1YJNZ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjnZ00
3G711 3OW2Y 1YIJZ 1K9M2 3CC21 1Q862 3CC4Z 1VQ41 2QA41 1VQ9Z 1YITZ 3CCJZ 1QVFZ 1VQ51 1Q7Y1 1VQKZ 1VQ61 1N8R2 3I561 1KC81 3CCQZ 3CD61 1VQM1 3G4S1 1YJW1 1VQL1 1N8R1 1S721 3I55Z 3I56Z 1M902 1VQP1 1YJNZ 1VQK1 1VQLZ 1W2BZ 1KQSZ 3CD6Z 2QA4Z 1Q822 3CCQ1 1Q812 2OTJ1 3CME1 1YHQZ 1KD12 3CCRZ 3CCJ1 3CCV1 1VQ8Z 1JJ2Z 3CC41 3G6EZ 3CPWY 3CMAZ 1K732 3CCL1 3CCUZ 1KQSY 1YJ9Z 1YI21 1QVGY 1YIT1 1YI2Z 1YJ91 1VQ7Z 3CMA1 3CPWZ 3CXCY 1S72Z 3CCMZ 1VQOZ 1YJWZ 1Q861 2OTLZ 2QEXZ 3CCS1 3CCR1 3OW2Z 1VQ6Z 1YHQ1 1W2BY 1VQ5Z 1Q7Y2 2OTJZ 3CCVZ 1VQ81 1NJI2 1KC82 1Q821 1VQ91 1QVFY 1M1K1 1VQN1 3CCEZ 3CCM1 1KD11 3CMEZ 1YJN1 3I551 1M901 1NJI1 2QEX1 1M1K2 2OTL1 3G4SZ 1VQMZ 1VQPZ 1QVGZ 3CC7Z 1Q811 3CCE1 1VQNZ 1K8A2 1VQ4Z 1VQ71 3CC2Z 1YIJ1 3CCSZ 1K8A1 3G71Z 3CC71 1VQO1 1JJ2Y 3CCLZ 3CCU1 1K731 3G6E1 1K9M1 3CXCZ
chains in the Genus database with same CATH superfamily
3S2HI 5FLMI 1RQFA 2AKLA 4HH4A 1ML8A 4RS4A 4E30A 1QVFZ 1Q7Y1 1N8R2 3GTLI 1Z03A 2YADA 3CCQZ 3CD61 2G2KA 1N8R1 1M902 2DE7A 3HOUI 1VQK1 1VQLZ 3MZLB 1KQSZ 3CD6Z 4AYBA 2RBLA 2OTJ1 4A3DI 3CME1 4TNUA 2GU2A 2QREB 3ESWA 1KRLA 2QRCB 4E2ZA 3CPWY 3H3VJ 3D9XA 4NB8A 2J6AA 5A2Qb 2Q51A 4NBBA 1L1OC 3GKQA 1KQSY 2QR1B 1QVGY 2YU9I 2V8KA 1NUIA 1I6HI 1I50I 2LIYA 3VB9A 2JNYA 3JAMb 1LQLA 2Y0SA 4RVGA 3NH5A 3CXCY 4MRIA 1X0TA 4DGLA 5CM2M 3CCMZ 1X3ZA 2PM9A 3BG1B 1FDOA 1W2BY 2OTJZ 4A3KI 1NJI2 3RZOI 1KC82 1VQ91 1VLAA 3CCEZ 3CCM1 4E2YA 4DQYB 1QYPA 1WJ2A 3I551 2F4MA 2JUBA 3J80f 3HOXI 2QEX1 1M1K2 2JIOA 2OTL1 5LL6f 2OZKA 1VQPZ 1QVGZ 5FLXb 2W03A 1Q811 1RNIA 3CCE1 3VMIA 5T6BA 3D2LA 1R9TI 3PO3S 1VQ4Z 1VQ71 3F3FC 3IX0A 3K7AI 1Y8CA 1K8A1 2JA6I 3CC71 3CCLZ 2E9HA 1Y1VS 1K9M1 3HOVI 4EWCA 1YUKA 2WB1A 3G711 5T64A 1NP6A 4MXUA 4X6AI 2W04A 1I3QI 1YIJZ 4CL1A 3CC21 2QLVB 1VQ41 2E2HI 3CCJZ 2VF1A 3RZDI 2JA8I 1VQKZ 2V3VA 3VTNA 1YJW1 3I55Z 1W2BZ 4QTTA 4NBAA 2VPYA 1YHQZ 1KD12 4E32A 4E2WA 1AA6A 3CC41 2E7ZA 2V45A 3IF8A 4NFRA 5D1PA 3T4NB 5C4JI 3D6WA 3CCUZ 1Y1WI 1Z01A 2GTIA 1YJ91 4MD9A 1WIIA 3CPWZ 1QF8A 2V8IA 1TWFI 1JWHC 1S72Z 4BBRI 2RPRA 1Q861 3KIHA 2PMZA 