1YJNZ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjnZ00
1M1K2 1VQMZ 1VQLZ 1YJ9Z 1YI2Z 3CCE1 1KD12 1VQ41 1VQ81 3G6E1 3CD61 3G711 1QVFZ 1VQNZ 1KD11 1YIT1 3CPWZ 1VQ5Z 3CXCY 1K8A2 3CC7Z 3CCJ1 1Q811 1QVGZ 3CME1 1S721 1Q822 1YJ91 1Q812 3I551 3OW2Y 3CC4Z 3CCMZ 1VQ91 1YHQ1 1Q821 1QVFY 3CC41 1VQP1 3I561 3CMAZ 2OTLZ 3CMEZ 1S72Z 3CC2Z 3OW2Z 3CCU1 1VQK1 1YHQZ 1YITZ 3I55Z 1VQN1 2QEXZ 1VQ61 3CC71 1VQ8Z 1VQ51 1Q862 3CCM1 1KC81 1NJI2 1YIJZ 3CXCZ 1NJI1 1VQ4Z 1KC82 3CCRZ 3CCEZ 1VQ6Z 1YI21 1YIJ1 2QA4Z 1VQ7Z 1Q7Y1 1W2BY 3G71Z 3CCQ1 1K9M2 1Q7Y2 3CD6Z 1KQSY 1VQKZ 1K732 3CCR1 1YJW1 1K9M1 1M902 3CCVZ 1K731 2QEX1 3CCLZ 1VQM1 3CCS1 1VQL1 2OTJZ 1YJNZ 1Q861 1VQO1 1YJN1 1KQSZ 3CC21 3G4SZ 2OTJ1 1JJ2Z 3I56Z 2OTL1 3CMA1 3CCJZ 1VQOZ 3CCUZ 1M901 1W2BZ 1K8A1 3CCQZ 3CCL1 3CCSZ 1VQ9Z 1N8R2 3CPWY 2QA41 1VQ71 1JJ2Y 1VQPZ 3G4S1 3G6EZ 1QVGY 1YJWZ 3CCV1 1M1K1 1N8R1
chains in the Genus database with same CATH superfamily
1Y8CA 1QYPA 1ZH1A 2LFUA 2RT9A 1VQMZ 2M6NA 1YI2Z 2WAQA 4A3BI 4HGYA 1VQ41 1VQ81 3NH5A 3FKII 3S16I 4NBFA 3CXCY 4A3KI 1K8A2 2JR6A 3CCJ1 2RPRA 3CME1 1Q812 4DK1A 3H0GI 3CCMZ 1YHQ1 1Y1VS 1X0TA 2OZKA 5CM2M 3F3PC 2QRDB 1FDIA 5IP9I 2DE7A 2KPIA 3I561 3S1RI 3OW2Z 1WZNA 3GTPI 3J80f 2V8IA 4A3GI 2ZAEB 1WJ2A 4E2ZA 1VQ61 1NP6A 2V8KA 1Q862 3J81f 1KC81 3PO3S 4RVDA 3IF8A 1NJI1 1KC82 3S2HI 2VPZA 1YI21 4RVHA 1TWHI 1RO2A 2P28A 2RHBA 2E2HI 3CCQ1 3HOVI 3GTLI 2E7ZA 2QRCB 4NH1C 1YJW1 1K9M1 1M902 2JA5I 2M48A 4A3JI 3CCVZ 5FLXf 3Q87A 2QEX1 4RVGA 3CCLZ 1TWAI 2JA8I 1SIWA 1DL6A 4BY1I 1YJN1 2E9HA 2VF1A 1JJ2Z 4BBSI 3I56Z 3QWUA 4E2XA 3CMA1 3CCJZ 3S17I 2LIYA 5A2Qf 3J7A4 4MXUA 2K3RA 3CCL1 2QA41 3GKQA 2HU9A 3S1QI 1M1K1 4S1TA 1QVGY 5D1OA 4NBEA 5FLXb 4EWCA 2OOYB 1Y1VI 2VPXA 5AN9F 3S2DI 2Q4ZA 3CCE1 4QTUA 4Y52I 2F4MA 3CD61 3G711 1KD11 4Y7NI 4NB9A 3CPWZ 2GTIA 1R9TI 1VQ5Z 1Q811 1QVGZ 4NBCA 4A3MI 3S1NI 2GTHA 3OW2Y 3NDJA 1KRLA 1VQ91 4QTTA 1VLAA 1QF8A 3PO3I 4RS4A 3CC41 1VQP1 4RVFA 3NDIA 2R7ZI 2AYDA 4A93I 3CCU1 1VQK1 3F3FC 4RV9A 2V8JA 1YHQZ 5C3EI 1YITZ 3TDHB 3CQZI 3GTMS 2W03A 3CC71 5IT9f 2NAPA 1NJI2 3I4MI 4A3LI 3CCRZ 1USPA 1VQ6Z 2JA7I 2JS4A 2H85A 