1YJNZ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjnZ00
2QA41 3I561 1YJW1 1M1K2 3CXCZ 3CCV1 1YJNZ 1YHQ1 2OTJZ 1Q862 3CME1 1Q811 1Q822 1KD12 3OW2Y 1VQM1 3CC21 3CCUZ 1K732 1VQ61 3CCQZ 1YIJ1 3CCRZ 3G71Z 1M901 1NJI2 3CPWY 1VQOZ 1VQ81 2QEXZ 3CXCY 1VQL1 1YJ91 1K8A2 3CCJZ 1M1K1 1VQN1 1VQ51 3CCM1 1K9M2 1VQPZ 3CC41 1Q861 1Q821 3CD6Z 1JJ2Z 2OTLZ 1KD11 1KQSZ 3CMAZ 1K731 1QVFZ 3CCR1 1N8R2 3CC71 1QVGZ 1YITZ 1KC81 1Q7Y2 3CCS1 1NJI1 3CCE1 3G6EZ 3CCLZ 1VQKZ 1VQ9Z 1YI2Z 1K8A1 1W2BZ 1YJN1 1VQ4Z 1VQ7Z 1K9M1 1S72Z 1JJ2Y 3CD61 2OTJ1 1KQSY 2OTL1 1Q812 1QVFY 3CMA1 3CMEZ 1QVGY 3CCU1 3CCQ1 1VQMZ 3G711 1N8R1 1VQ6Z 1VQ91 3G4SZ 1VQO1 2QEX1 3I55Z 3CPWZ 1W2BY 1VQ8Z 3CCJ1 1VQ41 1VQLZ 1VQ71 1YJ9Z 2QA4Z 1S721 1VQNZ 3I56Z 1YJWZ 1VQ5Z 1VQP1 3CCMZ 3CCVZ 3CC4Z 1YHQZ 1YIT1 1KC82 3CC2Z 3CC7Z 3OW2Z 1YIJZ 3G4S1 3G6E1 3CCSZ 1Q7Y1 1M902 3CCL1 3CCEZ 1VQK1 3I551 1YI21
chains in the Genus database with same CATH superfamily
2QLVB 2K5RA 3LUSA 2JNYA 1YJW1 1YJNZ 3NDJA 3NH5A 4NBGA 4E2WA 1Z02A 4BY7I 2OTJZ 2QR1B 1Q862 3CME1 3GKQA 1TFIA 3FQMA 4NBFA 1X3ZA 2LFUA 4QTUA 4A3FI 2B63I 1RQFA 3OW2Y 1VQM1 2RIQA 3F3FC 1YIJ1 1Y1WI 1TWGI 2JA7I 3CCRZ 4RVHA 4MD8A 4E31A 3HOWI 3VB9A 2E7ZA 2V8KA 2JIMA 1VQOZ 3HOUI 1Z03A 1VQ81 1K8A2 1M1K1 1I6HI 3S2DI 3I4NI 1K9M2 1VQPZ 3HOXI 4MXUA 1JJ2Z 3GCFA 5IP7I 1KQSZ 2YU9I 1K731 2IZ4A 3NH4A 2HF1A 2P28A 1N8R2 1QVGZ 3D6WA 1YITZ 3GTOI 2IV2X 2LIYA 1Q7Y2 3CCS1 2NAPA 3S14I 3CCE1 4X6AI 1QF8A 2Y0SA 5D1PA 1VQ9Z 2QRDB 2E9HA 3GTJI 2DE7A 3S1NI 3S1QI 1Z01A 4TNUA 4A3CI 2OOXB 1JJ2Y 2G2KA 1KQSY 3GTPI 3CQZI 3FQQA 3CMEZ 1QVGY 1RNIA 1VQMZ 2V3VA 1SFOI 3M3YI 5D1OB 2O53A 1R9TI 3J80b 3I4MI 3RZDI 1USPB 4MRIA 2KPIA 3NDIA 3S15I 1RLYA 4NBBA 3G4SZ 5C4JI 3I55Z 3CPWZ 1Y8CA 1VQ8Z 4A3JI 3RZOI 2F4OA 1VQ71 2QA4Z 5CM2M 3I56Z 3CCVZ 4RS4A 2KI7B 2IZ3A 4BY1I 2WAQA 5T64A 2VUMI 4EWCA 3IX0A 1KC82 4BBSI 3CC2Z 1FDIA 3G6E1 3CCSZ 1Q7Y1 2VPYA 3CCEZ 3IR7A 3MONA 2GTIA 4E2ZA 5LL6f 4NFRA 3FKII 4CL1A 2V8IA 2GTHA 2ZAEB 1M1K2 3CXCZ 3QWUA 3U50C 1RO2A 2K3RA 3P5JB 1K732 4A3EI 3GTKI 2Q51A 4A3KI 5IT9f 2W03A 3GTMS 2JS4A 2H85A 4A3GI 4A3DI 5T6BA 3CXCY 1NP6A 3TDHB 2VF1A 