3CCS1 3IFUA 1VQ6Z 3M4OI 1VQ5Z 5A2Qf 4BY7I 3CCVZ 1VQ81 4S1TA 2LEXA 1VQN1 3MONA 1M901 3BG0B 3S16I 1WCMI 2RHBA 3G4SZ 3F3PC 3KIFA 2RIQA 2P3YA 3J81b 4NBCA 4A3II 3HOZI 2HU9A 3I4NI 5C4XI 2R92I 1K8A2 4A3JI 3LUSA 2O53A 5C3EI 2H85A 3S1MI 1JJ2Y 2JMOA 3S1QI 3PO3I 3CXCZ 2QRDB 3OW2Y 4NBHA 3MZKB 1Q862 3CC4Z 1YITZ 4NBEA 4HGYA 1Z02A 5IT9f 1VQ51 1VQ61 2BJOA 3I561 3Q87A 5D1OA 2M48A 2JIMA 1VQM1 1S721 2VUGA 3NDJA 4MD8A 4A3CI 1SIWA 4QTUA 3VMHA 2R93I 2QA4Z 2ZAEB 3P5JB 2R7ZI 1DL6A 1RO2A 4RV9A 4A3EI 1ZB9A 2IV2X 4RVDA 2V8JA 3HKZA 3TDHB 2I3CA 3GTKI 3CCV1 1VQ8Z 3S15I 5IP7I 3G6EZ 1RO4A 4NOZA 5IT9b 1TWHI 2JR6A 4Y52I 1ZB8A 3CMAZ 1K732 1Q16A 1YI21 4NBDA 4BBSI 2VUMI 2JIPA 3GTMI 3IR7A 3J80b 1YI2Z 2VPZA 3FKII 4A93I 5C44I 1VQ7Z 3I4MI 3EEDA 2JA7I 2O4HA 2AYDA 4E31A 1VQOZ 1YJWZ 4NBGA 2OTLZ 4BXXI 2QEXZ 2NAPA 3CCR1 2JS4A 3OW2Z 2E2JI 3S1RI 4NBFA 2JIRA 1Q7Y2 2VPXA 2HF1A 1WZNA 2LFUA 1Q821 1QVFY 2IZ4A 1M1K1 4XX2A 3GTQI 1KD11 1YJN1 1TWCI 3JAMf 3GTPI 4DK1A 3NH4A 2IZ3A 2KI7B 4RVFA 1VQMZ 3VMGA 2K3RA 3CC7Z 2EGTA 2M6NA 2F4OA 4BY1I 4MONA 1RLYA 3M3YI 5IP9I 2Q4ZA 3I07A 2OOXB 1VQO1 3CCU1 1K731 3G6E1 1USPB 2DE6A 3NFZA 3J81f 4HGZA 1K9M2 1FDIA 2QA41 1VQ9Z 2NVQI 1PFTA 2KPIA 3J7A4 4Y7NI 2R6MA 5D1OB 3S1NI 2OOYB 1KC81 1X3WA 3G4S1 4RVHA 3TE5B 1VQL1 3I56Z 1WW9A 3GCFA 1VQP1 1YJNZ 5FLXf 1ZH1A 3NH8A 4NH1C 2K5RA 3HOYI 5T67A 3FQMA 1Q822 1Y1VI 3CCQ1 1Q812 3GTGI 2QKDA 3CCRZ 3CCJ1 2B63I 1JJ2Z 3S17I 3H0GI 4A3LI 4E33A 4A3MI 1QXFA 2E2II 3CCL1 4MH4A 2NVXI 2PK7A 1YJ9Z 5AN9F 3GTOI 3S14I 2RT9A 1TFIA 3S2DI 1YIT1 1N2FA 3CQZI 2JA5I 3CMA1 1YUAA 3U50C 3HOWI 3GTMS 1K83I 2NVTI 1TWGI 1RO0A 4A3FI 2DE5A 1YHQ1 4NB9A 3GTJI 3FQQA 2NVYI 3CMEZ 3PO2I 1NJI1 2WAQA 2P28A 1S7MA 3QWUA 3NDIA 4A3GI 1VQNZ 4E2XA 1USPA 1P9NA 3EERA 2VPWA 4A3BI 4MD7A 3CC2Z 1YIJ1 2GTHA 1TWAI 3CCSZ 2JIQA 3G71Z 1SFOI
chains in the Genus database with same CATH topology
