2LIY A;  1VQ7 1;  3VTN A;  1NP6 A;  4BBR I;  2NVQ I;  1WW9 A;  3J7A 4;  3QWU A;  1VQ6 1;  3FQM A;  2VUM I;  3D9X A;  1K8A 1;  4EWC A;  4A3B I;  3CMA Z;  3S1N I;  1KD1 2;  3G6E 1;  2K3R A;  3KIF A;  1R9T I;  2QA4 Z;  3TE5 B;  1VQ9 1;  1YIJ 1;  2YAD A;  3MZK B;  3I55 Z;  3GTP I;  1X0T A;  2NAP A;  2ZAE B;  3KIH A;  3G6E Z;  4NBD A;  3NH8 A;  2JIP A;  1Q86 1;  3CD6 Z;  1WCM I;  3BG0 B;  4NFR A;  4A93 I;  2QKD A;  4NBH A;  5C3E I;  5FLX b;  2E2H I;  4TNU A;  4NOZ A;  3CCQ 1;  3J80 f;  1Y1V I;  3NDI A;  3MZL B;  3PO3 S;  1M1K 2;  1Q82 2;  3GKQ A;  1VQ7 Z;  2F4O A;  1YI2 Z;  2JNY A;  3CC7 1;  1VQK 1;  1Q7Y 1;  2JA6 I;  1VQ8 1;  3HKZ A;  3IFU A;  2LFU A;  3J81 b;  4MD8 A;  4A3M I;  2PMZ A;  2RPR A;  3T4N B;  3CCR 1;  2Y0S A;  2O4H A;  3I56 1;  4A3K I;  2IV2 X;  4DQY B;  1X3Z A;  4Y52 I;  4A3G I;  4NBF A;  2DE5 A;  4E32 A;  2QRD B;  1VQL 1;  2KPI A;  1KQS Z;  4DK1 A;  1VQ8 Z;  3H3V J;  4NH1 C;  3CCS Z;  4E2Y A;  2JIR A;  1S7M A;  4E33 A;  3CC7 Z;  1VQK Z;  3CCR Z;  2OOY B;  2V45 A;  3RZO I;  1RO4 A;  4BY1 I;  1JWH C;  1YJ9 1;  3CC2 1;  4E2X A;  2W03 A;  3FQQ A;  1RQF A;  3LUS A;  2AYD A;  1JJ2 Z;  1VQ4 Z;  1YI2 1;  2V8K A;  3EED A;  2JMO A;  3CCV Z;  3FKI I;  2OTJ Z;  1WZN A;  1NJI 1;  1YUA A;  5CM2 M;  1N8R 2; 
#chains in the Genus database with same CATH homology
 3I4N I;  2HF1 A;  1USP A;  4NB8 A;  1Q81 2;  4S1T A;  2QLV B;  3CCJ Z;  5FLM I;  5T64 A;  5LL6 f;  1JJ2 Y;  2KI7 B;  4CL1 A;  2RIQ A;  3NFZ A;  3GTJ I;  2F4M A;  3HOX I;  1K73 2;  1K9M 2;  3S16 I;  2VF1 A;  4NBB A;  2NVY I;  2EGT A;  3CCU Z;  1X3W A;  2I3C A;  4RVH A;  1QVG Y;  3CCE Z;  2BJO A;  1VQN Z;  3RZD I;  2QA4 1;  2JA7 I;  3M4O I;  3CCV 1;  2OTL Z;  1QVF Z;  3I55 1;  3CXC Y;  3D6W A;  1Q86 2;  3J80 b;  2M6N A;  3CMA 1;  2R93 I;  1KC8 1;  2E2J I;  3CME 1;  4A3I I;  1Z01 A;  1YIT Z;  2R6M A;  2QRE B;  3G4S 1;  2JR6 A;  2RT9 A;  5C44 I;  2B63 I;  1ML8 A;  1VQ6 Z;  3S14 I;  3PO2 I;  3CCL Z;  3CCM Z;  3GTM I;  5T67 A;  5IT9 b;  3CPW Z;  4QTU A;  3CCL 1;  1VQM Z;  3S1M I;  1VQP 1;  4NBC A;  3F3F C;  1Q81 1;  5FLX f;  3CC4 1;  3CME Z;  1SFO I;  2RHB A;  2V8I A;  1YIT 1;  1Y1W I;  3OW2 Z;  1USP B;  1S72 1;  4HGY A;  1TWC I;  1QYP A;  4NBA A;  4NBG A;  3G71 Z;  5D1O A;  2OTL 1;  2OZK A;  1M90 1;  1QF8 A;  3CCQ Z;  1YJN Z;  2W04 A;  4BXX I;  4MRI A;  2JUB A;  4NB9 A;  1VQ9 Z;  2GTI A;  3JAM b;  2M48 A;  2V8J A;  5AN9 F;  4A3J I;  4HH4 A;  1YJW 1;  1KQS Y;  1NJI 2;  3HOV I;  1KD1 1;  1N8R 1;  1L1O C;  4MD9 A;  5IP9 I;  2DE7 A;  3GTO I;  2R92 I;  4HGZ A;  1Q7Y 2;  3NH5 A;  3S1R I;  3GCF A;  1W2B Z;  3VMH A;  4MON A;  4RVG A;  3EER A;  2K5R A;  4A3D I;  3H0G I;  3IX0 A;  1PFT A;  2H85 A;  1VQ5 1;  1TWG I;  2WB1 A;  3HOW I;  4MH4 A;  1K73 1;  4BBS I;  1K9M 1;  2E9H A;  3CQZ I;  