3CCM1 3JAMf 3CD6Z 1JWHC 1Y1VI 3IFUA 3CMAZ 1QVFZ 3J7A4 3CC71 1KC81 3T4NB 1NJI1 3ESWA 3G6EZ 1RO4A 3S16I 1WZNA 3GTGI 1S7MA 2R6MA 2JIQA 1S72Z 3HKZA 2OTL1 1QVFY 2YADA 1TWFI 5AN9F 3CCU1 3CCQ1 1AA6A 2M6NA 1QXFA 5FLMI 3G711 3PO3S 2AKLA 4E30A 2PMZA 3IF8A 3EEDA 2DE5A 4NB8A 1Y1VS 1VQ41 4E2XA 2E2HI 1YJWZ 3CCMZ 1TWAI 2EGTA 4E32A 3KIFA 4NH1C 4A3BI 4BXXI 1I50I 2WB1A 4HGZA 2E2II 3CC7Z 1YIJZ 3Q87A 1FDOA 4NBDA 3J81f 2QREB 1VQK1 1YI21 1ZB8A 3VMIA 2JIOA 2V8JA 2JIRA 3GTMI 4E2YA 3S2HI 2NVTI 1LQLA 3KIHA 1X0TA 2VPXA 1YHQ1 2OOYB 3CCUZ 3CCQZ 3M4OI 4E33A 4S1TA 2QKDA 3G71Z 3HOZI 1M901 1NJI2 3J81b 4Y7NI 4NOZA 4MD9A 3CPWY 2R93I 1VQL1 1NUIA 1ML8A 1VQ51 2BJOA 3MZKB 3PO2I 3GTLI 4HH4A 4DGLA 3CC41 5A2Qf 1Q821 3VMHA 2F4MA 1KD11 4NBHA 4DQYB 3CCR1 1VLAA 1TWHI 2JMOA 1DL6A 1VQKZ 1YI2Z 1USPA 3HOYI 3S1MI 5C44I 3PO3I 1VQ7Z 3HOVI 5A2Qb 1Q812 2R92I 3D9XA 1L1OC 1Q16A 5T67A 5IT9b 3TE5B 4XX2A 1VQ91 2M48A 2QEX1 2J6AA 3CCJ1 1RO0A 1VQLZ 5C3EI 4A3MI 3K7AI 1VQ5Z 4AYBA 1K83I 2VPWA 5IP9I 1YUKA 1X3WA 3CC4Z 4RVFA 4NB9A 2NVYI 4HGYA 3JAMb 2E2JI 3F3PC 4Y52I 2LEXA 5FLXf 3MZLB 3VMGA 2Q4ZA 3G4S1 1M902 2I3CA 3H0GI 3CCL1 2AYDA 3NFZA 3I551 2QA41 3I561 2JA6I 3CCV1 2O4HA 4A93I 1Q822 1Q811 2VPZA 3BG0B 1KD12 2JA5I 4MONA 3CC21 3S17I 1VQ61 5FLXb 4BBRI 2JR6A 2HU9A 1QYPA 2RPRA 3J80f 3S1RI 2RHBA 1PFTA 2OZKA 1P9NA 2QEXZ 2NVXI 1I3QI 1YJ91 3CCJZ 3BG1B 1VQN1 4A3II 2PK7A 1WJ2A 1Q861 2OTLZ 2GU2A 3GTQI 4A3LI 4NBEA 2RT9A 3CCLZ 2JIPA 2R7ZI 1K8A1 2VUGA 1WIIA 2JUBA 1W2BZ 1KRLA 1YJN1 1VQ4Z 2NVQI 2QRCB 2W04A 1K9M1 3CD61 5C4XI 2OTJ1 1ZH1A 2P3YA 3CMA1 1SIWA 4QTTA 1N8R1 1VQ6Z 3VTNA 1WW9A 1VQO1 2JA8I 4NBCA 5D1OA 3H3VJ 4RVDA 1W2BY 4MD7A 1YJ9Z 1YUAA 3EERA 4DK1A 1S721 1VQNZ 2DE6A 1VQP1 2RBLA 2V45A 3NH8A 1YHQZ 3D2LA 1WCMI 3I07A 1TWCI 1YIT1 3OW2Z 1ZB9A 2PM9A 1N2FA 4RVGA 4RV9A 4MH4A 4NBAA
chains in the Genus database with same CATH topology