3S2HI 5FLMI 1RQFA 2AKLA 4HH4A 1ML8A 4RS4A 4E30A 1QVFZ 1Q7Y1 1N8R2 3GTLI 1Z03A 2YADA 3CCQZ 3CD61 2G2KA 1N8R1 1M902 2DE7A 3HOUI 1VQK1 1VQLZ 3MZLB 1KQSZ 3CD6Z 4AYBA 2RBLA 2OTJ1 4A3DI 3CME1 4TNUA 2GU2A 2QREB 3ESWA 1KRLA 2QRCB 4E2ZA 3CPWY 3H3VJ 3D9XA 4NB8A 2J6AA 5A2Qb 2Q51A 4NBBA 1L1OC 3GKQA 1KQSY 2QR1B 1QVGY 2YU9I 2V8KA 1NUIA 1I6HI 1I50I 2LIYA 3VB9A 2JNYA 3JAMb 1LQLA 2Y0SA 4RVGA 3NH5A 3CXCY 4MRIA 1X0TA 4DGLA 5CM2M 3CCMZ 1X3ZA 2PM9A 3BG1B 1W2BY 2OTJZ 4A3KI 1NJI2 3RZOI 1KC82 1VQ91 1VLAA 3CCEZ 3CCM1 4E2YA 4DQYB 1QYPA 3I551 2F4MA 2JUBA 3J80f 3HOXI 2QEX1 1M1K2 2OTL1 5LL6f 2OZKA 1VQPZ 1QVGZ 5FLXb 2W03A 1Q811 1RNIA 3CCE1 3VMIA 5T6BA 1R9TI 3PO3S 1VQ4Z 1VQ71 3F3FC 3IX0A 3K7AI 1K8A1 2JA6I 3CC71 3CCLZ 2E9HA 1Y1VS 1K9M1 3HOVI 4EWCA 1YUKA 2WB1A 3G711 5T64A 1NP6A 4MXUA 4X6AI 2W04A 1I3QI 1YIJZ 4CL1A 3CC21 2QLVB 1VQ41 2E2HI 3CCJZ 2VF1A 3RZDI 2JA8I 1VQKZ 3VTNA 1YJW1 3I55Z 1W2BZ 4QTTA 4NBAA 1YHQZ 1KD12 4E32A 4E2WA 3CC41 3IF8A 4NFRA 5D1PA 3T4NB 5C4JI 3D6WA 3CCUZ 1Y1WI 1Z01A 2GTIA 1YJ91 4MD9A 1WIIA 3CPWZ 1QF8A 2V8IA 1TWFI 1JWHC 1S72Z 4BBRI 2RPRA 1Q861 3KIHA 2PMZA 3CCS1 3IFUA 1VQ6Z 3M4OI 1VQ5Z 5A2Qf 4BY7I 3CCVZ 1VQ81 4S1TA 1VQN1 3MONA 1M901 3BG0B 3S16I 1WCMI 2RHBA 3G4SZ 3F3PC 3KIFA 2RIQA 2P3YA 3J81b 4NBCA 4A3II 3HOZI 2HU9A 3I4NI 5C4XI 2R92I 1K8A2 4A3JI 3LUSA 2O53A 5C3EI 2H85A 3S1MI 1JJ2Y 2JMOA 3S1QI 3PO3I 3CXCZ 2QRDB 3OW2Y 4NBHA 3MZKB 1Q862 3CC4Z 1YITZ 4NBEA 4HGYA 1Z02A 5IT9f 1VQ51 1VQ61 2BJOA 3I561 3Q87A 5D1OA 2M48A 1VQM1 1S721 2VUGA 3NDJA 4MD8A 4A3CI 4QTUA 3VMHA 2R93I 2QA4Z 2ZAEB 3P5JB 2R7ZI 1DL6A 1RO2A 4RV9A 4A3EI 1ZB9A 4RVDA 2V8JA 3HKZA 3TDHB 2I3CA 3GTKI 3CCV1 1VQ8Z 3S15I 5IP7I 3G6EZ 1RO4A 4NOZA 5IT9b 1TWHI 2JR6A 4Y52I 1ZB8A 3CMAZ 1K732 1YI21 4NBDA 4BBSI 2VUMI 3GTMI 3J80b 1YI2Z 3FKII 4A93I 5C44I 1VQ7Z 3I4MI 3EEDA 2JA7I 2O4HA 4E31A 1VQOZ 1YJWZ 4NBGA 2OTLZ 4BXXI 2QEXZ 3CCR1 2JS4A 3OW2Z 2E2JI 3S1RI 4NBFA 1Q7Y2 2HF1A 2LFUA 1Q821 1QVFY 2IZ4A 1M1K1 4XX2A 3GTQI 1KD11 1YJN1 1TWCI 3JAMf 3GTPI 4DK1A 3NH4A 2IZ3A 2KI7B 4RVFA 1VQMZ 3VMGA 2K3RA 3CC7Z 2EGTA 2M6NA 2F4OA 4BY1I 4MONA 1RLYA 3M3YI 5IP9I 2Q4ZA 3I07A 2OOXB 1VQO1 3CCU1 1K731 3G6E1 1USPB 2DE6A 3NFZA 3J81f 4HGZA 1K9M2 2QA41 1VQ9Z 2NVQI 1PFTA 2KPIA 3J7A4 4Y7NI 2R6MA 5D1OB 3S1NI 2OOYB 1KC81 1X3WA 3G4S1 4RVHA 3TE5B 1VQL1 3I56Z 1WW9A 3GCFA 1VQP1 1YJNZ 5FLXf 1ZH1A 3NH8A 4NH1C 2K5RA 3HOYI 5T67A 