1P9NA

Crystal structure of escherichia coli mobb.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
169
structure length
162
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 29
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1p9nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9nA01
1D6JA 1ETUA 3WY9A 4HDQB 3WYAA 5BN4A 3L0OA 2PZFA 4JT4A 1MO6A 1AGPA 2H17A 5EXTA 1ZP6A 4H1UA 2PL3A 1ZJ6A 4M1KA 4O2LA 4XSHA 1GKYA 5KSOA 5FOUA 4C7OB 2IYWA 3ECCA 3WNCA 4WA7A 5AUOB 1FZQA 1GNRA 1KI7A 4JYBA 4I1SA 3AKDA 4TLBA 1ZRHA 3B5JA 3RRNA 2O8BB 3GJ8A 3K0CA 4MDEA 3KQHA 3X1YA 1TTTA 221PA 1ZUHA 1RVDA 2R44A 3VAAA 2YYZA 2XZOA 1GITA 1NN5A 1X6VA 2H7VA 4XD7A 3RSLA 1DOAA 4PSKA 2EVWX 2XNSA 1GWNA 4RFSA 3QKRB 1FW6A 2ZYUX 4PC3A 1US8B 1VIAA 5J4HA 2RGGA 1FQJA 1RJ9A 3IEVA 1KMQA 4QBFA 2C03A 4QBIA 1BYUA 2YOHA 5SZKB 4B76A 1E79D 2ZI3A 4Q7MB 3NDBB 2Q0HA 1LS6A 3SBEA 3EG5A 3QPUA 2FZLA 3TSWA 4DLVA 3PG5A 2HLDD 2YWGA 2UZ3A 4LV6A 3LA6A 4ZCIA 2FU5C 3CX8A 3TVTA 1N0VC 4PZYA 1KAGA 4JYCA 2X8AA 1F2TA 5J4YA 3EX7C 1KDTA 4Q4HB 3G5UA 5FUXA 5EE5B 1PZNA 1IXRC 2FSFA 4PXAA 3K9GA 4DVGA 2VHTA 1T5LA 1XB2A 2O8DB 2YWHA 3SNHA 4Q19A 4DLYA 4ZIRA 1KK0A 2LCFA 1E2LA 4QRHA 5FTKA 3P1JA 2O8FA 2BBWA 4JVSB 1P6XA 1QF9A 5JSZB 3UIEA 4PSAA 1XEXA 1IN8A 1AS0A 4UXIA 2HJGA 2XJ4A 3CH4B 4BZXA 4XOIA 2X2EA 3ZS9A 2IYZA 4TT3A 4IJMA 2F7SA 1KY2A 2YC2C 4EQ6B 4UNQA 3LO5A 2XNDD 2PX3A 1WE2A 2PJRA 1VYVA 1GVNB 4B35A 1JJ7A 1BS1A 2DFTA 2CEAA 1FUUA 2ZRIA 1JEDA 4GBMA 2JLWA 1L4UA 3DL0A 2ZPTX 2UVQA 2C99A 3LXXA 3E1SA 5JZVA 1GM5A 1COWA 4LBYA 3QE0A 6Q21A 1CKEA 2IL1A 2WJJA 1E2GA 3BXZA 2QNRA 1DAGA 2C95A 1VYTA 4V0ME 1G8GA 4EPVA 1XPRA 1U0JA 4IRUB 4EPRA 4Q9HA 1AJEA 3R7WA 2GTPA 2J5XA 5CM8B 3N2IA 1E1QD 2Q3MA 1TEXA 1M8PA 5DHFA 4IVQA 4NCJA 2W6JA 5FTLA 5G3ZA 4LPSA 3THXA 3D3QA 2D06A 4NBSA 2QE7D 3ZD6A 2ZJBA 1XEWX 4Q1CA 4Q9JA 3EPKA 5TV2A 3DHWC 4EJSC 2J0UB 4N1AA 3ND9A 4ZPXA 1NLZA 1X1RA 2OO7A 1Y63A 3NHBA 1KI6B 3FVQA 5FH9A 3CW2A 4F93B 2O8EB 1E1RA 2EQBA 2GCOB 2JLUA 4NE2A 3T15A 3CR8A 1SVMA 3KJIA 4ESVA 1KO8A 1A2BA 3TUIC 1XPUA 3LV8A 1U90A 1CULC 4ACAA 3B1VA 4CZ2A 2JJ2D 1GRNA 2ZRGA 2F1JA 3L0IB 4FWTA 5DYIA 4CYMA 4A0RA 4CEJB 2WSSD 4ZCMA 5FBLB 4Z8XA 1E96A 3RWMB 3O8BA 1JQLB 4PQYA 5EP1A 1TF5A 1ZMXA 3ADCA 3CPJB 1G7SA 3B8HA 4GRAA 3RVBA 1T6NA 4NMMA 4HAVA 1KNXA 4MDFA 3AF4A 1J90A 2IHYA 3SHWA 3KUDA 1NSTA 3CRQA 4MGYR 1U9IA 5EE1A 3EWAA 1K8RA 1J7KA 3E5HA 4JSYA 3FKSD 4LJ5A 4A1FA 1E99A 2ZRFA 4UNPA 3H2YA 5KNDA 3RDPA 2Z4SA 5EUMA 4B32A 4B43A 2QN6A 4DIEA 2ZS8A 1NN0A 3VR2A 4QL3A 5TXGA 3CNNA 4ARZA 5HE8A 3WYGA 3BC1A 4L9WA 4HLDA 4DXAA 4LV8B 4Q4LA 2ZE5A 1R0YA 2C9YA 2J59A 1BKDR 5GJVC 4KO8A 3W3ZB 3BFKA 2AHOA 4IOLA 2GAAA 3ZQJA 1UKVY 4O3MA 1HT2E 2DY1A 1E9SA 5KNBA 4RCZA 3THWB 1E2KA 1W0JD 2H8KA 1AQUA 3BBPA 3LWNA 1OXUA 2YOFA 2GZDA 4LJ4A 3EXAA 4QJ3A 1E9AA 1E69A 4RKFA 4PZZA 1FX0B 2IT1A 2QA5A 1E2QA 1Z6XA 2NO1A 5JJLA 4EFMA 4K8OA 4CEIA 3HJNA 1OB2A 1RC8A 1NMZA 1KI2A 2QMOA 5UKDA 2PZGA 2JAQA 1NBMD 1XTQA 3EIEA 4B6FA 4JLKA 1VG9B 1W36C 4UNRA 1TQ4A 3ZDQA 4TQAA 1KOFA 1XD8A 1R8QA 2VP2A 3BIFA 3KJEA 2O8CA 1SZPA 1XRJA 4V02A 4FMDF 4JKYA 2XAUA 1T3HA 4LJ6A 1PUIA 2ZREA 3LD9A 1TADA 1YRBA 1R0WA 1IN7A 4YMTA 2QTFA 3GFPA 4KAXA 1KO1A 4P4UA 4TLCA 4LSGA 2FGJA 2R6AA 2R62A 4CT5A 3RS5A 2FJUA 4TMXA 4B3DA 3DVLA 1XTSA 2NO0A 1M2OB 3NWJA 5CLLA 4Q1AA 3O8RA 1X1SA 4AKGA 1QHXA 1J8MF 1IJFA 2AFHE 2JDIA 2ZITA 2ZAOA 3AV0B 1VCIA 3K1JA 5FL7D 1GL7A 3TLXA 1NVVQ 1G18A 5HPYB 3BH0A 1MRNA 4C2UA 1E2IA 1UPTA 3IEUA 3EZ6A 4LJ9A 5CDFA 2GJKA 3VKWA 3TQCA 5CB8A 1DAIA 1U0HC 3SJCA 2W0MA 4IKEA 1ZM2A 4I1OA 2RCNA 3GLIB 5LD2C 3RAPR 3NIBA 1UEIA 2QROA 1HT1E 3ZQ6A 2WAYA 5L3RA 3U6BA 2A5GA 1OH7A 3AVWA 1JPJA 2FFHA 2B7BA 1G8YA 1N6HA 2J1LA 4OHZA 2IA5A 2WPDD 1OPXA 4TWZA 1DARA 3ZJYA 4AK9A 3CPHA 3QXJA 4ZDIA 2BMFA 3MWKA 1XXHA 3Q72A 5FR2A 1G291 1A7JA 5K8LA 5CK5A 1A82A 4WIAA 3P4YA 2VIIA 1BMFD 4DLWA 2FN4A 4RZXA 1YKSA 5FL3A 1CR0A 2HJVA 4IXNA 1TX4B 2IXFA 1T5IA 3K0CC 3MGCA 5L3SB 4PX9A 4QOSA 4TSFD 4FMDB 4TL8A 4LV5B 1R2QA 3A1UA 5CM9C 2FEOA 1JEEA 3A1SA 2QQ0A 3NBZC 3RS3A 3LRPA 1HQCA 2ZI9A 1EFRA 3GJ4A 4PPFA 3T1TA 4Y0AA 2J7PD 1J8YF 2ZI5A 4LJ8A 1Z06A 4DCSA 5LPNA 1RW4A 1W49A 2CNWD 4OQNA 1PUJA 4LOAA 4DCVA 2GEDA 3O8DA 3FMFA 2ODEA 3Q7QA 4AKEA 1KTVA 3QENA 4HDOB 1SXJA 5HE9A 4D4LA 3PEVA 1T91A 1G8FA 4EFNA 3WMFA 4Z54A 1MR3F 5JEEA 4PO1A 1JXMA 3VHXA 1OXXK 4RY2A 4Z1MD 4DZZA 5FI0B 4X8OA 3EA0A 2FFAA 5DN6D 1NBME 3U7GA 2J87A 3QEJA 1ZNWA 1W5TA 4XSGA 1IXZA 4MITA 3ZYCA 1T8TA 2QZ4A 1ZU4A 4KHZA 4C2TA 2D3WA 4UKDA 3DM9B 1F5NA 5SZHB 3RRYA 4POAA 3BWDD 2G9NA 4GOXA 2J3EA 2QL6A 2UZIR 3A1WA 3HYRA 1W2GA 3P4XA 5BN5A 4ZDWA 3W9YA 4D4JA 1BOFA 1Q1ZA 2OEPA 2WWYA 1XMVA 2OE2A 2OT3B 4KFSA 3AUXA 4P4SB 1IBRA 1SGWA 4Q18A 4CEHA 1SVWA 2IC5A 4QBGB 4D0NA 1M74A 2TMKA 3QJYA 1G7RA 1DG3A 3SHFA 3GEEA 1F3OA 1KI8A 4KI0A 2CBZA 2OAQ1 1DG1G 4NCKA 3LFUA 2GXSA 2YINC 2GJAA 3PEUA 3I3SR 2HCBA 1LS1A 1XTJA 4TMZA 3BFXA 3W6PA 4UNNA 4WZBE 3TW4A 5FTJA 1Z0IA 4HSEA 4LPKA 4L9SA 2ZRMA 3OZXA 4DUGD 4URZR 3QKTA 1C4OA 2IYQA 3KQKA 4UXJA 4B2IA 4DRZA 2XB2A 4MQBA 1ESMA 4KVGA 2C04A 2DYKA 1U8ZA 1NL3A 1XX6A 1KGDA 