1YJNZ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjnZ00
3CCUZ 1VQP1 1VQ8Z 3CCE1 1VQ9Z 1N8R2 3I56Z 2QA41 1VQK1 2QEX1 1VQL1 1K8A2 1YIJZ 2OTLZ 3I55Z 1YIT1 1M901 1KD11 1KQSY 1VQM1 1VQPZ 1JJ2Z 3CCEZ 1VQ51 1KD12 3G4S1 3OW2Y 3CC41 1YJNZ 3CCL1 2QA4Z 3CPWZ 1VQKZ 1VQ41 2QEXZ 1N8R1 1YITZ 1NJI2 3CCR1 1VQN1 1K8A1 1S721 1VQMZ 3CC71 1YJW1 2OTJZ 1VQ5Z 1Q822 1VQO1 3G4SZ 1YHQ1 1YJ91 3CC4Z 3CCLZ 3CCMZ 1K732 1VQ4Z 3CCJ1 1M1K2 1KQSZ 3G6E1 3CC2Z 3CCQ1 3CCRZ 1YI21 3CD61 1VQ61 1S72Z 3CC7Z 1NJI1 3CMA1 3OW2Z 1VQLZ 1VQOZ 1YHQZ 1YJ9Z 3G711 1QVGZ 1Q821 1KC82 1VQ71 1QVFY 1W2BZ 1Q862 3CCJZ 1YI2Z 1Q7Y2 1K731 1VQ6Z 1M1K1 3CXCY 3I561 3CCS1 1YIJ1 2OTL1 1K9M2 1VQNZ 1VQ7Z 1Q812 1YJWZ 1KC81 1Q861 3CME1 1Q7Y1 3CCV1 1YJN1 3CCSZ 3G6EZ 3CCQZ 1QVFZ 3CCU1 3CD6Z 1VQ81 1K9M1 1VQ91 1JJ2Y 3CC21 1Q811 3CXCZ 2OTJ1 1M902 3CMAZ 3CMEZ 3CPWY 3I551 3CCVZ 3G71Z 3CCM1 1QVGY 1W2BY
chains in the Genus database with same CATH superfamily
2K3RA 2V8JA 3ESWA 3VTNA 4NOZA 2LEXA 2Y0SA 1K8A2 2OTLZ 2I3CA 3GTMS 3K7AI 2G2KA 3PO3I 2OZKA 1JJ2Z 1KD12 4MD7A 2LFUA 5D1PA 1VLAA 3J81b 1Y1WI 3I4MI 2V8KA 1WZNA 2OTJZ 2W04A 5IP7I 4MH4A 1Q822 2K5RA 1YUKA 4A3II 1K732 1M1K2 1KQSZ 3KIFA 3CC2Z 3HOZI 1NJI1 3IFUA 3CMA1 3GTOI 1YJ9Z 1W2BZ 5LL6f 1QF8A 4HH4A 4A3FI 1YI2Z 1NP6A 3CXCY 5D1OA 3CCS1 4RVGA 3TDHB 3BG1B 2OTL1 2KPIA 2V3VA 2JIRA 1VQNZ 1Q812 2JNYA 3S1RI 1KC81 2M6NA 4A3JI 1Q861 2R93I 2JA6I 1Q7Y1 3GTMI 5A2Qb 4RVFA 1QXFA 3D6WA 2V8IA 3G6EZ 3CCU1 3H0GI 2NVQI 2Q4ZA 2QKDA 1K9M1 2O4HA 4QTTA 3GCFA 4NB9A 2RHBA 4NBFA 2OTJ1 1M902 2J6AA 3CPWY 2F4OA 5FLXb 3JAMf 3CQZI 1N2FA 3TE5B 1RLYA 3CC21 1W2BY 3CCE1 2P3YA 1N8R2 3F3FC 1TWAI 2P28A 4A3DI 1USPB 3I07A 2QA41 1Y1VI 3M3YI 4NBBA 2QEX1 1YIJZ 2R92I 1FDOA 1RNIA 2JMOA 1KD11 1VQM1 4NBEA 1TWFI 2NVTI 4MD8A 1VQPZ 4A3KI 3RZOI 3G4S1 3QWUA 5T67A 3CC41 3CCL1 1TWCI 1VQKZ 1X0TA 5AN9F 1YITZ 3CCR1 1VQN1 3Q87A 1S721 3CC71 2VPYA 2JIPA 2JS4A 1VQ5Z 2B63I 1Z01A 1VQO1 4RVHA 4HGZA 2PK7A 1VQ4Z 4BY1I 4RS4A 4X6AI 4RVDA 1RQFA 3G6E1 1I50I 2EGTA 1K83I 3KIHA 3NH5A 1WCMI 2OOXB 2JIMA 2O53A 3OW2Z 1YHQZ 2OOYB 2JIQA 1VQ71 1QVFY 1I3QI 2YADA 3CCJZ 4BXXI 2RT9A 5CM2M 