3FQMA 1Q822 1Y1VI 3CCQ1 1Q812 3GTGI 2QKDA 3CCRZ 3CCJ1 2B63I 1JJ2Z 3S17I 3H0GI 4A3LI 4E33A 4A3MI 2E2II 3CCL1 4MH4A 2NVXI 2PK7A 1YJ9Z 5AN9F 3GTOI 3S14I 2RT9A 1TFIA 3S2DI 1YIT1 1N2FA 3CQZI 2JA5I 3CMA1 1YUAA 3U50C 3HOWI 3GTMS 1K83I 2NVTI 1TWGI 1RO0A 4A3FI 2DE5A 1YHQ1 4NB9A 3GTJI 3FQQA 2NVYI 3CMEZ 3PO2I 1NJI1 2WAQA 2P28A 1S7MA 3QWUA 3NDIA 4A3GI 1VQNZ 4E2XA 1USPA 1P9NA 3EERA 4A3BI 4MD7A 3CC2Z 1YIJ1 2GTHA 1TWAI 3CCSZ 3G71Z 1SFOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 1;  3OW2 Y;  1YIJ Z;  1K9M 2;  3CC2 1;  1Q86 2;  3CC4 Z;  1VQ4 1;  2QA4 1;  1VQ9 Z;  1YIT Z;  3CCJ Z;  1QVF Z;  1VQ5 1;  1Q7Y 1;  1VQK Z;  1VQ6 1;  1N8R 2;  3I56 1;  1KC8 1;  3CCQ Z;  3CD6 1;  1VQM 1;  3G4S 1;  1YJW 1;  1VQL 1;  1N8R 1;  1S72 1;  3I55 Z;  3I56 Z;  1M90 2;  1VQP 1;  1YJN Z;  1VQK 1;  1VQL Z;  1W2B Z;  1KQS Z;  3CD6 Z;  2QA4 Z;  1Q82 2;  3CCQ 1;  1Q81 2;  2OTJ 1;  3CME 1;  1YHQ Z;  1KD1 2;  3CCR Z;  3CCJ 1;  3CCV 1;  1VQ8 Z;  1JJ2 Z;  3CC4 1;  3G6E Z;  3CPW Y;  3CMA Z;  1K73 2;  3CCL 1;  3CCU Z;  1KQS Y;  1YJ9 Z;  1YI2 1;  1QVG Y;  1YIT 1;  1YI2 Z;  1YJ9 1;  1VQ7 Z;  3CMA 1;  3CPW Z;  3CXC Y;  1S72 Z;  3CCM Z;  1VQO Z;  1YJW Z;  1Q86 1;  2OTL Z;  2QEX Z;  3CCS 1;  3CCR 1;  3OW2 Z;  1VQ6 Z;  1YHQ 1;  1W2B Y;  1VQ5 Z;  1Q7Y 2;  2OTJ Z;  3CCV Z;  1VQ8 1;  1NJI 2;  1KC8 2;  1Q82 1;  1VQ9 1;  1QVF Y;  1M1K 1;  1VQN 1;  3CCE Z;  3CCM 1;  1KD1 1;  3CME Z;  1YJN 1;  3I55 1;  1M90 1;  1NJI 1;  2QEX 1;  1M1K 2;  2OTL 1;  3G4S Z;  1VQM Z;  1VQP Z;  1QVG Z;  3CC7 Z;  1Q81 1;  3CCE 1;  1VQN Z;  1K8A 2;  1VQ4 Z;  1VQ7 1;  3CC2 Z;  1YIJ 1;  3CCS Z;  1K8A 1;  3G71 Z;  3CC7 1;  1VQO 1;  1JJ2 Y;  3CCL Z;  3CCU 1;  1K73 1;  3G6E 1;  1K9M 1;  3CXC Z; 
#chains in the Genus database with same CATH topology
 3S2H I;  5FLM I;  1RQF A;  2AKL A;  4HH4 A;  1ML8 A;  4RS4 A;  4E30 A;  1QVF Z;  1Q7Y 1;  1N8R 2;  3GTL I;  1Z03 A;  2YAD A;  3CCQ Z;  3CD6 1;  2G2K A;  1N8R 1;  1M90 2;  2DE7 A;  3HOU I;  1VQK 1;  1VQL Z;  3MZL B;  1KQS Z;  3CD6 Z;  4AYB A;  2RBL A;  2OTJ 1;  4A3D I;  3CME 1;  4TNU A;  2GU2 A;  2QRE B;  3ESW A;  1KRL