1QVFY

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfY00
1VQO1 3CCVZ 1W2BZ 3CC4Z 1NJI1 2OTL1 1VQMZ 1KC82 3CME1 3CXCZ 1VQK1 1VQOZ 1YIJ1 1VQ51 1VQ41 1YJ91 1VQ8Z 1VQKZ 1YHQ1 3CCSZ 1VQ7Z 1K9M2 1VQ5Z 1VQ4Z 1VQP1 1YHQZ 1M902 1KC81 3CD61 1M1K2 1YITZ 3G6EZ 3CC2Z 1Q811 1QVGY 1KD11 3CCRZ 3CC71 3CCMZ 1YI2Z 1M901 1VQ81 3CC7Z 1VQL1 3CCS1 1VQ71 1QVFZ 3OW2Z 3CMAZ 3CCJZ 1K731 1VQLZ 1Q862 1W2BY 1YIT1 1S72Z 3G6E1 3CXCY 3CC21 1KQSZ 3I56Z 3CCR1 3CCM1 1Q822 1YI21 3CPWZ 3G71Z 1Q861 2QEX1 1K9M1 3CCEZ 3CMA1 3CCJ1 2QEXZ 3CCL1 3CCUZ 1JJ2Z 1M1K1 1Q7Y2 1QVGZ 1VQ61 1N8R2 3G4SZ 3CCLZ 1S721 1NJI2 1VQ6Z 3I561 1VQNZ 3OW2Y 1K8A2 3G711 3CCE1 1YJNZ 3I551 2OTJZ 3CCU1 2OTLZ 3G4S1 3I55Z 3CCQ1 1KQSY 3CMEZ 1Q812 1YIJZ 1K8A1 1KD12 3CCQZ 1YJ9Z 1Q821 3CPWY 1YJW1 1VQN1 2QA41 1VQ91 1VQPZ 1YJWZ 1K732 3CC41 3CCV1 1JJ2Y 1QVFY 2QA4Z 3CD6Z 1VQ9Z 1YJN1 1VQM1 1Q7Y1 1N8R1 2OTJ1
chains in the Genus database with same CATH superfamily
1TWHI 2O53A 2G2KA 2OTL1 2KPIA 2QR1B 3CME1 2RIQA 1P9NA 4A3FI 3JAMf 4NBFA 1YUAA 1VQKZ 1YHQ1 3NDJA 3HOWI 3CCSZ 1K9M2 1AA6A 2QRCB 3S2DI 1M902 1M1K2 3G6EZ 3CC2Z 2JMOA 2W04A 3MONA 1WW9A 2JA5I 3MZKB 2JS4A 3VB9A 3I4NI 1KD11 3GTPI 4RVFA 2Q4ZA 2V3VA 1Y1VS 4NBGA 3CCS1 1Q16A 2IZ4A 4E30A 4TNUA 2VPWA 2J6AA 4E2WA 5C44I 1W2BY 5FLXb 4MXUA 3G6E1 3CC21 3D6WA 3NFZA 2BJOA 1KQSZ 2EGTA 3FQQA 2QKDA 4EWCA 5CM2M 1RLYA 3NH5A 3LUSA 1KRLA 2WAQA 2F4MA 2F4OA 1NJI2 2NVXI 2V45A 2K3RA 1Y1WI 4NB8A 4DQYB 2KI7B 2PMZA 1I6HI 3U50C 3S1MI 3I551 2RBLA 2M48A 4HGYA 2DE5A 5IT9b 4NFRA 2R92I 2DE7A 1YJ9Z 1Q821 1YJW1 1VQ91 2W03A 1JWHC 4HGZA 2NVQI 3CC41 3CCV1 3I07A 1QVFY 2OZKA 1VQM1 1Q7Y1 4XX2A 1VQO1 2LEXA 4E31A 5IP9I 1VQ41 3S2HI 1YJ91 3H3VJ 1WCMI 4A3BI 3HOUI 3CQZI 3J81b 3S1RI 3S17I 3GCFA 1YUKA 4NBDA 3FKII 1YHQZ 2K5RA 3GTGI 3HOYI 3IX0A 3JAMb 1Q811 1QVGY 1WIIA 3CC71 3CCMZ 2PK7A 1RQFA 1M901 1TWAI 3VMIA 1QVFZ 4NH1C 2LIYA 2E9HA 1Q862 3J80f 3GKQA 5D1OA 3CXCY 2E2JI 3I4MI 2R6MA 4HH4A 2Y0SA 2JIRA 2M6NA 3CCM1 2V8IA 3HKZA 3CPWZ 1SIWA 3GTMS 1RO2A 2GTHA 3Q87A 4NB9A 3CCEZ 1I50I 4MRIA 4MH4A 1Z02A 3CCUZ 1JJ2Z 1QVGZ 1VQ61 3G4SZ 3PO3I 3IFUA 5T67A 3HOXI 3OW2Y 3VMGA 