1YJNZ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjnZ00
1S72Z 3CCJZ 1VQ91 1K8A1 3CCM1 1Q861 1QVGY 1VQ51 1VQ9Z 3CCMZ 1Q811 3G4SZ 3I561 1YIT1 1VQ5Z 2QA41 1N8R1 3I56Z 1YITZ 2QA4Z 1YI2Z 1JJ2Y 3CD61 3OW2Z 1YJ91 3CD6Z 1NJI2 1YJ9Z 3CMEZ 3CMAZ 1YHQ1 3CPWZ 1VQM1 1YHQZ 3CCE1 1VQMZ 1W2BY 3CCS1 3CCEZ 3CCSZ 1Q7Y1 1VQ81 1W2BZ 1N8R2 1VQ8Z 1QVGZ 1VQ71 1KC81 1VQ7Z 1K731 1KD12 1Q821 1JJ2Z 2QEX1 3I551 2QEXZ 1YJN1 1YJNZ 1VQN1 1K9M2 3CCV1 1K8A2 1Q7Y2 1Q862 3CCVZ 3CXCY 1Q812 3CCU1 2OTJ1 2OTJZ 3CCUZ 1YIJ1 3CC71 1K732 1YIJZ 1VQ61 3CC7Z 1VQ6Z 1Q822 1KQSY 1QVFY 3I55Z 1M901 1M1K1 1VQ41 1VQP1 1QVFZ 1VQ4Z 3CC21 1VQPZ 3G4S1 3CC2Z 3G6E1 1VQNZ 3CCR1 3G6EZ 1VQK1 1YI21 3CCRZ 3OW2Y 1VQKZ 3CXCZ 1KC82 1VQO1 1VQL1 1VQOZ 3CC41 1KD11 1VQLZ 3G711 3CME1 3CCQ1 2OTL1 3CC4Z 3CMA1 1NJI1 2OTLZ 3G71Z 3CCQZ 3CPWY 1YJW1 3CCL1 1YJWZ 1M1K2 1M902 1KQSZ 3CCLZ 1S721 3CCJ1 1K9M1
chains in the Genus database with same CATH superfamily
1K8A1 1VQ91 5C3EI 1VQ51 1VQ9Z 3G4SZ 1VQ5Z 2QA41 1N8R1 2QA4Z 2JA8I 1YI2Z 3HOZI 2VF1A 1LQLA 3CMEZ 2NAPA 2RPRA 1QYPA 4BBSI 3MZLB 4HGZA 3CCS1 3CCSZ 1W2BZ 2R7ZI 3J80b 1QVGZ 1KC81 4E30A 2BJOA 2HU9A 4NH1C 3J81b 4NBHA 2JIQA 4MD9A 1YJN1 1I3QI 1YJNZ 3I4MI 3MZKB 2JMOA 3TE5B 5IT9b 5FLMI 1Q7Y2 3FQQA 3CXCY 4A3MI 3CCU1 1Z02A 2M6NA 4BY7I 3CCUZ 4E33A 1YIJ1 2OOYB 1K732 1YIJZ 1TFIA 4MRIA 2NVTI 1X3ZA 2P28A 1TWHI 1KQSY 2R93I 2IZ3A 1QVFY 3S1RI 1VQP1 1VQPZ 2F4OA 3G6E1 3G6EZ 3D9XA 5A2Qb 2KI7B 1KD11 2J6AA 3CCQ1 2RT9A 3GTJI 2HF1A 3GKQA 3CCQZ 2GTHA 1ML8A 3P5JB 2QRCB 1M902 3J80f 1M1K2 2O4HA 2OOXB 1S721 1S72Z 3S16I 1I50I 2KPIA 3CCM1 1Q861 1QVGY 3CCMZ 3J81f 4NBEA 3HOXI 2V8IA 4E31A 1ZH1A 2QLVB 2E2II 4DQYB 3CD61 3M3YI 2JR6A 2V8KA 3CD6Z 1QXFA 4A3FI 2DE6A 4E32A 4BY1I 1Q16A 1RLYA 3CMAZ 2V3VA 1WCMI 4MONA 1VQM1 2NVQI 1K83I 2JIRA 1VQMZ 3EEDA 2VPXA 3IFUA 4MD8A 1VQ81 2DE7A 4NBFA 1N8R2 1VQ8Z 3VMHA 3GTLI 1N2FA 3S1MI 4MD7A 5A2Qf 2QKDA 1K9M2 4NFRA 1Q812 1Y1VI 2VUGA 2F4MA 5D1PA 2QRDB 1WIIA 3D6WA 3NH8A 3CC71 3EERA 3GTGI 4NBBA 3CC7Z 4NBCA 1L1OC 3BG0B 3QWUA 5AN9F 2AYDA 2JA5I 2E2JI 5CM2M 1NUIA 3J7A4 3NH4A 3RZDI 3KIHA 4RVHA 1Y1VS 3LUSA 2V8JA 5T64A 