5C44I 3VMGA 1Q7Y1 1Q16A 1X3WA 1W2BY 3EERA 3NFZA 2VPYA 1K9M2 1Q7Y2 3CD6Z 3MONA 1VQKZ 5IP7I 5D1OB 2DE5A 1VQL1 1ZB9A 4HH4A 4MD8A 2R92I 2O53A 5D1PA 3G4SZ 1RLYA 4HGZA 1TWFI 2VPWA 1RO0A 3CCUZ 1W2BZ 1K8A1 1Z03A 3CCQZ 2YU9I 1VQ9Z 1N8R2 3J80b 4BXXI 4A3FI 2Y0SA 3G6EZ 3CCV1 4X6AI 4E2WA 1S7MA 4E33A 4AYBA 1N8R1 3TE5B 1M1K2 1VQLZ 2JNYA 2P3YA 1YJ9Z 3P5JB 2W04A 1KD12 3ESWA 1LQLA 4E32A 2B63I 3S14I 2BJOA 4A3DI 2O4HA 4TNUA 3D2LA 2RBLA 1YJ91 2EGTA 3CC4Z 1RO4A 2LEXA 1Q821 1QVFY 3JAMf 3IX0A 2NVTI 2NVYI 1RNIA 3IR7A 1S72Z 3HOZI 4MD7A 1I3QI 4NBDA 5C4JI 2QEXZ 2OOXB 2AKLA 3IFUA 1VQ8Z 4E30A 1WCMI 1VQ51 3CCM1 2V3VA 3S1MI 1FDOA 1ML8A 3EEDA 3GTOI 1I50I 2Q51A 1X3ZA 1VQ4Z 3I4NI 3VB9A 2PM9A 3CCEZ 1YIJ1 1VQ7Z 3G71Z 1USPB 1PFTA 4NBGA 2PMZA 1K732 3KIFA 3KIHA 1K731 3GTKI 3CCS1 3K7AI 3GTGI 4DGLA 1AA6A 1VQO1 2HF1A 1KQSZ 3CC21 2OTJ1 3M3YI 2IZ4A 4MONA 3FQQA 3HOWI 1VQOZ 1M901 3HOUI 2R93I 3D6WA 3CCSZ 3BG0B 2JIRA 1N2FA 2G2KA 1VQPZ 3G4S1 1YJWZ 1WW9A 3RZDI 2QREB 2K5RA 3MZKB 1YUKA 5LL6f 4XX2A 3VMIA 2VUGA 2YADA 3M4OI 3JAMb 5C4XI 2NVQI 4MH4A 3MZLB 3I07A 3PO2I 3G6E1 5A2Qb 1K83I 1QVFZ 4DQYB 4E2YA 1VQNZ 1YIT1 3S15I 1WIIA 2JUBA 3CC7Z 3NH4A 1S721 1Q822 3H3VJ 3I551 2E2JI 2RIQA 4MRIA 1JWHC 4A3EI 1TFIA 3HOYI 2VUMI 2IV2X 1RQFA 3GTQI 4MD9A 3CMAZ 1SFOI 2QR1B 2OTLZ 3CMEZ 3CC2Z 2PK7A 3HKZA 1TWGI 3GTJI 2JMOA 1Z01A 3VTNA 3I55Z 1VQN1 4A3CI 3GTMI 4BY7I 4A3II 1Y1WI 4NBBA 1P9NA 2JIQA 3D9XA 3NH8A 2KI7B 4NOZA 1YIJZ 3CXCZ 3GCFA 4CL1A 1NUIA 5FLMI 2I3CA 3T4NB 2QA4Z 2QLVB 1QXFA 2QKDA 2WB1A 1KQSY 4NBAA 5T6BA 2IZ3A 3CCR1 5T67A 3LUSA 1ZB8A 2NVXI 1VQM1 2JIPA 3FQMA 2OTJZ 1YJNZ 2JA6I 1Q861 1TWCI 4NFRA 2GU2A 3RZOI 3J81b 2V45A 1Z02A 2OTL1 3HOXI 3U50C 1L1OC 2E2II 1I6HI 4BBRI 4NBHA 1YUAA 5T64A 2JIOA 3CPWY 2R6MA 1VQ71 4E31A 2J6AA 4NB8A 1JJ2Y 3VMHA 2JIMA 3BG1B 2DE6A 5IT9b 2F4OA
chains in the Genus database with same CATH topology