2VPXA 3CCE1 3PO2I 3RZDI 1YJNZ 2E2II 3EERA 1WZNA 4MD9A 2OTJZ 3CCU1 3G4S1 3I55Z 3CCQ1 2RT9A 3IR7A 1KD12 5D1PA 4E2ZA 2NVYI 4E2YA 1WJ2A 2QA41 1Z01A 1YJWZ 1Z03A 1N2FA 3GTJI 2P28A 1VQ9Z 1YJN1 3GTOI 1N8R1 1K83I 2OTJ1 2E7ZA 2JIOA 3CC4Z 2HU9A 3CCVZ 2H85A 1W2BZ 3GTQI 1VQMZ 1KC82 2Q51A 1RNIA 3T4NB 1VQOZ 3S1QI 1VQ51 1Y1VI 2AYDA 2VUMI 2JIMA 3D9XA 4A3DI 1VQ7Z 3D2LA 2V8JA 1VQ4Z 4A3GI 2E2HI 2WB1A 4DGLA 1DL6A 4RVGA 2IV2X 1LQLA 2PM9A 5C3EI 1YITZ 4NBBA 3BG0B 5C4XI 4BBSI 4X6AI 4E33A 4A3EI 3CCRZ 1TWFI 4A93I 4NBHA 2JA6I 5D1OB 1YI2Z 3M3YI 2R93I 1VQL1 3CC7Z 1VQ71 3CMAZ 1K731 2VPYA 1X0TA 3S1NI 2JR6A 3NH4A 4NBCA 5IP7I 3NH8A 2R7ZI 1YIT1 1S72Z 4BBRI 3GTKI 2JIPA 5A2Qf 3I56Z 3IF8A 3CCR1 1Q822 3HOZI 4QTUA 1YI21 2P3YA 3G71Z 1Q861 2AKLA 2QEX1 3F3FC 2DE6A 1K9M1 2JA7I 3J80b 1S7MA 3CMA1 4BXXI 2RHBA 3CCL1 1M1K1 1Q7Y2 2RPRA 1QYPA 3J7A4 3S14I 1S721 3HOVI 4NOZA 1VQ6Z 5LL6f 1I3QI 3EEDA 3I561 1FDOA 1VQNZ 4BY1I 4E32A 1K8A2 3G711 3GTLI 4MONA 1USPA 1TFIA 3F3PC 4RS4A 2VUGA 4A3JI 1KQSY 4QTTA 1Q812 1L1OC 3H0GI 1YIJZ 3M4OI 1Y8CA 4A3II 3CCQZ 4RV9A 4CL1A 1VQN1 2IZ3A 2V8KA 1VQPZ 3BG1B 2I3CA 1R9TI 2LFUA 3KIFA 2QA4Z 3CD6Z 2O4HA 5FLMI 1SFOI 1QXFA 1NUIA 1X3ZA 1NJI1 1X3WA 3RZOI 4RVHA 3CXCZ 1VQK1 1YIJ1 4A3LI 4BY7I 1VQ8Z 2ZAEB 4MD8A 1VQ5Z 1VQP1 2JA8I 2QREB 5T6BA 1KC81 1NP6A 3TDHB 3CD61 1ZB8A 5FLXf 2VPZA 3S16I 2NVTI 4S1TA 3GTMI 3S15I 1PFTA 2HF1A 5C4JI 2OOYB 1RO0A 1VQ81 4NBAA 3OW2Z 3CCJZ 4A3KI 1VQLZ 2QRDB 2B63I 1TWGI 4Y52I 2JNYA 2YADA 2VF1A 3VMHA 2QLVB 1FDIA 2JUBA 4MD7A 3VTNA 4A3MI 4RVDA 3FQMA 3CCJ1 1ZH1A 4NBEA 2QEXZ 2YU9I 5A2Qb 1N8R2 2GTIA 3CCLZ 4DK1A 1USPB 1TWCI 3P5JB 3NDIA 2GU2A 1QF8A 2JIQA 3K7AI 5IT9f 3TE5B 2NAPA 4A3CI 1ZB9A 1VLAA 3MZLB 5T64A 2OOXB 2OTLZ 3CMEZ 3ESWA 1K8A1 4Y7NI 3KIHA 3CPWY 3PO3S 4AYBA 4E2XA 5AN9F 1RO4A 1K732 1ML8A 1JJ2Y 3J81f 3QWUA
chains in the Genus database with same CATH topology