1VQ41 1VQ4Z 3CC21 3CC2Z 2RBLA 1TWGI 3NH5A 2QR1B 2G2KA 3I4NI 4MXUA 3PO3I 3BG1B 5LL6f 2B63I 4TNUA 5T6BA 4S1TA 1AA6A 4A93I 2OTL1 4A3KI 4E2YA 1NJI1 2OTLZ 1WZNA 2K5RA 2AKLA 3GTOI 3IX0A 1USPB 2PMZA 2VUMI 1Z03A 1YIT1 2VPWA 5FLXb 3PO2I 1YITZ 3KIFA 3F3PC 1RO0A 2NVYI 2YADA 3GTQI 2JIMA 2JA6I 3H0GI 4A3II 1YJ91 1YJ9Z 2NVXI 2DE5A 2VPZA 4A3CI 1YHQ1 1FDOA 2K3RA 3CPWZ 2E9HA 1Z01A 1YHQZ 3CCE1 1WW9A 4E2ZA 1W2BY 2IZ4A 2E7ZA 3HOUI 1X0TA 3CCEZ 3M4OI 1DL6A 5D1OB 2Q51A 2IV2X 4E2XA 2PK7A 4BXXI 1JWHC 2V45A 2JA7I 2I3CA 3GTMI 4RVFA 3CQZI 1YUAA 1Q821 1JJ2Z 2LEXA 3I551 1Y8CA 4Y7NI 1RO2A 2R6MA 2YU9I 3GCFA 1VQN1 3NFZA 1I6HI 4NB9A 4A3LI 1K8A2 1USPA 3GTMS 2JIOA 3GTPI 2OTJ1 1QF8A 3RZOI 2OTJZ 5C44I 4A3JI 2M48A 2LFUA 1VQ61 3VMGA 4A3GI 3S1QI 1VLAA 1VQ6Z 4X6AI 4QTTA 2JUBA 3GTKI 3I07A 2GTIA 4NBGA 3S2HI 5T67A 2LIYA 5FLXf 4AYBA 2WB1A 1QVFZ 2R92I 3G4S1 1YUKA 1NP6A 5D1OA 1VQK1 1SIWA 4EWCA 1YI21 2P3YA 4DGLA 5IP7I 1VQKZ 3Q87A 1KC82 2VPYA 1VQO1 3S17I 1VQL1 1VQOZ 3CC41 3HOWI 1VQLZ 3G711 3CME1 3CC4Z 3JAMf 2EGTA 2ZAEB 3G71Z 3CPWY 3TDHB 2PM9A 1YJW1 1YJWZ 3CCJ1 2GU2A 1K9M1 4DK1A 3CCJZ 1Q811 3I561 2JIPA 3I56Z 3HOYI 3U50C 3VB9A 1WJ2A 1JJ2Y 4CL1A 3OW2Z 2Y0SA 4A3EI 3ESWA 1TWCI 4BBRI 2WAQA 1NJI2 4QTUA 4NOZA 4E2WA 3PO3S 3NDJA 3VMIA 3HOVI 3D2LA 1Q7Y1 2W03A 2RIQA 3S2DI 1VQ71 3FKII 1R9TI 1VQ7Z 1K731 2JS4A 4RV9A 4HH4A 1TWFI 1KD12 1KRLA 3VTNA 2QEX1 3IR7A 2QEXZ 3S14I 1Y1WI 4RVDA 1SFOI 1ZB8A 2RHBA 4NBDA 1RNIA 4A3BI 3FQMA 2H85A 3CCV1 2OZKA 2QREB 3JAMb 3CCVZ 1Q862 2JNYA 4HGYA 3S1NI 2Q4ZA 1RO4A 5C4JI 4NB8A 2E2HI 1Q822 1FDIA 4MH4A 3IF8A 3I55Z 1X3WA 1M901 1ZB9A 3MONA 3F3FC 1M1K1 2O53A 5C4XI 5IP9I 3HKZA 4A3DI 1VQNZ 3T4NB 3CCR1 3CCRZ 3OW2Y 3H3VJ 3NDIA 3S15I 3CXCZ 1RQFA 5IT9f 1P9NA 3CMA1 1S7MA 1PFTA 4RS4A 3K7AI 1TWAI 4NBAA 3CCL1 1KQSZ 4RVGA 3CCLZ 2W04A 4Y52I 4XX2A
chains in the Genus database with same CATH topology
