1QVFY

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfY00
1VQOZ 3I551 2QEXZ 1VQ9Z 3CCUZ 1Q7Y2 1VQK1 1W2BY 1M902 1VQ8Z 3G6E1 1K8A1 3CCQZ 2QA4Z 3CPWY 1YIJZ 1YJWZ 3CCJZ 3CCMZ 1YJ9Z 3OW2Z 1YJNZ 3G4S1 1VQPZ 1NJI1 2OTLZ 1QVGZ 3G71Z 3I561 3CCLZ 3CCV1 1QVFZ 3CD61 1VQKZ 1YHQ1 3CCE1 1KQSY 1S721 1Q861 1VQL1 1Q811 3CCS1 1Q821 1K9M2 1VQN1 1VQ61 1K732 1VQ5Z 1YITZ 1N8R1 3CC21 2OTJZ 3CXCZ 1VQ7Z 3CCVZ 3CD6Z 1YHQZ 3CCEZ 1K8A2 3CME1 3I55Z 1M1K1 3OW2Y 3CCSZ 3CCR1 1VQNZ 1NJI2 1QVGY 1KC81 1VQ41 3G6EZ 1VQO1 1JJ2Z 1YI21 3CMA1 1QVFY 1KD11 3G4SZ 3CC41 3CC71 3CCQ1 2QA41 3I56Z 1YJW1 1Q7Y1 1Q862 1Q812 1M901 1Q822 1VQP1 1W2BZ 1VQM1 3CCRZ 2OTL1 1S72Z 3G711 3CPWZ 1VQLZ 3CCL1 1N8R2 1YI2Z 3CMAZ 3CXCY 3CC4Z 3CC7Z 1VQ6Z 2QEX1 1VQ91 3CCU1 3CC2Z 1M1K2 1VQ81 1KQSZ 1VQMZ 1VQ51 1YIT1 1KC82 1JJ2Y 1YIJ1 3CMEZ 3CCJ1 3CCM1 1YJ91 2OTJ1 1YJN1 1K9M1 1VQ71 1KD12 1K731 1VQ4Z
chains in the Genus database with same CATH superfamily
2V3VA 1VQK1 3NH5A 1K83I 5D1OB 2JA7I 3RZDI 1M902 5FLMI 1VQ8Z 1QYPA 2NVYI 4MONA 3MONA 1YJWZ 1ML8A 4A3BI 2NVQI 3OW2Z 1YJNZ 5C4JI 4CL1A 3HKZA 5IT9b 4NB9A 3G71Z 4Y7NI 2EGTA 2GTIA 1Z01A 2AKLA 1KRLA 4AYBA 1Q861 2JIMA 1WIIA 3GKQA 3CQZI 3HOWI 3HOYI 3QWUA 1PFTA 3S15I 1YITZ 4BBRI 4S1TA 2WAQA 2OTJZ 2HF1A 3F3FC 1YHQZ 1Q16A 1WJ2A 1Y1WI 3CME1 3OW2Y 3KIFA 4E2XA 2B63I 3HOXI 1X3ZA 5IP9I 2E9HA 4BY7I 3G4SZ 1RNIA 3CC41 2GU2A 2DE7A 2VPWA 1YJW1 2JMOA 2NAPA 4BBSI 2IZ4A 3NH8A 3MZLB 1S72Z 4MRIA 3G711 3RZOI 3CPWZ 2JR6A 1N8R2 1YI2Z 1LQLA 1VLAA 3S16I 2Q51A 2E2JI 4NB8A 2E2HI 1VQ91 5FLXb 3KIHA 5AN9F 3CCU1 3HOUI 1RLYA 2F4MA 1M1K2 5IP7I 4NBFA 3NFZA 1YIT1 4NFRA 3S1QI 2OTJ1 1K9M1 3ESWA 3VMHA 2R7ZI 2WB1A 1Z02A 1VQOZ 3S14I 1Q7Y2 3PO3S 4E32A 2JUBA 1X3WA 4MD7A 2JNYA 3D6WA 2DE5A 2K5RA 2QA4Z 2PK7A 3CPWY 3CCMZ 1NP6A 3G4S1 4A3MI 3S1NI 2OTLZ 3FQQA 3PO3I 1TWGI 4NBCA 2JIQA 5A2Qb 2KPIA 3I4NI 2VPXA 1QVFZ 2R6MA 3CCE1 2IV2X 1S721 1WW9A 2LIYA 4A3GI 2IZ3A 2RPRA 1Q811 1RQFA 3CCS1 1Q821 3I4MI 2ZAEB 1YUKA 2JA5I 2PM9A 1K732 4E2YA 1Y1VS 3VMIA 4QTUA 2VPYA 2BJOA 3CCVZ 3CD6Z 2NVXI 2AYDA 1QF8A 5T64A 2W03A 4A3EI 1L1OC 4MXUA 3LUSA 1Y1VI 1VQNZ 1NUIA 3S1RI 