1QYPA 1ZH1A 2LFUA 2RT9A 1VQMZ 2M6NA 1YI2Z 2WAQA 4A3BI 4HGYA 1VQ41 1VQ81 3NH5A 3FKII 3S16I 4NBFA 3CXCY 4A3KI 1K8A2 2JR6A 3CCJ1 2RPRA 3CME1 1Q812 4DK1A 3H0GI 3CCMZ 1YHQ1 1Y1VS 1X0TA 2OZKA 5CM2M 3F3PC 2QRDB 5IP9I 2DE7A 2KPIA 3I561 3S1RI 3OW2Z 3GTPI 3J80f 2V8IA 4A3GI 2ZAEB 4E2ZA 1VQ61 1NP6A 2V8KA 1Q862 3J81f 1KC81 3PO3S 4RVDA 3IF8A 1NJI1 1KC82 3S2HI 1YI21 4RVHA 1TWHI 1RO2A 2P28A 2RHBA 2E2HI 3CCQ1 3HOVI 3GTLI 2QRCB 4NH1C 1YJW1 1K9M1 1M902 2JA5I 2M48A 4A3JI 3CCVZ 5FLXf 3Q87A 2QEX1 4RVGA 3CCLZ 1TWAI 2JA8I 1DL6A 4BY1I 1YJN1 2E9HA 2VF1A 1JJ2Z 4BBSI 3I56Z 3QWUA 4E2XA 3CMA1 3CCJZ 3S17I 2LIYA 5A2Qf 3J7A4 4MXUA 2K3RA 3CCL1 2QA41 3GKQA 2HU9A 3S1QI 1M1K1 1QVGY 4S1TA 5D1OA 4NBEA 5FLXb 4EWCA 2OOYB 1Y1VI 5AN9F 3S2DI 2Q4ZA 3CCE1 4QTUA 4Y52I 2F4MA 3CD61 3G711 1KD11 4Y7NI 4NB9A 3CPWZ 2GTIA 1R9TI 1VQ5Z 1Q811 1QVGZ 4NBCA 4A3MI 3S1NI 2GTHA 3OW2Y 3NDJA 1KRLA 1VQ91 4QTTA 1VLAA 1QF8A 3PO3I 4RS4A 3CC41 1VQP1 4RVFA 3NDIA 2R7ZI 4A93I 3CCU1 1VQK1 3F3FC 4RV9A 2V8JA 1YHQZ 5C3EI 1YITZ 3TDHB 3CQZI 3GTMS 2W03A 3CC71 5IT9f 1NJI2 3I4MI 4A3LI 3CCRZ 1USPA 1VQ6Z 2JA7I 2JS4A 2H85A 5C44I 3VMGA 1Q7Y1 1X3WA 1W2BY 3EERA 3NFZA 1K9M2 1Q7Y2 3CD6Z 3MONA 1VQKZ 5IP7I 5D1OB 2DE5A 1VQL1 1ZB9A 4HH4A 4MD8A 2R92I 2O53A 5D1PA 3G4SZ 1RLYA 4HGZA 1TWFI 1RO0A 3CCUZ 1W2BZ 1K8A1 1Z03A 3CCQZ 2YU9I 1VQ9Z 1N8R2 3J80b 4BXXI 4A3FI 2Y0SA 3G6EZ 3CCV1 4X6AI 4E2WA 1S7MA 4E33A 4AYBA 1N8R1 3TE5B 1M1K2 1VQLZ 2JNYA 2P3YA 1YJ9Z 3P5JB 2W04A 1KD12 3ESWA 1LQLA 4E32A 2B63I 3S14I 2BJOA 4A3DI 2O4HA 4TNUA 2RBLA 1YJ91 2EGTA 3CC4Z 1RO4A 1Q821 1QVFY 3JAMf 3IX0A 2NVTI 2NVYI 1RNIA 1S72Z 3HOZI 4MD7A 1I3QI 4NBDA 5C4JI 2QEXZ 2OOXB 2AKLA 3IFUA 1VQ8Z 4E30A 1WCMI 1VQ51 3CCM1 3S1MI 1ML8A 3EEDA 3GTOI 1I50I 2Q51A 1X3ZA 1VQ4Z 3I4NI 3VB9A 2PM9A 3CCEZ 1YIJ1 1VQ7Z 3G71Z 1USPB 1PFTA 4NBGA 2PMZA 1K732 3KIFA 3KIHA 1K731 3GTKI 3CCS1 3K7AI 3GTGI 4DGLA 1VQO1 2HF1A 1KQSZ 3CC21 2OTJ1 3M3YI 2IZ4A 4MONA 3FQQA 3HOWI 1VQOZ 1M901 3HOUI 2R93I 3D6WA 3CCSZ 3BG0B 1N2FA 2G2KA 1VQPZ 3G4S1 1YJWZ 1WW9A 3RZDI 2QREB 2K5RA 3MZKB 1YUKA 5LL6f 4XX2A 3VMIA 2VUGA 2YADA 3M4OI 3JAMb 5C4XI 2NVQI 4MH4A 3MZLB 3I07A 3PO2I 3G6E1 5A2Qb 1K83I 1QVFZ 4DQYB 4E2YA 1VQNZ 1YIT1 3S15I 1WIIA 2JUBA 3CC7Z 3NH4A 1S721 1Q822 3H3VJ 3I551 2E2JI 2RIQA 4MRIA 1JWHC 4A3EI 1TFIA 3HOYI 2VUMI 1RQFA 3GTQI 4MD9A 3CMAZ 1SFOI 2QR1B 2OTLZ 3CMEZ 3CC2Z 2PK7A 3HKZA 1TWGI 3GTJI 