1TWHI 2O53A 2G2KA 2OTL1 2KPIA 2QR1B 3CME1 2RIQA 1P9NA 4A3FI 3JAMf 4NBFA 1YUAA 1VQKZ 1YHQ1 3NDJA 3HOWI 3CCSZ 1K9M2 2QRCB 3S2DI 1M902 1M1K2 3G6EZ 3CC2Z 2JMOA 2W04A 3MONA 1WW9A 2JA5I 3MZKB 2JS4A 3VB9A 3I4NI 1KD11 3GTPI 4RVFA 2Q4ZA 1Y1VS 4NBGA 3CCS1 2IZ4A 4E30A 4TNUA 2J6AA 4E2WA 5C44I 1W2BY 5FLXb 4MXUA 3G6E1 3CC21 3D6WA 3NFZA 2BJOA 1KQSZ 2EGTA 3FQQA 2QKDA 4EWCA 5CM2M 1RLYA 3NH5A 3LUSA 1KRLA 2WAQA 2F4MA 2F4OA 1NJI2 2NVXI 2K3RA 1Y1WI 4NB8A 4DQYB 2KI7B 2PMZA 1I6HI 3U50C 3S1MI 3I551 2RBLA 2M48A 4HGYA 2DE5A 5IT9b 4NFRA 2R92I 2DE7A 1YJ9Z 1Q821 1YJW1 1VQ91 2W03A 1JWHC 4HGZA 2NVQI 3CC41 3CCV1 3I07A 1QVFY 2OZKA 1VQM1 1Q7Y1 4XX2A 1VQO1 4E31A 5IP9I 1VQ41 3S2HI 1YJ91 3H3VJ 1WCMI 4A3BI 3HOUI 3CQZI 3J81b 3S1RI 3S17I 3GCFA 1YUKA 4NBDA 3FKII 1YHQZ 2K5RA 3GTGI 3HOYI 3IX0A 3JAMb 1Q811 1QVGY 1WIIA 3CC71 3CCMZ 2PK7A 1RQFA 1M901 1TWAI 3VMIA 1QVFZ 4NH1C 2LIYA 2E9HA 1Q862 3J80f 3GKQA 5D1OA 3CXCY 2E2JI 3I4MI 2R6MA 4HH4A 2Y0SA 2M6NA 3CCM1 2V8IA 3HKZA 3CPWZ 3GTMS 1RO2A 2GTHA 3Q87A 4NB9A 3CCEZ 1I50I 4MRIA 4MH4A 1Z02A 3CCUZ 1JJ2Z 1QVGZ 1VQ61 3G4SZ 3PO3I 3IFUA 5T67A 3HOXI 3OW2Y 3VMGA 3CCE1 3PO2I 3RZDI 1YJNZ 2E2II 3EERA 4MD9A 2OTJZ 3CCU1 3G4S1 3I55Z 3CCQ1 2RT9A 1KD12 5D1PA 4E2ZA 2NVYI 4E2YA 2QA41 1Z01A 1YJWZ 1Z03A 1N2FA 3GTJI 2P28A 1VQ9Z 1YJN1 3GTOI 1N8R1 1K83I 2OTJ1 3CC4Z 2HU9A 3CCVZ 2H85A 1W2BZ 3GTQI 1VQMZ 1KC82 2Q51A 1RNIA 3T4NB 1VQOZ 3S1QI 1VQ51 1Y1VI 2VUMI 3D9XA 4A3DI 1VQ7Z 2V8JA 1VQ4Z 4A3GI 2E2HI 2WB1A 4DGLA 1DL6A 4RVGA 1LQLA 2PM9A 5C3EI 1YITZ 4NBBA 3BG0B 5C4XI 4BBSI 4X6AI 4E33A 4A3EI 3CCRZ 1TWFI 4A93I 4NBHA 2JA6I 5D1OB 1YI2Z 3M3YI 2R93I 1VQL1 3CC7Z 1VQ71 3CMAZ 1K731 1X0TA 3S1NI 2JR6A 3NH4A 4NBCA 5IP7I 3NH8A 2R7ZI 1YIT1 1S72Z 4BBRI 3GTKI 5A2Qf 3I56Z 3IF8A 3CCR1 1Q822 3HOZI 4QTUA 1YI21 2P3YA 3G71Z 1Q861 2AKLA 2QEX1 3F3FC 2DE6A 1K9M1 2JA7I 3J80b 1S7MA 3CMA1 4BXXI 2RHBA 3CCL1 1M1K1 1Q7Y2 2RPRA 1QYPA 3J7A4 3S14I 1S721 3HOVI 4NOZA 1VQ6Z 5LL6f 1I3QI 3EEDA 3I561 1VQNZ 4BY1I 4E32A 1K8A2 3G711 3GTLI 4MONA 1USPA 1TFIA 3F3PC 4RS4A 2VUGA 4A3JI 1KQSY 4QTTA 1Q812 1L1OC 3H0GI 1YIJZ 3M4OI 4A3II 3CCQZ 4RV9A 4CL1A 1VQN1 2IZ3A 2V8KA 1VQPZ 3BG1B 2I3CA 1R9TI 2LFUA 3KIFA 2QA4Z 3CD6Z 2O4HA 5FLMI 1SFOI 1NUIA 1X3ZA 1NJI1 1X3WA 3RZOI 4RVHA 3CXCZ 1VQK1 1YIJ1 4A3LI 4BY7I 1VQ8Z 2ZAEB 4MD8A 1VQ5Z 1VQP1 2JA8I 2QREB 5T6BA 1KC81 1NP6A 3TDHB 3CD61 1ZB8A 5FLXf 3S16I 2NVTI 