1RO2A 1KC81 1VQO1 1TFIA 1QVFY 3J81f 3EERA 2JIPA 2E7ZA 2V8IA 2QA41 1TWHI 3EEDA 1ZB8A 3I56Z 1Q862 4RVDA 4RV9A 1W2BZ 3CCRZ 2OTL1 2K3RA 2O53A 2LEXA 4A3JI 3NDJA 3CMAZ 3GTGI 1FDOA 3CC7Z 1VQ6Z 2KI7B 3CC2Z 4DK1A 2RT9A 1USPA 4NBAA 3M4OI 1VQ81 4A3DI 1VQMZ 5C3EI 1SIWA 2O4HA 1DL6A 1YJN1 5C44I 3Q87A 4E31A 2QEXZ 2RBLA 2JIRA 1W2BY 2W04A 3S1MI 4NBEA 2QRCB 3HOZI 1K8A1 3J80f 3CCQZ 1YIJZ 3CCJZ 1YJ9Z 1VQPZ 1NJI1 4DQYB 3F3PC 1S7MA 1ZB9A 3I561 1VQKZ 1YHQ1 2OOYB 2YU9I 3GTKI 3IFUA 3VMGA 2R93I 3PO2I 1K9M2 2I3CA 1ZH1A 1VQ61 4A3KI 3NH4A 3D2LA 3CC21 1I6HI 5T6BA 3BG0B 3TE5B 3K7AI 4A93I 3I55Z 3S2DI 3GCFA 2V45A 3H0GI 2VUMI 3T4NB 3M3YI 2PMZA 3G6EZ 1JJ2Z 1YI21 1KD11 4A3CI 4A3II 5CM2M 3VB9A 3CCQ1 2Y0SA 5D1OA 1Q812 1M901 3J80b 1Q822 2M6NA 1VQP1 4MD9A 4MD8A 1TWAI 1VQLZ 2VF1A 1AA6A 4Y52I 3S2HI 2JIOA 2E2II 5D1PA 3CC4Z 3D9XA 2R92I 2OZKA 3GTPI 4RS4A 4E2WA 4EWCA 1KQSZ 1P9NA 1KC82 1JJ2Y 3CCM1 4NOZA 3GTQI 2RHBA 5FLXf 1TWFI 2JS4A 1QXFA 1VQ4Z 2QR1B 2NVTI 2Q4ZA 2P28A 3I07A 3I551 1VQ9Z 2QREB 3CCUZ 2F4OA 3J7A4 2JA8I 1JWHC 3G6E1 3VTNA 2QKDA 1Z03A 4RVGA 4HH4A 4A3LI 2J6AA 2V8JA 2JA6I 1QVGZ 3GTLI 1FDIA 4BXXI 3FKII 3CCLZ 2P3YA 3CCV1 1RO0A 3CD61 1USPB 2OOXB 4HGYA 3H3VJ 5T67A 1KQSY 3TDHB 4TNUA 4A3FI 3P5JB 1VQL1 2G2KA 2H85A 4DGLA 1I3QI 3JAMf 4BY1I 3BG1B 4MH4A 1VQN1 1N2FA 4XX2A 2QRDB 5A2Qf 1I50I 1VQ5Z 1N8R1 4NBDA 4HGZA 3CXCZ 1TWCI 4E2ZA 1VQ7Z 3GTMS 4NBBA 3CCEZ 1WZNA 2GTHA 1K8A2 4NH1C 3J81b 1M1K1 3IX0A 3NDIA 5C4XI 3CCSZ 4RVHA 5LL6f 3CCR1 1WCMI 1NJI2 1QVGY 1VQ41 3U50C 3GTMI 2RIQA 2LFUA 3CMA1 2M48A 1RO4A 5IT9f 3CC71 3S17I 1Q7Y1 2V8KA 1Y8CA 3IF8A 4NBHA 4X6AI 1VQM1 4NBGA 3HOVI 4E33A 3CCL1 2VUGA 4RVFA 3CXCY 3MZKB 4E30A 2DE6A 2VPZA 2QEX1 1YUAA 3GTOI 2QLVB 1SFOI 3IR7A 3JAMb 1VQ51 3GTJI 1X0TA 1YIJ1 3CMEZ 3CCJ1 1YJ91 1VQ71 3FQMA 1R9TI 1KD12 2HU9A 2YADA 1K731 4QTTA
chains in the Genus database with same CATH topology