2JMOA 1Z01A 3VTNA 3I55Z 1VQN1 4A3CI 3GTMI 4BY7I 4A3II 1Y1WI 4NBBA 1P9NA 3D9XA 3NH8A 2KI7B 4NOZA 1YIJZ 3CXCZ 3GCFA 4CL1A 1NUIA 5FLMI 2I3CA 3T4NB 2QA4Z 2QLVB 2QKDA 2WB1A 1KQSY 4NBAA 5T6BA 2IZ3A 3CCR1 5T67A 3LUSA 1ZB8A 2NVXI 1VQM1 3FQMA 2OTJZ 1YJNZ 2JA6I 1Q861 1TWCI 4NFRA 2GU2A 3RZOI 3J81b 1Z02A 2OTL1 3HOXI 3U50C 1L1OC 2E2II 1I6HI 4BBRI 4NBHA 1YUAA 5T64A 3CPWY 2R6MA 1VQ71 4E31A 2J6AA 4NB8A 1JJ2Y 3VMHA 3BG1B 2DE6A 5IT9b 2F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 2;  1VQM Z;  1VQL Z;  1YJ9 Z;  1YI2 Z;  3CCE 1;  1KD1 2;  1VQ4 1;  1VQ8 1;  3G6E 1;  3CD6 1;  3G71 1;  1QVF Z;  1VQN Z;  1KD1 1;  1YIT 1;  3CPW Z;  1VQ5 Z;  3CXC Y;  1K8A 2;  3CC7 Z;  3CCJ 1;  1Q81 1;  1QVG Z;  3CME 1;  1S72 1;  1Q82 2;  1YJ9 1;  1Q81 2;  3I55 1;  3OW2 Y;  3CC4 Z;  3CCM Z;  1VQ9 1;  1YHQ 1;  1Q82 1;  1QVF Y;  3CC4 1;  1VQP 1;  3I56 1;  3CMA Z;  2OTL Z;  3CME Z;  1S72 Z;  3CC2 Z;  3OW2 Z;  3CCU 1;  1VQK 1;  1YHQ Z;  1YIT Z;  3I55 Z;  1VQN 1;  2QEX Z;  1VQ6 1;  3CC7 1;  1VQ8 Z;  1VQ5 1;  1Q86 2;  3CCM 1;  1KC8 1;  1NJI 2;  1YIJ Z;  3CXC Z;  1NJI 1;  1VQ4 Z;  1KC8 2;  3CCR Z;  3CCE Z;  1VQ6 Z;  1YI2 1;  1YIJ 1;  2QA4 Z;  1VQ7 Z;  1Q7Y 1;  1W2B Y;  3G71 Z;  3CCQ 1;  1K9M 2;  1Q7Y 2;  3CD6 Z;  1KQS Y;  1VQK Z;  1K73 2;  3CCR 1;  1YJW 1;  1K9M 1;  1M90 2;  3CCV Z;  1K73 1;  2QEX 1;  3CCL Z;  1VQM 1;  3CCS 1;  1VQL 1;  2OTJ Z;  1YJN Z;  1Q86 1;  1VQO 1;  1YJN 1;  1KQS Z;  3CC2 1;  3G4S Z;  2OTJ 1;  1JJ2 Z;  3I56 Z;  2OTL 1;  3CMA 1;  3CCJ Z;  1VQO Z;  3CCU Z;  1M90 1;  1W2B Z;  1K8A 1;  3CCQ Z;  3CCL 1;  3CCS Z;  1VQ9 Z;  1N8R 2;  3CPW Y;  2QA4 1;  1VQ7 1;  1JJ2 Y;  1VQP Z;  3G4S 1;  3G6E Z;  1QVG Y;  1YJW Z;  3CCV 1;  1M1K 1;  1N8R 1; 
#chains in the Genus database with same CATH topology
 1Y8C A;  1QYP A;  1ZH1 A;  2LFU A;  2RT9 A;  1VQM Z;  2M6N A;  1YI2 Z;  2WAQ A;  4A3B I;  4HGY A;  1VQ4 1;  1VQ8 1;  3NH5 A;  3FKI I;  3S16 I;  4NBF A;  3CXC Y;  4A3K I;  1K8A 2;  2JR6 A;  3CCJ 1;  2RPR A;  3CME 1;  1Q81 2;  4DK1 A;  3H0G I;  3CCM Z;  1YHQ 1;  1Y1V S;  1X0T A;  2OZK A;  5CM2 M;  3F3P C;  2QRD B;  1FDI