1P9NA

Crystal structure of escherichia coli mobb.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
169
structure length
162
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1p9nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9nA01
1Z5ZA 5FBLB 3K70D 3PUVA 1OIWA 3AP1A 2C98A 2EU8A 1NLYA 1P62B 3HJNA 1KKMA 2XTNA 1E79D 2CHVA 2KJQA 2ONKA 4Y0VA 4TSFD 1CJTC 2FU5C 3RDPA 4EPYA 3QUSA 4LC1A 1G8HA 1E2IA 4TWZA 4A8JA 1OF1A 1TQDA 5FUVA 1EFRA 2QORA 2ZIAA 1G6OA 4I81A 1UF9A 3AVTA 2GJAA 3PUZA 3C7KA 1DG1G 1P60A 1T8TA 1VYUA 4NCJA 4A9AA 2KBEA 4Q03A 2W6ID 4FMCB 5DN6D 2YVUA 3FMIA 4UJ5A 2C77A 3VR1A 2C03A 4MA4A 1GILA 4TQUS 4QJ4A 3QKSB 5KDLA 3WY9A 4C0HA 4AG5A 3VU9B 2ZRPA 3GJ0A 3BB4A 5A4JA 4C7OB 1FQKA 1RIFA 4A2QA 4UKDA 4MKHA 4XWOA 2QMEA 2V54A 1XEXB 4YMVA 1UBCA 2BHRA 3O8CA 2BMEA 4TMVA 5DIFA 4KODA 1TNDA 2G88A 3Q8XB 2FGKA 4GOJA 4M9QA 4C0QC 2WV9A 2VP4A 2IYWA 2ZRDA 4HEJA 4L9SA 3TQCA 5BWMA 1YU9A 4HLUA 4GBMA 1LFDB 3CM0A 4P4SB 3D3QA 5IHPA 1J99A 3OFND 4P4TA 1CTQA 1COWA 1GM5A 1DE0A 1P9NA 1YZLA 1ZNZA 1FNMA 2KB0A 4JJZA 3VFDA 1NI3A 5KNCA 4B35A 4JKIA 2VLIA 3PENA 2FZ4A 3EA0A 3GJXC 3R9XA 1G7RA 3AVQA 3WRYC 1JR6A 4QNRA 4XVQA 4DSOA 1JQLB 3OAAD 1OJLA 1JNYA 1T4GA 4B47A 3ZVLA 4IDHA 4CEHA 3CRW1 2ODNA 3SBDA 3A1UA 2OAQ1 2QQ0A 4TLDA 3K0EA 2CLCX 5F9HA 2OHFA 1Q21A 1Q3TA 1JPNA 1Z0JA 2ZRNA 5KNBA 2PMDA 1XZQA 2WJHA 3TW4A 5KSZA 1NBMA 3C16C 5EZ5A 4W5WA 3REFA 4QFMA 1FMJA 2GF9A 5AUQA 2W2VA 3BRWD 4KHZA 4V03A 1SXJC 4PSAA 3RABA 1F2UA 1GRRA 1MO3A 2HF8A 3U4QA 3ZZTA 2GK7A 2EWVA 4WXRA 3BB3A 3WHKA 4DUGD 1E69A 1VG8A 4I99A 4JLJA 3CB4A 3GD7A 4CF7A 4LJ4A 5FH9A 3TAHA 1KMHB 3TQFA 1SQ5A 1P2SA 1FL9A 2ZJBA 3K9NA 4UXIA 4WZBE 3UMSA 2VRWA 5KDOA 1N5KA 3AF1A 4JL5A 1XDBA 