1CJMA 2VSOA 3BAFA 5JWRA 4QFMA 1TQ2A 2RGNA 1OFUX 4HLUA 1P9RA 1ZM3A 1E4VA 3B1YA 3DKVA 1XNJA 5J47A 1JALA 1TU4A 1TPZA 1E79A 1CF4A 1P3JA 4URYR 4Q21A 4GMXA 2HLDA 4ACBA 3PITA 2XTNA 3K70B 2HT6A 2D7CA 1TUEA 2QMEA 3C5HA 5FR1A 2J46A 1CXZA 3FFAA 4DSUA 3K0AA 5FPTA 1Z63A 2OCAA 3QQ5A 3SJAA 1NLFA 1U9IC 2WWFA 2Y8EA 3MJHA 4KFUA 1TMKA 5D3MB 3VU9B 2FEMA 3P20A 1PV4A 1H8EA 1XZQA 2AWNA 2YV5A 1A5TA 1UDWA 4BEJA 3CZPA 5DI9A 3X2SA 2FSGA 2XSZD 3THOA 4BGDA 2UKDA 4C0KA 4LWZA 4D26A 5E7MA 1LFDB 4C0BA 1EFCA 3EPLA 4NU0A 3Q9LA 4PTLA 2GILA 1Z6AA 2VHQA 1KSFX 5EXSA 3EAQA 2XXAA 1M7GA 2NZ8A 3T06B 1Z6TA 3RC3A 4N0EA 1OIVA 2XNDA 4Z51A 3NC1C 1QZXA 2BJWA 3KX2A 3BRWD 3R8CA 3MJRA 3PR1A 3CRVA 4HUTA 1M7HA 4CW7A 4JBWA 3IIJA 1OKKD 2OXRA 1Q22A 4D0GA 3H84A 2QP3A 1RZ3A 1A2KC 1QHGA 3W6NA 3PJRA 1YVDA 1B23P 1RYHA 2WKRA 1E2HA 2ZJAA 2Z83A 2GF0A 3GFTA 3IPXA 2ZXUA 2ZM5A 4QGFA 1R0XA 3CF2A 3UMFA 1E1QA 3UMSA 1CS4C 2RGCA 3B78A 3A4MA 3NBXX 3O47A 5J4KA 2CK3D 1GZSA 2OXCA 4IFBA 3SJBA 4F4IA 2QBYA 3ADDA 1KZGB 2O52A 3MSXA 4BUJA 2MSCB 4NZYA 4DIDA 4US2R 2OM2A 1WMSA 2FNAA 2CL0X 4JLDA 2CE2X 2QE7A 3KKNA 1G6HA 1R7RA 1D9ZA 1YHNA 3S1AA 3C7KA 4M1WA 3G0HA 1C1YA 2ZR9A 2V1UA 1HUQA 1ZC3A 4N0DA 3UWKA 3U4QA 3K9NA 2OLKA 1XPOA 2W2XA 4CVNA 1KO7A 3ZZUA 1G5PA 2A5YB 2CJWB 1FFHA 3M4YA 2PMKA 4A6XA 1J2JA 1VCOA 1ZNZA 4Q1DA 2GA8A 1T8UA 3ZVMA 5M04A 5A5GA 2JJ2A 2IW3A 521PA 1C9KA 1Q3HA 4A92A 4YMVA 2BMJA 1XD9A 3KQLA 3BD9A 2AXPA 4D82A 2WSSA 5DISB 4LYFA 3C15C 4B6EA 4LJYA 2GWHA 2AD1A 1ODFA 3EZFA 1VMAA 3QKSB 5FPKA 1IN6A 1G5RA 1R5NA 1MO4A 3GCGA 2VBCA 1E3MA 3CWZA 1Z6GA 1IAQA 3L0PA 4PFSA 2XGJA 2RHDA 2GEVA 3SBDA 1WP9A 1YU9A 1EWRA 2XITA 2BOVA 4C7OA 5GJBA 5FPYA 3FKSA 3QBTA 1QHNA 4JBYA 3GQBA 2FV8A 3A8TA 4HLCA 4OQFA 2EFHB 3PIRA 3TAHA 3RC8A 3ICQB 3G82C 3HYTA 3EWSA 4Q66C 3CWQA 2O8BA 4XVQA 1NVVR 1X8KA 4YONB 2GBLA 2XZPA 3WRYC 4R9UC 4XVUA 1YJ5A 1IY0A 4R71A 3SS8A 2G0TA 2V6IA 3UG7A 3HU1A 4JZKA 2O0KA 3A1TA 3I1FA 5EZ6B 2C96A 2J9RA 3QKRA 1US8A 2DHRA 1XCGB 2ZS9A 4GP7A 4C0QC 2RGBA 3OE7D 4MKGA 5JFGA 1J70A 1W0JA 1Z22A 4C0HA 2REXB 4LHWA 5FBVB 1G5TA 4Q1EA 1K6MA 4PANA 3L8YA 2A9KA 1U8YA 3K70D 3UG6A 1N6PA 1G8PA 2V4ZA 1KAOA 3GFOA 5JECA 1XD2B 3UWOA 4V03A 4MUAA 3KB1A 4PC6A 1CR4A 1WQ1R 2Q3FA 1XCPA 4OHXA 5A4JA 4Q4HA 3C5CA 4AURA 4Q4JB 1D2NA 1ANKA 4JLOA 3SEAA 2O8DA 1NBMA 2V6JA 4LY6A 5L8VA 3HR8A 2J0VA 3BB1A 5BYKA 5F9FA 1DAFA 1KK2A 1SXJC 3MRSA 5C46F 1U0LA 5DSZA 5JSZA 2DBYA 2NGRA 4MRPA 5CDFE 1YZLA 3D31A 1JR6A 3BERA 3K53A 3GJ5A 1OT3A 5EZ5A 5GADl 5LB2A 3W34A 1UKZA 3Q8XB 4BLRA 4ZDJA 5J5CA 1EFTA 3A36A 2DCUA 3ZVRA 4EQ6A 4WZ6A 4IDQA 4LHXA 4BECA 2F55A 4Y0VA 4YMWA 5G3YA 4JMPA 2NIPA 2R65A 1W36B 2A5DA 4TL7A 1YZNA 3PUYA 1P9NA 2BKUA 2IX3A 4LHVA 1XXHE 4S2EA 2FSIA 2FFBA 3IILA 5KU1A 4KU4A 4IDOA 3MCAA 2OBNA 3AUYA 4G5SA 1HYQA 1WDTA 4M9ZA 5K8UA 5BXQC 4PHGA 1AZTA 2IXGA 2C78A 3BORA 1I4LD 1HE1C 5FL7A 4M9QA 4A9AA 5EXXA 2IF0A 1TQ6A 2OSBA 2VP4A 2HF9A 4MGIR 2A78A 1Q44A 4OKSA 4FN5A 3WP1B 4LBVA 1IOZA 1D9XA 5JMTA 1W47A 2REOA 4MGKR 3W8NA 4F91B 1TL7C 1H8ED 1XP8A 2J0UA 1VHTA 2ECKA 2Z4RA 3A4LA 3OF5A 4O2RA 1NJFA 4NTZA 1SXJE 2QI9C 1CIPA 1KI6A 2QPAA 1OLOA 1NF3A 3QF4B 4Q7KA 2WPDA 5BW8A 2O8EA 2GCOA 1P61B 2FA9A 1AA9A 2EFDB 5AJZA 2P0EA 2J7KA 3U3JA 2VP6A 4DDVA 5AJYA 4EDHA 1K5DA 2CHQA 3OEED 4URWR 5B2ZA 1BMFA 3ASYA 4DLTA 4PO8A 2JASA 4MYTA 3KDSE 3VKGA 4EAQA 4IHQA 4CEJA 4U7DA 1NSFA 2QG6A 2DWPA 4TSFA 4QJ4A 5KOYA 2QPOA 4WXRA 1B0UA 3LX5A 4BASA 2PJZA 2G1JA 3N2EA 4LBZA 1P5ZB 4XWAA 2WTUA 4M1SA 5KSYA 2VP0A 2RGNC 4QBHA 1HE8B 4HLUC 1JECA 4G5QA 1WBBA 1ONBA 2W83A 4CRWB 2J7PA 3K9HA 3LX8A 1KZ7B 4LX0A 4QHYA 1YR8A 3GD7A 4R7ZA 1G41A 4R2HA 4OJQA 4A8JB 5AJXA 2RGDA 1AM4D 1FP6A 1L4YA 2CNWA 1DAHA 3PUZA 3W90A 3X1WA 1O87A 1W5SA 3HPQA 4DCUA 3CH5A 4LRWA 5HCIA 4PHTA 1IONA 5FBQB 5G40A 3T1OA 4M0LA 3AVYA 3QKUA 1U98A 2VTKA 3VKHA 3VHLB 2Z0MA 1TEVA 1JNYA 2EWWA 2YWFA 2AKYA 4B3CA 3RRZA 5BWMA 3CZQA 4MRRA 4ON9A 2WIBA 3N70A 1BH2A 1VTKA 1KI9A 1Z29A 4Z1MA 3THYB 3MLEA 3NHAA 1RYFA 2WMNB 3P32A 4GOKA 5DN6A 1R8SA 5FUYA 4C0LA 1ZVQA 3THWA 1R6BX 3GLHB 4B44A 1S2MA 3B1WA 2B8WA 1GFIA 2DFLA 2V8OA 3I5XA 2R6CA 1A1VA 3PQCA 1NMXA 4F92B 5JJIA 5C18A 2WKQA 4AYTA 1TF2A 2HUPA 4YDSA 5JI2E 4TL6A 1FX0A 2ZJ2A 2ZTSA 1IXSB 1I4TD 2WOOA 1KJYA 3NKVA 1UBEA 2QT0A 1LB1B 1MABB 4JLVA 1RRCA 1KK1A 2V54A 4W5WA 2FX3A 4Q00A 1BO6A 1GL9B 5ELXA 1LTQA 2O5VA 1VG8A 2AWOA 1G7TA 4NCIA 1E2JA 1TAGA 4Q9KA 2ZJ8A 2QAGB 1NG9A 1E9FA 1GG2A 4F4CA 1W48A 3W5IA 2VHCA 1W0KD 4XJXA 3IO3A 5EP3A 4OBEA 5G53C 3REGA 1ZAKA 1ZM7A 4QJ5A 4BFUA 3VNUA 2EYUA 2ERXA 2JJ1D 2BHRA 4DBLC 1Q0UA 4A2QA 1S9DA 1SKQA 3KKMA 5DYGA 3IPYA 3NC0C 3B9PA 4I81A 3RSOA 5HZHA 2REBA 1N3BA 1F48A 2IBMA 2WIAA 2YNMA 1W36D 5C4MA 3KQUA 3PEWA 2QQEA 3NEJA 2IYUA 2QM8A 2PH1A 3FMIA 4BRWA 3U7HB 2OLJA 4HUQB 4DUGA 3BK7A 3ND8A 5EE0A 1JR3D 5F3WB 1OXVA 1HEIA 4G3XA 1W1WA 2OZEA 3H0KA 2DWQA 1VHLA 3NH9A 3K0FB 3VQTA 3LH5A 4P33A 5DE3A 2H18A 2ZYVX 5EP2A 1ZD9A 3RLFA 1SKYE 5J4LA 2VRWA 2YC4C 4D4KA 3Q85A 4IXMA 2J0QA 2YJTD 3B9QA 3OIVA 5E7IA 3MWJA 3TR5A 1E0KA 4K46A 3W6OA 2ASEA 2F1HA 3AQ4A 3HR7A 4E22A 2VHJA 2WBLC 3AVXA 2KBEA 3GLIA 3SYNA 3DO6A 4FCTA 