4A3EI 3HKZA 3RZDI 1VQ6Z 3GTKI 5C4XI 3S1MI 2H85A 5T64A 1Z03A 4A3MI 1YIJ1 2HU9A 1Y1VS 5C3EI 3J81f 1YJWZ 2DE7A 1TWGI 3BG0B 1RO2A 4MD9A 2QLVB 3NDIA 4E33A 3CCQZ 5FLMI 1TWHI 3F3PC 1JJ2Y 2AKLA 3FKII 3CMEZ 2JUBA 3CCVZ 1RO0A 4AYBA 5IT9b 3VMIA 1JWHC 1WW9A 4NBHA 1S7MA 3D2LA 1VQ8Z 4A3LI 1VQ9Z 2F4MA 3M4OI 1Z02A 3GKQA 3HOVI 3S14I 3I56Z 4XX2A 2QR1B 2VPZA 3I55Z 3EEDA 3S17I 4A3CI 5IT9f 1KQSY 3S1QI 1I6HI 1YJNZ 5A2Qf 5C4JI 3D9XA 2E2II 3HOXI 2JR6A 3GTQI 1NJI2 4DQYB 2ZAEB 1K8A1 2RBLA 1YJW1 5IP9I 3EERA 3HOUI 3IX0A 1YJ91 5FLXf 4A3GI 1ZB8A 1SIWA 4E32A 2RIQA 3CCQ1 1YI21 3NFZA 2IZ3A 3IF8A 3NDJA 2JA8I 3GTJI 1FDIA 2QREB 1VQLZ 4E2YA 1ML8A 4NFRA 1KC82 1Q821 1L1OC 4E31A 1Q862 3GTLI 5D1OB 2DE5A 1R9TI 2WAQA 1Q7Y2 1K731 3HOWI 1PFTA 2AYDA 4NBAA 1M1K1 3VB9A 3I561 1K9M2 3NH4A 3MONA 1NUIA 2BJOA 3S16I 2R7ZI 1RO4A 3LUSA 4BBRI 2WB1A 1Y8CA 1YJN1 4Y52I 3CCSZ 2E9HA 3FQQA 4E2XA 3H3VJ 3CD6Z 2E2HI 2YU9I 1Q811 3CXCZ 1QYPA 3J80b 2IZ4A 2KI7B 3IR7A 3G71Z 1X3WA 2LIYA 2NVXI 1X3ZA 3CCUZ 1VQP1 4E2ZA 4MXUA 3GTPI 5C44I 1WJ2A 2PMZA 4E30A 1KRLA 3HOYI 4Y7NI 3S15I 1VQK1 1VQL1 4MONA 2W03A 3S2DI 3J80f 1YIT1 1M901 1USPA 2NVYI 3S2HI 1SFOI 3P5JB 4S1TA 2VUGA 2IV2X 2GU2A 2QRCB 5T6BA 3CCEZ 1VQ51 3S1NI 1Q16A 4BY7I 4NB8A 3OW2Y 2DE6A 2QA4Z 3CPWZ 1VQ41 2QEXZ 3NH8A 1N8R1 4CL1A 4HGYA 1VQMZ 2GTIA 4TNUA 4A93I 3VMGA 3G4SZ 2VUMI 1YHQ1 3CC4Z 4NBCA 3CCLZ 3CCMZ 1AA6A 3VMHA 3MZLB 3U50C 4DK1A 1LQLA 2JA5I 3CCJ1 3CCRZ 3CD61 1TFIA 2RPRA 1VQ61 1YUAA 1S72Z 3CC7Z 3MZKB 1DL6A 2VPWA 4RV9A 4E2WA 4DGLA 1VQOZ 3PO3S 4NBDA 3JAMb 3G711 2JA7I 1QVGZ 1P9NA 2PM9A 4EWCA 2V45A 2R6MA 3T4NB 4BBSI 2QRDB 1WIIA 4MRIA 2VF1A 3FQMA 2VPXA 1VQ7Z 4NBGA 3J7A4 3PO2I 2NAPA 2GTHA 3CME1 3CCV1 2E2JI 4A3BI 2E7ZA 2JIOA 1QVFZ 2HF1A 2Q51A 1VQ81 1ZH1A 1ZB9A 1VQ91 3CMAZ 3I4NI 3I551 3GTGI 2M48A 3CCM1 1QVGY 4QTUA 4NH1C
chains in the Genus database with same CATH topology