1VQK1 3NH5A 1K83I 5D1OB 2JA7I 3RZDI 1M902 5FLMI 1VQ8Z 1QYPA 2NVYI 4MONA 3MONA 1YJWZ 1ML8A 4A3BI 2NVQI 3OW2Z 1YJNZ 5C4JI 4CL1A 3HKZA 5IT9b 4NB9A 3G71Z 4Y7NI 2EGTA 2GTIA 1Z01A 2AKLA 1KRLA 4AYBA 1Q861 1WIIA 3GKQA 3CQZI 3HOWI 3HOYI 3QWUA 1PFTA 3S15I 1YITZ 4BBRI 4S1TA 2WAQA 2OTJZ 2HF1A 3F3FC 1YHQZ 1Y1WI 3CME1 3OW2Y 3KIFA 4E2XA 2B63I 3HOXI 1X3ZA 5IP9I 2E9HA 4BY7I 3G4SZ 1RNIA 3CC41 2GU2A 2DE7A 1YJW1 2JMOA 4BBSI 2IZ4A 3NH8A 3MZLB 1S72Z 4MRIA 3G711 3RZOI 3CPWZ 2JR6A 1N8R2 1YI2Z 1LQLA 1VLAA 3S16I 2Q51A 2E2JI 4NB8A 2E2HI 1VQ91 5FLXb 3KIHA 5AN9F 3CCU1 3HOUI 1RLYA 2F4MA 1M1K2 5IP7I 4NBFA 3NFZA 1YIT1 4NFRA 3S1QI 2OTJ1 1K9M1 3ESWA 3VMHA 2R7ZI 2WB1A 1Z02A 1VQOZ 3S14I 1Q7Y2 3PO3S 4E32A 2JUBA 1X3WA 4MD7A 2JNYA 3D6WA 2DE5A 2K5RA 2QA4Z 2PK7A 3CPWY 3CCMZ 1NP6A 3G4S1 4A3MI 3S1NI 2OTLZ 3FQQA 3PO3I 1TWGI 4NBCA 5A2Qb 2KPIA 3I4NI 1QVFZ 2R6MA 3CCE1 1S721 1WW9A 2LIYA 4A3GI 2IZ3A 2RPRA 1Q811 1RQFA 3CCS1 1Q821 3I4MI 2ZAEB 1YUKA 2JA5I 2PM9A 1K732 4E2YA 1Y1VS 3VMIA 4QTUA 2BJOA 3CCVZ 3CD6Z 2NVXI 1QF8A 5T64A 2W03A 4A3EI 1L1OC 4MXUA 3LUSA 1Y1VI 1VQNZ 1NUIA 3S1RI 1RO2A 1KC81 1VQO1 1TFIA 1QVFY 3J81f 3EERA 2V8IA 2QA41 1TWHI 3EEDA 1ZB8A 3I56Z 1Q862 4RVDA 4RV9A 1W2BZ 3CCRZ 2OTL1 2K3RA 2O53A 4A3JI 3NDJA 3CMAZ 3GTGI 3CC7Z 1VQ6Z 2KI7B 3CC2Z 4DK1A 2RT9A 1USPA 4NBAA 3M4OI 1VQ81 4A3DI 1VQMZ 5C3EI 2O4HA 1DL6A 1YJN1 5C44I 3Q87A 4E31A 2QEXZ 2RBLA 1W2BY 2W04A 3S1MI 4NBEA 2QRCB 3HOZI 1K8A1 3J80f 3CCQZ 1YIJZ 3CCJZ 1YJ9Z 1VQPZ 1NJI1 4DQYB 3F3PC 1S7MA 1ZB9A 3I561 1VQKZ 1YHQ1 2OOYB 2YU9I 3GTKI 3IFUA 3VMGA 2R93I 3PO2I 1K9M2 2I3CA 1ZH1A 1VQ61 4A3KI 3NH4A 3CC21 1I6HI 5T6BA 3BG0B 3TE5B 3K7AI 4A93I 3I55Z 3S2DI 3GCFA 3H0GI 2VUMI 3T4NB 3M3YI 2PMZA 3G6EZ 1JJ2Z 1YI21 1KD11 4A3CI 4A3II 5CM2M 3VB9A 3CCQ1 2Y0SA 5D1OA 1Q812 1M901 3J80b 1Q822 2M6NA 1VQP1 4MD9A 4MD8A 1TWAI 1VQLZ 2VF1A 4Y52I 3S2HI 2E2II 5D1PA 3CC4Z 3D9XA 2R92I 2OZKA 3GTPI 4RS4A 4E2WA 4EWCA 1KQSZ 1P9NA 1KC82 1JJ2Y 3CCM1 4NOZA 3GTQI 2RHBA 5FLXf 1TWFI 2JS4A 1VQ4Z 2QR1B 2NVTI 2Q4ZA 2P28A 3I07A 3I551 1VQ9Z 2QREB 3CCUZ 2F4OA 3J7A4 2JA8I 1JWHC 3G6E1 3VTNA 2QKDA 1Z03A 4RVGA 4HH4A 4A3LI 2J6AA 2V8JA 2JA6I 1QVGZ 3GTLI 4BXXI 3FKII 3CCLZ 2P3YA 3CCV1 1RO0A 3CD61 1USPB 2OOXB 4HGYA 3H3VJ 5T67A 1KQSY 3TDHB 4TNUA 4A3FI 3P5JB 1VQL1 2G2KA 2H85A 4DGLA 1I3QI 3JAMf 4BY1I 3BG1B 4MH4A 1VQN1 1N2FA 4XX2A 2QRDB 5A2Qf 1I50I 1VQ5Z 1N8R1 4NBDA 