A;  5IP9 I;  2DE7 A;  2KPI A;  3I56 1;  3S1R I;  3OW2 Z;  1WZN A;  3GTP I;  3J80 f;  2V8I A;  4A3G I;  2ZAE B;  1WJ2 A;  4E2Z A;  1VQ6 1;  1NP6 A;  2V8K A;  1Q86 2;  3J81 f;  1KC8 1;  3PO3 S;  4RVD A;  3IF8 A;  1NJI 1;  1KC8 2;  3S2H I;  2VPZ A;  1YI2 1;  4RVH A;  1TWH I;  1RO2 A;  2P28 A;  2RHB A;  2E2H I;  3CCQ 1;  3HOV I;  3GTL I;  2E7Z A;  2QRC B;  4NH1 C;  1YJW 1;  1K9M 1;  1M90 2;  2JA5 I;  2M48 A;  4A3J I;  3CCV Z;  5FLX f;  3Q87 A;  2QEX 1;  4RVG A;  3CCL Z;  1TWA I;  2JA8 I;  1SIW A;  1DL6 A;  4BY1 I;  1YJN 1;  2E9H A;  2VF1 A;  1JJ2 Z;  4BBS I;  3I56 Z;  3QWU A;  4E2X A;  3CMA 1;  3CCJ Z;  3S17 I;  2LIY A;  5A2Q f;  3J7A 4;  4MXU A;  2K3R A;  3CCL 1;  2QA4 1;  3GKQ A;  2HU9 A;  3S1Q I;  1M1K 1;  4S1T A;  1QVG Y;  5D1O A;  4NBE A;  5FLX b;  4EWC A;  2OOY B;  1Y1V I;  2VPX A;  5AN9 F;  3S2D I;  2Q4Z A;  3CCE 1;  4QTU A;  4Y52 I;  2F4M A;  3CD6 1;  3G71 1;  1KD1 1;  4Y7N I;  4NB9 A;  3CPW Z;  2GTI A;  1R9T I;  1VQ5 Z;  1Q81 1;  1QVG Z;  4NBC A;  4A3M I;  3S1N I;  2GTH A;  3OW2 Y;  3NDJ A;  1KRL A;  1VQ9 1;  4QTT A;  1VLA A;  1QF8 A;  3PO3 I;  4RS4 A;  3CC4 1;  1VQP 1;  4RVF A;  3NDI A;  2R7Z I;  2AYD A;  4A93 I;  3CCU 1;  1VQK 1;  3F3F C;  4RV9 A;  2V8J A;  1YHQ Z;  5C3E I;  1YIT Z;  3TDH B;  3CQZ I;  3GTM S;  2W03 A;  3CC7 1;  5IT9 f;  2NAP A;  1NJI 2;  3I4M I;  4A3L I;  3CCR Z;  1USP A;  1VQ6 Z;  2JA7 I;  2JS4 A;  2H85 A;  5C44 I;  3VMG A;  1Q7Y 1;  1Q16 A;  1X3W A;  1W2B Y;  3EER A;  3NFZ A;  2VPY A;  1K9M 2;  1Q7Y 2;  3CD6 Z;  3MON A;  1VQK Z;  5IP7 I;  5D1O B;  2DE5 A;  1VQL 1;  1ZB9 A;  4HH4 A;  4MD8 A;  2R92 I;  2O53 A;  5D1P A;  3G4S Z;  1RLY A;  4HGZ A;  1TWF I;  2VPW A;  1RO0 A;  3CCU Z;  1W2B Z;  1K8A 1;  1Z03 A;  3CCQ Z;  2YU9 I;  1VQ9 Z;  1N8R 2;  3J80 b;  4BXX I;  4A3F I;  2Y0S A;  3G6E Z;  3CCV 1;  4X6A I;  4E2W A;  1S7M A;  4E33 A;  4AYB A;  1N8R 1;  3TE5 B;  1M1K 2;  1VQL Z;  2JNY A;  2P3Y A;  1YJ9 Z;  3P5J B;  2W04 A;  1KD1 2;  3ESW A;  1LQL A;  4E32 A;  2B63 I;  3S14 I;  2BJO A;  4A3D I;  2O4H A;  4TNU A;  3D2L A;  2RBL A;  1YJ9 1;  2EGT A;  3CC4 Z;  