2K3RA 2V8JA 3ESWA 3VTNA 4NOZA 2Y0SA 1K8A2 2OTLZ 2I3CA 3GTMS 3K7AI 2G2KA 3PO3I 2OZKA 1JJ2Z 1KD12 4MD7A 2LFUA 5D1PA 1VLAA 3J81b 1Y1WI 3I4MI 2V8KA 2OTJZ 2W04A 5IP7I 4MH4A 1Q822 2K5RA 1YUKA 4A3II 1K732 1M1K2 1KQSZ 3KIFA 3CC2Z 3HOZI 1NJI1 3IFUA 3CMA1 3GTOI 1YJ9Z 1W2BZ 5LL6f 1QF8A 4HH4A 4A3FI 1YI2Z 1NP6A 3CXCY 5D1OA 3CCS1 4RVGA 3TDHB 3BG1B 2OTL1 2KPIA 1VQNZ 1Q812 2JNYA 3S1RI 1KC81 2M6NA 4A3JI 1Q861 2R93I 2JA6I 1Q7Y1 3GTMI 5A2Qb 4RVFA 3D6WA 2V8IA 3G6EZ 3CCU1 3H0GI 2NVQI 2Q4ZA 2QKDA 1K9M1 2O4HA 4QTTA 3GCFA 4NB9A 2RHBA 4NBFA 2OTJ1 1M902 2J6AA 3CPWY 2F4OA 5FLXb 3JAMf 3CQZI 1N2FA 3TE5B 1RLYA 3CC21 1W2BY 3CCE1 2P3YA 1N8R2 3F3FC 1TWAI 2P28A 4A3DI 1USPB 3I07A 2QA41 1Y1VI 3M3YI 4NBBA 2QEX1 1YIJZ 2R92I 1RNIA 2JMOA 1KD11 1VQM1 4NBEA 1TWFI 2NVTI 4MD8A 1VQPZ 4A3KI 3RZOI 3G4S1 3QWUA 5T67A 3CC41 3CCL1 1TWCI 1VQKZ 1X0TA 5AN9F 1YITZ 3CCR1 1VQN1 3Q87A 1S721 3CC71 2JS4A 1VQ5Z 2B63I 1Z01A 1VQO1 4RVHA 4HGZA 2PK7A 1VQ4Z 4BY1I 4RS4A 4X6AI 4RVDA 1RQFA 3G6E1 1I50I 2EGTA 1K83I 3KIHA 3NH5A 1WCMI 2OOXB 2O53A 3OW2Z 1YHQZ 2OOYB 1VQ71 1QVFY 1I3QI 2YADA 3CCJZ 4BXXI 2RT9A 5CM2M 4A3EI 3HKZA 3RZDI 1VQ6Z 3GTKI 5C4XI 3S1MI 2H85A 5T64A 1Z03A 4A3MI 1YIJ1 2HU9A 1Y1VS 5C3EI 3J81f 1YJWZ 2DE7A 1TWGI 3BG0B 1RO2A 4MD9A 2QLVB 3NDIA 4E33A 3CCQZ 5FLMI 1TWHI 3F3PC 1JJ2Y 2AKLA 3FKII 3CMEZ 2JUBA 3CCVZ 1RO0A 4AYBA 5IT9b 3VMIA 1JWHC 1WW9A 4NBHA 1S7MA 1VQ8Z 4A3LI 1VQ9Z 2F4MA 3M4OI 1Z02A 3GKQA 3HOVI 3S14I 3I56Z 4XX2A 2QR1B 3I55Z 3EEDA 3S17I 4A3CI 5IT9f 1KQSY 3S1QI 1I6HI 1YJNZ 5A2Qf 5C4JI 3D9XA 2E2II 3HOXI 2JR6A 3GTQI 1NJI2 4DQYB 2ZAEB 1K8A1 2RBLA 1YJW1 5IP9I 3EERA 3HOUI 3IX0A 1YJ91 5FLXf 4A3GI 1ZB8A 4E32A 2RIQA 3CCQ1 1YI21 3NFZA 2IZ3A 3IF8A 3NDJA 2JA8I 3GTJI 2QREB 1VQLZ 4E2YA 1ML8A 4NFRA 1KC82 1Q821 1L1OC 4E31A 1Q862 3GTLI 5D1OB 2DE5A 1R9TI 2WAQA 1Q7Y2 1K731 3HOWI 1PFTA 4NBAA 1M1K1 3VB9A 3I561 1K9M2 3NH4A 3MONA 1NUIA 2BJOA 3S16I 2R7ZI 1RO4A 3LUSA 4BBRI 2WB1A 1YJN1 4Y52I 3CCSZ 2E9HA 3FQQA 4E2XA 3H3VJ 3CD6Z 2E2HI 2YU9I 1Q811 3CXCZ 1QYPA 3J80b 2IZ4A 2KI7B 3G71Z 1X3WA 2LIYA 2NVXI 1X3ZA 3CCUZ 1VQP1 4E2ZA 4MXUA 3GTPI 5C44I 2PMZA 4E30A 1KRLA 3HOYI 4Y7NI 3S15I 1VQK1 1VQL1 4MONA 2W03A 3S2DI 3J80f 1YIT1 1M901 1USPA 2NVYI 3S2HI 1SFOI 3P5JB 4S1TA 2VUGA 2GU2A 2QRCB 5T6BA 3CCEZ 1VQ51 3S1NI 4BY7I 4NB8A 3OW2Y 2DE6A 2QA4Z 3CPWZ 1VQ41 2QEXZ 3NH8A 1N8R1 4CL1A 4HGYA 1VQMZ 2GTIA 4TNUA 4A93I 