4HGZA 3CXCZ 1TWCI 4E2ZA 1VQ7Z 3GTMS 4NBBA 3CCEZ 2GTHA 1K8A2 4NH1C 3J81b 1M1K1 3IX0A 3NDIA 5C4XI 3CCSZ 4RVHA 5LL6f 3CCR1 1WCMI 1NJI2 1QVGY 1VQ41 3U50C 3GTMI 2RIQA 2LFUA 3CMA1 2M48A 1RO4A 5IT9f 3CC71 3S17I 1Q7Y1 2V8KA 3IF8A 4NBHA 4X6AI 1VQM1 4NBGA 3HOVI 4E33A 3CCL1 2VUGA 4RVFA 3CXCY 3MZKB 4E30A 2DE6A 2QEX1 1YUAA 3GTOI 2QLVB 1SFOI 3JAMb 1VQ51 3GTJI 1X0TA 1YIJ1 3CMEZ 3CCJ1 1YJ91 1VQ71 3FQMA 1R9TI 1KD12 2HU9A 2YADA 1K731 4QTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  3I55 1;  2QEX Z;  1VQ9 Z;  3CCU Z;  1Q7Y 2;  1VQK 1;  1W2B Y;  1M90 2;  1VQ8 Z;  3G6E 1;  1K8A 1;  3CCQ Z;  2QA4 Z;  3CPW Y;  1YIJ Z;  1YJW Z;  3CCJ Z;  3CCM Z;  1YJ9 Z;  3OW2 Z;  1YJN Z;  3G4S 1;  1VQP Z;  1NJI 1;  2OTL Z;  1QVG Z;  3G71 Z;  3I56 1;  3CCL Z;  3CCV 1;  1QVF Z;  3CD6 1;  1VQK Z;  1YHQ 1;  3CCE 1;  1KQS Y;  1S72 1;  1Q86 1;  1VQL 1;  1Q81 1;  3CCS 1;  1Q82 1;  1K9M 2;  1VQN 1;  1VQ6 1;  1K73 2;  1VQ5 Z;  1YIT Z;  1N8R 1;  3CC2 1;  2OTJ Z;  3CXC Z;  1VQ7 Z;  3CCV Z;  3CD6 Z;  1YHQ Z;  3CCE Z;  1K8A 2;  3CME 1;  3I55 Z;  1M1K 1;  3OW2 Y;  3CCS Z;  3CCR 1;  1VQN Z;  1NJI 2;  1QVG Y;  1KC8 1;  1VQ4 1;  3G6E Z;  1VQO 1;  1JJ2 Z;  1YI2 1;  3CMA 1;  1QVF Y;  1KD1 1;  3G4S Z;  3CC4 1;  3CC7 1;  3CCQ 1;  2QA4 1;  3I56 Z;  1YJW 1;  1Q7Y 1;  1Q86 2;  1Q81 2;  1M90 1;  1Q82 2;  1VQP 1;  1W2B Z;  1VQM 1;  3CCR Z;  2OTL 1;  1S72 Z;  3G71 1;  3CPW Z;  1VQL Z;  3CCL 1;  1N8R 2;  1YI2 Z;  3CMA Z;  3CXC Y;  3CC4 Z;  3CC7 Z;  1VQ6 Z;  2QEX 1;  1VQ9 1;  3CCU 1;  3CC2 Z;  1M1K 2;  1VQ8 1;  1KQS Z;  1VQM Z;  1VQ5 1;  1YIT 1;  1KC8 2;  1JJ2 Y;  1YIJ 1;  3CME Z;  3CCJ 1;  3CCM 1;  1YJ9 1;  2OTJ 1;  1YJN 1;  1K9M 1;  1VQ7 1;  1KD1 2;  1K73 1;  1VQ4 Z; 
#chains in the Genus database with same CATH topology
 2V3V A;  1VQK 1;  3NH5 A;  1K83 I;  5D1O B;  2JA7 I;  3RZD I;  1M90 2;  5FLM I;  1VQ8 Z;  1QYP A;  2NVY I;  4MON A;  3MON A;  1YJW Z;  1ML8 A;  4A3B I;  2NVQ I;  3OW2 Z;  1YJN Z;  5C4J I;  4CL1 A;  3HKZ A;  5IT9 b;  4NB9 A;  3G71 Z;  4Y7N I;  2EGT A;  2GTI A;  1Z01 A;  2AKL A;  1KRL A;  4AYB A;  1Q86 1;  2JIM A;  1WII A;  3GKQ A;  3CQZ I;  3HOW I;  3HOY I;  3QWU A;  1PFT A;  3S15 I;  1YIT Z;  4BBR I;  4S1T A;  2WAQ A;  2OTJ Z;  2HF1 A;  3F3F C;  1YHQ Z;  1Q16 A;  1WJ2 A;  1Y1W I;  3CME 1;  3OW2 Y;  3KIF A;  4E2X A;  2B63 I;  3HOX I;  1X3Z A;  5IP9 I;  2E9H A;  4BY7 I;  3G4S Z;  1RNI A;  3CC4 1;  2GU2 A;  2DE7 A;  2VPW A;  1YJW 1;  2JMO A;  2NAP A;  4BBS I;  2IZ4 A;  3NH8 A;  3MZL B;  1S72 Z;  4MRI A;  3G71 1;  3RZO I;  3CPW Z;  2JR6 A;  1N8R 2;  1YI2 Z;  1LQL A;  1VLA A;  3S16 I;  2Q51 A;  2E2J I;  4NB8 A;  2E2H I;  1VQ9 1;  5FLX b;  3KIH A;  5AN9 F;  3CCU 1;  3HOU I;  1RLY A;  2F4M A;  1M1K 2;  5IP7 I;  4NBF A;  3NFZ A;  1YIT 1;  4NFR A;  3S1Q I;  2OTJ 1;  1K9M 1;  3ESW A;  3VMH A;  2R7Z I;  2WB1 A;  1Z02 A;  1VQO Z;  3S14 I;  1Q7Y 2;  3PO3 S;  4E32 A;  2JUB A;  1X3W A;  4MD7 A;  2JNY A;  3D6W A;  2DE5 A;  2K5R A;  2QA4 Z;  2PK7 A;  3CPW Y;  3CCM Z;  1NP6 A;  3G4S 1;  4A3M I;  3S1N I;  2OTL Z;  3FQQ A;  3PO3 I;  1TWG I;  4NBC A;  2JIQ A;  5A2Q b;  2KPI A;  3I4N I;  2VPX A;  1QVF Z;  2R6M A;  3CCE 1;  2IV2 X;  1S72 1;  1WW9 A;  2LIY A;  4A3G I;  2IZ3 A;  2RPR A;  1Q81 1;  1RQF A;  3CCS 1;  1Q82 1;  3I4M I;  2ZAE B;  1YUK A;  2JA5 I;  2PM9 A;  1K73 2;  4E2Y A;  1Y1V S;  3VMI A;  4QTU A;  2VPY A;  2BJO A;  3CCV Z;  3CD6 Z;  2NVX I;  2AYD A;  1QF8 A;  5T64 A;  2W03 A;  4A3E I;  1L1O C;  4MXU A;  3LUS A;  1Y1V I;  1VQN Z;  1NUI A;  3S1R I;  1RO2 A;  1KC8 1;  1VQO 1;  1TFI A;  1QVF Y;  3J81 f;  3EER A;  2JIP A;  2E7Z A;  2V8I A;  2QA4 1;  1TWH I;  3EED A;  1ZB8 A;  3I56 Z;  1Q86 2;  4RVD A;  4RV9 A;  1W2B Z;  3CCR Z;  2OTL 1;  2K3R A;  2O53 A;  2LEX A;  4A3J I;  3NDJ A;  3CMA Z;  3GTG I;  1FDO A;  3CC7 Z;  1VQ6 Z;  2KI7 B;  3CC2 Z;  4DK1 A;  2RT9 A;  1USP A;  4NBA A;  3M4O I;  1VQ8 1;  4A3D I;  1VQM Z;  5C3E I;  1SIW A;  2O4H A;  1DL6 A;  1YJN 1;  5C44 I;  3Q87 A;  4E31 A;  2QEX Z;  2RBL A;  2JIR A;  1W2B Y;  2W04 A;  3S1M I;  4NBE A;  2QRC B;  3HOZ I;  1K8A 1;  3J80 f;  3CCQ Z;  1YIJ Z;  3CCJ Z;  1YJ9 Z;  1VQP Z;  1NJI 1;  4DQY B;  3F3P C;  1S7M A;  1ZB9 A;  3I56 1;  1VQK Z;  1YHQ 1;  2OOY B;  2YU9 