1VG0B 3GLFB 5DLQC 1RRGA 4OI4A 5KYKA 2AKAB 2W6ID 4KITB 4NH0A 2C77A 1DO0A 3IDQA 3GLGB 1N6NA 2G88A 3RRMA 1N6LA 1QBKC 2HCJB 3IUYA 1Q3TA 4MA4A 2D2EA 2GCPA 4FIDA 4EPXA 2BM0A 5HR5A 1G20E 1KSHA 2XSZA 3T35A 3I62A 3IO5A 2CHGA 2GXUA 1N6OA 2QAJA 5L3SA 2GBLC 1GILA 4OI2A 1D2MA 2ZRCA 4YDHB 3ZZ0A 2OBLA 1SHZA 3EASA 4JL6A 1NIPA 3GJ6A 3QI2A 2IWHA 2IYTA 1JQJC 4TYQA 5DHAA 4TYWA 1L8QA 2ATXA 1W44A 4A2PA 1Q20A 2A7QA 1FTNA 3AVOA 5EUQB 2JLXA 2BKEA 2JGNA 2NG1A 2QENA 2I3BA 1FTSA 1Z28A 1VECA 1NVWQ 2P6UA 2ZVPX 8OHMA 4DKXA 3AF2A 1V5WA 2F43B 1OKKA 1OFIA 2WZQA 5KDLA 3V4RA 1EX7A 2WJGA 4JSTA 2PZEA 2GVDC 5B58C 2B6HA 2BBOA 3E2IA 3TW8B 4TMVA 4FINA 1IHUA 1Q57A 4BFTA 2EFCB 4B73A 1KK3A 5CYOA 2P5TB 1SVKA 2QY9A 4EIWA 1S0UA 4LC0A 1WCV1 1K5GA 2XOKD 4UJ3A 3GEHA 4LHZA 4US0R 5H1YA 2CK3A 4HEJA 2XX3A 1KIMA 4WAUA 4I1VA 4D6PA 1ZINA 2Q21A 1Z3IX 4FMBB 2V3CC 4XVRA 2B92A 3JVVA 5KDOA 1FOEB 2BIFA 3AVPA 3X1ZA 2ZU0C 5HZKA 3QG1A 1OFTA 2GJSA 4NPHA 5JWOA 4L16A 2GRJA 3OFND 3SZRA 3EC1A 5SZIA 5H68A 2JLRA 1YZUA 1W2HA 4P31A 3U3KA 2QT1A 3QUSA 4IOMA 1M6NA 2L0XA 1OV4A 1NP6A 1VCMA 2IYYA 4WOPA 4P4SA 1G9XA 4D2IA 3AGQA 1P60A 4LBWA 4UJ5A 5CIQA 4D81A 4JVNA 3FFBA 3C41J 5BQ5A 3U3OA 4MYCA 5CK4A 1YZKA 3CF0A 4RJLA 3ADKA 3O8CA 1JR3E 1CLUA 4PPNA 2GK7A 1E32A 2ODWA 2P2LA 4AI6A 1Q1EA 2PT7A 3KXKA 5E3HA 3ZLJA 3L43A 2F3TA 1DE0A 5C4GB 1QHHB 2ZIAA 1P2UA 2HXYA 4PC2A 2YHSA 2GNOA 2HEIA 2VEDA 4KSBA 4PAMA 4A36A 1AKYA 1WF3A 2N1BA 4NDZA 5CYPA 4URUR 1JJVA 2OILA 2NPIA 4BLSA 1AN0A 2AXNA 3AF3A 4L15A 4OK3A 1WBDA 1T0HB 2R8RA 3PCRB 4XWOA 2G3YA 1P62B 1DADA 3IIMA 3RYTC 5JEDA 1IQPA 4HB4A 3HP1A 1XF9A 1CEEA 2KBFA 1EXMA 4NL4H 3ZIAD 1KI1A 1N2CE 2PCLA 2WJYA 3AP3A 4W7SA 4TYPA 2R9VA 4HB3A 3GP8A 2PEYA 2ZJ5A 4YXWD 2H92A 3K8YA 3RS2A 4MKFA 1LVGA 3T61A 2MSDB 4A0FA 4OYHA 2RKOA 1N6KA 1OXSC 1G3UA 1SQ5A 3OE7A 4OI1A 4KBFA 2WWWA 1JAIA 1SVOA 2ZVQX 1PLJA 4TQ9A 4Z8YA 1DAMA 5IHPA 3EZ2A 3LW7A 4HATA 4KFRA 4UXHA 3IGFA 2OFXA 4EPYA 1MT0A 2QMHA 4GOJA 4NONA 5D3MA 3VX4A 3VU9A 2AX4A 3U44B 4NYIQ 1IM2A 4IEIA 3UXMA 1X3SA 3JZMA 4PC1A 3IBYA 3SYKA 4AYXA 1QDEA 3R9XA 4PQFA 2IS2A 1E0AA 4S35A 4QNRA 5AK0A 4E03A 5FOXA 1EWQA 4HAUA 1JXOA 2CCKA 4LJAA 4QGGA 3JVUA 4B3BA 4DB2A 2YVUA 3UPUA 1SVSA 2YKGA 1MO5A 2JLVA 4DC9A 2PLRA 4QM6A 2Q9AA 1I2MA 3K0EA 1DTSA 4JJKA 4DLXA 3SOPA 2VA8A 1NKTA 2F1RA 4GT1A 3FDIA 3GMTA 3GLHE 3I32A 4BFYA 5KHOC 3MMPA 4HAYA 2GZHA 5E95A 4GDFA 4YMUA 3LNCA 4X8MA 1Q1QA 2CLCX 3QXSA 1EG7A 3QNUA 1GRQA 4RKEA 1TNDA 1OIWA 1Z8FA 4AKIA 1N0UA 3FTQA 5FBRB 4C4PA 3L82B 3PFIA 1XU4A 4G5OA 5DGXA 1KY3A 5CITA 5KUTA 1Z5ZA 1P4SA 1NI3A 2Q3HA 4IVRA 2JJ8A 1R4AA 1W4CA 3KTAB 3BGWA 1NKSA 3H4MA 2QTVB 1XMJA 2FWRA 2P3SA 1LF0A 3D8BA 4WBSA 3DPUA 1P2TA 4A6PA 3GPLA 1S8FA 4OQMA 4ABYA 1RFLA 1T3LA 4Q4AB 1DAKA 1XTKA 3SC3A 2CJWA 5LB4A 4OHWA 1QRAA 3A6PC 5FPHA 3H86A 4JL5A 4AWXA 1U8AA 2OBMA 1AZSC 2QMUA 1G7CA 3L8ZA 2HYDA 1I4DD 3OEEA 3KJHA 4L8GA 1OB5A 3PV0A 3R9WA 3R8FA 4RD6A 3CX6A 3SQWA 2YOGA 1KMHB 4JS0A 4JVMA 1CTQA 2OV2A 3CPEA 1KDRA 1UBCA 3CKLA 4DCTA 3DKPA 3QKSA 2QRNA 4F7WA 1UEJA 3RS7A 1FPMA 3TR0A 3ZVLA 2EFEB 3PUXA 4LHYA 1W4RA 1XJ0A 4TLDA 2KSQA 1NRJB 1S3GA 3TQFA 3Q7PA 3WMGA 3T1QA 5DNYB 2X1VA 4JT2A 4ITRC 4TMTA 2CL7X 4E07A 4KSCA 3LLUA 5TARA 2GJ8A 4KVAA 3AM1A 2ONKA 1L2TA 1M34E 4MRNA 2AFIE 4DDUA 2WKPA 2DPXA 3A37A 1E0JA 2CMKA 4JL8A 2YZ2A 4Q02A 1PLLA 3GLFE 3EIHA 2VF8A 2WV9A 2XTMA 5FTMA 2FMXA 2OFOA 3OIUA 2IYVA 4HZUB 4UQOA 4AY2A 3T5DA 5KSZA 1GRRA 4JLBA 3GLGE 1II8B 1XWIA 3AEZA 4Q7LA 1TUIA 5FOWA 3NG1A 3RHFA 2A5JA 2ODNA 5ANRB 2ZSEA 4ZV4A 3QSYA 1XMIA 4PPGA 4R2IA 2N42A 2BMEA 2E9SA 1HA3A 2NO6A 5FUVA 2ORIA 3FHTA 4XTRA 4MKHA 2OESA 2ERYA 3IIKA 3TAUA 1AK2A 3LAWA 1AIPA 5BN3A 4BRUA 4RD0A 3A4NA 1XD2A 4BZQA 1VDZA 2WSMA 4EJSB 4URXR 3F5FA 2P67A 1S9HA 1VCNA 1AS3A 3KB2A 2QEQA 2IS4A 5LDDC 4PR0A 4Q4JA 2ZUCA 3U2QA 2ATVA 3VR6A 2HV8A 3BH7A 2JLQA 4HYYA 2IEZA 2NQ2C 4WXPA 4XWKA 4D25A 2J41A 3KXLA 2OAP1 4FI3C 2H5EA 2NTYC 1DAEA 2VHUA 1AQYA 1UM8A 4G0NA 4TYNA 1W0KA 1XEWY 1N25A 2X19A 2BWJA 4OL0A 1S1CA 4PPQA 2QORA 2ZUBA 2XZLA 2JJ1A 1W4BA 2C8VA 1D5CA 3LY5A 4NYMQ 1XZPA 1UADA 3GLIE 2LKCA 4RCYA 2D4HA 5JHGB 4LK2A 3VFDA 4O25A 2GDJA 4KCGA 5F2EA 2GXAA 3R20A 2LWIA 3NEYA 4DDTA 4GPTA 1CJUC 4M2LA 4QHTA 2IYXA 4XH9B 1IN5A 2JA1A 2QP9X 3VMFA 4P32A 4KXFB 2BJVA 2QTHA 4IDHA 2HDNB 2VH5R 3E70C 4B74A 3AVUA 4QKQA 1E9CA 4ASUD 1U2RA 2CVHA 3MWLA 3WRXC 1JR3A 3AKEA 4M9XA 3DMDA 4OQLA 4QG7A 3KXIA 3UANA 3KJGA 3W3AA 2ZAMA 2K5UA 2BM1A 2O0HA 1FMLA 4BQSA 1H8HD 1WB9A 1OH5A 4FXPA 4HAWA 2W2VA 3TK1A 1CP2A 2VSFA 4ZDKA 4BFXA 2V55B 5DH9A 3Q3JB 3ZVNA 5HCNA 2ZRBA 2B21A 3LVQE 4DJTA 1CJTC 1ZIPA 2DWOA 2GF9A 1Z2AA 3PVSA 5JCPA 2I1QA 4TYYA 2H57A 1P75A 1E0SA 2FSHA 4X8LA 2JLYA 4DT1B 4IOJA 3CRMA 3W8RA 4B47A 2QUZA 3CRW1 4JVLA 2OFWA 2ZE7A 3OEHD 4EFLA 1FQKA 2W6IA 3D7MA 3EIQA 1UFQA 1ZM4A 2DFKB 1OW3B 3QF4A 4Q1BA 1EESA 1ZW6A 2F6RA 4YMSA 5FBWB 1KDPA 5JWHA 3I61A 2Z43A 1OJLA 2IYRA 1JAHA 2WVJA 3ICEA 1JPNA 4A15A 4NKRA 5HTKA 2ZS7A 4OK6A 2WJHA 3BJIC 1GOTA 4G5RA 2KI5A 3WHLA 3VNVA 2GCNA 4BLOA 1GAJA 4B2PA 4WZAE 5JLJA 1Z2CA 2RHMA 3RANA 2QPTA 3DZ8A 2E1RA 1V43A 2IK8A 2H16A 3CUEF 3VR1A 