2QLVB 2K5RA 3LUSA 2JNYA 1YJW1 1YJNZ 3NDJA 3NH5A 4NBGA 4E2WA 1Z02A 4BY7I 2OTJZ 2QR1B 1Q862 3CME1 3GKQA 1TFIA 3FQMA 4NBFA 1X3ZA 4A3FI 2LFUA 4QTUA 2B63I 1RQFA 3OW2Y 1VQM1 2RIQA 3F3FC 1YIJ1 1Y1WI 1TWGI 2JA7I 3CCRZ 4RVHA 4MD8A 4E31A 3HOWI 3VB9A 2V8KA 1VQOZ 3HOUI 1Z03A 1VQ81 1K8A2 1M1K1 1I6HI 3S2DI 3I4NI 1K9M2 1VQPZ 3HOXI 4MXUA 1JJ2Z 3GCFA 5IP7I 1KQSZ 2YU9I 1K731 2IZ4A 3NH4A 2HF1A 2P28A 1N8R2 1QVGZ 3D6WA 1YITZ 3GTOI 2LIYA 1Q7Y2 3CCS1 3S14I 3CCE1 4X6AI 1QF8A 2Y0SA 5D1PA 1VQ9Z 2QRDB 2E9HA 3GTJI 2DE7A 3S1NI 3S1QI 1Z01A 4TNUA 4A3CI 2OOXB 1JJ2Y 2G2KA 1KQSY 3GTPI 3CQZI 3FQQA 3CMEZ 1QVGY 1RNIA 1VQMZ 1SFOI 3M3YI 5D1OB 2O53A 1R9TI 3J80b 3I4MI 3RZDI 1USPB 4MRIA 2KPIA 3NDIA 3S15I 1RLYA 4NBBA 3G4SZ 5C4JI 3I55Z 3CPWZ 1VQ8Z 4A3JI 3RZOI 2F4OA 1VQ71 2QA4Z 5CM2M 3I56Z 3CCVZ 4RS4A 2KI7B 2IZ3A 4BY1I 2WAQA 5T64A 2VUMI 4EWCA 3IX0A 1KC82 4BBSI 3CC2Z 1Q7Y1 3G6E1 3CCSZ 3CCEZ 3MONA 2GTIA 4E2ZA 5LL6f 4NFRA 3FKII 4CL1A 2V8IA 2GTHA 2ZAEB 1M1K2 3CXCZ 3QWUA 3U50C 1RO2A 2K3RA 3P5JB 1K732 4A3EI 3GTKI 2Q51A 4A3KI 5IT9f 2W03A 3GTMS 2JS4A 2H85A 4A3GI 4A3DI 5T6BA 3CXCY 1NP6A 3TDHB 2VF1A 3CCM1 3JAMf 3CD6Z 1JWHC 1Y1VI 3IFUA 3CMAZ 1QVFZ 3J7A4 3CC71 1KC81 3T4NB 1NJI1 3ESWA 3G6EZ 1RO4A 3S16I 3GTGI 1S7MA 2R6MA 1S72Z 3HKZA 2OTL1 1QVFY 2YADA 1TWFI 5AN9F 3CCU1 3CCQ1 2M6NA 3G711 5FLMI 3PO3S 2AKLA 4E30A 2PMZA 3IF8A 3EEDA 2DE5A 4NB8A 1Y1VS 1VQ41 4E2XA 2E2HI 1YJWZ 3CCMZ 1TWAI 2EGTA 4E32A 3KIFA 4NH1C 4A3BI 4BXXI 1I50I 2WB1A 4HGZA 2E2II 3CC7Z 1YIJZ 3Q87A 4NBDA 3J81f 2QREB 1VQK1 1YI21 1ZB8A 3VMIA 2V8JA 3GTMI 4E2YA 3S2HI 2NVTI 1LQLA 3KIHA 1X0TA 1YHQ1 2OOYB 3CCUZ 3CCQZ 3M4OI 4E33A 4S1TA 2QKDA 3G71Z 3HOZI 1M901 1NJI2 3J81b 4Y7NI 4NOZA 4MD9A 3CPWY 2R93I 1VQL1 1NUIA 1ML8A 1VQ51 2BJOA 3MZKB 3PO2I 3GTLI 4HH4A 4DGLA 3CC41 5A2Qf 1Q821 3VMHA 2F4MA 1KD11 4NBHA 4DQYB 3CCR1 1VLAA 1TWHI 2JMOA 1DL6A 1VQKZ 1YI2Z 1USPA 3HOYI 3S1MI 5C44I 3PO3I 1VQ7Z 3HOVI 5A2Qb 1Q812 2R92I 3D9XA 1L1OC 5T67A 5IT9b 3TE5B 4XX2A 1VQ91 2M48A 2QEX1 2J6AA 3CCJ1 1RO0A 1VQLZ 5C3EI 4A3MI 3K7AI 1VQ5Z 4AYBA 1K83I 5IP9I 1YUKA 1X3WA 3CC4Z 4RVFA 4NB9A 2NVYI 4HGYA 3JAMb 2E2JI 3F3PC 4Y52I 5FLXf 3MZLB 3VMGA 2Q4ZA 3G4S1 1M902 2I3CA 3H0GI 3CCL1 3NFZA 3I551 2QA41 3I561 2JA6I 3CCV1 2O4HA 4A93I 1Q822 1Q811 3BG0B 1KD12 2JA5I 4MONA 3CC21 3S17I 1VQ61 5FLXb 4BBRI 2JR6A 2HU9A 1QYPA 2RPRA 3J80f 3S1RI 2RHBA 1PFTA 2OZKA 1P9NA 2QEXZ 