1RO4 A;  2LEX A;  1Q82 1;  1QVF Y;  3JAM f;  3IX0 A;  2NVT I;  2NVY I;  1RNI A;  3IR7 A;  1S72 Z;  3HOZ I;  4MD7 A;  1I3Q I;  4NBD A;  5C4J I;  2QEX Z;  2OOX B;  2AKL A;  3IFU A;  1VQ8 Z;  4E30 A;  1WCM I;  1VQ5 1;  3CCM 1;  2V3V A;  3S1M I;  1FDO A;  1ML8 A;  3EED A;  3GTO I;  1I50 I;  2Q51 A;  1X3Z A;  1VQ4 Z;  3I4N I;  3VB9 A;  2PM9 A;  3CCE Z;  1YIJ 1;  1VQ7 Z;  3G71 Z;  1USP B;  1PFT A;  4NBG A;  2PMZ A;  1K73 2;  3KIF A;  3KIH A;  1K73 1;  3GTK I;  3CCS 1;  3K7A I;  3GTG I;  4DGL A;  1AA6 A;  1VQO 1;  2HF1 A;  1KQS Z;  3CC2 1;  2OTJ 1;  3M3Y I;  2IZ4 A;  4MON A;  3FQQ A;  3HOW I;  1VQO Z;  1M90 1;  3HOU I;  2R93 I;  3D6W A;  3CCS Z;  3BG0 B;  2JIR A;  1N2F A;  2G2K A;  1VQP Z;  3G4S 1;  1YJW Z;  1WW9 A;  3RZD I;  2QRE B;  2K5R A;  3MZK B;  1YUK A;  5LL6 f;  4XX2 A;  3VMI A;  2VUG A;  2YAD A;  3M4O I;  3JAM b;  5C4X I;  2NVQ I;  4MH4 A;  3MZL B;  3I07 A;  3PO2 I;  3G6E 1;  5A2Q b;  1K83 I;  1QVF Z;  4DQY B;  4E2Y A;  1VQN Z;  1YIT 1;  3S15 I;  1WII A;  2JUB A;  3CC7 Z;  3NH4 A;  1S72 1;  1Q82 2;  3H3V J;  3I55 1;  2E2J I;  2RIQ A;  4MRI A;  1JWH C;  4A3E I;  1TFI A;  3HOY I;  2VUM I;  2IV2 X;  1RQF A;  3GTQ I;  4MD9 A;  3CMA Z;  1SFO I;  2QR1 B;  2OTL Z;  3CME Z;  3CC2 Z;  2PK7 A;  3HKZ A;  1TWG I;  3GTJ I;  2JMO A;  1Z01 A;  3VTN A;  3I55 Z;  1VQN 1;  4A3C I;  3GTM I;  4BY7 I;  4A3I I;  1Y1W I;  4NBB A;  1P9N A;  2JIQ A;  3D9X A;  3NH8 A;  2KI7 B;  4NOZ A;  1YIJ Z;  3CXC Z;  3GCF A;  4CL1 A;  1NUI A;  5FLM I;  2I3C A;  3T4N B;  2QA4 Z;  2QLV B;  1QXF A;  2QKD A;  2WB1 A;  1KQS Y;  4NBA A;  5T6B A;  2IZ3 A;  3CCR 1;  5T67 A;  3LUS A;  1ZB8 A;  2NVX I;  1VQM 1;  2JIP A;  3FQM A;  2OTJ Z;  1YJN Z;  2JA6 I;  1Q86 1;  1TWC I;  4NFR A;  2GU2 A;  3RZO I;  3J81 b;  2V45 A;  1Z02 A;  2OTL 1;  3HOX I;  3U50 C;  1L1O C;  2E2I I;  1I6H I;  4BBR I;  4NBH A;  1YUA A;  5T64 A;  2JIO A;  3CPW Y;  2R6M A;  1VQ7 1;  4E31 A;  2J6A A;  4NB8 A;  1JJ2 Y;  3VMH A;  2JIM A;  3BG1 B;  2DE6 A;  5IT9 b;  2F4O A; 
#chains in the Genus database with same CATH homology