2ZR7A 3KKOA 2A3RA 3X1DA 2WWHA 1QG4A 2HXSA 4LZZA 4PAQA 4TMKA 4C30A 1CR1A 4CGZA 2FFQA 4A8JA 3MG9A 5G41A 2BC9A 2WICA 3TBKA 4O0MA 2ZJZA 3L2OB 2OCYC 4TLEA 3EZ9A 4PZLA 4TLAA 1KDOA 3K70C 2N46A 2XB4A 5JI3E 2BMDA 1F2UB 3C16C 3PENA 4TTPA 5L3QB 1MH1A 4W5HA 2HF8A 1DO2A 2WAXA 4M53A 2GETA 1KJWA 4GP6A 3KKPA 3THYA 4Q47A 2XOKA 4RFVA 2QGZA 5EJEA 3DMNA 2VF7A 3VR5A 4QHSA 4L5BA 3M1IA 4OQXA 3V9PA 4BE7B 1OSNA 2VL7A 4GFDA 1OXTA 1ZM9A 4M1TA 5IK2D 1NMYA 3GLHA 1P73A 3CONA 4OHVA 1DEKA 2F9MA 1KSJA 1S96A 3U3RA 2YWEA 2KJQA 3BE4A 4NYIR 3N5CA 1DBSA 3GEIA 1G1MA 3B1ZA 3ZZTA 2IHBA 4NP6A 4Q1FA 4V0KA 2O0JA 1G3IA 5LD2B 1NNEA 5DI3B 3OFNA 5EP4A 3TUZC 3OIWA 3BB4A 4B71A 2P65A 2ZETA 1CBUA 1S3SA 1N5KA 4IOKA 1MABA 2KE5A 1U99A 1KI3A 2H1LA 1N5LA 3M0EA 4RD2A 1D2EA 1DVRA 3A58B 2A2ZA 2QAGA 4W5JA 5GJCA 5BYJA 1XJCA 4R98A 4TTQA 2RH5A 4RZUA 4NCNA 3JZAA 3QPWA 2HT1A 3FKQA 3SYLA 4A4DA 1MRSA 4D0LB 1G19A 2NO7A 3FYHA 5AUPB 5EE3A 3LXRA 4B75A 4Q03A 2ZE8A 1P7CA 2F1IA 2ZRPA 3OAAA 2OUKA 1CJVC 1E9EA 2JATA 3LVRE 4RFSB 4ZCLA 4CDGA 3BH6A 4KFTA 1QHIA 2AR7A 5FUWA 3FWYA 4P3YA 1RJ9B 2ANCA 1ZNXA 4HUQA 1F60A 2QGNA 4JLAA 1EFHA 4N3NA 4BFVA 2IXEA 1Z0KA 3DM5A 3CB4A 3QG5A 4HDCA 4KODA 3U5ZB 3B2EA 3HU3A 2IEYA 1P2SA 3ZIAA 4Q7JB 1NN1A 3K0FA 4HB0A 2AL7A 4M1OA 4QGAA 2AD5A 2JEOA 2XJ9A 4C3ZA 1NIJA 1F2TB 4ERNA 4URVR 4YXWA 1N6IA 3BB3A 2CXXA 2C2HA 4PO9A 2MSEB 1R5OA 3MWYW 3B85A 5FFMA 4HLQB 4LYHA 1KHTA 1NVXQ 2FDCA 1T0JB 4ZIRB 1OYWA 1II0A 3DDCA 2O8FB 1Z0JA 1KNQA 4AYWA 3GLFA 3T5GA 1XEXB 1W7AA 1GKUB 2WJVA 1ZIOA 3K09A 3OIYA 1LW7A 2JCSA 4BLQA 2G6BA 3REFA 2JLSA 2GHIA 1AGRA 1WA5A 1SVLA 1WXQA 2RMKA 4JLPA 3GLGA 1Z0FA 1MOZA 1KO4A 4MH0R 1NLYA 1OYYA 3B60A 4DLUA 4TN1A 4OJKA 5DIFA 4PQRA 2AN9A 1OFHA 3FPAA 5JRZA 5AJVB 4KLNA 5GVSA 1ZYUA 1OHHD 1VPLA 2XTZA 5B30A 3HDTA 2QP4A 1E98A 4H1VA 2JLZA 2ZU6A 4DEXA 2R2AA 2ZR0A 1GDDA 2PT5A 2JIZA 5C2JB 4TQUS 2FF7A 2EWVA 2R6GA 3UATA 3FOZA 1N6RA 4Q01A 3AF1A 2C9CA 5JS7A 5CIWA 4KYIB 3ONWA 4RD1A 1M1YE 5IRCD 1W46A 1KI4A 4DB4A 3R7WB 2CCJA 3HU2A 3ETLA 4C0AC 1UAAA 1HURA 4GNKA 3WNDA 1RE0A 3ASZA 3VX3A 2V7QD 1DPFA 2ZEJA 3V00A 2RAPA 2F43A 1IN4A 1Q12A 2D2FA 4JLMA 3AKCA 3CNLA 5P21A 1UKEA 1ZCBA 4IFEA 4LGMA 5EQTA 621PA 3R9IA 2IS1A 2BBTA 3THXB 3TE6A 1RIFA 1RPZA 2ZYTX 4A0HA 5KDDA 1NN3A 3J81k 5HKKA 4E5UA 4FWIB 4UNSA 1GNQA 1NG1A 1T4GA 2ZANA 3DOEA 2Z5FA 3FB4A 2VP5A 2ANBA 4L4UA 3TUJC 3PEYA 4IEEA 3RS4A 2P6NA 2PMDA 2NMVA 2G77B 1YR9A 3C14C 3IHWA 3RABA 3F3YA 1E94E 4OK5A 1Z07A 3TH5A 3VTKA 1E4YA 2PCJA 1II9A 3NDPA 5CJPA 1I2DA 1HQYE 1XJQA 2B8TA 4YLGA 2ZUDA 1NJGA 2G0NA 2V9PA 1VKJA 2RGAA 2ZRDA 3AVVA 1G16A 3EA5A 4GL2A 4MUBA 1QVAA 4P4TA 3IKJA 1PJRA 5CJ2A 4KJZA 3B7GA 3WP0A 1ESNA 2DR3A 4I99A 5FOVA 5IT5A 1G3RA 3D6TB 2ZQ5A 3WHKA 5C1BA 2Q9CA 1G17A 4BLTA 1GIAA 1T9HA 2FPKA 2FG5A 4EPTA 4NYMR 2CE7A 4IDNA 3HWSA 3AB3A 3SI7A 3U6KA 1LV7A 3Q5DA 1J99A 1OIXA 4XTCS 1GSIA 1YZGA 4ZO4A 2W58A 1OH6A 2WM9B 4I4LA 1PLKA 3CF6R 4ARZB 1W4AA 1QHHA 1N0WA 3OESA 2MMCA 4M22A 4JKIA 1EK0A 4ZI2A 4XD7D 4OI0A 3LW8A 1VG1A 2ZJYA 3FHCB 3SFVA 3UKDA 3B1XA 1G21E 1Q21A 3AVQA 1Z83A 4M4SA 1Z6YA 5TY0A 1TQDA 2Q6TA 2VQSA 2ZSDA 5K8TA 4KYUA 4QNMA 3SJZA 2A5FA 2LKDA 1UBFA 4II7A 5KNCA 3I92A 4YC7A 4DEYA 4WW0A 1M7BA 3QBVA 2WHXA 1KYIA 4RD4A 1E9RA 1KO5A 4JLNA 5GVRA 1Z0AA 1FUKA 5KPDA 4DWJA 3GJ7A 1VIYA 2GEUA 4MRVA 3C4JA 1E2MA 2VSXA 4XIGS 5D3QA 3TGPA 4TZ6A 5A0FA 4A82A 3FGNA 1R0ZA 4CEIB 2CHVA 4NYJQ 2ORWA 5JS8A 4JLJA 5J4VA 3BS4A 4Q48A 4BWYA 4DDWA 1T3SA 2GXQA 1GUAA 4ILEA 1E9DA 3TNFA 4BFWA 5FPSA 3BOSA 4GMDA 1FNNA 3EPHA 1G8HA 1ZUNB 5FOSA 3EARA 4V0OA 4AG6A 2O8CB 3FMOB 3GJ0A 2F3RA 3RS0A 5JJKA 3U44A 4TT3D 1G3QA 2FPLA 2WWGA 4RVCA 3DEFA 4A8JC 2VYFA 1DS6A 4FMCF 4LCBA 2IYLD 2ZRKA 3RWOA 5TB5A 1XTIA 4A2WA 3OAAD 2GVZC 2ZJOA 3KZ1E 5H70A 2CLSA 3QY0A 3UK6A 4PHHA 4OHYA 1E2EA 1IY1A 1COWD 4Q5IA 3RNLA 3SE0A 1GP2A 2ONJA 1DELA 5AWFC 1P72A 1QHYA 1U81A 1HH4A 1ZC4A 2CDNA 5E4FA 3SQXA 4M8NE 4A0GA 3IHLA 5JCZA 2G83A 2QM7A 3LBNA 2FGKA 4RD3A 3LQQA 2EYQA 2ZSAA 4MGZR 5JHHB 4M1YA 4V0LA 4MKIA 4PHFA 1YR6A 2EFGA 3DOFA 2QSZA 2W6JD 3CO5A 4ASUA 5LBIA 1XDBA 1U94A 2SHKA 4BPBA 4DSOA 4HI0E 4BFZA 1L7VC 3AKYA 1UBGA 5TVKA 5AR1A 2CL6X 1LY1A 3ADBA 4DLZA 1H8HA 2PEZA 4LI0A 2NO9A 4GZMA 4X8HA 2PBRA 5SZJA 2W0SA 1E1RD 2F9LA 3M6AA 3F0TA 3U3MA 4B3XA 1PVOA 2FZ4A 1ZCAA 3KTAA 3NBFA 5KPJA 1XXHB 2QAGC 4KV9A 3SN6A 2KB0A 4AD8A 2QU8A 2IUSA 3QEOA 4G01B 2ZRLA 4LYJA 4QC2A 3B6EA 4V0MA 1X86B 4LUCA 2IWRA 2BCJQ 1P9WA 2FE4A 2I4IA 1ELOA 3L0SA 721PA 3OEHA 4Q4AA 3QIAA 4KLZA 1E2PA 2D62A 2IUTA 2JIZD 3WBKA 3CNOA 3SDZA 2VPPA 1AKEA 1CR2A 2C9OA 3AP1A 3IQXA 4RSGA 4C0SA 4W9MC 4FMCB 4TZ0A 4TTRA 4YQFA 2BCGY 3AGPA 1D8TA 3Q5EA 1WRBA 3I8XA 4HB2A 3I5YA 3SFZA 4FCWA 1E2FA 4HAZA 2D7DA 4JJZA 1KSGA 1CRPA 4K81B 2WMOB 4RZ2A 2MMGA 4AC9A 2ZROA 1KMHA 3CRRA 2XEXA 5TDHA 2OHFA 3P26A 1G6OA 1HY3A 4B34A 1R5BA 1E6CA 3HPRA 821PA 2B7CA 1SXJB 1E2NA 4FW9A 121PA 2X77A 3TVDA 4EKDA 4U00A 3WYFA 1GNPA 1MKYA 1XBTA 1EFUA 2VLIA 3TIFA 3KQNA 1YRAA 1ZD1A 4M1MA 4Q9LA 2RGEA 3ZD7A 1NY6A 1H65A 2DFNA 2OG2A 5JBQA 1XCMA 4E09A 5HKKD 5GJWC 3NBYC 2J45A 4DHEA 2X2FA 1NY5A 3CIOA 1N5JA 2ZI4A 4HZIA 