2NVXI 1I3QI 1YJ91 3CCJZ 3BG1B 1VQN1 4A3II 2PK7A 1Q861 2OTLZ 2GU2A 3GTQI 4A3LI 4NBEA 2RT9A 3CCLZ 2R7ZI 1K8A1 2VUGA 1WIIA 2JUBA 1W2BZ 1KRLA 1YJN1 1VQ4Z 2NVQI 2QRCB 2W04A 1K9M1 3CD61 5C4XI 2OTJ1 1ZH1A 2P3YA 3CMA1 4QTTA 1N8R1 1VQ6Z 3VTNA 1WW9A 1VQO1 2JA8I 4NBCA 5D1OA 3H3VJ 4RVDA 1W2BY 4MD7A 1YJ9Z 1YUAA 3EERA 4DK1A 1S721 1VQNZ 2DE6A 1VQP1 2RBLA 3NH8A 1YHQZ 1WCMI 3I07A 1TWCI 1YIT1 3OW2Z 1ZB9A 2PM9A 1N2FA 4RVGA 4RV9A 4MH4A 4NBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 1;  3I56 1;  1YJW 1;  1M1K 2;  3CXC Z;  3CCV 1;  1YJN Z;  1YHQ 1;  2OTJ Z;  1Q86 2;  3CME 1;  1Q81 1;  1Q82 2;  1KD1 2;  3OW2 Y;  1VQM 1;  3CC2 1;  3CCU Z;  1K73 2;  1VQ6 1;  3CCQ Z;  1YIJ 1;  3CCR Z;  3G71 Z;  1M90 1;  1NJI 2;  3CPW Y;  1VQO Z;  1VQ8 1;  2QEX Z;  3CXC Y;  1VQL 1;  1YJ9 1;  1K8A 2;  3CCJ Z;  1M1K 1;  1VQN 1;  1VQ5 1;  3CCM 1;  1K9M 2;  1VQP Z;  3CC4 1;  1Q86 1;  1Q82 1;  3CD6 Z;  1JJ2 Z;  2OTL Z;  1KD1 1;  1KQS Z;  3CMA Z;  1K73 1;  1QVF Z;  3CCR 1;  1N8R 2;  3CC7 1;  1QVG Z;  1YIT Z;  1KC8 1;  1Q7Y 2;  3CCS 1;  1NJI 1;  3CCE 1;  3G6E Z;  3CCL Z;  1VQK Z;  1VQ9 Z;  1YI2 Z;  1K8A 1;  1W2B Z;  1YJN 1;  1VQ4 Z;  1VQ7 Z;  1K9M 1;  1S72 Z;  1JJ2 Y;  3CD6 1;  2OTJ 1;  1KQS Y;  2OTL 1;  1Q81 2;  1QVF Y;  3CMA 1;  3CME Z;  1QVG Y;  3CCU 1;  3CCQ 1;  1VQM Z;  3G71 1;  1N8R 1;  1VQ6 Z;  1VQ9 1;  3G4S Z;  1VQO 1;  2QEX 1;  3I55 Z;  3CPW Z;  1W2B Y;  1VQ8 Z;  3CCJ 1;  1VQ4 1;  1VQL Z;  1VQ7 1;  1YJ9 Z;  2QA4 Z;  1S72 1;  1VQN Z;  3I56 Z;  1YJW Z;  1VQ5 Z;  1VQP 1;  3CCM Z;  3CCV Z;  3CC4 Z;  1YHQ Z;  1YIT 1;  1KC8 2;  3CC2 Z;  3CC7 Z;  3OW2 Z;  1YIJ Z;  3G4S 1;  3G6E 1;  3CCS Z;  1Q7Y 1;  1M90 2;  3CCL 1;  3CCE Z;  1VQK 1;  3I55 1;  1YI2 1; 
#chains in the Genus database with same CATH topology
 2QLV B;  2K5R A;  3LUS A;  2JNY A;  1YJW 1;  1YJN Z;  3NDJ A;  3NH5 A;  4NBG A;  4E2W A;  1Z02 A;  4BY7 I;  2OTJ Z;  2QR1 B;  1Q86 2;  3CME 1;  3GKQ A;  1TFI A;  3FQM A;  4NBF A;  1X3Z A;  2LFU A;  4QTU A;  4A3F I;  2B63 I;  1RQF A;  3OW2 Y;  1VQM 1;  2RIQ A;  3F3F C;  1YIJ 1;  1Y1W I;  1TWG I;  2JA7 I;  3CCR Z;  4RVH