I;  3GTK I;  3IFU A;  3VMG A;  2R93 I;  3PO2 I;  1K9M 2;  2I3C A;  1ZH1 A;  1VQ6 1;  4A3K I;  3NH4 A;  3D2L A;  3CC2 1;  1I6H I;  5T6B A;  3BG0 B;  3TE5 B;  3K7A I;  4A93 I;  3I55 Z;  3S2D I;  3GCF A;  2V45 A;  3H0G I;  2VUM I;  3T4N B;  3M3Y I;  2PMZ A;  3G6E Z;  1JJ2 Z;  1YI2 1;  1KD1 1;  4A3C I;  4A3I I;  5CM2 M;  3VB9 A;  3CCQ 1;  2Y0S A;  5D1O A;  1Q81 2;  1M90 1;  3J80 b;  1Q82 2;  2M6N A;  1VQP 1;  4MD9 A;  4MD8 A;  1TWA I;  1VQL Z;  2VF1 A;  1AA6 A;  4Y52 I;  3S2H I;  2JIO A;  2E2I I;  5D1P A;  3CC4 Z;  3D9X A;  2R92 I;  2OZK A;  3GTP I;  4RS4 A;  4E2W A;  4EWC A;  1KQS Z;  1P9N A;  1KC8 2;  1JJ2 Y;  3CCM 1;  4NOZ A;  3GTQ I;  2RHB A;  5FLX f;  1TWF I;  2JS4 A;  1QXF A;  1VQ4 Z;  2QR1 B;  2NVT I;  2Q4Z A;  2P28 A;  3I07 A;  3I55 1;  1VQ9 Z;  2QRE B;  3CCU Z;  2F4O A;  3J7A 4;  2JA8 I;  1JWH C;  3G6E 1;  3VTN A;  2QKD A;  1Z03 A;  4RVG A;  4HH4 A;  4A3L I;  2J6A A;  2V8J A;  2JA6 I;  1QVG Z;  3GTL I;  1FDI A;  4BXX I;  3FKI I;  3CCL Z;  2P3Y A;  3CCV 1;  1RO0 A;  3CD6 1;  1USP B;  2OOX B;  4HGY A;  3H3V J;  5T67 A;  1KQS Y;  3TDH B;  4TNU A;  4A3F I;  3P5J B;  1VQL 1;  2G2K A;  2H85 A;  4DGL A;  1I3Q I;  3JAM f;  4BY1 I;  3BG1 B;  4MH4 A;  1VQN 1;  1N2F A;  4XX2 A;  2QRD B;  5A2Q f;  1I50 I;  1VQ5 Z;  1N8R 1;  4NBD A;  4HGZ A;  3CXC Z;  1TWC I;  4E2Z A;  1VQ7 Z;  3GTM S;  4NBB A;  3CCE Z;  1WZN A;  2GTH A;  1K8A 2;  4NH1 C;  3J81 b;  1M1K 1;  3IX0 A;  3NDI A;  5C4X I;  3CCS Z;  4RVH A;  5LL6 f;  3CCR 1;  1WCM I;  1NJI 2;  1QVG Y;  1VQ4 1;  3U50 C;  3GTM I;  2RIQ A;  2LFU A;  3CMA 1;  2M48 A;  1RO4 A;  5IT9 f;  3CC7 1;  3S17 I;  1Q7Y 1;  2V8K A;  1Y8C A;  3IF8 A;  4NBH A;  4X6A I;  1VQM 1;  4NBG A;  3HOV I;  4E33 A;  3CCL 1;  2VUG A;  4RVF A;  3CXC Y;  3MZK B;  4E30 A;  2DE6 A;  2VPZ A;  2QEX 1;  1YUA A;  3GTO I;  2QLV B;  1SFO I;  3IR7 A;  3JAM b;  1VQ5 1;  3GTJ I;  1X0T A;  1YIJ 1;  3CME Z;  3CCJ 1;  1YJ9 1;  1VQ7 1;  3FQM A;  1R9T I;  1KD1 2;  2HU9 A;  2YAD A;  1K73 1;  4QTT A; 
#chains in the Genus database with same CATH homology