1KJZA 1TF7A 4PSVA 1FP7A 3FMPB 3EW9A 4JBXA 4QXAA 2KWIA 2BEKA 2OCPA 5F9HA 1BIFA 3B13B 1VYUA 1LNZA 3K09C 4HZUA 2Q9BA 1YQTA 3I72A 3QVUA 4IDPA 3V4FA 2EU8A 1II8A 3KL4A 3NVAA 4FD2A 1QVRA 1N5IA 2NPFA 2NOAA 3ZGXA 3I73A 3I8SA 1HTWA 4D4MA 1RKBA 2GKSA 5EE9A 1BYIA 1MO3A 4WVFA 4AIIA 2EW1A 4F4JA 4FCVA 5IK2A 3SU8A 3AF0A 3NXSA 1OF1A 1GTVA 1YZTA 2VO1A 3CR7A 4CEHB 4BLPA 1XMSA 3NH6A 4M9SA 2IUUA 4GSYA 4DLRA 3DZDA 3WBJA 4NHOA 4MRSA 2DB3A 5J40A 3CX7A 4EJSA 2WJIA 2ORVA 4HAXA 4D80A 4ZI3A 4P0TA 5KTYA 2ZRAA 3T34A 3TRFA 3ZH9B 2BV3A 2ZRJA 4US1R 4BEBA 1G4UR 1Q1BA 2GK6A 2ZE6A 4LJ7A 3OHMA 1Z0DA 3QF7A 2I1VB 3VR3A 2FPMA 3WMEA 3U7FB 2AK2A 3FHOA 3KUCA 3LQRA 3PUWA 4PC7A 4J0QA 1ZD8A 3IBGA 1FMJA 2A30A 4M21A 4TL9A 3W5JA 5H8WA 4I1UA 4Q9IA 2RGXA 4RZ3A 3QXXA 2RB4A 1G64A 1SULA 4LYAA 4CIDA 5TMPA 3QPVA 4LC1A 2JDID 4C0JA 3U60B 2OCBA 3H1TA 3LLMA 5FTNA 5IF9A 2C5LA 3EC2A 1OH8A 1KKMA 1Y3AA 1RRPA 1P2VA 4B33A 1JB1A 1TU3A 2V1XA 4G5GA 1F6BA 2HYIC 3EPJA 4GZLA 3GJXC 2ZYWX 1X8LA 4BFSA 2WOJA 3I4LA 3P27A 4AG5A 1OE0A 1ZUIA 4B2LA 1KKLA 1SHKA 2ZRNA 5AUQA 3QXCA 3WXMA 3QVVA 3B82A 5KSPA 4IW3B 4NCHA 4V0NA 1UF9A 1EX6A 4EPWA 4MYHA 3TMKA 1FNMA 1HV8A 1QHSA 1UDXA 3IQWA 2W00A 3K0AB 3KKQA 3MUFA 1RRFA 2GESA 2ZSBA 2BDTA 2QRZA 2FH5B 2P6RA 3PXGA 3U61B 2QSYA 4GI7A 4DLSA 2W2TA 4G1UC 1JI0A 4U5XA 2ZI6A 1LF5A 5FOTA 1Z08A 3UMRA 4TMWA 1IY2A 3MD0A 4DT1A 1IJEA 2BBSA 1SVIA 2GZAA 4B3FX 1SKYB 2J0SA 1QG2A 1YE8A 3X1XA 2G1KA 2XXAB 4IVPA 1EFRD 4QGHA 3LDAA 3KFXA 5E7JA 4AKHA 2WWIA 4CT4B 3PUVA 2PX0A 2CLDX 2ODBA 3TSOA 3T1VA 1MV5A 2R6FA 2VP9A 5CLQA 5EXPA 2IYSA 4JIMA 1ZBDA 1XFAA 1OHHA 1E2DA 4ESHA 1CRQA 2IS6A 4CF7A 3QXHA 1ZNYA 3U7EB 5B57C 1EGAA 1XTRA 3BFVA 2ZRHA 4KBGA 3MAAC 1FL9A 1SXJD 1R10A 3TKLA 5F98A 1JBKA 3A1VA 4H9GA 3ZS8A 2WWXA 2BVNA 1GKIA 2R6DA 2CVFA 3CM0A 2NZJA 1YZQA 2AK3A 4B3GA 3MFYA 3QOFA 5AJWA 3TSZA 4ZKDA 3KFVA 1G3MA 5IDVA 3AH8A 3SR0A 421PA 2V7QA 5DO9A 2GAOA 4MYUA 1AS2A 2C98A 4DSTA 3C8UA 3CLVA 3CBQA 3LBIA 3LBHA 2QBYB 1O3YA 3NTUA 1Z47A 3F8TA 3AP2A 3EZ7A 3WNBA 4BZPA 1NVUQ 2E87A 2ZSFA 4QM7A 1CJKC 1F2UA 3FE2A 2D74A 4NYJR 3S1AB 5L3QA 2P5SA 5B64A 1UJ2A 1UKYA 3U4QB 1E9BA 1ZU5A 2Z6VA 1S1MA 5K8IA 2IF2A 3K9LA 1CU1A 4EUNA 1GL6A 4ZKEA 5FI1B 5JRJA 4B48A 2BEJA 2CCGA 2ZI7A 3VR4A 2FOLA 4LDJA 1A4RA 3T12A 4DCNA 3AVTA 4PAOA 4F38A 1S4QA 3K0SA 3TJZA 5KO2A 1YR7A 5AUNB 2GJ9A 4DSNA 1XEFA 2PLFA 5DI3A 5CB6A 1G4AE 5L3VA 1X8JA 3GJ3A 4U02A 4C9BA
chains in the Genus database with same CATH superfamily
3M6WA 1QF6A 3ORQA 5GZ1A 2FW9A 2O1XA 4GBJA 3I3OA 3MONA 4RMNA 3DDWA 1S2DA 2PZFA 1MO6A 1AGPA 2C1EA 2H17A 1ZP6A 4G36A 4TSKA 1LPPA 4XSHA 3CLTD 4NJEA 3SVLA 2XQVA 4U8HA 4JP5A 4QEZA 3UH1A 2XNJA 4JI3B 1QE5A 2PMBA 3SX0A 5B4UA 5KTMA 4YP6A 4S2UA 4YJHB 3R6TA 1FZQA 5EWMA 2IIBA 1KI7A 4IMPA 4WKGA 4PQGA 4H4EA 2RHCA 3TZBA 1SWWA 2O8BB 3QUBA 3H5WA 3OJLA 3HKBB 4IHJF 3ZQUA 3ZLUA 2H0RA 3K0CA 4DV4B 4DA9A 3PS9A 3NW9A 4MDEA 1XWWA 2BR3A 2DBVO 3X1YA 3KQHA 1TJ3A 1IDOA 4E4RA 2I80A 1QO7A 2HDOA 2Y77A 3FVWA 2BTQA 1GITA 1X6VA 2G36A 2GM5A 2GQ0A 2H7VA 2I2AA 1DOAA 2YBEA 3F2VA 1U2DA 4QUIA 3QKRB 2ZYUX 4PC3A 5DM2A 4YGXB 2X2PA 3O2NA 2RGGA 1FQJA 3DW1X 3KR2A 3JPYA 4QBFA 4ESEA 3AJEA 4YR7A 4QBIA 5EY5B 4CQJA 4B76A 1DC4A 1QTRA 4Q7MB 1FFYA 5CCEA 3PLAE 1I14A 1ZVMA 1LS6A 4NB8A 5LYJF 5CA1F 4DA4A 1CZNA 3EXHC 3HYSA 3DVRX 3UUFA 5LU9A 2JD2A 2XQKA 4CTNA 1WTCA 4LV6A 4YQZA 2SKCA 2ZDQA 2DCMA 2QJOA 4C6TA 1ZVKA 5DMHA 5EPOA 4DLLA 1RC8A 2VC2B 1Y1TA 1D2GA 3LYAA 1KAGA 4JYCA 2DFVA 5EIAA 2XECA 2V96A 3DDUA 4RKYA 3G5UA 2X8WA 4J0KA 5DNEA 1F14A 1PZNA 3KZXA 5FBKA 5YASA 1ZHFA 2FSFA 2R1UA 4EUEA 3G7UA 4G0XA 4FR5A 2VHTA 4GI1A 1XB2A 2BY4A 2YWHA 3NX4A 3TXYA 2VK8A 1YDEA 3TIIA 1M76A 4ZIRA 3EVTA 3P2JA 4Z6KA 2WP8J 4C4YA 4L95C 2Q6VA 3BJZA 1IOVA 1P6XA 1QF9A 1M2WA 2HK6A 5JSZB 4DJ5X 1KZ4A 2PD3A 1JHQA 4FOTA 5IM5A 2OYCA 4DNOA 6AT1A 1H0HA 3PTAA 2R8XA 2ALJA 1PGOA 4IUYA 1K8ZB 2X2EA 1E3JA 2FMIA 3GGPA 4N5IX 4TKUB 3I09A 1A2QA 3OY2A 3C3PA 4OMDA 3ZWWA 2F7SA 3MCUA 2YC2C 3WAJA 2PX3A 4CLOA 3U49A 4B35A 1N1EA 3RIEA 1JJ7A 2DFTA 5J2UF 1JEDA 1N3LA 3R8XA 2HB6A 3LX4A 3RYFB 1MBZA 2UVQA 1MEOA 3E1SA 5JZVA 4J03A 2H4ZA 1CVIA 1COWA 1FYDA 1YI21 2ARKA 2XRFA 3AU9A 4IHJB 4LBYA 4M1ZA 1E7WA 2E49A 2O48X 5ESWA 2EJCA 1N32B 5DB4A 3KPYA 2C95A 1VYTA 2G67A 2IIVA 2X6QA 3JQ8A 1Q822 3QE4A 4FT2A 5TPWB 4UTNA 5D1OA 4NNPA 1EK1A 4FKMA 1W2WB 1E6EA 1YT5A 5JASA 2J5XA 5JE8A 4S0XA 1KE1A 2Q3MA 4GOLD 3CV3A 2PMZA 1PFGA 3GT4A 3GFFA 2WVAA 5DHFA 4OOFA 1AC5A 2F8LA 4YCJA 3PJDA 2EAUA 3AY3A 4EF5A 4LHEA 4NCJA 2W6JA 2GBFA 5CA1B 3GV0A 3Q7EA 4LG1A 1QGUA 3RJZA 5IWAB 1KORA 1SAYA 3W1VA 3ZD6A 1JS1X 3A6DA 1XEWX 4PZ0A 4ZRDA 4AJOA 5TV2A 3EAGA 1Z38A 1JTVA 2W7TA 3CCL1 4EJSC 1H9AA 3ND9A 2FPOA 4ZPXA 5T3YA 4QU8A 3MYYA 2OO7A 3T4PA 2X7HA 5KU7A 3VGJA 3CW2A 5CUQA 4Q82A 2EQBA 3GCXA 3PXDA 3SDBA 1IUNA 1Z4JA 2OCDA 1SCKA 2ZJ1A 3QHPA 2I33A 3FHJA 3QLJA 3ZDFA 3JQFA 3KJIA 2HAEA 1U1FA 1XF1A 4CKEB 3PQ7A 2WSIA 1K2WA 1Q862 3WYBA 3IT0A 1CULC 3OJWA 4WLNA 4JITA 4KACA 4ACAA 3B1VA 4KE8A 4CZ2A 3S8YA 5K7SA 3ESZA 3ZIUA 5A3SA 1U8FO 3AFHA 4F06A 1BKYA 1BE6A 1I6LA 4KVZA 4A0RA 4DM3A 5B2EA 4S05A 3ME5A 4ZCMA 5KYYA 