3VMGA 3G4SZ 2VUMI 1YHQ1 3CC4Z 4NBCA 3CCLZ 3CCMZ 3VMHA 3MZLB 3U50C 4DK1A 1LQLA 2JA5I 3CCJ1 3CCRZ 3CD61 1TFIA 2RPRA 1VQ61 1YUAA 1S72Z 3CC7Z 3MZKB 1DL6A 4RV9A 4E2WA 4DGLA 1VQOZ 3PO3S 4NBDA 3JAMb 3G711 2JA7I 1QVGZ 1P9NA 2PM9A 4EWCA 2R6MA 3T4NB 4BBSI 2QRDB 1WIIA 4MRIA 2VF1A 3FQMA 1VQ7Z 4NBGA 3J7A4 3PO2I 2GTHA 3CME1 3CCV1 2E2JI 4A3BI 1QVFZ 2HF1A 2Q51A 1VQ81 1ZH1A 1ZB9A 1VQ91 3CMAZ 3I4NI 3I551 3GTGI 2M48A 3CCM1 1QVGY 4QTUA 4NH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Z;  1VQP 1;  1VQ8 Z;  3CCE 1;  1VQ9 Z;  1N8R 2;  3I56 Z;  2QA4 1;  1VQK 1;  2QEX 1;  1VQL 1;  1K8A 2;  1YIJ Z;  2OTL Z;  3I55 Z;  1YIT 1;  1M90 1;  1KD1 1;  1KQS Y;  1VQM 1;  1VQP Z;  1JJ2 Z;  3CCE Z;  1VQ5 1;  1KD1 2;  3G4S 1;  3OW2 Y;  3CC4 1;  1YJN Z;  3CCL 1;  2QA4 Z;  3CPW Z;  1VQK Z;  1VQ4 1;  2QEX Z;  1N8R 1;  1YIT Z;  1NJI 2;  3CCR 1;  1VQN 1;  1K8A 1;  1S72 1;  1VQM Z;  3CC7 1;  1YJW 1;  2OTJ Z;  1VQ5 Z;  1Q82 2;  1VQO 1;  3G4S Z;  1YHQ 1;  1YJ9 1;  3CC4 Z;  3CCL Z;  3CCM Z;  1K73 2;  1VQ4 Z;  3CCJ 1;  1M1K 2;  1KQS Z;  3G6E 1;  3CC2 Z;  3CCQ 1;  3CCR Z;  1YI2 1;  3CD6 1;  1VQ6 1;  1S72 Z;  3CC7 Z;  1NJI 1;  3CMA 1;  3OW2 Z;  1VQL Z;  1VQO Z;  1YHQ Z;  1YJ9 Z;  3G71 1;  1QVG Z;  1Q82 1;  1KC8 2;  1VQ7 1;  1QVF Y;  1W2B Z;  1Q86 2;  3CCJ Z;  1YI2 Z;  1Q7Y 2;  1K73 1;  1VQ6 Z;  1M1K 1;  3CXC Y;  3I56 1;  3CCS 1;  1YIJ 1;  2OTL 1;  1K9M 2;  1VQN Z;  1VQ7 Z;  1Q81 2;  1YJW Z;  1KC8 1;  1Q86 1;  3CME 1;  1Q7Y 1;  3CCV 1;  1YJN 1;  3CCS Z;  3G6E Z;  3CCQ Z;  1QVF Z;  3CCU 1;  3CD6 Z;  1VQ8 1;  1K9M 1;  1VQ9 1;  1JJ2 Y;  3CC2 1;  1Q81 1;  3CXC Z;  2OTJ 1;  1M90 2;  3CMA Z;  3CME Z;  3CPW Y;  3I55 1;  3CCV Z;  3G71 Z;  3CCM 1;  1QVG Y;  1W2B Y; 
#chains in the Genus database with same CATH topology
 2K3R A;  2V8J A;  3ESW A;  3VTN A;  4NOZ A;  2LEX A;  2Y0S A;  1K8A 2;  2OTL Z;  2I3C A;  3GTM S;  3K7A I;  2G2K A;  3PO3 I;  2OZK A;  1JJ2 Z;  1KD1 2;  4MD7 A;  2LFU A;  5D1P A;  1VLA A;  3J81 b;  1Y1W I;  3I4M I;  2V8K A;  1WZN A;  2OTJ Z;  2W04 A;  5IP7 I;  4MH4 A;  1Q82 2;  2K5R A;  1YUK A;  4A3I I;  1K73 2;  1M1K 