 1VQK 1;  3NH5 A;  1K83 I;  5D1O B;  2JA7 I;  3RZD I;  1M90 2;  5FLM I;  1VQ8 Z;  1QYP A;  2NVY I;  4MON A;  3MON A;  1YJW Z;  1ML8 A;  4A3B I;  2NVQ I;  3OW2 Z;  1YJN Z;  5C4J I;  4CL1 A;  3HKZ A;  5IT9 b;  4NB9 A;  3G71 Z;  4Y7N I;  2EGT A;  2GTI A;  1Z01 A;  2AKL A;  1KRL A;  4AYB A;  1Q86 1;  1WII A;  3GKQ A;  3CQZ I;  3HOW I;  3HOY I;  3QWU A;  1PFT A;  3S15 I;  1YIT Z;  4BBR I;  4S1T A;  2WAQ A;  2OTJ Z;  2HF1 A;  3F3F C;  1YHQ Z;  1Y1W I;  3CME 1;  3OW2 Y;  3KIF A;  4E2X A;  2B63 I;  3HOX I;  1X3Z A;  5IP9 I;  2E9H A;  4BY7 I;  3G4S Z;  1RNI A;  3CC4 1;  2GU2 A;  2DE7 A;  1YJW 1;  2JMO A;  4BBS I;  2IZ4 A;  3NH8 A;  3MZL B;  1S72 Z;  4MRI A;  3G71 1;  3RZO I;  3CPW Z;  2JR6 A;  1N8R 2;  1YI2 Z;  1LQL A;  1VLA A;  3S16 I;  2Q51 A;  2E2J I;  4NB8 A;  2E2H I;  1VQ9 1;  5FLX b;  3KIH A;  5AN9 F;  3CCU 1;  3HOU I;  1RLY A;  2F4M A;  1M1K 2;  5IP7 I;  4NBF A;  3NFZ A;  1YIT 1;  4NFR A;  3S1Q I;  2OTJ 1;  1K9M 1;  3ESW A;  3VMH A;  2R7Z I;  2WB1 A;  1Z02 A;  1VQO Z;  3S14 I;  1Q7Y 2;  3PO3 S;  4E32 A;  2JUB A;  1X3W A;  4MD7 A;  2JNY A;  3D6W A;  2DE5 A;  2K5R A;  2QA4 Z;  2PK7 A;  3CPW Y;  3CCM Z;  1NP6 A;  3G4S 1;  4A3M I;  3S1N I;  2OTL Z;  3FQQ A;  3PO3 I;  1TWG I;  4NBC A;  5A2Q b;  2KPI A;  3I4N I;  1QVF Z;  2R6M A;  3CCE 1;  1S72 1;  1WW9 A;  2LIY A;  4A3G I;  2IZ3 A;  2RPR A;  1Q81 1;  1RQF A;  3CCS 1;  1Q82 1;  3I4M I;  2ZAE B;  1YUK A;  2JA5 I;  2PM9 A;  1K73 2;  4E2Y A;  1Y1V S;  3VMI A;  4QTU A;  2BJO A;  3CCV Z;  3CD6 Z;  2NVX I;  1QF8 A;  5T64 A;  2W03 A;  4A3E I;  1L1O C;  4MXU A;  3LUS A;  1Y1V I;  1VQN Z;  1NUI A;  3S1R I;  1RO2 A;  1KC8 1;  1VQO 1;  1TFI A;  1QVF Y;  3J81 f;  3EER A;  2V8I A;  2QA4 1;  1TWH I;  3EED A;  1ZB8 A;  3I56 Z;  1Q86 2;  4RVD A;  4RV9 A;  1W2B Z;  3CCR Z;  2OTL 1;  2K3R A;  2O53 A;  4A3J I;  3NDJ A;  3CMA Z;  3GTG I;  3CC7 Z;  1VQ6 Z;  2KI7 B;  3CC2 Z;  4DK1 A;  2RT9 A;  1USP A;  4NBA A;  3M4O I;  1VQ8 1;  4A3D I;  1VQM Z;  5C3E I;  2O4H A;  1DL6 A;  1YJN 1;  5C44 I;  3Q87 A;  4E31 A;  2QEX Z;  2RBL A;  1W2B Y;  2W04 A;  3S1M I;  4NBE A;  2QRC B;  3HOZ I;  1K8A 1;  3J80 