1K8A1 1VQ91 5C3EI 1VQ51 1VQ9Z 3G4SZ 1VQ5Z 2QA41 1N8R1 2QA4Z 2JA8I 1YI2Z 3HOZI 2VF1A 1LQLA 3CMEZ 2RPRA 1QYPA 4BBSI 3MZLB 4HGZA 3CCS1 3CCSZ 1W2BZ 2R7ZI 3J80b 1QVGZ 1KC81 4E30A 2BJOA 2HU9A 4NH1C 3J81b 4NBHA 4MD9A 1YJN1 1I3QI 1YJNZ 3I4MI 3MZKB 2JMOA 3TE5B 5IT9b 5FLMI 1Q7Y2 3FQQA 3CXCY 4A3MI 3CCU1 1Z02A 2M6NA 4BY7I 3CCUZ 4E33A 1YIJ1 2OOYB 1K732 1YIJZ 1TFIA 4MRIA 2NVTI 1X3ZA 2P28A 1TWHI 1KQSY 2R93I 2IZ3A 1QVFY 3S1RI 1VQP1 1VQPZ 2F4OA 3G6E1 3G6EZ 3D9XA 5A2Qb 2KI7B 1KD11 2J6AA 3CCQ1 2RT9A 3GTJI 2HF1A 3GKQA 3CCQZ 2GTHA 1ML8A 3P5JB 2QRCB 1M902 3J80f 1M1K2 2O4HA 2OOXB 1S721 1S72Z 3S16I 1I50I 2KPIA 3CCM1 1Q861 1QVGY 3CCMZ 3J81f 4NBEA 3HOXI 2V8IA 4E31A 1ZH1A 2QLVB 2E2II 4DQYB 3CD61 3M3YI 2JR6A 2V8KA 3CD6Z 4A3FI 2DE6A 4E32A 4BY1I 1RLYA 3CMAZ 1WCMI 4MONA 1VQM1 2NVQI 1K83I 1VQMZ 3EEDA 3IFUA 4MD8A 1VQ81 2DE7A 4NBFA 1N8R2 1VQ8Z 3VMHA 3GTLI 1N2FA 3S1MI 4MD7A 5A2Qf 2QKDA 1K9M2 4NFRA 1Q812 1Y1VI 2VUGA 2F4MA 5D1PA 2QRDB 1WIIA 3D6WA 3NH8A 3CC71 3EERA 3GTGI 4NBBA 3CC7Z 4NBCA 1L1OC 3BG0B 3QWUA 5AN9F 2JA5I 2E2JI 5CM2M 1NUIA 3J7A4 3NH4A 3RZDI 3KIHA 4RVHA 1Y1VS 3LUSA 2V8JA 5T64A 1VQ41 1VQ4Z 3CC21 3CC2Z 2RBLA 1TWGI 3NH5A 2QR1B 2G2KA 3I4NI 4MXUA 3PO3I 3BG1B 5LL6f 2B63I 4TNUA 5T6BA 4S1TA 4A93I 2OTL1 4A3KI 4E2YA 1NJI1 2OTLZ 2K5RA 2AKLA 3GTOI 3IX0A 1USPB 2PMZA 2VUMI 1Z03A 1YIT1 5FLXb 3PO2I 1YITZ 3KIFA 3F3PC 1RO0A 2NVYI 2YADA 3GTQI 2JA6I 3H0GI 4A3II 1YJ91 1YJ9Z 2NVXI 2DE5A 4A3CI 1YHQ1 2K3RA 3CPWZ 2E9HA 1Z01A 1YHQZ 3CCE1 1WW9A 4E2ZA 1W2BY 2IZ4A 3HOUI 1X0TA 3CCEZ 3M4OI 1DL6A 5D1OB 2Q51A 4E2XA 2PK7A 4BXXI 1JWHC 2JA7I 2I3CA 3GTMI 4RVFA 3CQZI 1YUAA 1Q821 1JJ2Z 3I551 4Y7NI 1RO2A 2R6MA 2YU9I 3GCFA 1VQN1 3NFZA 1I6HI 4NB9A 4A3LI 1K8A2 1USPA 3GTMS 3GTPI 2OTJ1 1QF8A 3RZOI 2OTJZ 5C44I 4A3JI 2M48A 2LFUA 1VQ61 3VMGA 4A3GI 3S1QI 1VLAA 1VQ6Z 4X6AI 4QTTA 2JUBA 3GTKI 3I07A 2GTIA 4NBGA 3S2HI 5T67A 2LIYA 5FLXf 4AYBA 2WB1A 1QVFZ 2R92I 3G4S1 1YUKA 1NP6A 5D1OA 1VQK1 1YI21 4EWCA 2P3YA 4DGLA 5IP7I 1VQKZ 3Q87A 1KC82 3S17I 1VQO1 1VQL1 1VQOZ 3CC41 3HOWI 1VQLZ 3G711 3CME1 3CC4Z 3JAMf 2EGTA 2ZAEB 3G71Z 3CPWY 3TDHB 2PM9A 1YJW1 1YJWZ 3CCJ1 2GU2A 1K9M1 4DK1A 3CCJZ 1Q811 3I561 3I56Z 3HOYI 3U50C 3VB9A 1JJ2Y 4CL1A 3OW2Z 2Y0SA 4A3EI 3ESWA 1TWCI 4BBRI 2WAQA 1NJI2 4QTUA 4NOZA 4E2WA 3PO3S 3NDJA 3VMIA 3HOVI 1Q7Y1 2W03A 2RIQA 3S2DI 1VQ71 3FKII 1R9TI 1VQ7Z 1K731 2JS4A 4RV9A 4HH4A 1TWFI 