A;  2QRC B;  4E2Z A;  3CPW Y;  3H3V J;  3D9X A;  4NB8 A;  2J6A A;  5A2Q b;  2Q51 A;  4NBB A;  1L1O C;  3GKQ A;  1KQS Y;  2QR1 B;  1QVG Y;  2YU9 I;  2V8K A;  1NUI A;  1I6H I;  1I50 I;  2LIY A;  3VB9 A;  2JNY A;  3JAM b;  1LQL A;  2Y0S A;  4RVG A;  3NH5 A;  3CXC Y;  4MRI A;  1X0T A;  4DGL A;  5CM2 M;  3CCM Z;  1X3Z A;  2PM9 A;  3BG1 B;  1FDO A;  1W2B Y;  2OTJ Z;  4A3K I;  1NJI 2;  3RZO I;  1KC8 2;  1VQ9 1;  1VLA A;  3CCE Z;  3CCM 1;  4E2Y A;  4DQY B;  1QYP A;  1WJ2 A;  3I55 1;  2F4M A;  2JUB A;  3J80 f;  3HOX I;  2QEX 1;  1M1K 2;  2JIO A;  2OTL 1;  5LL6 f;  2OZK A;  1VQP Z;  1QVG Z;  5FLX b;  2W03 A;  1Q81 1;  1RNI A;  3CCE 1;  3VMI A;  5T6B A;  3D2L A;  1R9T I;  3PO3 S;  1VQ4 Z;  1VQ7 1;  3F3F C;  3IX0 A;  3K7A I;  1Y8C A;  1K8A 1;  2JA6 I;  3CC7 1;  3CCL Z;  2E9H A;  1Y1V S;  1K9M 1;  3HOV I;  4EWC A;  1YUK A;  2WB1 A;  3G71 1;  5T64 A;  1NP6 A;  4MXU A;  4X6A I;  2W04 A;  1I3Q I;  1YIJ Z;  4CL1 A;  3CC2 1;  2QLV B;  1VQ4 1;  2E2H I;  3CCJ Z;  2VF1 A;  3RZD I;  2JA8 I;  1VQK Z;  2V3V A;  3VTN A;  1YJW 1;  3I55 Z;  1W2B Z;  4QTT A;  4NBA A;  2VPY A;  1YHQ Z;  1KD1 2;  4E32 A;  4E2W A;  1AA6 A;  3CC4 1;  2E7Z A;  2V45 A;  3IF8 A;  4NFR A;  5D1P A;  3T4N B;  5C4J I;  3D6W A;  3CCU Z;  1Y1W I;  1Z01 A;  2GTI A;  1YJ9 1;  4MD9 A;  1WII A;  3CPW Z;  1QF8 A;  2V8I A;  1TWF I;  1JWH C;  1S72 Z;  4BBR I;  2RPR A;  1Q86 1;  3KIH A;  2PMZ A;  3CCS 1;  3IFU A;  1VQ6 Z;  3M4O I;  1VQ5 Z;  5A2Q f;  4BY7 I;  3CCV Z;  1VQ8 1;  4S1T A;  2LEX A;  1VQN 1;  3MON A;  1M90 1;  3BG0 B;  3S16 I;  1WCM I;  2RHB A;  3G4S Z;  3F3P C;  3KIF A;  2RIQ A;  2P3Y A;  3J81 b;  4NBC A;  4A3I I;  3HOZ I;  2HU9 A;  3I4N I;  5C4X I;  2R92 I;  1K8A 2;  4A3J I;  3LUS A;  2O53 A;  5C3E I;  2H85 A;  3S1M I;  1JJ2 Y;  2JMO A;  3S1Q I;  3PO3 I;  3CXC Z;  2QRD B;  3OW2 Y;  4NBH A;  3MZK B;  1Q86 2;  3CC4 Z;  1YIT Z;  4NBE A;  4HGY A;  1Z02 A;  5IT9 f;  1VQ5 1;  1VQ6 1;  2BJO A;  3I56 1;  3Q87 A;  5D1O A;  2M48 A;  2JIM A;  1VQM 1;  1S72 1;  2VUG A;  3NDJ A;  4MD8 A;  4A3C I;  1SIW A;  4QTU A;  3VMH A;  2R93 I;  2QA4 Z;  