A;  4MD8 A;  4E31 A;  3HOW I;  3VB9 A;  2E7Z A;  2V8K A;  2JIM A;  1VQO Z;  3HOU I;  1Z03 A;  1VQ8 1;  1K8A 2;  1M1K 1;  1I6H I;  3S2D I;  3I4N I;  1K9M 2;  1VQP Z;  3HOX I;  4MXU A;  1JJ2 Z;  3GCF A;  5IP7 I;  1KQS Z;  2YU9 I;  1K73 1;  2IZ4 A;  3NH4 A;  2HF1 A;  2P28 A;  1N8R 2;  1QVG Z;  3D6W A;  1YIT Z;  3GTO I;  2IV2 X;  2LIY A;  1Q7Y 2;  3CCS 1;  2NAP A;  3S14 I;  3CCE 1;  4X6A I;  1QF8 A;  2Y0S A;  5D1P A;  1VQ9 Z;  2QRD B;  2E9H A;  3GTJ I;  2DE7 A;  3S1N I;  3S1Q I;  1Z01 A;  4TNU A;  4A3C I;  2OOX B;  1JJ2 Y;  2G2K A;  1KQS Y;  3GTP I;  3CQZ I;  3FQQ A;  3CME Z;  1QVG Y;  1RNI A;  1VQM Z;  2V3V A;  1SFO I;  3M3Y I;  5D1O B;  2O53 A;  1R9T I;  3J80 b;  3I4M I;  3RZD I;  1USP B;  4MRI A;  2KPI A;  3NDI A;  3S15 I;  1RLY A;  4NBB A;  3G4S Z;  5C4J I;  3I55 Z;  3CPW Z;  1Y8C A;  1VQ8 Z;  4A3J I;  3RZO I;  2F4O A;  1VQ7 1;  2QA4 Z;  5CM2 M;  3I56 Z;  3CCV Z;  4RS4 A;  2KI7 B;  2IZ3 A;  4BY1 I;  2WAQ A;  5T64 A;  2VUM I;  4EWC A;  3IX0 A;  1KC8 2;  4BBS I;  3CC2 Z;  1FDI A;  3G6E 1;  3CCS Z;  1Q7Y 1;  2VPY A;  3CCE Z;  3IR7 A;  3MON A;  2GTI A;  4E2Z A;  5LL6 f;  4NFR A;  3FKI I;  4CL1 A;  2V8I A;  2GTH A;  2ZAE B;  1M1K 2;  3CXC Z;  3QWU A;  3U50 C;  1RO2 A;  2K3R A;  3P5J B;  1K73 2;  4A3E I;  3GTK I;  2Q51 A;  4A3K I;  5IT9 f;  2W03 A;  3GTM S;  2JS4 A;  2H85 A;  4A3G I;  4A3D I;  5T6B A;  3CXC Y;  1NP6 A;  3TDH B;  2VF1 A;  3CCM 1;  3JAM f;  3CD6 Z;  1JWH C;  1Y1V I;  3IFU A;  3CMA Z;  1QVF Z;  3J7A 4;  3CC7 1;  1KC8 1;  3T4N B;  1NJI 1;  3ESW A;  3G6E Z;  1RO4 A;  3S16 I;  1WZN A;  3GTG I;  1S7M A;  2R6M A;  2JIQ A;  1S72 Z;  3HKZ A;  2OTL 1;  1QVF Y;  2YAD A;  1TWF I;  5AN9 F;  3CCU 1;  3CCQ 1;  1AA6 A;  2M6N A;  1QXF A;  5FLM I;  3G71 1;  3PO3 S;  2AKL A;  4E30 A;  2PMZ A;  3IF8 A;  3EED A;  2DE5 A;  4NB8 A;  1Y1V S;  1VQ4 1;  4E2X A;  2E2H I;  1YJW Z;  3CCM Z;  1TWA I;  2EGT A;  4E32 A;  3KIF A;  4NH1 C;  4A3B I;  4BXX I;  1I50 I;  2WB1 A;  4HGZ A;  2E2I I;  3CC7 Z;  1YIJ Z;  3Q87 A;  1FDO A;  4NBD A;  3J81 f;  2QRE B;  1VQK 1;  1YI2 1;  1ZB8 A;  3VMI A;  2JIO A;  