2;  1KQS Z;  3KIF A;  3CC2 Z;  3HOZ I;  1NJI 1;  3IFU A;  3CMA 1;  3GTO I;  1YJ9 Z;  1W2B Z;  5LL6 f;  1QF8 A;  4HH4 A;  4A3F I;  1YI2 Z;  1NP6 A;  3CXC Y;  5D1O A;  3CCS 1;  4RVG A;  3TDH B;  3BG1 B;  2OTL 1;  2KPI A;  2V3V A;  2JIR A;  1VQN Z;  1Q81 2;  2JNY A;  3S1R I;  1KC8 1;  2M6N A;  4A3J I;  1Q86 1;  2R93 I;  2JA6 I;  1Q7Y 1;  3GTM I;  5A2Q b;  4RVF A;  1QXF A;  3D6W A;  2V8I A;  3G6E Z;  3CCU 1;  3H0G I;  2NVQ I;  2Q4Z A;  2QKD A;  1K9M 1;  2O4H A;  4QTT A;  3GCF A;  4NB9 A;  2RHB A;  4NBF A;  2OTJ 1;  1M90 2;  2J6A A;  3CPW Y;  2F4O A;  5FLX b;  3JAM f;  3CQZ I;  1N2F A;  3TE5 B;  1RLY A;  3CC2 1;  1W2B Y;  3CCE 1;  2P3Y A;  1N8R 2;  3F3F C;  1TWA I;  2P28 A;  4A3D I;  1USP B;  3I07 A;  2QA4 1;  1Y1V I;  3M3Y I;  4NBB A;  2QEX 1;  1YIJ Z;  2R92 I;  1FDO A;  1RNI A;  2JMO A;  1KD1 1;  1VQM 1;  4NBE A;  1TWF I;  2NVT I;  4MD8 A;  1VQP Z;  4A3K I;  3RZO I;  3G4S 1;  3QWU A;  5T67 A;  3CC4 1;  3CCL 1;  1TWC I;  1VQK Z;  1X0T A;  5AN9 F;  1YIT Z;  3CCR 1;  1VQN 1;  3Q87 A;  1S72 1;  3CC7 1;  2VPY A;  2JIP A;  2JS4 A;  1VQ5 Z;  2B63 I;  1Z01 A;  1VQO 1;  4RVH A;  4HGZ A;  2PK7 A;  1VQ4 Z;  4BY1 I;  4RS4 A;  4X6A I;  4RVD A;  1RQF A;  3G6E 1;  1I50 I;  2EGT A;  1K83 I;  3KIH A;  3NH5 A;  1WCM I;  2OOX B;  2JIM A;  2O53 A;  3OW2 Z;  1YHQ Z;  2OOY B;  2JIQ A;  1VQ7 1;  1QVF Y;  1I3Q I;  2YAD A;  3CCJ Z;  4BXX I;  2RT9 A;  5CM2 M;  4A3E I;  3HKZ A;  3RZD I;  1VQ6 Z;  3GTK I;  5C4X I;  3S1M I;  2H85 A;  5T64 A;  1Z03 A;  4A3M I;  1YIJ 1;  2HU9 A;  1Y1V S;  5C3E I;  3J81 f;  1YJW Z;  2DE7 A;  1TWG I;  3BG0 B;  1RO2 A;  4MD9 A;  2QLV B;  3NDI A;  4E33 A;  3CCQ Z;  5FLM I;  1TWH I;  3F3P C;  1JJ2 Y;  2AKL A;  3FKI I;  3CME Z;  2JUB A;  3CCV Z;  1RO0 A;  4AYB A;  5IT9 b;  3VMI A;  1JWH C;  1WW9 A;  4NBH A;  1S7M A;  3D2L A;  1VQ8 Z;  4A3L I;  1VQ9 Z;  2F4M A;  3M4O I;  1Z02 A;  3GKQ A;  3HOV I;  3S14 I;  3I56 Z;  4XX2 A;  2QR1 B;  2VPZ A;  3I55 Z;  3EED A;  3S17 I;  4A3C I;  5IT9 f;  1KQS Y;  3S1Q I;  1I6H I;  1YJN Z;  5A2Q f;  5C4J I;  3D9X A;  2E2I I;  3HOX I;  2JR6 A;  3GTQ I;  1NJI 