1QFXA 1QFYA 2FETA 4Z8XA 5C3UA 3UCXA 1LD3A 1JQLB 4PQYA 4R2WA 5IXYA 3J7AC 1ZMXA 1HDGO 3C70A 5IP9I 3F7MA 3DE3X 1K7SN 3NAMA 3ZBTA 2IYNA 4BX8A 5HS4A 3RVBA 3QWIA 1I7DA 4FQ7A 3ROEA 4HAVA 1KNXA 1F9AA 2JCBA 3R7DA 3RF6A 4FFBB 1JIJA 3UW1A 4EKGA 5FWYB 5J2UB 2JI4A 1TKAA 5K0FA 1ZHOA 3V8RA 1K8A2 3WFZA 4DA8A 4A1FA 2DE7A 4PG5A 3OZAA 4ZXPA 3SF0A 5JPDA 3CZ9A 2D1QA 1IWPB 5TF4A 3PC3A 4L85A 4QELA 2CXUA 2RAFA 3H2IA 1PEAA 3A6KA 4GPAA 3U0BA 4MO9A 4PN3A 2BFBB 4D4HA 2ZS8A 4XB2A 5IJXA 1GYPA 3ZZ1A 2SECE 2CNLA 2HWKA 4L9WA 4ARAA 3O4VA 4XUCA 4I5DA 3VSCA 3BKXA 4DRYA 4NNOA 2J59A 4DV1B 1GU0A 3GMIA 1F8UA 4BX0A 3PFFA 2NVYI 1RAEA 5IP7I 1HK7A 2I03A 4ZV7A 3ONEA 1HT2E 2DY1A 3TPFA 5KSWB 3BXEA 2MTBA 5GIPE 3N2GA 1T0PA 4LZAA 3IB3A 3M81A 5ERGB 3OTQA 3THWB 2FHPA 3MWEB 2H8KA 2IKSA 4M9RA 4RHFA 1MN6A 1PSWA 1FFSA 2NZ2A 3EMDA 1AQJA 2WB2A 1GPYA 5DXAA 2P4HX 3AEKA 1OXUA 4FONA 3GCFA 5GY7A 3RC7A 3EFOA 5B1DA 3SIXA 4A3DI 3EXAA 1IOLA 2PV7A 5MHTA 4RKFA 4EF6A 3E58A 4PZZA 4Y98A 4ZEXA 1ZK0A 2IT1A 2QA5A 2EEZA 3D7LA 4PX3A 3T7DA 5EIXA 1Z6XA 5JJLA 4BBPA 1NXXA 1DNPA 4CDMA 3TW0A 5GINE 3DZFA 4TN5A 3S4YA 4JYPA 4BNMA 3F6EX 1HL7A 2FMHA 3ZNQA 3N7AA 2P2NA 5EC8A 1NMZA 3U9SA 3GL9A 3EEBA 3OPVA 1SKUA 5UKDA 1AUVA 4M0FA 2C3OA 3FETA 2TMGA 4G4SO 4B6FA 2OO5C 1W36C 13PKA 3SIPA 3ZDQA 1MJGM 1SCQA 1ZIYA 4FJ2A 5C1PA 5BNTA 3TDMA 2VA9A 1SZPA 3EGEA 4U1RA 5DX0A 5DNAA 4FMDF 4BN4A 5B36A 3SWWA 1OBCA 1Z33A 3TR6A 4DAOA 2EW8A 3TOSA 5HKBA 5AI5A 3RK1A 1SEVA 4Z9YA 3UJ7A 1SH7A 2VJOA 3HL0A 2NQTA 2PUHA 1AHPA 3TKYA 3KOXA 1YRBA 1ZO8A 3G79A 4GM4A 2QTFA 3JZIA 2YIMA 4KAXA 4P54A 3IE1A 4ZTUB 3PDHA 3MRTA 4WFKA 2DQSA 2PUVA 2R62A 1VHJA 1FUYB 2RGYA 3KDPA 4FSDA 3RS5A 3V5NA 4TMXA 4B3DA 4H7KA 1XTSA 2LIVA 4WACA 4ZQEA 3OU7A 1M2OB 1Z82A 4Z9AA 5HSGA 5DNUA 3A26A 4BQIA 2JA6I 1X1SA 2OOYB 1QH0A 2G9RA 4H6PA 1JIXA 1QV6A 4HYQA 4R1SA 1QP4A 1C30A 1SOVA 1GTRA 3NIFB 2GUWA 2JDIA 4KOAA 4MA0A 3B5IA 3MINB 1C9DB 3OTHA 1VCIA 5FL7D 3RSHA 5J3JA 1GL7A 3AI7A 2X1MA 5E6RB 5JXJA 1NVVQ 1G18A 2ATCA 2I2DA 3KK0A 5ALDA 2Q51A 3UMJA 3DBVO 4V2IA 4DMCA 1E2IA 4BVGA 1QR2A 2EARA 3EZ6A 4LJ9A 1ZJZA 1EVZA 3GAAA 2WZCA 4UUOA 5L7WA 1NI5A 3ENVA 3VKWA 1V6SA 3TQCA 1I9GA 3DMYA 3O1HB 3SJCA 3D9XA 1M0SA 1K3UB 1L7EA 1WSWA 2W0MA 4KN6A 5EEGA 5GP1A 3RAPR 3SY8A 3FAZA 1NW8A 5EJ8A 3NHPA 3E3NA 1HT1E 1P19A 3ZQ6A 3CBGA 5KTPA 1XT6A 3AVWA 2UZ0A 1ZESA 1MU0A 3VYVA 1N4DA 1JPJA 4R6WA 4F8JA 1MLDA 1N6HA 2VAXA 5ABPA 5IT0A 5F21A 1Z2NX 3NU1A 2GLXA 1OTHA 3L46A 4AK9A 2G8LA 2LIYA 1D4OA 3AHIA 3CPHA 5F4BA 3ELBA 1YBFA 2A84A 3MWKA 4ZDIA 1GGKA 4MAAA 1EIWA 1G291 1N7HA 2AS0A 4EP1A 1FA9A 3HLKA 2IIQA 4RMHA 5DYYA 2JGDB 1UBJS 4PGAA 1CT9A 2GEKA 3L4BA 4JB0A 1GNTA 1J0XO 2HJVA 4RZXA 4UVDA 3EZNA 2F90A 1S89A 3MGCA 4QOSA 4JSRA 1MP0A 4FMDB 1WOYA 1GARA 3A1UA 2ZR8A 4X91A 1BE1A 2FEOA 3VSEA 3A1SA 1ORHA 1OPRA 2ZI9A 4EFKA 1JDZA 3DOJA 2HA5A 1T8RA 5ELLA 3VO8A 1FJXA 1WP4A 2WKSA 3DAHA 3GJ4A 4PPFA 4ZODA 4YUYA 4Y0AA 5JAZA 4DUZB 1RAFA 3QVGB 2ZI5A 5JARA 3U81A 3VI4B 3EJ6A 5LPNA 4MQEA 2RHOA 3E7DA 5FUMA 1W49A 2CNWD 2J31A 4OQNA 2GVNA 3RRFA 1PUJA 4H0CA 4LOAA 2FEWB 4OF4A 1BD4A 4OHKA 1H6BA 5LXTA 4WLOA 2FAXA 1M902 4NPCA 4DCJA 1YACA 4DEVA 3ZHVA 3RO7A 2WFLB 4Y6RA 1Y9JA 2HU5A 3CZ5A 2A0XA 3MTJA 3QA9A 4EG6A 1WZ2A 1GPKA 1QF8A 5I8ZA 3P4UA 5CB0A 4LMAA 2CYAA 1MR3F 5JEEA 1DWOA 2PRSA 5LVAA 4PO1A 4NVRA 3VHXA 1OXXK 2HGZA 4ALKA 1GQQA 1RU3A 4GR5A 1Y9DA 4GWLA 1HG1A 3PRYA 4X8OA 4D43A 4X64B 3JVIA 3E53A 1NBME 4RA9A 4UBOA 5EQFA 2J87A 3QEJA 3RTGA 3CH6A 3OA2A 4I6EA 1X7WB 2QV0A 1T8TA 4RDCA 1ZU4A 1CW2B 5AJUA 2BEWA 3D6AA 1KVQA 2GASA 4UKDA 1F5NA 1L6RA 2O3UA 2ZB4A 4POAA 3Q1KA 3LNTA 4EVSA 3R75A 4A3FI 5MFPA 4AXXA 3HYRA 1LNSA 1YUBA 3OURA 3P4XA 3O8LA 2OHXA 3CMMA 2OEPA 2WWYA 4LSMA 1XMVA 2D59A 2ZVDA 1FRNA 3AM4A 3PPXA 4P4SB 5AD1A 1FMFA 4A3II 4I1IA 2NU9B 2JA5I 4CEHA 3LPLA 3LTNC 5JNRA 2HCFA 3K35A 2A0KA 2BW0A 3PSHA 3QJYA 1EVYA 4HMPA 1BEZA 2IPNA 4B4DA 2XGGA 1ZAYA 3D5TA 3WBFA 4YA6A 3TFWA 3UTDA 3TG8A 2OAQ1 3TB6A 1VI5A 1UUFA 3AYXB 3OLYA 3HSKA 4MAMA 3FFXA 1I6WA 2PYIA 4E5NA 1YI0A 1NVAA 1SUWA 4WECA 3VSAA 3T7CA 2HCBA 1K7XB 5E7QA 3IBSA 1NAHA 4TMZA 1GPLA 1JXAA 3BFXA 4DIMA 3P7MA 4KXQA 1MO2A 1JFVA 3ZNPA 4HSEA 5EJFA 3D43A 1MJNA 4I8IA 3VKVA 5FXMA 3A7EA 4AX8A 1T8YA 1SM4A 1RYEA 4ZEVA 4ZGGA 2JA8I 1WQ4A 4GU5A 3RNOA 2DLCX 4IKOA 1FNDA 4IIXA 4B2IA 2YMQA 1QNLA 5J5AA 1V7CA 1SZDA 1Y6ZA 3UO8B 4WBNA 5I7OA 3BD8A 1ESMA 5DZSA 4W9NA 2DYKA 2PX5A 5I8WA 2RD2A 2R6HA 1P8AA 2WF6A 2B9EA 1XX6A 4Q3KA 3EQ8A 4MW4A 5JWRA 1I7NA 4QFMA 1TQ2A 2X0KA 4WMLA 2X0DA 3VC2A 2IFTA 1RKQA 2XWSA 3FSGD 3U09A 1L4BA 1HX7A 1YS4A 4HH4A 1E5QA 1YHQZ 5J47A 2GZMA 1FDTA 2NZWA 1R66A 4JAVC 2IRWA 3S99A 1U6KA 3PQ5A 1JQDA 2Q4DA 3C3EA 3PI6A 4PCVA 4CIYA 3O9VA 2A92A 4DA0A 4UHDA 2MSNA 1T9ZA 1NPYA 2NWQA 1MAHA 4HN4B 5A4DA 2IZ5A 4O5AA 5BV1A 5CLHA 4HTFB 2I1LA 2OCKA 3W6UA 1QDUA 4KGDA 2D7JA 1BWRA 1JZSA 4P98A 3CTMA 4KNVA 1XFDA 4LZLA 3ZTYA 1CY4A 2P27A 2VUIB 2ZIZA 1ZS9A 3T7AA 4GP9A 3UQYS 5IZCC 3CUVA 5JZSA 2OCAA 1V3QE 1NLFA 1U9IC 2Y8EA 3PFKA 1PV4A 5A4IS 2FEMA 3QWHA 1ONSA 3D2LA 2AF4C 4XEHA 1HEUA 4WLUA 1CZOA 3HB4X 2B6NA 3OZEA 1UDWA 4KGXA 5DBOA 3FYSA 