3A36A 4BECA 3AUYA 4FMDF 4O25A 4PTLA 2D3WA 3D7MA 1QHHA 1BO6A 3C41J 5EQTA 1A4RA 5DSZA 2CVFA 4OHXA 4DCSA 4DJTA 2TMKA 2G6BA 2F7SA 1R0WA 1TU3A 2A3RA 2A5DA 3SZRA 2CHQA 1R0ZA 2VP2A 1P61B 1T3HA 3CZQA 1IN4A 2JATA 2QGNA 3NDBB 4G5OA 4PXAA 1U98A 2WSMA 3SJCA 4IDQA 5EXXA 1OB2A 1E9EA 2F1JA 1E98A 1CR4A 1ONBA 1SHKA 4B2IA 2WJGA 2BOVA 2IWHA 2CK3A 3RLFA 4AKEA 4KFTA 1NVWQ 4ABYA 3FTQA 1GP2A 3SJZA 4WVFA 2GILA 4YMUA 1VHLA 4CVNA 2RGGA 1W4AA 4OK3A 1OE0A 1N6RA 2GKSA 1WDTA 2EYQA 2O8FA 3T1OA 2IF2A 1QRAA 1FX0A 3B1YA 1TTTA 1A5TA 4M0LA 5IK2D 3U44B 2BMDA 4RY2A 1A2BA 3MWJA 2CL0X 4D0NA 3V00A 5FUXA 2PT7A 3QOFA 3A37A 4XSGA 2V55B 2AL7A 4LJ6A 3U7EB 4GZMA 5JCZA 4CEJA 1TADA 5KYKA 3TSZA 3K0FA 2NTYC 3ZZUA 4XVRA 1KK2A 3TGPA 3KJGA 3EIEA 1G6HA 3F3YA 4HUTA 5HKKA 1EFRD 3F0TA 4JVNA 2RHDA 4M8NE 5JWRA 2ECKA 1P9WA 2RCNA 4B3GA 4PC1A 2ZAMA 5H70A 3T15A 1G3MA 3AKEA 1ELOA 4DKXA 1E2FA 4RD2A 4LPKA 4PPFA 2D06A 4DC9A 2PH1A 3OIUA 3EX7C 4RD0A 3ZQ6A 1ZUNB 1NSFA 1R10A 1LS6A 4DWJA 1HURA 5G3ZA 2H57A 4MGYR 2A30A 5L3QB 5GADl 3TH5A 4BFSA 1N3BA 2XZLA 3VX4A 4L16A 3AVXA 2Q9BA 5CIWA 2ZYWX 4TQ9A 4DXAA 3H0KA 2DFKB 2QU8A 3SHFA 1ZAKA 2VH5R 5AJXA 3Q85A 1XXHE 3ICQB 3PEYA 2JIZA 4CEIA 1HQYE 1Z0AA 1Z6GA 3L8YA 2W83A 3TLXA 4A6PA 5LD2C 1AJEA 4PFSA 5JSZB 4L9WA 3RYTC 5FOVA 4QHTA 3BK7A 3DOFA 1A7JA 2OCPA 4JMPA 4LV5B 1M1YE 2YHSA 4I1OA 1P73A 3UK6A 4TYWA 2RGNC 4I1UA 2WAXA 5FUWA 3LAWA 3H4MA 1BYUA 1T3SA 4YXWA 2HLDD 2WSSD 5FBQB 1R5BA 1E0JA 2H8KA 4DEYA 3X1ZA 1R5NA 2O8EB 2W58A 1HE8B 1Q1QA 2WMOB 2C78A 3K0AB 1P72A 1RKBA 3CX8A 2ZJAA 3I61A 1YRAA 1EG7A 3BE4A 4AKIA 1FTSA 3MG9A 4C0JA 2GZAA 4DLRA 3EC2A 2F55A 2ZAOA 2IYVA 1N25A 1UEJA 2AX4A 2HCJB 4AD8A 3W90A 3UANA 4DLYA 2XZPA 4U02A 5FI0B 1KAGA 5CM9C 4UXJA 