2;  4DQY B;  2ZAE B;  1K8A 1;  2RBL A;  1YJW 1;  5IP9 I;  3EER A;  3HOU I;  3IX0 A;  1YJ9 1;  5FLX f;  4A3G I;  1ZB8 A;  1SIW A;  4E32 A;  2RIQ A;  3CCQ 1;  1YI2 1;  3NFZ A;  2IZ3 A;  3IF8 A;  3NDJ A;  2JA8 I;  3GTJ I;  1FDI A;  2QRE B;  1VQL Z;  4E2Y A;  1ML8 A;  4NFR A;  1KC8 2;  1Q82 1;  1L1O C;  4E31 A;  1Q86 2;  3GTL I;  5D1O B;  2DE5 A;  1R9T I;  2WAQ A;  1Q7Y 2;  1K73 1;  3HOW I;  1PFT A;  2AYD A;  4NBA A;  1M1K 1;  3VB9 A;  3I56 1;  1K9M 2;  3NH4 A;  3MON A;  1NUI A;  2BJO A;  3S16 I;  2R7Z I;  1RO4 A;  3LUS A;  4BBR I;  2WB1 A;  1Y8C A;  1YJN 1;  4Y52 I;  3CCS Z;  2E9H A;  3FQQ A;  4E2X A;  3H3V J;  3CD6 Z;  2E2H I;  2YU9 I;  1Q81 1;  3CXC Z;  1QYP A;  3J80 b;  2IZ4 A;  2KI7 B;  3IR7 A;  3G71 Z;  1X3W A;  2LIY A;  2NVX I;  1X3Z A;  3CCU Z;  1VQP 1;  4E2Z A;  4MXU A;  3GTP I;  5C44 I;  1WJ2 A;  2PMZ A;  4E30 A;  1KRL A;  3HOY I;  4Y7N I;  3S15 I;  1VQK 1;  1VQL 1;  4MON A;  2W03 A;  3S2D I;  3J80 f;  1YIT 1;  1M90 1;  1USP A;  2NVY I;  3S2H I;  1SFO I;  3P5J B;  4S1T A;  2VUG A;  2IV2 X;  2GU2 A;  2QRC B;  5T6B A;  3CCE Z;  1VQ5 1;  3S1N I;  1Q16 A;  4BY7 I;  4NB8 A;  3OW2 Y;  2DE6 A;  2QA4 Z;  3CPW Z;  1VQ4 1;  2QEX Z;  3NH8 A;  1N8R 1;  4CL1 A;  4HGY A;  1VQM Z;  2GTI A;  4TNU A;  4A93 I;  3VMG A;  3G4S Z;  2VUM I;  1YHQ 1;  3CC4 Z;  4NBC A;  3CCL Z;  3CCM Z;  1AA6 A;  3VMH A;  3MZL B;  3U50 C;  4DK1 A;  1LQL A;  2JA5 I;  3CCJ 1;  3CCR Z;  3CD6 1;  1TFI A;  2RPR A;  1VQ6 1;  1YUA A;  1S72 Z;  3CC7 Z;  3MZK B;  1DL6 A;  2VPW A;  4RV9 A;  4E2W A;  4DGL A;  1VQO Z;  3PO3 S;  4NBD A;  3JAM b;  3G71 1;  2JA7 I;  1QVG Z;  1P9N A;  2PM9 A;  4EWC A;  2V45 A;  2R6M A;  3T4N B;  4BBS I;  2QRD B;  1WII A;  4MRI A;  2VF1 A;  3FQM A;  2VPX A;  1VQ7 Z;  4NBG A;  3J7A 4;  3PO2 I;  2NAP A;  2GTH A;  3CME 1;  3CCV 1;  2E2J I;  4A3B I;  2E7Z A;  2JIO A;  1QVF Z;  2HF1 A;  2Q51 A;  1VQ8 1;  1ZH1 A;  1ZB9 A;  1VQ9 1;  3CMA Z;  3I4N I;  3I55 1;  3GTG I;  2M48 A;  3CCM 1;  1QVG Y;  4QTU A;  4NH1 C; 
#chains in the Genus database with same CATH homology