2FSGA 3RUAA 3EXHB 3THOA 5MN5A 2UKDA 1RWOA 3KZMA 4C0KA 4ARIA 3QFSA 3CC41 1JIKA 4QQ8A 2FKAA 5K8VA 4YP0A 5SYNA 2PNFA 4DARA 1OVMA 1R8JA 1RYDA 1IHDA 2GILA 4PTLA 5IT4A 1KSFX 3G5TA 3V8PA 3EAQA 3MQ4A 4O4IF 4JI2B 1JWBB 1M7GA 1U8EA 1ZK2A 1BMQA 1FK8A 3BXHA 3G4SZ 1OASA 1Z6TA 2WHYA 3HFSA 5AW0A 5HVNA 2Y05A 3HWX1 4BP3A 1CETA 4DREA 1L5MA 1QFMA 1Q0RA 3G88A 1Q14A 3GRYA 1QZXA 2JLCA 2VG8A 3H6GA 3KX2A 4IY1A 5FTWA 1E61A 3PR1A 2R47A 5JY6A 1R64A 3DT8A 4G41A 1ST2A 3E9ZA 1OKKD 3HJUA 1ULHA 4IV5A 5EMHA 1CVLA 1Q22A 2WJZB 3IT3A 4RTPA 1NW7A 4QYIB 1E4EB 1HQDA 3H84A 4GKVA 4MV4A 1U9YA 3ZXYA 4R2LA 3KP1A 2W70A 1A2KC 2HU8A 1QHGA 1XYVA 2I1WA 4BNDB 4W63A 3PJRA 1XNRB 1P9LA 2WFAA 1YVDA 2B1IA 4M8SA 2PS0A 1DU4A 2WKRA 2XMQA 1A97A 2ZJAA 1BU5A 2QJRA 3IPXA 4H7FA 3BE8A 4RF3A 1U7TA 5HEKA 3UY4A 3YASA 5A3QA 3MOSA 1CS4C 1N57A 3BQMB 4WDQA 2V4UA 4ZICA 4AZVA 2RONA 4HGZA 2HMUA 1GZSA 1VLMA 2OXCA 3BN3A 3N1UA 1KZGB 2O52A 4BY7I 5CCBA 3RUPA 2MSCB 2PT9A 4NZYA 3WX0A 4AT1A 3PK0A 5EFOA 4QTUA 1DUSA 2CL0X 2CE2X 1TAQA 1AMUA 3STHA 3RFVA 1G6HA 2FZVA 3K72B 4WD3A 4G1EB 3G0HA 3QEAZ 3TLGB 4ROSA 3UWKA 5DK6A 2HFKA 2OLKA 4R41A 1XPOA 3A31A 3DGFC 4CVNA 4F9EA 3L7JA 3TQRA 1M1NB 1PG5A 1E6MA 1QLJA 1XELA 1KJ9A 2AFHA 3A9CA 3LMKA 2BISA 4ES6A 4A8TA 5K0TA 3M4YA 1Y1VS 2P0YA 5DPMA 1J2JA 4DQKA 1DRWA 2GA8A 4L8FA 4RELA 4B4UA 5M04A 3IP3A 4C5AA 2ZCUA 1F4LA 1L7DA 4Z3OA 3OICA 1ICIA 1WMFA 5JVDA 3HTXA 2JJ2A 4FYPA 3RC1A 3MUEA 4M8LA 4NV3A 2I3ZA 1U0GA 4OSEA 1K731 1XD9A 1LK0A 3DOHA 2I29A 3BD9A 3Q40A 5TQ2A 5DISB 1AKMA 2HHCA 3C15C 1Z4IA 4G2NA 4LW8A 2ZBUA 1ODFA 3EZFA 3M2TA 4G07A 4O4IB 3WB1A 5FPKA 3KZVA 1YRYE 2A1UB 5DX8A 1UP4A 1E3MA 3JWIA 1M0TA 1Z6GA 3QHQA 1G4HA 1SEPA 1W2BY 3SBDA 1VKZA 2QVCA 2X41A 4RVUA 4BC1A 4CU5A 4YRBA 3AEXA 4XGNA 5ADHA 4HJXA 2HSWA 2QRVB 1LXCA 1TA9A 4JBYA 3GQBA 4DDMA 2CWWA 4HLCA 2EFHB 5F7ZA 3ICQB 3WGUA 3FM9A 4NLLA 3VTAA 1CQXA 3A4VA 3ITNA 4IIUA 2AW3A 4CR8A 2VWQA 3EWSA 4ZC8A 4B79A 2CT8A 2FN7A 1NVVR 3X1JA 4JYMA 5B6JA 4G4GA 1EP3B 5CH8A 4AUNA 2GBLA 2XZPA 3KYIB 3WRYC 4QT4A 4XVUA 3EVAA 3SS8A 2G0TA 1A69A 1BSVA 3HU1A 3NRBA 5KWJA 2WA2A 1N8SA 3UPTA 1C2TA 1DQYA 4F11A 1U3TA 3DWGA 3T7RA 1US8A 3VMGA 1NGSA 3FG9A 2EP5A 1I4EB 4DMLA 4DZRA 2QMYA 1VGQA 2G4VA 2HA0A 1EFKA 4IIHA 5L7YA 1GPWB 1VLVA 1EM8B 1I80A 2J6IA 2REXB 4LHWA 1E3SA 4ZVQA 2J3JA 4E7OA 5LM3A 5EJ6A 4KO8A 4Q1EA 2I6TA 5IF3A 1TZ2A 4V38A 3L8YA 2Y3IA 4NXMB 5BN3B 3WA6A 1G8PA 4EECA 3F5DA 4YCMA 1NJ8A 3R7BA 3L8DA 1HT0A 3IDZA 2O2GA 2X8BA 3DHNA 5DBIA 1G60A 4MUAA 4JBNA 4PC6A 1CR4A 3DDHA 2VT2A 1CCWA 1L7PA 3C5CA 3HVUA 2AIRA 4DHWA 4EF4A 4KAAA 4W6QA 1YS9A 5JCOA 3QFCA 3S5UA 1PT6A 4TV9A 4WCDA 3SEAA 5K8JB 2GTIA 2O8DA 1HYGA 4LY6A 3HR8A 5PNTA 3FJ1A 2DE0X 5F9FA 1YE3A 1KK2A 2QPLA 3FVRA 2A57A 3JYHA 1G8JA 3DCIA 3ZC3A 4ENQA 1K6IA 1TT5A 3N8KA 3GG9A 2D8MA 3I12A 1U0LA 2J85A 3WGOA 5C46F 5JNVA 1NVFA 2DBYA 4IGFA 4MRPA 4D9MA 5CDFE 4JX8A 3W2HA 4YUVA 4CMHA 2JIDA 3BERA 3GJ5A 3UCFA 2QRHA 1K68A 2YV1A 3VH3A 1O4WA 3FWKA 1R0LA 1CC1S 5GADl 4BLRA 5FWXB 4YVFA 1RHRA 1EFTA 1O89A 3ZVRA 3SCZA 1WAMA 4IDQA 2Y1DA 4JFRA 4WZ6A 2UYYA 3I37X 2BEUA 2GYUA 4GR9A 4OSPA 4YMWA 4CLHA 4FSXA 2XMGA 4O63O 2FHSA 3CLKA 3P9XA 1W36B 3ZGZA 4XZ3A 1NBHA 1ZN7A 5LNK1 3CZMA 3D4NA 4CDRA 4LHVA 5T5QA 4O4LF 3V4SA 3AR9A 2WYWA 3IILA 2NVQI 3ZGNA 1DFGA 3S1NI 3GELA 4A10A 6NULA 3ICCA 2IEIA 4JBLA 1I5RA 2OBNA 1HYQA 1WDTA 1I50I 4MYRA 2PGOA 3PA8A 1E1KA 1JHXA 4OUDA 4TTSA 4YCBA 2VXBA 2YRWA 3ESYA 5I9SA 4YO7A 5LZ5A 3U4CA 2GEFA 4AP5A 3H18A 1ZDMA 2DPLA 2C78A 1GZ4A 4ZZ2A 5IWCA 3EQZA 3JYPA 1CUAA 3FLEA 3PNKA 1IPFA 2C57A 1ISSA 1ECBA 1GHTA 2HF9A 4MGIR 2YX1A 4OKSA 4DN6A 1NJSA 1RLJA 3ZI4A 2H5IA 2QYHA 5ILOA 2ACKA 2UUAB 5TEVA 1RJFA 3ND5A 1JZQA 2X0EA 3PTZA 3W8NA 3D2BA 1K7YA 1ZVVA 1JRLA 2IH2A 1L5OA 4XA8A 5ALOA 1C8KA 3S2FA 2OTLZ 4B46A 4LI3X 1NR1A 2J0UA 2Z4RA 3N8GA 3PO3I 1XTBA 3FI9A 3I2YX 3PUHA 2HBYA 1AXGA 2YZNA 2CDCA 3OF5A 4DY4A 1OFGA 4FX5A 4MQ4A 2D2VA 4NTZA 1CIPA 1KI6A 1OWOA 1HFEL 1NF3A 2H3EA 3P2OA 3QF4B 3WKCA 5F4ZA 2GCOA 5T3UA 1DJLA 3CLTC 3IRUA 5U4XA 4MVJA 3SQNA 2FN8A 4IWXA 3V7UA 2CUNA 4DDVA 2P0EA 4BJ3A 3AR5A 4BTVA 3PT5A 2CHQA 1LBHA 4HGQA 5DBGA 3KQOA 3OE4A 2JLAA 4G1FA 1ZOIA 5B2ZA 4YGYA 1Y8RB 4UEWA 1I4WA 4HH3C 4NMHA 3LX6A 2JASA 4PO8A 3V8BA 3RVOA 5TPZD 4JOSA 5A6SB 3LUHA 1NSFA 4CEJA 2W6CX 2HU7A 2VRCA 4BMZA 5KOYA 2XDAA 2JHCA 1KEWA 4JC8A 3ROXA 3WLSA 3VZSA 5TQVA 1Y0BA 3E8XA 1L5KA 4FFWA 2JGEA 2OB1A 2G1JA 3V4PB 4XWAA 1W5BA 4F2GA 1O77A 1YRLA 3EA4A 5IT9f 2PVPA 7MHTA 2RGNC 4K0KB 4HLUC 4NQRA 3SKYA 2QLVB 3OEYA 3ZGYA 4E1AA 4RTRA 1U5BA 1L7OA 3MW8A 4G5QA 4CRWB 4ENWA 2J7PA 3K9HA 1VL0A 4JKOA 4LX0A 1G1AA 2B36A 2QN7A 1TMYA 2YIJA 3A4IA 3GD7A 4MHOA 4RAOA 1CQPA 1KFCB 4WCFC 2XF2A 1VE7A 3PUZA 1MTZA 4O4LB 1L7AA 1YK1A 4I3FA 5F64A 1IUKA 3HPQA 4DCUA 3FR8A 5HJEA 4JK3A 4TROA 1IONA 1HDOA 2PIAA 3W78A 1ONPA 3X44A 1NFQA 3G02A 3ESBA 5FCDA 1Z8HA 3IKVA 3BXFA 4WKOA 4MO2A 3KVOA 2EWWA 1JNYA 3RVLA 4CGYA 4WLVA 5ECDA 1JVNA 4BUCA 2HGSA 2YADA 4KL8S 5CH5A 5AQEA 5A3RA 3WOHA 4QD3A 4S0ZA 1RS0A 3NHAA 1XQ9A 4OHPA 1UOEA 4BEVA 3KJQA 5JDIA 4GLBA 1R8SA 1CY7A 1U6IA 1X9IA 1ZITA 4BLVA 3OQMA 1IJBA 1RWWA 