2V8J A;  2JIR A;  3GTM I;  4E2Y A;  3S2H I;  2NVT I;  1LQL A;  3KIH A;  1X0T A;  2VPX A;  1YHQ 1;  2OOY B;  3CCU Z;  3CCQ Z;  3M4O I;  4E33 A;  4S1T A;  2QKD A;  3G71 Z;  3HOZ I;  1M90 1;  1NJI 2;  3J81 b;  4Y7N I;  4NOZ A;  4MD9 A;  3CPW Y;  2R93 I;  1VQL 1;  1NUI A;  1ML8 A;  1VQ5 1;  2BJO A;  3MZK B;  3PO2 I;  3GTL I;  4HH4 A;  4DGL A;  3CC4 1;  5A2Q f;  1Q82 1;  3VMH A;  2F4M A;  1KD1 1;  4NBH A;  4DQY B;  3CCR 1;  1VLA A;  1TWH I;  2JMO A;  1DL6 A;  1VQK Z;  1YI2 Z;  1USP A;  3HOY I;  3S1M I;  5C44 I;  3PO3 I;  1VQ7 Z;  3HOV I;  5A2Q b;  1Q81 2;  2R92 I;  3D9X A;  1L1O C;  1Q16 A;  5T67 A;  5IT9 b;  3TE5 B;  4XX2 A;  1VQ9 1;  2M48 A;  2QEX 1;  2J6A A;  3CCJ 1;  1RO0 A;  1VQL Z;  5C3E I;  4A3M I;  3K7A I;  1VQ5 Z;  4AYB A;  1K83 I;  2VPW A;  5IP9 I;  1YUK A;  1X3W A;  3CC4 Z;  4RVF A;  4NB9 A;  2NVY I;  4HGY A;  3JAM b;  2E2J I;  3F3P C;  4Y52 I;  2LEX A;  5FLX f;  3MZL B;  3VMG A;  2Q4Z A;  3G4S 1;  1M90 2;  2I3C A;  3H0G I;  3CCL 1;  2AYD A;  3NFZ A;  3I55 1;  2QA4 1;  3I56 1;  2JA6 I;  3CCV 1;  2O4H A;  4A93 I;  1Q82 2;  1Q81 1;  2VPZ A;  3BG0 B;  1KD1 2;  2JA5 I;  4MON A;  3CC2 1;  3S17 I;  1VQ6 1;  5FLX b;  4BBR I;  2JR6 A;  2HU9 A;  1QYP A;  2RPR A;  3J80 f;  3S1R I;  2RHB A;  1PFT A;  2OZK A;  1P9N A;  2QEX Z;  2NVX I;  1I3Q I;  1YJ9 1;  3CCJ Z;  3BG1 B;  1VQN 1;  4A3I I;  2PK7 A;  1WJ2 A;  1Q86 1;  2OTL Z;  2GU2 A;  3GTQ I;  4A3L I;  4NBE A;  2RT9 A;  3CCL Z;  2JIP A;  2R7Z I;  1K8A 1;  2VUG A;  1WII A;  2JUB A;  1W2B Z;  1KRL A;  1YJN 1;  1VQ4 Z;  2NVQ I;  2QRC B;  2W04 A;  1K9M 1;  3CD6 1;  5C4X I;  2OTJ 1;  1ZH1 A;  2P3Y A;  3CMA 1;  1SIW A;  4QTT A;  1N8R 1;  1VQ6 Z;  3VTN A;  1WW9 A;  1VQO 1;  2JA8 I;  4NBC A;  5D1O A;  3H3V J;  4RVD A;  1W2B Y;  4MD7 A;  1YJ9 Z;  1YUA A;  3EER A;  4DK1 A;  1S72 1;  1VQN Z;  2DE6 A;  1VQP 1;  2RBL A;  2V45 A;  3NH8 A;  1YHQ Z;  3D2L A;  1WCM I;  3I07 A;  1TWC I;  1YIT 1;  3OW2 Z;  1ZB9 A;  2PM9 A;  1N2F A;  4RVG A;  4RV9 A;  4MH4 A;  4NBA A; 
#chains in the Genus database with same CATH homology