4S1TA 3GTMI 3S15I 1PFTA 2HF1A 5C4JI 2OOYB 1RO0A 1VQ81 4NBAA 3OW2Z 3CCJZ 4A3KI 1VQLZ 2QRDB 2B63I 1TWGI 4Y52I 2JNYA 2YADA 2VF1A 3VMHA 2QLVB 2JUBA 4MD7A 3VTNA 4A3MI 4RVDA 3FQMA 3CCJ1 1ZH1A 4NBEA 2QEXZ 2YU9I 5A2Qb 1N8R2 2GTIA 3CCLZ 4DK1A 1USPB 1TWCI 3P5JB 3NDIA 2GU2A 1QF8A 3K7AI 5IT9f 3TE5B 4A3CI 1ZB9A 1VLAA 3MZLB 5T64A 2OOXB 2OTLZ 3CMEZ 3ESWA 1K8A1 4Y7NI 3KIHA 3CPWY 3PO3S 4AYBA 4E2XA 5AN9F 1RO4A 1K732 1ML8A 1JJ2Y 3J81f 3QWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO 1;  3CCV Z;  1W2B Z;  3CC4 Z;  1NJI 1;  2OTL 1;  1VQM Z;  1KC8 2;  3CME 1;  3CXC Z;  1VQK 1;  1VQO Z;  1YIJ 1;  1VQ5 1;  1VQ4 1;  1YJ9 1;  1VQ8 Z;  1VQK Z;  1YHQ 1;  3CCS Z;  1VQ7 Z;  1K9M 2;  1VQ5 Z;  1VQ4 Z;  1VQP 1;  1YHQ Z;  1M90 2;  1KC8 1;  3CD6 1;  1M1K 2;  1YIT Z;  3G6E Z;  3CC2 Z;  1Q81 1;  1QVG Y;  1KD1 1;  3CCR Z;  3CC7 1;  3CCM Z;  1YI2 Z;  1M90 1;  1VQ8 1;  3CC7 Z;  1VQL 1;  3CCS 1;  1VQ7 1;  1QVF Z;  3OW2 Z;  3CMA Z;  3CCJ Z;  1K73 1;  1VQL Z;  1Q86 2;  1W2B Y;  1YIT 1;  1S72 Z;  3G6E 1;  3CXC Y;  3CC2 1;  1KQS Z;  3I56 Z;  3CCR 1;  3CCM 1;  1Q82 2;  1YI2 1;  3CPW Z;  3G71 Z;  1Q86 1;  2QEX 1;  1K9M 1;  3CCE Z;  3CMA 1;  3CCJ 1;  2QEX Z;  3CCL 1;  3CCU Z;  1JJ2 Z;  1M1K 1;  1Q7Y 2;  1QVG Z;  1VQ6 1;  1N8R 2;  3G4S Z;  3CCL Z;  1S72 1;  1NJI 2;  1VQ6 Z;  3I56 1;  1VQN Z;  3OW2 Y;  1K8A 2;  3G71 1;  3CCE 1;  1YJN Z;  3I55 1;  2OTJ Z;  3CCU 1;  2OTL Z;  3G4S 1;  3I55 Z;  3CCQ 1;  1KQS Y;  3CME Z;  1Q81 2;  1YIJ Z;  1K8A 1;  1KD1 2;  3CCQ Z;  1YJ9 Z;  1Q82 1;  3CPW Y;  1YJW 1;  1VQN 1;  2QA4 1;  1VQ9 1;  1VQP Z;  1YJW Z;  1K73 2;  3CC4 1;  3CCV 1;  1JJ2 Y;  1QVF Y;  2QA4 Z;  3CD6 Z;  1VQ9 Z;  1YJN 1;  1VQM 1;  1Q7Y 1;  1N8R 1;  2OTJ 1; 
#chains in the Genus database with same CATH topology
 1TWH I;  2O53 A;  2G2K A;  2OTL 1;  2KPI A;  2QR1 B;  3CME 1;  2RIQ A;  1P9N A;  4A3F I;  3JAM f;  4NBF A;  1YUA A;  1VQK Z;  1YHQ 1;  3NDJ A;  3HOW I;  3CCS Z;  1K9M 2;  1AA6 A;  2QRC B;  3S2D I;  1M90 2;  1M1K 2;  3G6E Z;  3CC2 Z;  2JMO A;  2W04 A;  3MON A;  1WW9 A;  2JA5 I;  3MZK B;  2JS4 A;  3VB9 A;  3I4N I;  1KD1 