 1QYP A;  1ZH1 A;  2LFU A;  2RT9 A;  1VQM Z;  2M6N A;  1YI2 Z;  2WAQ A;  4A3B I;  4HGY A;  1VQ4 1;  1VQ8 1;  3NH5 A;  3FKI I;  3S16 I;  4NBF A;  3CXC Y;  4A3K I;  1K8A 2;  2JR6 A;  3CCJ 1;  2RPR A;  3CME 1;  1Q81 2;  4DK1 A;  3H0G I;  3CCM Z;  1YHQ 1;  1Y1V S;  1X0T A;  2OZK A;  5CM2 M;  3F3P C;  2QRD B;  5IP9 I;  2DE7 A;  2KPI A;  3I56 1;  3S1R I;  3OW2 Z;  3GTP I;  3J80 f;  2V8I A;  4A3G I;  2ZAE B;  4E2Z A;  1VQ6 1;  1NP6 A;  2V8K A;  1Q86 2;  3J81 f;  1KC8 1;  3PO3 S;  4RVD A;  3IF8 A;  1NJI 1;  1KC8 2;  3S2H I;  1YI2 1;  4RVH A;  1TWH I;  1RO2 A;  2P28 A;  2RHB A;  2E2H I;  3CCQ 1;  3HOV I;  3GTL I;  2QRC B;  4NH1 C;  1YJW 1;  1K9M 1;  1M90 2;  2JA5 I;  2M48 A;  4A3J I;  3CCV Z;  5FLX f;  3Q87 A;  2QEX 1;  4RVG A;  3CCL Z;  1TWA I;  2JA8 I;  1DL6 A;  4BY1 I;  1YJN 1;  2E9H A;  2VF1 A;  1JJ2 Z;  4BBS I;  3I56 Z;  3QWU A;  4E2X A;  3CMA 1;  3CCJ Z;  3S17 I;  2LIY A;  5A2Q f;  3J7A 4;  4MXU A;  2K3R A;  3CCL 1;  2QA4 1;  3GKQ A;  2HU9 A;  3S1Q I;  1M1K 1;  1QVG Y;  4S1T A;  5D1O A;  4NBE A;  5FLX b;  4EWC A;  2OOY B;  1Y1V I;  5AN9 F;  3S2D I;  2Q4Z A;  3CCE 1;  4QTU A;  4Y52 I;  2F4M A;  3CD6 1;  3G71 1;  1KD1 1;  4Y7N I;  4NB9 A;  3CPW Z;  2GTI A;  1R9T I;  1VQ5 Z;  1Q81 1;  1QVG Z;  4NBC A;  4A3M I;  3S1N I;  2GTH A;  3OW2 Y;  3NDJ A;  1KRL A;  1VQ9 1;  4QTT A;  1VLA A;  1QF8 A;  3PO3 I;  4RS4 A;  3CC4 1;  1VQP 1;  4RVF A;  3NDI A;  2R7Z I;  4A93 I;  3CCU 1;  1VQK 1;  3F3F C;  4RV9 A;  2V8J A;  1YHQ Z;  5C3E I;  1YIT Z;  3TDH B;  3CQZ I;  3GTM S;  2W03 A;  3CC7 1;  5IT9 f;  1NJI 2;  3I4M I;  4A3L I;  3CCR Z;  1USP A;  1VQ6 Z;  2JA7 I;  2JS4 A;  2H85 A;  5C44 I;  3VMG A;  1Q7Y 1;  1X3W A;  1W2B Y;  3EER A;  3NFZ A;  1K9M 2;  1Q7Y 2;  3CD6 Z;  3MON A;  1VQK Z;  5IP7 I;  5D1O B;  2DE5 A;  1VQL 1;  1ZB9 A;  4HH4 A;  4MD8 A;  2R92 I;  2O53 A;  5D1P A;  3G4S Z;  1RLY A;  4HGZ A;  1TWF I;  1RO0 A;  3CCU Z;  1W2B Z;  1K8A 1;  1Z03 A;  3CCQ Z;  2YU9 I;  1VQ9 Z;  1N8R 2;  3J80 b;  4BXX I;  4A3F I;  2Y0S A;  3G6E Z;  3CCV 1;  4X6A I;  4E2W A;  1S7M A;  4E33 A;  4AYB A;  1N8R 1;  3TE5 B;  1M1K 2;  1VQL Z;  2JNY A;  2P3Y