2ZAE B;  3P5J B;  2R7Z I;  1DL6 A;  1RO2 A;  4RV9 A;  4A3E I;  1ZB9 A;  2IV2 X;  4RVD A;  2V8J A;  3HKZ A;  3TDH B;  2I3C A;  3GTK I;  3CCV 1;  1VQ8 Z;  3S15 I;  5IP7 I;  3G6E Z;  1RO4 A;  4NOZ A;  5IT9 b;  1TWH I;  2JR6 A;  4Y52 I;  1ZB8 A;  3CMA Z;  1K73 2;  1Q16 A;  1YI2 1;  4NBD A;  4BBS I;  2VUM I;  2JIP A;  3GTM I;  3IR7 A;  3J80 b;  1YI2 Z;  2VPZ A;  3FKI I;  4A93 I;  5C44 I;  1VQ7 Z;  3I4M I;  3EED A;  2JA7 I;  2O4H A;  2AYD A;  4E31 A;  1VQO Z;  1YJW Z;  4NBG A;  2OTL Z;  4BXX I;  2QEX Z;  2NAP A;  3CCR 1;  2JS4 A;  3OW2 Z;  2E2J I;  3S1R I;  4NBF A;  2JIR A;  1Q7Y 2;  2VPX A;  2HF1 A;  1WZN A;  2LFU A;  1Q82 1;  1QVF Y;  2IZ4 A;  1M1K 1;  4XX2 A;  3GTQ I;  1KD1 1;  1YJN 1;  1TWC I;  3JAM f;  3GTP I;  4DK1 A;  3NH4 A;  2IZ3 A;  2KI7 B;  4RVF A;  1VQM Z;  3VMG A;  2K3R A;  3CC7 Z;  2EGT A;  2M6N A;  2F4O A;  4BY1 I;  4MON A;  1RLY A;  3M3Y I;  5IP9 I;  2Q4Z A;  3I07 A;  2OOX B;  1VQO 1;  3CCU 1;  1K73 1;  3G6E 1;  1USP B;  2DE6 A;  3NFZ A;  3J81 f;  4HGZ A;  1K9M 2;  1FDI A;  2QA4 1;  1VQ9 Z;  2NVQ I;  1PFT A;  2KPI A;  3J7A 4;  4Y7N I;  2R6M A;  5D1O B;  3S1N I;  2OOY B;  1KC8 1;  1X3W A;  3G4S 1;  4RVH A;  3TE5 B;  1VQL 1;  3I56 Z;  1WW9 A;  3GCF A;  1VQP 1;  1YJN Z;  5FLX f;  1ZH1 A;  3NH8 A;  4NH1 C;  2K5R A;  3HOY I;  5T67 A;  3FQM A;  1Q82 2;  1Y1V I;  3CCQ 1;  1Q81 2;  3GTG I;  2QKD A;  3CCR Z;  3CCJ 1;  2B63 I;  1JJ2 Z;  3S17 I;  3H0G I;  4A3L I;  4E33 A;  4A3M I;  1QXF A;  2E2I I;  3CCL 1;  4MH4 A;  2NVX I;  2PK7 A;  1YJ9 Z;  5AN9 F;  3GTO I;  3S14 I;  2RT9 A;  1TFI A;  3S2D I;  1YIT 1;  1N2F A;  3CQZ I;  2JA5 I;  3CMA 1;  1YUA A;  3U50 C;  3HOW I;  3GTM S;  1K83 I;  2NVT I;  1TWG I;  1RO0 A;  4A3F I;  2DE5 A;  1YHQ 1;  4NB9 A;  3GTJ I;  3FQQ A;  2NVY I;  3CME Z;  3PO2 I;  1NJI 1;  2WAQ A;  2P28 A;  1S7M A;  3QWU A;  3NDI A;  4A3G I;  1VQN Z;  4E2X A;  1USP A;  1P9N A;  3EER A;  2VPW A;  4A3B I;  4MD7 A;  3CC2 Z;  1YIJ 1;  2GTH A;  1TWA I;  3CCS Z;  2JIQ A;  3G71 Z;  1SFO I; 
#chains in the Genus database with same CATH homology