1KD12 1KRLA 3VTNA 2QEX1 2QEXZ 3S14I 1Y1WI 4RVDA 1SFOI 1ZB8A 2RHBA 4NBDA 1RNIA 4A3BI 3FQMA 2H85A 3CCV1 2OZKA 2QREB 3JAMb 3CCVZ 1Q862 2JNYA 4HGYA 3S1NI 2Q4ZA 1RO4A 5C4JI 4NB8A 2E2HI 1Q822 4MH4A 3IF8A 3I55Z 1X3WA 1M901 1ZB9A 3MONA 3F3FC 1M1K1 2O53A 5C4XI 5IP9I 3HKZA 4A3DI 1VQNZ 3T4NB 3CCR1 3OW2Y 3CCRZ 3H3VJ 3NDIA 3S15I 3CXCZ 1RQFA 5IT9f 1P9NA 3CMA1 1S7MA 1PFTA 4RS4A 3K7AI 1TWAI 4NBAA 3CCL1 1KQSZ 4RVGA 3CCLZ 2W04A 4Y52I 4XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Z;  3CCJ Z;  1VQ9 1;  1K8A 1;  3CCM 1;  1Q86 1;  1QVG Y;  1VQ5 1;  1VQ9 Z;  3CCM Z;  1Q81 1;  3G4S Z;  3I56 1;  1YIT 1;  1VQ5 Z;  2QA4 1;  1N8R 1;  3I56 Z;  1YIT Z;  2QA4 Z;  1YI2 Z;  1JJ2 Y;  3CD6 1;  3OW2 Z;  1YJ9 1;  3CD6 Z;  1NJI 2;  1YJ9 Z;  3CME Z;  3CMA Z;  1YHQ 1;  3CPW Z;  1VQM 1;  1YHQ Z;  3CCE 1;  1VQM Z;  1W2B Y;  3CCS 1;  3CCE Z;  3CCS Z;  1Q7Y 1;  1VQ8 1;  1W2B Z;  1N8R 2;  1VQ8 Z;  1QVG Z;  1VQ7 1;  1KC8 1;  1VQ7 Z;  1K73 1;  1KD1 2;  1Q82 1;  1JJ2 Z;  2QEX 1;  3I55 1;  2QEX Z;  1YJN 1;  1YJN Z;  1VQN 1;  1K9M 2;  3CCV 1;  1K8A 2;  1Q7Y 2;  1Q86 2;  3CCV Z;  3CXC Y;  1Q81 2;  3CCU 1;  2OTJ 1;  2OTJ Z;  3CCU Z;  1YIJ 1;  3CC7 1;  1K73 2;  1YIJ Z;  1VQ6 1;  3CC7 Z;  1VQ6 Z;  1Q82 2;  1KQS Y;  1QVF Y;  3I55 Z;  1M90 1;  1M1K 1;  1VQ4 1;  1VQP 1;  1QVF Z;  1VQ4 Z;  3CC2 1;  1VQP Z;  3G4S 1;  3CC2 Z;  3G6E 1;  1VQN Z;  3CCR 1;  3G6E Z;  1VQK 1;  1YI2 1;  3CCR Z;  3OW2 Y;  1VQK Z;  3CXC Z;  1KC8 2;  1VQO 1;  1VQL 1;  1VQO Z;  3CC4 1;  1KD1 1;  1VQL Z;  3G71 1;  3CME 1;  3CCQ 1;  2OTL 1;  3CC4 Z;  3CMA 1;  1NJI 1;  2OTL Z;  3G71 Z;  3CCQ Z;  3CPW Y;  1YJW 1;  3CCL 1;  1YJW Z;  1M1K 2;  1M90 2;  1KQS Z;  3CCL Z;  1S72 1;  3CCJ 1;  1K9M 1; 
#chains in the Genus database with same CATH topology
 1K8A 1;  1VQ9 1;  5C3E I;  1VQ5 1;  1VQ9 Z;  3G4S Z;  1VQ5 Z;  2QA4 1;  1N8R 1;  2QA4 Z;  2JA8 I;  1YI2 Z;  3HOZ I;  2VF1 A;  1LQL A;  3CME Z;  2NAP A;  2RPR A;  1QYP A;  4BBS I;  3MZL B;  4HGZ A;  3CCS 1;  3CCS Z;  1W2B Z;  2R7Z I;  3J80 b;  1QVG Z;  1KC8 1;  4E30 A;  2BJO A;  2HU9 A;  4NH1 C;  3J81 b;  4NBH A;  2JIQ A;  4MD9 A;  1YJN 1;  1I3Q I;  1YJN Z;  3I4M I;  3MZK B;  2JMO A;  3TE5 B;  5IT9 b;  5FLM I;  1Q7Y 2;  3FQQ A;  3CXC Y;  4A3M I;  3CCU 1;  1Z02 A;  2M6N A;  4BY7 I;  3CCU Z;  4E33 A;  1YIJ 1;  2OOY B;  1K73 2;  1YIJ Z;  1TFI A;  4MRI A;  2NVT I;  1X3Z A;  2P28 A;  1TWH I;  1KQS Y;  2R93 I;  2IZ3 A;  1QVF Y;  3S1R I;  1VQP 1;  1VQP Z;  2F4O A;  3G6E 1;  3G6E Z;  3D9X A;  5A2Q b;  2KI7 B;  1KD1 1;  2J6A A;  3CCQ 1;  2RT9 A;  3GTJ I;  2HF1 A;  3GKQ A;  3CCQ Z;  2GTH A;  1ML8 A;  3P5J B;  2QRC B;  1M90 2;  3J80 f;  1M1K 2;  2O4H A;  2OOX B;  1S72 1;  1S72 Z;  3S16 I;  1I50 I;  2KPI A;  3CCM 1;  1Q86 1;  1QVG Y;  3CCM Z;  3J81 f;  4NBE A;  3HOX I;  2V8I A;  4E31 A;  1ZH1 A;  2QLV B;  2E2I I;  4DQY B;  3CD6 1;  3M3Y I;  2JR6 A;  2V8K A;  3CD6 Z;  1QXF A;  4A3F I;  2DE6 A;  4E32 A;  4BY1 I;  1Q16 A;  1RLY A;  3CMA Z;  2V3V A;  1WCM I;  4MON A;  1VQM 1;  2NVQ I;  1K83 I;  2JIR A;  1VQM Z;  3EED A;  2VPX A;  3IFU A;  4MD8 A;  1VQ8 1;  2DE7 A;  4NBF A;  1N8R 2;  1VQ8 Z;  3VMH A;  3GTL I;  1N2F A;  3S1M I;  4MD7 A;  5A2Q f;  2QKD A;  1K9M 2;  4NFR A;  1Q81 2;  1Y1V I;  2VUG A;  2F4M A;  5D1P A;  2QRD B;  1WII A;  3D6W A;  3NH8 A;  3CC7 1;  3EER A;  3GTG I;  4NBB A;  3CC7 Z;  4NBC A;  1L1O C;  3BG0 B;  3QWU A;  5AN9 F;  2AYD A;  2JA5 I;  2E2J I;  5CM2 M;  1NUI A;  3J7A 4;  3NH4 A;  3RZD I;  3KIH A;  4RVH A;  1Y1V S;  3LUS A;  2V8J A;  5T64 A;  1VQ4 1;  1VQ4 Z;  3CC2 1;  3CC2 Z;  2RBL A;  1TWG I;  3NH5 A;  2QR1 B;  2G2K A;  3I4N I;  4MXU A;  3PO3 I;  3BG1 B;  5LL6 f;  2B63 I;  4TNU A;  5T6B A;  4S1T A;  1AA6 A;  4A93 I;  2OTL 1;  4A3K I;  4E2Y A;  1NJI 1;  2OTL Z;  1WZN A;  2K5R A;  2AKL A;  3GTO I;  3IX0 A;  1USP B;  2PMZ A;  2VUM I;  1Z03 A;  1YIT 1;  2VPW A;  5FLX b;  3PO2 I;  1YIT Z;  3KIF A;  3F3P C;  1RO0 A;  2NVY I;  2YAD A;  3GTQ I;  2JIM A;  2JA6 I;  3H0G I;  4A3I I;  1YJ9 1;  1YJ9 Z;  2NVX I;  2DE5 A;  2VPZ A;  4A3C I;  1YHQ 1;  1FDO A;  2K3R A;  3CPW Z;  2E9H A;  1Z01 A;  1YHQ Z;  3CCE 1;  1WW9 A;  4E2Z A;  1W2B Y;  2IZ4 A;  2E7Z A;  3HOU I;  1X0T A;  3CCE Z;  3M4O I;  1DL6 A;  