 2K3R A;  2V8J A;  3ESW A;  3VTN A;  4NOZ A;  2Y0S A;  1K8A 2;  2OTL Z;  2I3C A;  3GTM S;  3K7A I;  2G2K A;  3PO3 I;  2OZK A;  1JJ2 Z;  1KD1 2;  4MD7 A;  2LFU A;  5D1P A;  1VLA A;  3J81 b;  1Y1W I;  3I4M I;  2V8K A;  2OTJ Z;  2W04 A;  5IP7 I;  4MH4 A;  1Q82 2;  2K5R A;  1YUK A;  4A3I I;  1K73 2;  1M1K 2;  1KQS Z;  3KIF A;  3CC2 Z;  3HOZ I;  1NJI 1;  3IFU A;  3CMA 1;  3GTO I;  1YJ9 Z;  1W2B Z;  5LL6 f;  1QF8 A;  4HH4 A;  4A3F I;  1YI2 Z;  1NP6 A;  3CXC Y;  5D1O A;  3CCS 1;  4RVG A;  3TDH B;  3BG1 B;  2OTL 1;  2KPI A;  1VQN Z;  1Q81 2;  2JNY A;  3S1R I;  1KC8 1;  2M6N A;  4A3J I;  1Q86 1;  2R93 I;  2JA6 I;  1Q7Y 1;  3GTM I;  5A2Q b;  4RVF A;  3D6W A;  2V8I A;  3G6E Z;  3CCU 1;  3H0G I;  2NVQ I;  2Q4Z A;  2QKD A;  1K9M 1;  2O4H A;  4QTT A;  3GCF A;  4NB9 A;  2RHB A;  4NBF A;  2OTJ 1;  1M90 2;  2J6A A;  3CPW Y;  2F4O A;  5FLX b;  3JAM f;  3CQZ I;  1N2F A;  3TE5 B;  1RLY A;  3CC2 1;  1W2B Y;  3CCE 1;  2P3Y A;  1N8R 2;  3F3F C;  1TWA I;  2P28 A;  4A3D I;  1USP B;  3I07 A;  2QA4 1;  1Y1V I;  3M3Y I;  4NBB A;  2QEX 1;  1YIJ Z;  2R92 I;  1RNI A;  2JMO A;  1KD1 1;  1VQM 1;  4NBE A;  1TWF I;  2NVT I;  4MD8 A;  1VQP Z;  4A3K I;  3RZO I;  3G4S 1;  3QWU A;  5T67 A;  3CC4 1;  3CCL 1;  1TWC I;  1VQK Z;  1X0T A;  5AN9 F;  1YIT Z;  3CCR 1;  1VQN 1;  3Q87 A;  1S72 1;  3CC7 1;  2JS4 A;  1VQ5 Z;  2B63 I;  1Z01 A;  1VQO 1;  4RVH A;  4HGZ A;  2PK7 A;  1VQ4 Z;  4BY1 I;  4RS4 A;  4X6A I;  4RVD A;  1RQF A;  3G6E 1;  1I50 I;  2EGT A;  1K83 I;  3KIH A;  3NH5 A;  1WCM I;  2OOX B;  2O53 A;  3OW2 Z;  1YHQ Z;  2OOY B;  1VQ7 1;  1QVF Y;  1I3Q I;  2YAD A;  3CCJ Z;  4BXX I;  2RT9 A;  5CM2 M;  4A3E I;  3HKZ A;  3RZD I;  1VQ6 Z;  3GTK I;  5C4X I;  3S1M I;  2H85 A;  5T64 A;  1Z03 A;  4A3M I;  1YIJ 1;  2HU9 A;  1Y1V S;  5C3E I;  3J81 f;  1YJW Z;  2DE7 A;  1TWG I;  3BG0 B;  1RO2 A;  4MD9 A;  2QLV B;  3NDI A;  4E33 A;  3CCQ Z;  5FLM I;  1TWH I;  3F3P C;  1JJ2 Y;  2AKL A;  3FKI I;  3CME Z;  2JUB A;  3CCV Z;  1RO0 A;  4AYB A;  5IT9 b;  3VMI A;  1JWH C;  1WW9 A;  4NBH A;  1S7M A;  1VQ8 Z;  4A3L I;  1VQ9 Z;  2F4M A;  3M4O I;  1Z02 A;  3GKQ A;  3HOV I;  3S14 