 3S2H I;  5FLM I;  1RQF A;  2AKL A;  4HH4 A;  1ML8 A;  4RS4 A;  4E30 A;  1QVF Z;  1Q7Y 1;  1N8R 2;  3GTL I;  1Z03 A;  2YAD A;  3CCQ Z;  3CD6 1;  2G2K A;  1N8R 1;  1M90 2;  2DE7 A;  3HOU I;  1VQK 1;  1VQL Z;  3MZL B;  1KQS Z;  3CD6 Z;  4AYB A;  2RBL A;  2OTJ 1;  4A3D I;  3CME 1;  4TNU A;  2GU2 A;  2QRE B;  3ESW A;  1KRL A;  2QRC B;  4E2Z A;  3CPW Y;  3H3V J;  3D9X A;  4NB8 A;  2J6A A;  5A2Q b;  2Q51 A;  4NBB A;  1L1O C;  3GKQ A;  1KQS Y;  2QR1 B;  1QVG Y;  2YU9 I;  2V8K A;  1NUI A;  1I6H I;  1I50 I;  2LIY A;  3VB9 A;  2JNY A;  3JAM b;  1LQL A;  2Y0S A;  4RVG A;  3NH5 A;  3CXC Y;  4MRI A;  1X0T A;  4DGL A;  5CM2 M;  3CCM Z;  1X3Z A;  2PM9 A;  3BG1 B;  1W2B Y;  2OTJ Z;  4A3K I;  1NJI 2;  3RZO I;  1KC8 2;  1VQ9 1;  1VLA A;  3CCE Z;  3CCM 1;  4E2Y A;  4DQY B;  1QYP A;  3I55 1;  2F4M A;  2JUB A;  3J80 f;  3HOX I;  2QEX 1;  1M1K 2;  2OTL 1;  5LL6 f;  2OZK A;  1VQP Z;  1QVG Z;  5FLX b;  2W03 A;  1Q81 1;  1RNI A;  3CCE 1;  3VMI A;  5T6B A;  1R9T I;  3PO3 S;  1VQ4 Z;  1VQ7 1;  3F3F C;  3IX0 A;  3K7A I;  1K8A 1;  2JA6 I;  3CC7 1;  3CCL Z;  2E9H A;  1Y1V S;  1K9M 1;  3HOV I;  4EWC A;  1YUK A;  2WB1 A;  3G71 1;  5T64 A;  1NP6 A;  4MXU A;  4X6A I;  2W04 A;  1I3Q I;  1YIJ Z;  4CL1 A;  3CC2 1;  2QLV B;  1VQ4 1;  2E2H I;  3CCJ Z;  2VF1 A;  3RZD I;  2JA8 I;  1VQK Z;  3VTN A;  1YJW 1;  3I55 Z;  1W2B Z;  4QTT A;  4NBA A;  1YHQ Z;  1KD1 2;  4E32 A;  4E2W A;  3CC4 1;  3IF8 A;  4NFR A;  5D1P A;  3T4N B;  5C4J I;  3D6W A;  3CCU Z;  1Y1W I;  1Z01 A;  2GTI A;  1YJ9 1;  4MD9 A;  1WII A;  3CPW Z;  1QF8 A;  2V8I A;  1TWF I;  1JWH C;  1S72 Z;  4BBR I;  2RPR A;  1Q86 1;  3KIH A;  2PMZ A;  3CCS 1;  3IFU A;  1VQ6 Z;  3M4O I;  1VQ5 Z;  5A2Q f;  4BY7 I;  3CCV Z;  1VQ8 1;  4S1T A;  1VQN 1;  3MON A;  1M90 1;  3BG0 B;  3S16 I;  1WCM I;  2RHB A;  3G4S Z;  3F3P C;  3KIF A;  2RIQ A;  2P3Y A;  3J81 b;  4NBC A;  4A3I I;  3HOZ I;  2HU9 A;  3I4N I;  5C4X I;  2R92 I;  1K8A 2;  4A3J I;  3LUS A;  2O53 A;  5C3E I;  2H85 A;  3S1M I;  1JJ2 Y;  2JMO A;  3S1Q I;  3PO3 I;  3CXC Z;  2QRD B;  3OW2 Y;  4NBH A;  3MZK B;  1Q86 2;  3CC4 Z;  1YIT Z;  4NBE A;  4HGY A;  1Z02 A;  