1;  3GTP I;  4RVF A;  2Q4Z A;  2V3V A;  1Y1V S;  4NBG A;  3CCS 1;  1Q16 A;  2IZ4 A;  4E30 A;  4TNU A;  2VPW A;  2J6A A;  4E2W A;  5C44 I;  1W2B Y;  5FLX b;  4MXU A;  3G6E 1;  3CC2 1;  3D6W A;  3NFZ A;  2BJO A;  1KQS Z;  2EGT A;  3FQQ A;  2QKD A;  4EWC A;  5CM2 M;  1RLY A;  3NH5 A;  3LUS A;  1KRL A;  2WAQ A;  2F4M A;  2F4O A;  1NJI 2;  2NVX I;  2V45 A;  2K3R A;  1Y1W I;  4NB8 A;  4DQY B;  2KI7 B;  2PMZ A;  1I6H I;  3U50 C;  3S1M I;  3I55 1;  2RBL A;  2M48 A;  4HGY A;  2DE5 A;  5IT9 b;  4NFR A;  2R92 I;  2DE7 A;  1YJ9 Z;  1Q82 1;  1YJW 1;  1VQ9 1;  2W03 A;  1JWH C;  4HGZ A;  2NVQ I;  3CC4 1;  3CCV 1;  3I07 A;  1QVF Y;  2OZK A;  1VQM 1;  1Q7Y 1;  4XX2 A;  1VQO 1;  2LEX A;  4E31 A;  5IP9 I;  1VQ4 1;  3S2H I;  1YJ9 1;  3H3V J;  1WCM I;  4A3B I;  3HOU I;  3CQZ I;  3J81 b;  3S1R I;  3S17 I;  3GCF A;  1YUK A;  4NBD A;  3FKI I;  1YHQ Z;  2K5R A;  3GTG I;  3HOY I;  3IX0 A;  3JAM b;  1Q81 1;  1QVG Y;  1WII A;  3CC7 1;  3CCM Z;  2PK7 A;  1RQF A;  1M90 1;  1TWA I;  3VMI A;  1QVF Z;  4NH1 C;  2LIY A;  2E9H A;  1Q86 2;  3J80 f;  3GKQ A;  5D1O A;  3CXC Y;  2E2J I;  3I4M I;  2R6M A;  4HH4 A;  2Y0S A;  2JIR A;  2M6N A;  3CCM 1;  2V8I A;  3HKZ A;  3CPW Z;  1SIW A;  3GTM S;  1RO2 A;  2GTH A;  3Q87 A;  4NB9 A;  3CCE Z;  1I50 I;  4MRI A;  4MH4 A;  1Z02 A;  3CCU Z;  1JJ2 Z;  1QVG Z;  1VQ6 1;  3G4S Z;  3PO3 I;  3IFU A;  5T67 A;  3HOX I;  3OW2 Y;  3VMG A;  2VPX A;  3CCE 1;  3PO2 I;  3RZD I;  1YJN Z;  2E2I I;  3EER A;  1WZN A;  4MD9 A;  2OTJ Z;  3CCU 1;  3G4S 1;  3I55 Z;  3CCQ 1;  2RT9 A;  3IR7 A;  1KD1 2;  5D1P A;  4E2Z A;  2NVY I;  4E2Y A;  1WJ2 A;  2QA4 1;  1Z01 A;  1YJW Z;  1Z03 A;  1N2F A;  3GTJ I;  2P28 A;  1VQ9 Z;  1YJN 1;  3GTO I;  1N8R 1;  1K83 I;  2OTJ 1;  2E7Z A;  2JIO A;  3CC4 Z;  2HU9 A;  3CCV Z;  2H85 A;  1W2B Z;  3GTQ I;  1VQM Z;  1KC8 2;  2Q51 A;  1RNI A;  3T4N B;  1VQO Z;  3S1Q I;  1VQ5 1;  1Y1V I;  2AYD A;  2VUM I;  2JIM A;  3D9X A;  4A3D I;  1VQ7 Z;  3D2L A;  2V8J A;  1VQ4 Z;  4A3G I;  2E2H I;  2WB1 A;  4DGL A;  1DL6 A;  4RVG A;  2IV2 X;  1LQL A;  2PM9 A;  5C3E I;  1YIT Z;  4NBB A;  