5D1O B;  2Q51 A;  2IV2 X;  4E2X A;  2PK7 A;  4BXX I;  1JWH C;  2V45 A;  2JA7 I;  2I3C A;  3GTM I;  4RVF A;  3CQZ I;  1YUA A;  1Q82 1;  1JJ2 Z;  2LEX A;  3I55 1;  1Y8C A;  4Y7N I;  1RO2 A;  2R6M A;  2YU9 I;  3GCF A;  1VQN 1;  3NFZ A;  1I6H I;  4NB9 A;  4A3L I;  1K8A 2;  1USP A;  3GTM S;  2JIO A;  3GTP I;  2OTJ 1;  1QF8 A;  3RZO I;  2OTJ Z;  5C44 I;  4A3J I;  2M48 A;  2LFU A;  1VQ6 1;  3VMG A;  4A3G I;  3S1Q I;  1VLA A;  1VQ6 Z;  4X6A I;  4QTT A;  2JUB A;  3GTK I;  3I07 A;  2GTI A;  4NBG A;  3S2H I;  5T67 A;  2LIY A;  5FLX f;  4AYB A;  2WB1 A;  1QVF Z;  2R92 I;  3G4S 1;  1YUK A;  1NP6 A;  5D1O A;  1VQK 1;  1SIW A;  4EWC A;  1YI2 1;  2P3Y A;  4DGL A;  5IP7 I;  1VQK Z;  3Q87 A;  1KC8 2;  2VPY A;  1VQO 1;  3S17 I;  1VQL 1;  1VQO Z;  3CC4 1;  3HOW I;  1VQL Z;  3G71 1;  3CME 1;  3CC4 Z;  3JAM f;  2EGT A;  2ZAE B;  3G71 Z;  3CPW Y;  3TDH B;  2PM9 A;  1YJW 1;  1YJW Z;  3CCJ 1;  2GU2 A;  1K9M 1;  4DK1 A;  3CCJ Z;  1Q81 1;  3I56 1;  2JIP A;  3I56 Z;  3HOY I;  3U50 C;  3VB9 A;  1WJ2 A;  1JJ2 Y;  4CL1 A;  3OW2 Z;  2Y0S A;  4A3E I;  3ESW A;  1TWC I;  4BBR I;  2WAQ A;  1NJI 2;  4QTU A;  4NOZ A;  4E2W A;  3PO3 S;  3NDJ A;  3VMI A;  3HOV I;  3D2L A;  1Q7Y 1;  2W03 A;  2RIQ A;  3S2D I;  1VQ7 1;  3FKI I;  1R9T I;  1VQ7 Z;  1K73 1;  2JS4 A;  4RV9 A;  4HH4 A;  1TWF I;  1KD1 2;  1KRL A;  3VTN A;  2QEX 1;  3IR7 A;  2QEX Z;  3S14 I;  1Y1W I;  4RVD A;  1SFO I;  1ZB8 A;  2RHB A;  4NBD A;  1RNI A;  4A3B I;  3FQM A;  2H85 A;  3CCV 1;  2OZK A;  2QRE B;  3JAM b;  3CCV Z;  1Q86 2;  2JNY A;  4HGY A;  3S1N I;  2Q4Z A;  1RO4 A;  5C4J I;  4NB8 A;  2E2H I;  1Q82 2;  1FDI A;  4MH4 A;  3IF8 A;  3I55 Z;  1X3W A;  1M90 1;  1ZB9 A;  3MON A;  3F3F C;  1M1K 1;  2O53 A;  5C4X I;  5IP9 I;  3HKZ A;  4A3D I;  1VQN Z;  3T4N B;  3CCR 1;  3CCR Z;  3OW2 Y;  3H3V J;  3NDI A;  3S15 I;  3CXC Z;  1RQF A;  5IT9 f;  1P9N A;  3CMA 1;  1S7M A;  1PFT A;  4RS4 A;  3K7A I;  1TWA I;  4NBA A;  3CCL 1;  1KQS Z;  4RVG A;  3CCL Z;  2W04 A;  4Y52 I;  4XX2 A; 
#chains in the Genus database with same CATH homology