4DSTA 2HYDA 3G5UA 3IPXA 4HLDA 1T91A 2D62A 1E6CA 2QY9A 1G9XA 1OFUX 5JEEA 1XU4A 4BFUA 2FMXA 1HYQA 2AK3A 5F98A 4ACAA 4B2LA 3AF3A 3KB2A 1NBMD 1US8A 2F1IA 2H16A 1RC8A 2JEOA 3VQTA 4AYXA 2WKQA 2WWFA 2ZS7A 1CRQA 2K5UA 2F3TA 4JBXA 2QTVB 5CK4A 2I3BA 4PZYA 1WF3A 5DE3A 2UZ3A 2ZANA 2WJJA 3IGFA 4D4LA 2GAOA 4KU4A 3HYTA 5JFGA 1CEEA 4HB4A 1UKVY 2B7CA 5BXQC 4OBEA 3ZYCA 4AWXA 4WBSA 4YMSA 2JLUA 4WZ6A 4A36A 4K8OA 4D6PA 2VHTA 2IK8A 5G53C 3KJHA 2GJ9A 5EXSA 1AS3A 4EPXA 4GZLA 2D74A 3ECCA 1XWIA 5DHAA 1YRBA 3JZAA 3SN6A 4BFZA 4YONB 4OI1A 2B92A 4A82A 1E9FA 1R8SA 4DLWA 4QGFA 3AVPA 4GMXA 1FOEB 4M21A 1EFHA 1GOTA 4TT3A 1NSTA 4FCTA 3I8SA 4LY6A 4N0DA 3CF2A 1MRNA 3E1SA 1OLOA 1ZCBA 2D4HA 2OSBA 4UNNA 5AUPB 2QP4A 1W4BA 1IXZA 2GJSA 5J4VA 1IN5A 3W6NA 1M74A 3U3JA 1W7AA 3WBKA 4Q47A 3LBHA 2A9KA 3TNFA 4FIDA 4PSKA 2GCOB 4I1VA 1KHTA 5DI3B 4KFUA 4ACBA 2CE7A 4KV9A 1AKEA 1ODFA 1ESNA 2J45A 3HPQA 1F5NA 3ZDQA 4OJKA 4RVCA 5GJBA 3B82A 2CK3D 2BBSA 1Z2CA 1MKYA 1KI3A 1Z07A 2ZI9A 4BZQA 2JJ8A 1Y3AA 2WWYA 4MUBA 2N1BA 2OCAA 1QHSA 4W5JA 3MGCA 4E09A 1GNRA 3BXZA 2WWXA 3QQ5A 1HTWA 5HCIA 1C4OA 4DLVA 2YV5A 4Z54A 3LXXA 2IUSA 2ZRMA 4IDOA 2JLXA 4D80A 5J4LA 3T06B 3PG5A 2GESA 4GDFA 2NOAA 621PA 2E1RA 4G5QA 4HAVA 5JLJA 4QL3A 4PAQA 2QM8A 3LVRE 4G5GA 2ZSAA 1KSGA 1Z28A 3E2IA 1TEVA 521PA 2Y8EA 1E0KA 3WMFA 3CLVA 3R7WB 4LBZA 5J4YA 3EAQA 3NBZC 2ZXUA 1ZU5A 1JR3E 3TUZC 5B58C 3ICEA 2OZEA 2QRZA 4M9XA 3RWOA 5HKKD 2GXQA 3THWA 3J81k 3RANA 3ZVRA 3A1SA 4A0FA 3KDSE 2ZJYA 1D2MA 2CLSA 2FFBA 5BYJA 2RGCA 3GLHB 1CKEA 3U60B 4B3XA 4MDEA 3VKHA 4C0LA 5D3MB 5FOUA 2E9SA 4GNKA 1AM4D 1E4VA 1NBME 1LY1A 2ZREA 4YDSA 5LBIA 1KJYA 4PC7A 3SOPA 3IILA 3O8DA 2VF8A 3RRMA 4B43A 4EPVA 2JAQA 3NH6A 3CNOA 1S8FA 