 2QLV B;  2K5R A;  3LUS A;  2JNY A;  1YJW 1;  1YJN Z;  3NDJ A;  3NH5 A;  4NBG A;  4E2W A;  1Z02 A;  4BY7 I;  2OTJ Z;  2QR1 B;  1Q86 2;  3CME 1;  3GKQ A;  1TFI A;  3FQM A;  4NBF A;  1X3Z A;  4A3F I;  2LFU A;  4QTU A;  2B63 I;  1RQF A;  3OW2 Y;  1VQM 1;  2RIQ A;  3F3F C;  1YIJ 1;  1Y1W I;  1TWG I;  2JA7 I;  3CCR Z;  4RVH A;  4MD8 A;  4E31 A;  3HOW I;  3VB9 A;  2V8K A;  1VQO Z;  3HOU I;  1Z03 A;  1VQ8 1;  1K8A 2;  1M1K 1;  1I6H I;  3S2D I;  3I4N I;  1K9M 2;  1VQP Z;  3HOX I;  4MXU A;  1JJ2 Z;  3GCF A;  5IP7 I;  1KQS Z;  2YU9 I;  1K73 1;  2IZ4 A;  3NH4 A;  2HF1 A;  2P28 A;  1N8R 2;  1QVG Z;  3D6W A;  1YIT Z;  3GTO I;  2LIY A;  1Q7Y 2;  3CCS 1;  3S14 I;  3CCE 1;  4X6A I;  1QF8 A;  2Y0S A;  5D1P A;  1VQ9 Z;  2QRD B;  2E9H A;  3GTJ I;  2DE7 A;  3S1N I;  3S1Q I;  1Z01 A;  4TNU A;  4A3C I;  2OOX B;  1JJ2 Y;  2G2K A;  1KQS Y;  3GTP I;  3CQZ I;  3FQQ A;  3CME Z;  1QVG Y;  1RNI A;  1VQM Z;  1SFO I;  3M3Y I;  5D1O B;  2O53 A;  1R9T I;  3J80 b;  3I4M I;  3RZD I;  1USP B;  4MRI A;  2KPI A;  3NDI A;  3S15 I;  1RLY A;  4NBB A;  3G4S Z;  5C4J I;  3I55 Z;  3CPW Z;  1VQ8 Z;  4A3J I;  3RZO I;  2F4O A;  1VQ7 1;  2QA4 Z;  5CM2 M;  3I56 Z;  3CCV Z;  4RS4 A;  2KI7 B;  2IZ3 A;  4BY1 I;  2WAQ A;  5T64 A;  2VUM I;  4EWC A;  3IX0 A;  1KC8 2;  4BBS I;  3CC2 Z;  1Q7Y 1;  3G6E 1;  3CCS Z;  3CCE Z;  3MON A;  2GTI A;  4E2Z A;  5LL6 f;  4NFR A;  3FKI I;  4CL1 A;  2V8I A;  2GTH A;  2ZAE B;  1M1K 2;  3CXC Z;  3QWU A;  3U50 C;  1RO2 A;  2K3R A;  3P5J B;  1K73 2;  4A3E I;  3GTK I;  2Q51 A;  4A3K I;  5IT9 f;  2W03 A;  3GTM S;  2JS4 A;  2H85 A;  4A3G I;  4A3D I;  5T6B A;  3CXC Y;  1NP6 A;  3TDH B;  2VF1 A;  3CCM 1;  3JAM f;  3CD6 Z;  1JWH C;  1Y1V I;  3IFU A;  3CMA Z;  1QVF Z;  3J7A 4;  3CC7 1;  1KC8 1;  3T4N B;  1NJI 1;  3ESW A;  3G6E Z;  1RO4 A;  3S16 I;  3GTG I;  1S7M A;  2R6M A;  1S72 Z;  3HKZ A;  2OTL 1;  1QVF Y;  2YAD A;  1TWF I;  5AN9 F;  3CCU 1;  3CCQ 1;  2M6N A;  3G71 1;  5FLM I;  3PO3 S;  2AKL A;  4E30 A;  2PMZ A;  3IF8 A;  3EED A;  2DE5 A;  4NB8 A;  1Y1V S;  1VQ4 1;  4E2X A;  2E2H I;  1YJW Z;  3CCM Z;  1TWA I;  2EGT A;  4E32 A;  3KIF A;  4NH1 