 1K8A 1;  1VQ9 1;  5C3E I;  1VQ5 1;  1VQ9 Z;  3G4S Z;  1VQ5 Z;  2QA4 1;  1N8R 1;  2QA4 Z;  2JA8 I;  1YI2 Z;  3HOZ I;  2VF1 A;  1LQL A;  3CME Z;  2RPR A;  1QYP A;  4BBS I;  3MZL B;  4HGZ A;  3CCS 1;  3CCS Z;  1W2B Z;  2R7Z I;  3J80 b;  1QVG Z;  1KC8 1;  4E30 A;  2BJO A;  2HU9 A;  4NH1 C;  3J81 b;  4NBH A;  4MD9 A;  1YJN 1;  1I3Q I;  1YJN Z;  3I4M I;  3MZK B;  2JMO A;  3TE5 B;  5IT9 b;  5FLM I;  1Q7Y 2;  3FQQ A;  3CXC Y;  4A3M I;  3CCU 1;  1Z02 A;  2M6N A;  4BY7 I;  3CCU Z;  4E33 A;  1YIJ 1;  2OOY B;  1K73 2;  1YIJ Z;  1TFI A;  4MRI A;  2NVT I;  1X3Z A;  2P28 A;  1TWH I;  1KQS Y;  2R93 I;  2IZ3 A;  1QVF Y;  3S1R I;  1VQP 1;  1VQP Z;  2F4O A;  3G6E 1;  3G6E Z;  3D9X A;  5A2Q b;  2KI7 B;  1KD1 1;  2J6A A;  3CCQ 1;  2RT9 A;  3GTJ I;  2HF1 A;  3GKQ A;  3CCQ Z;  2GTH A;  1ML8 A;  3P5J B;  2QRC B;  1M90 2;  3J80 f;  1M1K 2;  2O4H A;  2OOX B;  1S72 1;  1S72 Z;  3S16 I;  1I50 I;  2KPI A;  3CCM 1;  1Q86 1;  1QVG Y;  3CCM Z;  3J81 f;  4NBE A;  3HOX I;  2V8I A;  4E31 A;  1ZH1 A;  2QLV B;  2E2I I;  4DQY B;  3CD6 1;  3M3Y I;  2JR6 A;  2V8K A;  3CD6 Z;  4A3F I;  2DE6 A;  4E32 A;  4BY1 I;  1RLY A;  3CMA Z;  1WCM I;  4MON A;  1VQM 1;  2NVQ I;  1K83 I;  1VQM Z;  3EED A;  3IFU A;  4MD8 A;  1VQ8 1;  2DE7 A;  4NBF A;  1N8R 2;  1VQ8 Z;  3VMH A;  3GTL I;  1N2F A;  3S1M I;  4MD7 A;  5A2Q f;  2QKD A;  1K9M 2;  4NFR A;  1Q81 2;  1Y1V I;  2VUG A;  2F4M A;  5D1P A;  2QRD B;  1WII A;  3D6W A;  3NH8 A;  3CC7 1;  3EER A;  3GTG I;  4NBB A;  3CC7 Z;  4NBC A;  1L1O C;  3BG0 B;  3QWU A;  5AN9 F;  2JA5 I;  2E2J I;  5CM2 M;  1NUI A;  3J7A 4;  3NH4 A;  3RZD I;  3KIH A;  4RVH A;  1Y1V S;  3LUS A;  2V8J A;  5T64 A;  1VQ4 1;  1VQ4 Z;  3CC2 1;  3CC2 Z;  2RBL A;  1TWG I;  3NH5 A;  2QR1 B;  2G2K A;  3I4N I;  4MXU A;  3PO3 I;  3BG1 B;  5LL6 f;  2B63 I;  4TNU A;  5T6B A;  4S1T A;  4A93 I;  2OTL 1;  4A3K I;  4E2Y A;  1NJI 1;  2OTL Z;  2K5R A;  2AKL A;  3GTO I;  3IX0 A;  1USP B;  2PMZ A;  2VUM I;  1Z03 A;  1YIT 1;  5FLX b;  3PO2 I;  1YIT Z;  3KIF A;  3F3P C;  1RO0 A;  2NVY I;  2YAD A;  3GTQ I;  2JA6 I;  3H0G I;  4A3I I;  1YJ9 1;  1YJ9 Z;  2NVX I;  2DE5 A;  4A3C