2JIZD 5C1BA 1CIPA 3L0OA 5FPSA 3U3KA 2ZJ5A 3TK1A 1X6VA 4B33A 3FFAA 2HCBA 2QA5A 4P4UA 4EJSB 1E9DA 1XTKA 3I1FA 2QQEA 1GL9B 1NJGA 2QZ4A 1J2JA 1G291 2GBLC 1CJVC 1NJFA 2OXCA 4NYJQ 1G8YA 4DT1B 2IYTA 4US0R 4PO1A 3IO5A 4Q00A 1G4AE 3CPJB 1ZM7A 4NYJR 4TMXA 1Q3HA 1DTSA 4Q4LA 4KXFB 3N5CA 2ASEA 4XTCS 2PLFA 3RWMB 3GLIE 4LHVA 2G1KA 1QVAA 2ZRKA 3ZZ0A 4OHWA 4RCZA 2MSDB 1S1CA 4QGHA 4B73A 1WBBA 2VEDA 4MRRA 1S0UA 4HZIA 1TQ2A 2WBLC 4FWIB 3V4FA 5HE9A 3AVUA 2WPDA 3QKSA 4KBFA 2IT1A 4HAZA 1DEKA 4Q9IA 1ZINA 2GCNA 2IS1A 5DYIA 4QC2A 4KITB 3B1VA 1KI7A 5LD2B 3BH7A 4FWTA 1HE1C 2JA1A 4NP6A 2WJYA 4FI3C 2OBLA 1ZRHA 4C3ZA 2V9PA 2FFQA 3GEEA 2HEIA 3THYB 3AEZA 4H1VA 4Q1BA 2VSXA 1L2TA 1ZC3A 2QGZA 1Z29A 1XMVA 1GL7A 3D6TB 5JWHA 1LB1B 5CK5A 3LH5A 3UKDA 2VP6A 4TLEA 4DLSA 3FDIA 1KO5A 5EE0A 4P4SA 4A2WA 1Z47A 2HUPA 4OHVA 5TVKA 3ZD7A 2J0VA 4DLXA 4LV6A 3GLGB 1YR6A 4LHZA 3QI2A 1VG1A 2ATXA 2YC2C 2OM2A 2NO6A 2IYSA 5KSOA 1D9XA 1VKJA 2IYZA 4PPGA 3VNUA 1P9RA 1BMFD 5AUOB 5K8IA 4F4CA 4P33A 4G5RA 4HUQA 5F9FA 4FCVA 1X1RA 1YZNA 4U7DA 1VIYA 4KSCA 2OG2A 2C5LA 2P6NA 2LKCA 2VL7A 3WNBA 1KO7A 1QG4A 3THXB 4TT3D 2GEDA 3GLFE 2O8BB 5FPTA 3B2EA 1ETUA 4JLMA 2QT1A 4QBHA 4XSHA 1KGDA 4NYIQ 3JVVA 1KK3A 2WHXA 1TF2A 3TMKA 2XITA 1G4UR 2NMVA 1AQYA 2ODWA 4BLPA 4DDVA 3Q72A 2WKPA 3CWQA 5FTJA 1I2MA 1Z0FA 4AY2A 1KJWA 1DVRA 4E5UA 2O0KA 2I1QA 1N6LA 3GEIA 5KUTA 2J46A 3RS2A 1G8FA 3QE0A 2FV8A 1SVWA 4Q01A 3SFVA 1DAFA 4QBGB 5L3VA 3KKPA 4B3FX 1WXQA 2P3SA 1XFAA 4DLUA 4JLVA 4C0BA 3QSYA 1WQ1R 2Q21A 3GFTA 1KMHA 4URYR 1ANKA 3OE7A 4MDFA 4HSEA 4JT2A 1N2CE 2OCYC 4MKIA 1FFHA 3T5DA 4GFDA 3H1TA 1R0YA 3RRNA 4DIEA 1G20E 2IEZA 1FP7A 4ZKDA 3KQUA 1OFHA 1XPRA 3T1VA 2FPMA 4DCNA 3BC1A 2OXRA 4JBYA 3VKWA 2ZYTX 