4WN9A 3ZWPA 1WG8A 3N76A 3AERB 3D8UA 3P0HA 5AW3A 5I9NA 1ZD4A 4R51A 1L7NA 4I55B 3ZDCA 1GFIA 1WZEA 2JFQA 3PC2A 4PYJA 5A2Qf 4KZPA 5TT0A 3Q98A 1C9NA 3KU4A 3M89A 3PQCA 3QM1A 1YFKA 2XEDA 4UM8B 4Z9BA 5H9VA 1R4ZA 1TF2A 2O0LA 4QSHA 5JI2E 3P9ZA 4IDFA 4AN0A 1E6KA 2ZJ0A 2ZJ2A 3W79A 1I4TD 2HTFA 1KJYA 2R60A 3HACA 3ZV4A 3WKAA 3T8YA 1M34A 4QDKA 4IG9A 4M89A 2P90A 3KSZO 2VZEA 3ND6A 5BPHA 2QR1B 3JARA 2R79A 3RAGA 3P0RA 1OAKA 1BO6A 5C8YA 2L42A 5E2BA 3UN1A 3U80A 2WYHA 4KXLA 4LZPA 2YZGA 1TAGA 3L18A 2Z2KA 1TTHA 1VSVA 4PPYA 1A9TA 3A2NA 3ADBA 1GG2A 5LKRA 4ZANA 4F4CA 2HQSA 2MCFA 3E22B 2H59A 4RFLA 4XJXA 1ORVA 3OT1B 4MDYA 3IMFA 4OBEA 2Z4TA 5G53C 1W25A 3HO8A 1FSZA 3OZFA 4ML3A 3REGA 3ESAA 2DE5A 3T0GA 4EB0A 5CB4F 3RG2A 1G2IA 2EIXA 2J5RA 2EL9A 2XYHA 1AN9A 3IPYA 1J5PA 3Q9NA 3B9PA 4I81A 5HZHA 2A4MA 2REBA 5ICSA 4ALJA 1A95A 1N3BA 1T36B 1ZI9A 1MB2A 1KXJA 1E8NA 2JS7A 2PUJA 2WAMA 3LKVA 4P2BA 1U1CA 4RDIA 2RGWA 4BNXA 4EHNA 5TMEA 2IYUA 3FMIA 3PEWA 3CCMZ 1JDBC 5CA0A 1QYWA 1MGPA 1L5VA 2AG0A 4YJFA 4DUGA 1UBTS 5EZYF 3L6RA 3ZU5A 4B3TB 1RQ7A 5EOVA 3T9DA 5K4HA 4G3XA 2PSSA 1SUSA 4UASA 2RH8A 4F2HA 5JSQA 1Y6GA 3BGSA 3LH5A 3M4XA 1YB7A 4XFDA 5DE3A 1T34A 5EP2A 4OX9Y 4I46A 4CUZA 3OCVA 1GUYA 3HGQA 3V32A 3RGWS 2QMQA 2B99A 2JL1A 2WNHA 3PUKA 1K2VN 4R8LA 1UDAA 2ASEA 2PMEA 1OGJA 4HLNA 3F97A 3EZGA 3ULKA 3ZCPA 3CVOA 3SOZA 4UARA 1R6AA 2GBPA 3H3FA 4IUCS 5H83A 1QH1B 3SZMA 3D0KA 5JADA 3LZCA 1RZRA 4EENA 3GLIA 3DOIA 3SYNA 3DO6A 2HJWA 3RFCA 4ARBA 4AJ4A 4D41A 3OJOA 4NATA 5K0JA 4CL3A 1SUBA 3QK7A 4KPGA 3Q9UA 5IKXA 5FJJA 1DO0A 3OZVA 3BIWA 2P78A 3IDQA 4GF5A 1PJAA 2CUTA 4DC1A 4WNIA 2XZOA 2J33A 1N6LA 1T2FA 3H3JA 3HLYA 4IX9A 2DU8A 5DK4A 4AXBA 4UBLA 1UIRA 1Z2EA 3BX1A 1Q3TA 4I55F 3GT0A 4K9SA 4HH1A 2F3QA 2E18A 3OECA 2D2EA 4FIDA 3RVRA 3FWZA 1VJ0A 1Z2OX 2VNKA 2R92I 2GI4A 3W9UA 3SHTA 2CHFA 2Y6UA 2ID4A 1RQRA 3I62A 4H15A 2GXUA 5I7VA 1N6OA 1V4BA 2QAJA 3SE7A 4OI2A 3FYUC 1NUUA 2GD6A 2VUUA 1EP1B 2TSYB 4YDHB 3UZUA 3ZZ0A 5CB4B 3S2DI 1BN7A 4LVCA 4ZMSA 4ZWNA 3SHQA 2IYTA 5AM5A 4ZCSA 1JQJC 4TYQA 5DHAA 1L6IA 3RJTA 4UATA 2H1VA 4WUTA 3L92A 1ZJWA 2C9DA 3FVTA 4W1SA 1Q20A 2V7WA 1FTNA 3AVOA 4XDYA 5D84A 2DSTA 1KC82 2F48A 2NG1A 4F9TA 1TD1A 4DGSA 1FFBA 2I3BA 5D87A 5FJIA 1FTSA 4LXUA 4BDTA 2ZVPX 4C76A 4IILA 1W9MA 3VH4A 4KQCA 2FZKA 4P80A 3BMOB 1M75A 5EZYB 1IB6A 1OFIA 4MI3A 4MJ7A 4JI6B 1EX7A 3T9FA 3I6ZA 2WJGA 2W2NA 2O07A 4GAEA 2BBOA 3ZV5A 1F9EA 3DBLB 5DCUA 4TMVA 3HKEB 3EMKA 3DQPA 5JTTA 2C5HA 3Q87B 1Q57A 3IDAA 3M4JA 4BFTA 1KK3A 5TRTA 1F51E 4EIWA 4MLCA 3PNBA 4L74A 2YQ5A 4NZNA 5KYWA 1WCV1 3E8SA 4JOBA 2NUPB 3GRZA 3TZLA 3VB9A 1PL0A 3D54D 5COQA 4BJ5A 1DDIA 4RVHA 1KIMA 2B4KA 3QVMA 4WZAA 3WHPA 4E31A 3G3EA 3UMMA 5IJ9A 2CLFB 4XVRA 1L1EA 3IL2A 2ZUEA 3JVVA 4FDAA 3H9CA 1OZFA 3ZDAA 4PLWA 1UXKA 2R5NA 1IG3A 3WRXA 1OFTA 1P7WA 1UODA 2YMLA 3NMUF 4XIYA 1FJGB 1OXBB 3IT1A 2QQFA 3ER6A 3PC6A 2B0JA 2QT1A 1PK9A 2WINI 3D3WB 1M6NA 4N9WA 1OV4A 3HCNA 1NP6A 2FLKA 4GGOA 4R2KA 1CUDA 3B38A 4XUGB 4V1CB 4UTZA 1DKRA 1L5YA 5KYVA 3WQBA 1IBSA 4LBWA 3I64A 1U2DC 2ZWVA 3NATA 5KCZA 1MPXA 2OBXA 4XYGA 4MYCA 5CK4A 5DBEX 3N53A 4XI9A 3JASA 3PWKA 1PD1A 2Q5LA 4ER3A 3ADKA 3O8CA 1JR3E 1CLUA 3GZ4A 4DA7A 4PPNA 1A4XA 2MIIA 5TNXA 4ZJZA 2ODWA 1OT5A 1PQPA 1Q1EA 1UWKA 3I9OA 2RB5A 1WJ2A 1RYBA 2GPWA 2B5OA 1DE0A 1UBNA 1QHHB 2F3TA 1M2VA 2XMCA 3L43A 1P2UA 5C4GB 5D8DA 4PC2A 4NG5A 2CFIA 4HPJB 5B3KA 2IP2A 5KJFA 1E2BA 5ALTA 2GNOA 2H1HA 3L8MA 4A36A 1AKYA 1UT5A 4GHWA 4ZQCB 1TGYA 4ZVVA 2WD7B 4LECA 1JSLA 2NO4A 1SUIA 3UGQA 1U0EA 3OTWA 1KYZA 2AXNA 3PHJA 5EIWA 3ZY2A 1TVMA 1Y82A 2CF5A 2COEA 2J3MA 2R8RA 4HMQA 2G3YA 5FFNA 3LOQA 1T4CB 2IV7A 1P62B 3INGA 3UFBA 4X90A 1DADA 3SXJA 3B6KA 5KHAA 4D5GA 4EG3A 1HI9A 3WAKA 4ENVA 5JEDA 4CCAA 4XWWA 5BQOA 1CEEA 2OOKA 4AZ0B 1O94A 4RQBA 1EXMA 3HKZA 1RM0A 2Z56A 3SYRA 4LOJA 4A5SA 1N2CE 2YXPX 3LUKA 3QYPA 1KBQA 2BTOA 1Y3CE 4MW9A 3I39X 4G0YA 1KWGA 1X0TA 3AFGA 4QG3A 4RNCA 3H6KA 4IQ0A 3NYIA 4TZKA 4DR4B 1ZBQA 3IX0A 4MKFA 4XPIB 3F7OA 5LQJA 3VNAA 4JUAA 1YB4A 1ZUWA 1XMOB 3V4VB 1F1BA 1N6KA 1FFXA 1G3UA 1NZDA 2Q29A 3OE7A 4FHEA 2CGEA 4KMSA 1O96A 4OI1A 1K3FA 4ZJPA 1O97D 1UAGA 1D1PA 3NRCA 2OORA 4TM8A 3R23A 1SURA 2CEKA 3ZHBA 3LDUA 5CLFA 2B4TO 2QLBA 4TQ9A 1XNQB 5E2IA 2GHTA 3A2LA 1DAMA 2OKGA 2OMKA 2B8JA 2VRNA 3LW7A 4HATA 1A5SB 2G06A 4KFRA 3AETA 4ECEA 4UOZA 1LLFA 1NYLA 1OR8A 3QJ5A 5EIFA 1WZIA 3CCBA 4PS1A 5CTAA 1UMDB 4IEIA 2EBFX 5AXAA 3R0XA 1X3SA 3UXMA 2I0FA 4LA4A 4K88A 1QV7A 4LZJA 1BE0A 4GGPA 3KWMA 1MNAA 4QZVA 3K20A 1XUOA 4L27A 3SYKA 4TM7A 3R9XA 1SHJA 1ULSA 3PYMA 4HH0A 4PQFA 4Y6QA 2FXIA 5BT8A 4IJVA 1VQ9Z 1S3IA 4IZIA 5E6UB 3EQ9A 2YHBA 3BICA 1QGZA 3NBKA 2XGSA 3V48A 3V2HA 3ADCA 1KQOA 1AHHA 3G13A 3DMHA 1IHPA 2JVKA 5CPBA 2DQZA 3WDMA 1M5TA 1VI2A 3N58A 2YKGA 1LUAA 5AMXA 5IW8A 3KQYA 4M8KA 4ZT7A 1NQVA 1P2DA 2FI1A 3K1YA 2F59A 2RIRA 3PP8A 4FU0A 3SOPA 3GMTA 1FLAA 1GNLA 1PL8A 5FADA 4KPYA 4QYXA 3THSA 2YMMA 3L7CA 5E95A 3RTDA 3TOVA 5JDCA 4GDFA 4YMUA 1RAHA 5J2TA 3EGOA 4JH0A 4BBRI 2OENG 1WMBA 3D8TA 3N8IA 3EF0A 1WW2A 3PXAA 1KZHA 3ZCRA 4OSOA 1EKXA 2FRDC 1IZZA 5BW5A 4RKEA 2QX8A 1OIWA 1KR2A 1Z8FA