I;  1YHQ 1;  2K3R A;  3CPW Z;  2E9H A;  1Z01 A;  1YHQ Z;  3CCE 1;  1WW9 A;  4E2Z A;  1W2B Y;  2IZ4 A;  3HOU I;  1X0T A;  3CCE Z;  3M4O I;  1DL6 A;  5D1O B;  2Q51 A;  4E2X A;  2PK7 A;  4BXX I;  1JWH C;  2JA7 I;  2I3C A;  3GTM I;  4RVF A;  3CQZ I;  1YUA A;  1Q82 1;  1JJ2 Z;  3I55 1;  4Y7N I;  1RO2 A;  2R6M A;  2YU9 I;  3GCF A;  1VQN 1;  3NFZ A;  1I6H I;  4NB9 A;  4A3L I;  1K8A 2;  1USP A;  3GTM S;  3GTP I;  2OTJ 1;  1QF8 A;  3RZO I;  2OTJ Z;  5C44 I;  4A3J I;  2M48 A;  2LFU A;  1VQ6 1;  3VMG A;  4A3G I;  3S1Q I;  1VLA A;  1VQ6 Z;  4X6A I;  4QTT A;  2JUB A;  3GTK I;  3I07 A;  2GTI A;  4NBG A;  3S2H I;  5T67 A;  2LIY A;  5FLX f;  4AYB A;  2WB1 A;  1QVF Z;  2R92 I;  3G4S 1;  1YUK A;  1NP6 A;  5D1O A;  1VQK 1;  1YI2 1;  4EWC A;  2P3Y A;  4DGL A;  5IP7 I;  1VQK Z;  3Q87 A;  1KC8 2;  3S17 I;  1VQO 1;  1VQL 1;  1VQO Z;  3CC4 1;  3HOW I;  1VQL Z;  3G71 1;  3CME 1;  3CC4 Z;  3JAM f;  2EGT A;  2ZAE B;  3G71 Z;  3CPW Y;  3TDH B;  2PM9 A;  1YJW 1;  1YJW Z;  3CCJ 1;  2GU2 A;  1K9M 1;  4DK1 A;  3CCJ Z;  1Q81 1;  3I56 1;  3I56 Z;  3HOY I;  3U50 C;  3VB9 A;  1JJ2 Y;  4CL1 A;  3OW2 Z;  2Y0S A;  4A3E I;  3ESW A;  1TWC I;  4BBR I;  2WAQ A;  1NJI 2;  4QTU A;  4NOZ A;  4E2W A;  3PO3 S;  3NDJ A;  3VMI A;  3HOV I;  1Q7Y 1;  2W03 A;  2RIQ A;  3S2D I;  1VQ7 1;  3FKI I;  1R9T I;  1VQ7 Z;  1K73 1;  2JS4 A;  4RV9 A;  4HH4 A;  1TWF I;  1KD1 2;  1KRL A;  3VTN A;  2QEX 1;  2QEX Z;  3S14 I;  1Y1W I;  4RVD A;  1SFO I;  1ZB8 A;  2RHB A;  4NBD A;  1RNI A;  4A3B I;  3FQM A;  2H85 A;  3CCV 1;  2OZK A;  2QRE B;  3JAM b;  3CCV Z;  1Q86 2;  2JNY A;  4HGY A;  3S1N I;  2Q4Z A;  1RO4 A;  5C4J I;  4NB8 A;  2E2H I;  1Q82 2;  4MH4 A;  3IF8 A;  3I55 Z;  1X3W A;  1M90 1;  1ZB9 A;  3MON A;  3F3F C;  1M1K 1;  2O53 A;  5C4X I;  5IP9 I;  3HKZ A;  4A3D I;  1VQN Z;  3T4N B;  3CCR 1;  3OW2 Y;  3CCR Z;  3H3V J;  3NDI A;  3S15 I;  3CXC Z;  1RQF A;  5IT9 f;  1P9N A;  3CMA 1;  1S7M A;  1PFT A;  4RS4 A;  3K7A I;  1TWA I;  4NBA A;  3CCL 1;  1KQS Z;  4RVG A;  3CCL Z;  2W04 A;  4Y52 I;  4XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...