A;  1YJ9 Z;  3P5J B;  2W04 A;  1KD1 2;  3ESW A;  1LQL A;  4E32 A;  2B63 I;  3S14 I;  2BJO A;  4A3D I;  2O4H A;  4TNU A;  2RBL A;  1YJ9 1;  2EGT A;  3CC4 Z;  1RO4 A;  1Q82 1;  1QVF Y;  3JAM f;  3IX0 A;  2NVT I;  2NVY I;  1RNI A;  1S72 Z;  3HOZ I;  4MD7 A;  1I3Q I;  4NBD A;  5C4J I;  2QEX Z;  2OOX B;  2AKL A;  3IFU A;  1VQ8 Z;  4E30 A;  1WCM I;  1VQ5 1;  3CCM 1;  3S1M I;  1ML8 A;  3EED A;  3GTO I;  1I50 I;  2Q51 A;  1X3Z A;  1VQ4 Z;  3I4N I;  3VB9 A;  2PM9 A;  3CCE Z;  1YIJ 1;  1VQ7 Z;  3G71 Z;  1USP B;  1PFT A;  4NBG A;  2PMZ A;  1K73 2;  3KIF A;  3KIH A;  1K73 1;  3GTK I;  3CCS 1;  3K7A I;  3GTG I;  4DGL A;  1VQO 1;  2HF1 A;  1KQS Z;  3CC2 1;  2OTJ 1;  3M3Y I;  2IZ4 A;  4MON A;  3FQQ A;  3HOW I;  1VQO Z;  1M90 1;  3HOU I;  2R93 I;  3D6W A;  3CCS Z;  3BG0 B;  1N2F A;  2G2K A;  1VQP Z;  3G4S 1;  1YJW Z;  1WW9 A;  3RZD I;  2QRE B;  2K5R A;  3MZK B;  1YUK A;  5LL6 f;  4XX2 A;  3VMI A;  2VUG A;  2YAD A;  3M4O I;  3JAM b;  5C4X I;  2NVQ I;  4MH4 A;  3MZL B;  3I07 A;  3PO2 I;  3G6E 1;  5A2Q b;  1K83 I;  1QVF Z;  4DQY B;  4E2Y A;  1VQN Z;  1YIT 1;  3S15 I;  1WII A;  2JUB A;  3CC7 Z;  3NH4 A;  1S72 1;  1Q82 2;  3H3V J;  3I55 1;  2E2J I;  2RIQ A;  4MRI A;  1JWH C;  4A3E I;  1TFI A;  3HOY I;  2VUM I;  1RQF A;  3GTQ I;  4MD9 A;  3CMA Z;  1SFO I;  2QR1 B;  2OTL Z;  3CME Z;  3CC2 Z;  2PK7 A;  3HKZ A;  1TWG I;  3GTJ I;  2JMO A;  1Z01 A;  3VTN A;  3I55 Z;  1VQN 1;  4A3C I;  3GTM I;  4BY7 I;  4A3I I;  1Y1W I;  4NBB A;  1P9N A;  3D9X A;  3NH8 A;  2KI7 B;  4NOZ A;  1YIJ Z;  3CXC Z;  3GCF A;  4CL1 A;  1NUI A;  5FLM I;  2I3C A;  3T4N B;  2QA4 Z;  2QLV B;  2QKD A;  2WB1 A;  1KQS Y;  4NBA A;  5T6B A;  2IZ3 A;  3CCR 1;  5T67 A;  3LUS A;  1ZB8 A;  2NVX I;  1VQM 1;  3FQM A;  2OTJ Z;  1YJN Z;  2JA6 I;  1Q86 1;  1TWC I;  4NFR A;  2GU2 A;  3RZO I;  3J81 b;  1Z02 A;  2OTL 1;  3HOX I;  3U50 C;  1L1O C;  2E2I I;  1I6H I;  4BBR I;  4NBH A;  1YUA A;  5T64 A;  3CPW Y;  2R6M A;  1VQ7 1;  4E31 A;  2J6A A;  4NB8 A;  1JJ2 Y;  3VMH A;  3BG1 B;  2DE6 A;  5IT9 b;  2F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...