3BG0 B;  5C4X I;  4BBS I;  4X6A I;  4E33 A;  4A3E I;  3CCR Z;  1TWF I;  4A93 I;  4NBH A;  2JA6 I;  5D1O B;  1YI2 Z;  3M3Y I;  2R93 I;  1VQL 1;  3CC7 Z;  1VQ7 1;  3CMA Z;  1K73 1;  2VPY A;  1X0T A;  3S1N I;  2JR6 A;  3NH4 A;  4NBC A;  5IP7 I;  3NH8 A;  2R7Z I;  1YIT 1;  1S72 Z;  4BBR I;  3GTK I;  2JIP A;  5A2Q f;  3I56 Z;  3IF8 A;  3CCR 1;  1Q82 2;  3HOZ I;  4QTU A;  1YI2 1;  2P3Y A;  3G71 Z;  1Q86 1;  2AKL A;  2QEX 1;  3F3F C;  2DE6 A;  1K9M 1;  2JA7 I;  3J80 b;  1S7M A;  3CMA 1;  4BXX I;  2RHB A;  3CCL 1;  1M1K 1;  1Q7Y 2;  2RPR A;  1QYP A;  3J7A 4;  3S14 I;  1S72 1;  3HOV I;  4NOZ A;  1VQ6 Z;  5LL6 f;  1I3Q I;  3EED A;  3I56 1;  1FDO A;  1VQN Z;  4BY1 I;  4E32 A;  1K8A 2;  3G71 1;  3GTL I;  4MON A;  1USP A;  1TFI A;  3F3P C;  4RS4 A;  2VUG A;  4A3J I;  1KQS Y;  4QTT A;  1Q81 2;  1L1O C;  3H0G I;  1YIJ Z;  3M4O I;  1Y8C A;  4A3I I;  3CCQ Z;  4RV9 A;  4CL1 A;  1VQN 1;  2IZ3 A;  2V8K A;  1VQP Z;  3BG1 B;  2I3C A;  1R9T I;  2LFU A;  3KIF A;  2QA4 Z;  3CD6 Z;  2O4H A;  5FLM I;  1SFO I;  1QXF A;  1NUI A;  1X3Z A;  1NJI 1;  1X3W A;  3RZO I;  4RVH A;  3CXC Z;  1VQK 1;  1YIJ 1;  4A3L I;  4BY7 I;  1VQ8 Z;  2ZAE B;  4MD8 A;  1VQ5 Z;  1VQP 1;  2JA8 I;  2QRE B;  5T6B A;  1KC8 1;  1NP6 A;  3TDH B;  3CD6 1;  1ZB8 A;  5FLX f;  2VPZ A;  3S16 I;  2NVT I;  4S1T A;  3GTM I;  3S15 I;  1PFT A;  2HF1 A;  5C4J I;  2OOY B;  1RO0 A;  1VQ8 1;  4NBA A;  3OW2 Z;  3CCJ Z;  4A3K I;  1VQL Z;  2QRD B;  2B63 I;  1TWG I;  4Y52 I;  2JNY A;  2YAD A;  2VF1 A;  3VMH A;  2QLV B;  1FDI A;  2JUB A;  4MD7 A;  3VTN A;  4A3M I;  4RVD A;  3FQM A;  3CCJ 1;  1ZH1 A;  4NBE A;  2QEX Z;  2YU9 I;  5A2Q b;  1N8R 2;  2GTI A;  3CCL Z;  4DK1 A;  1USP B;  1TWC I;  3P5J B;  3NDI A;  2GU2 A;  1QF8 A;  2JIQ A;  3K7A I;  5IT9 f;  3TE5 B;  2NAP A;  4A3C I;  1ZB9 A;  1VLA A;  3MZL B;  5T64 A;  2OOX B;  2OTL Z;  3CME Z;  3ESW A;  1K8A 1;  4Y7N I;  3KIH A;  3CPW Y;  3PO3 S;  4AYB A;  4E2X A;  5AN9 F;  1RO4 A;  1K73 2;  1ML8 A;  1JJ2 Y;  3J81 f;  3QWU A; 
#chains in the Genus database with same CATH homology