3NH4 A;  2P28 A;  4RVD A;  1YJN 1;  1Z03 A;  3JAM f;  1TWA I;  3IF8 A;  3G71 1;  2RBL A;  5D1O B;  4QTT A;  1I3Q I;  1I50 I;  1VQL Z;  1YHQ Z;  3GTM S;  3CPW Y;  3GTK I;  3GTQ I;  1RO2 A;  4E2Z A;  3S15 I;  3CCS 1;  2OOX B;  2G2K A;  3I07 A;  1YHQ 1;  4A3L I;  1VQM 1;  1YJ9 Z;  5IT9 f;  2QEX Z;  5C4X I;  4RS4 A;  1ZB8 A;  3NDJ A;  3G4S Z;  1I6H I;  3I4M I;  2J6A A;  1WII A;  3BG1 B;  2IZ3 A;  2IZ4 A;  4E31 A;  3S1Q I;  3CCJ 1;  2DE6 A;  3CCU 1;  1Z02 A;  3U50 C;  3I56 Z;  1TWH I;  3CCE 1;  1N2F A;  5T6B A;  1QVF Y;  3VMI A;  2NVX I;  3J81 f;  3OW2 Y;  4E30 A;  1YJW Z;  1NUI A;  3VB9 A;  1TWF I;  4RVF A;  1ZB9 A;  3HOU I;  4AYB A;  4A3E I;  2WAQ A;  1YIJ Z;  4A3C I;  2AKL A;  3HOY I;  2PM9 A;  1VQN 1;  3M3Y I;  1M1K 1;  3MON A;  2GTH A;  5IP7 I;  4MXU A;  2JS4 A;  3S2D I;  2QEX 1;  1VQ4 1;  4A3F I;  1VQO Z;  2JA8 I;  2GU2 A;  4RV9 A;  1LQL A;  1RLY A;  3CD6 1;  2OTJ 1;  3K7A I;  3Q87 A;  5A2Q b;  2Q4Z A;  1VLA A;  5D1P A;  3CXC Z;  1K8A 2;  3CC4 Z;  4Y7N I;  3F3P C;  1ZH1 A;  1RO0 A;  5A2Q f;  4NBE A;  2JA5 I;  3TDH B;  1M90 2;  1S72 Z;  1VQP Z;  1W2B Y;  4MD7 A;  4E2W A;  3S17 I;  2R7Z I;  5C4J I;  1K83 I;  1DL6 A;  3GTL I;  2QR1 B;  2O53 A;  1TFI A;  3P5J B;  1KC8 2;  4DGL A;  3CCM 1;  2QRC B;  1KRL A;  3HOZ I;  2HU9 A;  1RNI A;  3ESW A;  2Q51 A;  3PO3 I;  2PK7 A;  1Y1V S;  1VQO 1;  3CC2 Z;  4X6A I;  1Q82 1;  2P3Y A;  1QVG Z;  2YU9 I;  3GTG I;  4XX2 A;  2NVT I;  1VQ5 Z;  1P9N A;  3VMG A;  2E2I I;  4BY7 I;  1YUK A;  3S2H I;  2VUG A;  2LIY A;  1VQ7 1;  3VTN A;  1NP6 A;  4BBR I;  2NVQ I;  1WW9 A;  3J7A 4;  3QWU A;  1VQ6 1;  3FQM A;  2VUM I;  3D9X A;  1K8A 1;  4EWC A;  4A3B I;  3CMA Z;  3S1N I;  1KD1 2;  3G6E 1;  2K3R A;  3KIF A;  1R9T I;  2QA4 Z;  3TE5 B;  1VQ9 1;  1YIJ 1;  2YAD A;  3MZK B;  3I55 Z;  3GTP I;  1X0T A;  2ZAE B;  3KIH A;  3G6E Z;  4NBD A;  3NH8 A;  1Q86 1;  3CD6 Z;  1WCM I;  3BG0 B;  4NFR A;  4A93 I;  2QKD A;  4NBH A;  5C3E I;  5FLX b;  2E2H I;  4TNU A;  4NOZ A;  3CCQ 1;  3J80 f;  1Y1V I;  3NDI A;  3MZL B;  3PO3 S;  1M1K 2;  1Q82 2;  3GKQ A;  1VQ7 Z;  2F4O A;  1YI2 Z;  2JNY A;  3CC7 1;  1VQK 1;  1Q7Y 1;  2JA6 I;  1VQ8 1;  3HKZ A;  3IFU A;  2LFU A;  3J81 b;  4MD8 A;  4A3M I;  2PMZ A;  2RPR A;  3T4N B;  3CCR 1;  2Y0S A;  2O4H A;  3I56 1;  4A3K I;  4DQY B;  1X3Z A;  4Y52 I;  4A3G I;  4NBF A;  2DE5 A;  4E32 A;  2QRD B;  1VQL 1;  2KPI A;  1KQS Z;  4DK1 A;  1VQ8 Z;  3H3V J;  4NH1 C;  3CCS Z;  4E2Y A;  1S7M A;  4E33 A;  3CC7 Z;  1VQK Z;  3CCR Z;  2OOY B;  3RZO I;  1RO4 A;  4BY1 I;  1JWH C;  1YJ9 1;  3CC2 1;  4E2X A;  2W03 A;  3FQQ A;  1RQF A;  3LUS A;  1JJ2 Z;  1VQ4 Z;  1YI2 1;  2V8K A;  3EED A;  2JMO A;  3FKI I;  3CCV Z;  2OTJ Z;  1NJI 1;  1YUA A;  5CM2 M;  1N8R 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...