I;  3I56 Z;  4XX2 A;  2QR1 B;  3I55 Z;  3EED A;  3S17 I;  4A3C I;  5IT9 f;  1KQS Y;  3S1Q I;  1I6H I;  1YJN Z;  5A2Q f;  5C4J I;  3D9X A;  2E2I I;  3HOX I;  2JR6 A;  3GTQ I;  1NJI 2;  4DQY B;  2ZAE B;  1K8A 1;  2RBL A;  1YJW 1;  5IP9 I;  3EER A;  3HOU I;  3IX0 A;  1YJ9 1;  5FLX f;  4A3G I;  1ZB8 A;  4E32 A;  2RIQ A;  3CCQ 1;  1YI2 1;  3NFZ A;  2IZ3 A;  3IF8 A;  3NDJ A;  2JA8 I;  3GTJ I;  2QRE B;  1VQL Z;  4E2Y A;  1ML8 A;  4NFR A;  1KC8 2;  1Q82 1;  1L1O C;  4E31 A;  1Q86 2;  3GTL I;  5D1O B;  2DE5 A;  1R9T I;  2WAQ A;  1Q7Y 2;  1K73 1;  3HOW I;  1PFT A;  4NBA A;  1M1K 1;  3VB9 A;  3I56 1;  1K9M 2;  3NH4 A;  3MON A;  1NUI A;  2BJO A;  3S16 I;  2R7Z I;  1RO4 A;  3LUS A;  4BBR I;  2WB1 A;  1YJN 1;  4Y52 I;  3CCS Z;  2E9H A;  3FQQ A;  4E2X A;  3H3V J;  3CD6 Z;  2E2H I;  2YU9 I;  1Q81 1;  3CXC Z;  1QYP A;  3J80 b;  2IZ4 A;  2KI7 B;  3G71 Z;  1X3W A;  2LIY A;  2NVX I;  1X3Z A;  3CCU Z;  1VQP 1;  4E2Z A;  4MXU A;  3GTP I;  5C44 I;  2PMZ A;  4E30 A;  1KRL A;  3HOY I;  4Y7N I;  3S15 I;  1VQK 1;  1VQL 1;  4MON A;  2W03 A;  3S2D I;  3J80 f;  1YIT 1;  1M90 1;  1USP A;  2NVY I;  3S2H I;  1SFO I;  3P5J B;  4S1T A;  2VUG A;  2GU2 A;  2QRC B;  5T6B A;  3CCE Z;  1VQ5 1;  3S1N I;  4BY7 I;  4NB8 A;  3OW2 Y;  2DE6 A;  2QA4 Z;  3CPW Z;  1VQ4 1;  2QEX Z;  3NH8 A;  1N8R 1;  4CL1 A;  4HGY A;  1VQM Z;  2GTI A;  4TNU A;  4A93 I;  3VMG A;  3G4S Z;  2VUM I;  1YHQ 1;  3CC4 Z;  4NBC A;  3CCL Z;  3CCM Z;  3VMH A;  3MZL B;  3U50 C;  4DK1 A;  1LQL A;  2JA5 I;  3CCJ 1;  3CCR Z;  3CD6 1;  1TFI A;  2RPR A;  1VQ6 1;  1YUA A;  1S72 Z;  3CC7 Z;  3MZK B;  1DL6 A;  4RV9 A;  4E2W A;  4DGL A;  1VQO Z;  3PO3 S;  4NBD A;  3JAM b;  3G71 1;  2JA7 I;  1QVG Z;  1P9N A;  2PM9 A;  4EWC A;  2R6M A;  3T4N B;  4BBS I;  2QRD B;  1WII A;  4MRI A;  2VF1 A;  3FQM A;  1VQ7 Z;  4NBG A;  3J7A 4;  3PO2 I;  2GTH A;  3CME 1;  3CCV 1;  2E2J I;  4A3B I;  1QVF Z;  2HF1 A;  2Q51 A;  1VQ8 1;  1ZH1 A;  1ZB9 A;  1VQ9 1;  3CMA Z;  3I4N I;  3I55 1;  3GTG I;  2M48 A;  3CCM 1;  1QVG Y;  4QTU A;  4NH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...