 1TWH I;  2O53 A;  2G2K A;  2OTL 1;  2KPI A;  2QR1 B;  3CME 1;  2RIQ A;  1P9N A;  4A3F I;  3JAM f;  4NBF A;  1YUA A;  1VQK Z;  1YHQ 1;  3NDJ A;  3HOW I;  3CCS Z;  1K9M 2;  2QRC B;  3S2D I;  1M90 2;  1M1K 2;  3G6E Z;  3CC2 Z;  2JMO A;  2W04 A;  3MON A;  1WW9 A;  2JA5 I;  3MZK B;  2JS4 A;  3VB9 A;  3I4N I;  1KD1 1;  3GTP I;  4RVF A;  2Q4Z A;  1Y1V S;  4NBG A;  3CCS 1;  2IZ4 A;  4E30 A;  4TNU A;  2J6A A;  4E2W A;  5C44 I;  1W2B Y;  5FLX b;  4MXU A;  3G6E 1;  3CC2 1;  3D6W A;  3NFZ A;  2BJO A;  1KQS Z;  2EGT A;  3FQQ A;  2QKD A;  4EWC A;  5CM2 M;  1RLY A;  3NH5 A;  3LUS A;  1KRL A;  2WAQ A;  2F4M A;  2F4O A;  1NJI 2;  2NVX I;  2K3R A;  1Y1W I;  4NB8 A;  4DQY B;  2KI7 B;  2PMZ A;  1I6H I;  3U50 C;  3S1M I;  3I55 1;  2RBL A;  2M48 A;  4HGY A;  2DE5 A;  5IT9 b;  4NFR A;  2R92 I;  2DE7 A;  1YJ9 Z;  1Q82 1;  1YJW 1;  1VQ9 1;  2W03 A;  1JWH C;  4HGZ A;  2NVQ I;  3CC4 1;  3CCV 1;  3I07 A;  1QVF Y;  2OZK A;  1VQM 1;  1Q7Y 1;  4XX2 A;  1VQO 1;  4E31 A;  5IP9 I;  1VQ4 1;  3S2H I;  1YJ9 1;  3H3V J;  1WCM I;  4A3B I;  3HOU I;  3CQZ I;  3J81 b;  3S1R I;  3S17 I;  3GCF A;  1YUK A;  4NBD A;  3FKI I;  1YHQ Z;  2K5R A;  3GTG I;  3HOY I;  3IX0 A;  3JAM b;  1Q81 1;  1QVG Y;  1WII A;  3CC7 1;  3CCM Z;  2PK7 A;  1RQF A;  1M90 1;  1TWA I;  3VMI A;  1QVF Z;  4NH1 C;  2LIY A;  2E9H A;  1Q86 2;  3J80 f;  3GKQ A;  5D1O A;  3CXC Y;  2E2J I;  3I4M I;  2R6M A;  4HH4 A;  2Y0S A;  2M6N A;  3CCM 1;  2V8I A;  3HKZ A;  3CPW Z;  3GTM S;  1RO2 A;  2GTH A;  3Q87 A;  4NB9 A;  3CCE Z;  1I50 I;  4MRI A;  4MH4 A;  1Z02 A;  3CCU Z;  1JJ2 Z;  1QVG Z;  1VQ6 1;  3G4S Z;  3PO3 I;  3IFU A;  5T67 A;  3HOX I;  3OW2 Y;  3VMG A;  3CCE 1;  3PO2 I;  3RZD I;  1YJN Z;  2E2I I;  3EER A;  4MD9 A;  2OTJ Z;  3CCU 1;  3G4S 1;  3I55 Z;  3CCQ 1;  2RT9 A;  1KD1 2;  5D1P A;  4E2Z A;  2NVY I;  4E2Y A;  2QA4 1;  1Z01 A;  1YJW Z;  1Z03 A;  1N2F A;  3GTJ I;  2P28 A;  1VQ9 Z;  1YJN 1;  3GTO I;  1N8R 1;  1K83 I;  2OTJ 1;  3CC4 Z;  2HU9 A;  3CCV Z;  2H85 A;  1W2B Z;  3GTQ I;  1VQM Z;  1KC8 2;  2Q51 A;  1RNI A;  3T4N B;  1VQO Z;  3S1Q I;  1VQ5 1;  1Y1V I;  2VUM I;  3D9X A;  4A3D I;  1VQ7 