C;  4A3B I;  4BXX I;  1I50 I;  2WB1 A;  4HGZ A;  2E2I I;  3CC7 Z;  1YIJ Z;  3Q87 A;  4NBD A;  3J81 f;  2QRE B;  1VQK 1;  1YI2 1;  1ZB8 A;  3VMI A;  2V8J A;  3GTM I;  4E2Y A;  3S2H I;  2NVT I;  1LQL A;  3KIH A;  1X0T A;  1YHQ 1;  2OOY B;  3CCU Z;  3CCQ Z;  3M4O I;  4E33 A;  4S1T A;  2QKD A;  3G71 Z;  3HOZ I;  1M90 1;  1NJI 2;  3J81 b;  4Y7N I;  4NOZ A;  4MD9 A;  3CPW Y;  2R93 I;  1VQL 1;  1NUI A;  1ML8 A;  1VQ5 1;  2BJO A;  3MZK B;  3PO2 I;  3GTL I;  4HH4 A;  4DGL A;  3CC4 1;  5A2Q f;  1Q82 1;  3VMH A;  2F4M A;  1KD1 1;  4NBH A;  4DQY B;  3CCR 1;  1VLA A;  1TWH I;  2JMO A;  1DL6 A;  1VQK Z;  1YI2 Z;  1USP A;  3HOY I;  3S1M I;  5C44 I;  3PO3 I;  1VQ7 Z;  3HOV I;  5A2Q b;  1Q81 2;  2R92 I;  3D9X A;  1L1O C;  5T67 A;  5IT9 b;  3TE5 B;  4XX2 A;  1VQ9 1;  2M48 A;  2QEX 1;  2J6A A;  3CCJ 1;  1RO0 A;  1VQL Z;  5C3E I;  4A3M I;  3K7A I;  1VQ5 Z;  4AYB A;  1K83 I;  5IP9 I;  1YUK A;  1X3W A;  3CC4 Z;  4RVF A;  4NB9 A;  2NVY I;  4HGY A;  3JAM b;  2E2J I;  3F3P C;  4Y52 I;  5FLX f;  3MZL B;  3VMG A;  2Q4Z A;  3G4S 1;  1M90 2;  2I3C A;  3H0G I;  3CCL 1;  3NFZ A;  3I55 1;  2QA4 1;  3I56 1;  2JA6 I;  3CCV 1;  2O4H A;  4A93 I;  1Q82 2;  1Q81 1;  3BG0 B;  1KD1 2;  2JA5 I;  4MON A;  3CC2 1;  3S17 I;  1VQ6 1;  5FLX b;  4BBR I;  2JR6 A;  2HU9 A;  1QYP A;  2RPR A;  3J80 f;  3S1R I;  2RHB A;  1PFT A;  2OZK A;  1P9N A;  2QEX Z;  2NVX I;  1I3Q I;  1YJ9 1;  3CCJ Z;  3BG1 B;  1VQN 1;  4A3I I;  2PK7 A;  1Q86 1;  2OTL Z;  2GU2 A;  3GTQ I;  4A3L I;  4NBE A;  2RT9 A;  3CCL Z;  2R7Z I;  1K8A 1;  2VUG A;  1WII A;  2JUB A;  1W2B Z;  1KRL A;  1YJN 1;  1VQ4 Z;  2NVQ I;  2QRC B;  2W04 A;  1K9M 1;  3CD6 1;  5C4X I;  2OTJ 1;  1ZH1 A;  2P3Y A;  3CMA 1;  4QTT A;  1N8R 1;  1VQ6 Z;  3VTN A;  1WW9 A;  1VQO 1;  2JA8 I;  4NBC A;  5D1O A;  3H3V J;  4RVD A;  1W2B Y;  4MD7 A;  1YJ9 Z;  1YUA A;  3EER A;  4DK1 A;  1S72 1;  1VQN Z;  2DE6 A;  1VQP 1;  2RBL A;  3NH8 A;  1YHQ Z;  1WCM I;  3I07 A;  1TWC I;  1YIT 1;  3OW2 Z;  1ZB9 A;  2PM9 A;  1N2F A;  4RVG A;  4RV9 A;  4MH4 A;  4NBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...