5IT9 f;  1VQ5 1;  1VQ6 1;  2BJO A;  3I56 1;  3Q87 A;  5D1O A;  2M48 A;  1VQM 1;  1S72 1;  2VUG A;  3NDJ A;  4MD8 A;  4A3C I;  4QTU A;  3VMH A;  2R93 I;  2QA4 Z;  2ZAE B;  3P5J B;  2R7Z I;  1DL6 A;  1RO2 A;  4RV9 A;  4A3E I;  1ZB9 A;  4RVD A;  2V8J A;  3HKZ A;  3TDH B;  2I3C A;  3GTK I;  3CCV 1;  1VQ8 Z;  3S15 I;  5IP7 I;  3G6E Z;  1RO4 A;  4NOZ A;  5IT9 b;  1TWH I;  2JR6 A;  4Y52 I;  1ZB8 A;  3CMA Z;  1K73 2;  1YI2 1;  4NBD A;  4BBS I;  2VUM I;  3GTM I;  3J80 b;  1YI2 Z;  3FKI I;  4A93 I;  5C44 I;  1VQ7 Z;  3I4M I;  3EED A;  2JA7 I;  2O4H A;  4E31 A;  1VQO Z;  1YJW Z;  4NBG A;  2OTL Z;  4BXX I;  2QEX Z;  3CCR 1;  2JS4 A;  3OW2 Z;  2E2J I;  3S1R I;  4NBF A;  1Q7Y 2;  2HF1 A;  2LFU A;  1Q82 1;  1QVF Y;  2IZ4 A;  1M1K 1;  4XX2 A;  3GTQ I;  1KD1 1;  1YJN 1;  1TWC I;  3JAM f;  3GTP I;  4DK1 A;  3NH4 A;  2IZ3 A;  2KI7 B;  4RVF A;  1VQM Z;  3VMG A;  2K3R A;  3CC7 Z;  2EGT A;  2M6N A;  2F4O A;  4BY1 I;  4MON A;  1RLY A;  3M3Y I;  5IP9 I;  2Q4Z A;  3I07 A;  2OOX B;  1VQO 1;  3CCU 1;  1K73 1;  3G6E 1;  1USP B;  2DE6 A;  3NFZ A;  3J81 f;  4HGZ A;  1K9M 2;  2QA4 1;  1VQ9 Z;  2NVQ I;  1PFT A;  2KPI A;  3J7A 4;  4Y7N I;  2R6M A;  5D1O B;  3S1N I;  2OOY B;  1KC8 1;  1X3W A;  3G4S 1;  4RVH A;  3TE5 B;  1VQL 1;  3I56 Z;  1WW9 A;  3GCF A;  1VQP 1;  1YJN Z;  5FLX f;  1ZH1 A;  3NH8 A;  4NH1 C;  2K5R A;  3HOY I;  5T67 A;  3FQM A;  1Q82 2;  1Y1V I;  3CCQ 1;  1Q81 2;  3GTG I;  2QKD A;  3CCR Z;  3CCJ 1;  2B63 I;  1JJ2 Z;  3S17 I;  3H0G I;  4A3L I;  4E33 A;  4A3M I;  2E2I I;  3CCL 1;  4MH4 A;  2NVX I;  2PK7 A;  1YJ9 Z;  5AN9 F;  3GTO I;  3S14 I;  2RT9 A;  1TFI A;  3S2D I;  1YIT 1;  1N2F A;  3CQZ I;  2JA5 I;  3CMA 1;  1YUA A;  3U50 C;  3HOW I;  3GTM S;  1K83 I;  2NVT I;  1TWG I;  1RO0 A;  4A3F I;  2DE5 A;  1YHQ 1;  4NB9 A;  3GTJ I;  3FQQ A;  2NVY I;  3CME Z;  3PO2 I;  1NJI 1;  2WAQ A;  2P28 A;  1S7M A;  3QWU A;  3NDI A;  4A3G I;  1VQN Z;  4E2X A;  1USP A;  1P9N A;  3EER A;  4A3B I;  4MD7 A;  3CC2 Z;  1YIJ 1;  2GTH A;  1TWA I;  3CCS Z;  3G71 Z;  1SFO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...