Z;  2V8J A;  1VQ4 Z;  4A3G I;  2E2H I;  2WB1 A;  4DGL A;  1DL6 A;  4RVG A;  1LQL A;  2PM9 A;  5C3E I;  1YIT Z;  4NBB A;  3BG0 B;  5C4X I;  4BBS I;  4X6A I;  4E33 A;  4A3E I;  3CCR Z;  1TWF I;  4A93 I;  4NBH A;  2JA6 I;  5D1O B;  1YI2 Z;  3M3Y I;  2R93 I;  1VQL 1;  3CC7 Z;  1VQ7 1;  3CMA Z;  1K73 1;  1X0T A;  3S1N I;  2JR6 A;  3NH4 A;  4NBC A;  5IP7 I;  3NH8 A;  2R7Z I;  1YIT 1;  1S72 Z;  4BBR I;  3GTK I;  5A2Q f;  3I56 Z;  3IF8 A;  3CCR 1;  1Q82 2;  3HOZ I;  4QTU A;  1YI2 1;  2P3Y A;  3G71 Z;  1Q86 1;  2AKL A;  2QEX 1;  3F3F C;  2DE6 A;  1K9M 1;  2JA7 I;  3J80 b;  1S7M A;  3CMA 1;  4BXX I;  2RHB A;  3CCL 1;  1M1K 1;  1Q7Y 2;  2RPR A;  1QYP A;  3J7A 4;  3S14 I;  1S72 1;  3HOV I;  4NOZ A;  1VQ6 Z;  5LL6 f;  1I3Q I;  3EED A;  3I56 1;  1VQN Z;  4BY1 I;  4E32 A;  1K8A 2;  3G71 1;  3GTL I;  4MON A;  1USP A;  1TFI A;  3F3P C;  4RS4 A;  2VUG A;  4A3J I;  1KQS Y;  4QTT A;  1Q81 2;  1L1O C;  3H0G I;  1YIJ Z;  3M4O I;  4A3I I;  3CCQ Z;  4RV9 A;  4CL1 A;  1VQN 1;  2IZ3 A;  2V8K A;  1VQP Z;  3BG1 B;  2I3C A;  1R9T I;  2LFU A;  3KIF A;  2QA4 Z;  3CD6 Z;  2O4H A;  5FLM I;  1SFO I;  1NUI A;  1X3Z A;  1NJI 1;  1X3W A;  3RZO I;  4RVH A;  3CXC Z;  1VQK 1;  1YIJ 1;  4A3L I;  4BY7 I;  1VQ8 Z;  2ZAE B;  4MD8 A;  1VQ5 Z;  1VQP 1;  2JA8 I;  2QRE B;  5T6B A;  1KC8 1;  1NP6 A;  3TDH B;  3CD6 1;  1ZB8 A;  5FLX f;  3S16 I;  2NVT I;  4S1T A;  3GTM I;  3S15 I;  1PFT A;  2HF1 A;  5C4J I;  2OOY B;  1RO0 A;  1VQ8 1;  4NBA A;  3OW2 Z;  3CCJ Z;  4A3K I;  1VQL Z;  2QRD B;  2B63 I;  1TWG I;  4Y52 I;  2JNY A;  2YAD A;  2VF1 A;  3VMH A;  2QLV B;  2JUB A;  4MD7 A;  3VTN A;  4A3M I;  4RVD A;  3FQM A;  3CCJ 1;  1ZH1 A;  4NBE A;  2QEX Z;  2YU9 I;  5A2Q b;  1N8R 2;  2GTI A;  3CCL Z;  4DK1 A;  1USP B;  1TWC I;  3P5J B;  3NDI A;  2GU2 A;  1QF8 A;  3K7A I;  5IT9 f;  3TE5 B;  4A3C I;  1ZB9 A;  1VLA A;  3MZL B;  5T64 A;  2OOX B;  2OTL Z;  3CME Z;  3ESW A;  1K8A 1;  4Y7N I;  3KIH A;  3CPW Y;  3PO3 S;  4AYB A;  4E2X A;  5AN9 F;  1RO4 A;  1K73 2;  1ML8 A;  1JJ2 Y;  3J81 f;  3QWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...