f;  3CCQ Z;  1YIJ Z;  3CCJ Z;  1YJ9 Z;  1VQP Z;  1NJI 1;  4DQY B;  3F3P C;  1S7M A;  1ZB9 A;  3I56 1;  1VQK Z;  1YHQ 1;  2OOY B;  2YU9 I;  3GTK I;  3IFU A;  3VMG A;  2R93 I;  3PO2 I;  1K9M 2;  2I3C A;  1ZH1 A;  1VQ6 1;  4A3K I;  3NH4 A;  3CC2 1;  1I6H I;  5T6B A;  3BG0 B;  3TE5 B;  3K7A I;  4A93 I;  3I55 Z;  3S2D I;  3GCF A;  3H0G I;  2VUM I;  3T4N B;  3M3Y I;  2PMZ A;  3G6E Z;  1JJ2 Z;  1YI2 1;  1KD1 1;  4A3C I;  4A3I I;  5CM2 M;  3VB9 A;  3CCQ 1;  2Y0S A;  5D1O A;  1Q81 2;  1M90 1;  3J80 b;  1Q82 2;  2M6N A;  1VQP 1;  4MD9 A;  4MD8 A;  1TWA I;  1VQL Z;  2VF1 A;  4Y52 I;  3S2H I;  2E2I I;  5D1P A;  3CC4 Z;  3D9X A;  2R92 I;  2OZK A;  3GTP I;  4RS4 A;  4E2W A;  4EWC A;  1KQS Z;  1P9N A;  1KC8 2;  1JJ2 Y;  3CCM 1;  4NOZ A;  3GTQ I;  2RHB A;  5FLX f;  1TWF I;  2JS4 A;  1VQ4 Z;  2QR1 B;  2NVT I;  2Q4Z A;  2P28 A;  3I07 A;  3I55 1;  1VQ9 Z;  2QRE B;  3CCU Z;  2F4O A;  3J7A 4;  2JA8 I;  1JWH C;  3G6E 1;  3VTN A;  2QKD A;  1Z03 A;  4RVG A;  4HH4 A;  4A3L I;  2J6A A;  2V8J A;  2JA6 I;  1QVG Z;  3GTL I;  4BXX I;  3FKI I;  3CCL Z;  2P3Y A;  3CCV 1;  1RO0 A;  3CD6 1;  1USP B;  2OOX B;  4HGY A;  3H3V J;  5T67 A;  1KQS Y;  3TDH B;  4TNU A;  4A3F I;  3P5J B;  1VQL 1;  2G2K A;  2H85 A;  4DGL A;  1I3Q I;  3JAM f;  4BY1 I;  3BG1 B;  4MH4 A;  1VQN 1;  1N2F A;  4XX2 A;  2QRD B;  5A2Q f;  1I50 I;  1VQ5 Z;  1N8R 1;  4NBD A;  4HGZ A;  3CXC Z;  1TWC I;  4E2Z A;  1VQ7 Z;  3GTM S;  4NBB A;  3CCE Z;  2GTH A;  1K8A 2;  4NH1 C;  3J81 b;  1M1K 1;  3IX0 A;  3NDI A;  5C4X I;  3CCS Z;  4RVH A;  5LL6 f;  3CCR 1;  1WCM I;  1NJI 2;  1QVG Y;  1VQ4 1;  3U50 C;  3GTM I;  2RIQ A;  2LFU A;  3CMA 1;  2M48 A;  1RO4 A;  5IT9 f;  3CC7 1;  3S17 I;  1Q7Y 1;  2V8K A;  3IF8 A;  4NBH A;  4X6A I;  1VQM 1;  4NBG A;  3HOV I;  4E33 A;  3CCL 1;  2VUG A;  4RVF A;  3CXC Y;  3MZK B;  4E30 A;  2DE6 A;  2QEX 1;  1YUA A;  3GTO I;  2QLV B;  1SFO I;  3JAM b;  1VQ5 1;  3GTJ I;  1X0T A;  1YIJ 1;  3CME Z;  3CCJ 1;  1YJ9 1;  1VQ7 1;  3FQM A;  1R9T I;  1KD1 2;  2HU9 A;  2YAD A;  1K73 1;  4QTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...