1XXHA 2CCJA 1IOZA 2QRNA 2RMKA 4WA7A 4PHFA 1WE2A 5JJIA 4P32A 3QF4B 5ELXA 5TB5A 1IXSB 4CIDA 4H1UA 3CUEF 1AS0A 5FOSA 4C2UA 1CRPA 1C1YA 4RZXA 1N6IA 2YINC 1Z22A 2AXNA 4LHWA 1N6HA 2ZUCA 1OSNA 4PZLA 2CXXA 4MITA 1CR1A 4TMTA 2XXAB 2RGBA 1FZQA 5E7IA 4C30A 1SKYB 2O8CA 5JJLA 2P6RA 4TZ0A 3FKSA 1TUEA 3SS8A 2CCGA 4B48A 3KXKA 1F2TB 1CXZA 2C04A 2X77A 3CONA 1ZIPA 1ZC4A 3K09C 4DLTA 1LV7A 1MO5A 2B21A 1IAQA 2JJ1A 1DAEA 3IO3A 2HT1A 2FF7A 2GK6A 3HDTA 4R9UC 1S9DA 2P5SA 1G21E 1SVLA 2V4ZA 3OEHD 3B8HA 1PLJA 1KMQA 3QXSA 1H8EA 2REBA 4LX0A 2N46A 2PBRA 2VA8A 5A5GA 2GXUA 3UMFA 1SVOA 1R7RA 3W6PA 2JLWA 3EIHA 1U9IC 5TDHA 2BM1A 2VQSA 3KTAB 3NHAA 4HDOB 1HUQA 2WJVA 2PT5A 3C15C 3TE6A 1R2QA 4US1R 1R8QA 4M53A 1QHNA 4HI0E 2BVNA 2UKDA 5BQ5A 2DHRA 3GJ5A 4Q4AA 3KKMA 2FZLA 3QXJA 4M1MA 1QDEA 5FTMA 1EWQA 4FD2A 1BOFA 2FPKA 2R44A 3MD0A 3QPVA 4B2PA 4NKRA 2YOHA 1GFIA 2WPDD 2V6IA 4QHYA 2OUKA 4QRHA 1ZIOA 3LNCA 4RFSA 1P7CA 2MMCA 3WHLA 4P31A 4A92A 4B71A 4LJ7A 5L8VA 1QF9A 2X19A 5DI9A 2CJWB 3C5HA 3X1WA 1K8RA 1YZGA 5B30A 5E3HA 4Q4HB 4DCUA 2QBYB 5CIQA 1II8B 2W0SA 3A4LA 2AWOA 3Q5EA 2BIFA 4Z51A 4WZAE 1N6NA 3MJHA 1O3YA 3GMTA 3LX8A 3EW9A 3AGPA 4A1FA 3V4RA 1IY2A 1OPXA 3DHWC 2IL1A 1A82A 4EFLA 5IF9A 5BN3A 2G1JA 1LW7A 5F2EA 1E2PA 1WA5A 1GWNA 1VHTA 3PEVA 1T5LA 4TMZA 3AVYA 1B23P 3OESA 1UADA 2RGXA 1XJQA 3K0AA 4OQXA 1XCMA 1KZGB 4Q4JA 3IEVA 1KJZA 1M7HA 3IBYA 3SNHA 1FTNA 4II7A 4TZ6A 2QT0A 5CB6A 1P6XA 1OH5A 2IUUA 4LBVA 4LJYA 2O8DA 2ZVQX 3K70B 1MABA 1M34E 3B7GA 3Q5DA 5GJWC 1RRGA 2QMUA 2H18A 4BUJA 5J4HA 1RJ9A 2WWWA 3U7HB 1IY0A 4UXHA 2ZSBA 5C18A 5FBVB 3SI7A 1ZM2A 1S2MA 1JXOA 4NMMA 3CNLA 3RRZA 3SQWA 3KQNA 1JR3A 2GVZC 2ERYA 2NIPA 1DOAA 1IN7A 4Q1FA 4ZI2A 1K5DA 4LPSA 2AD1A 1JALA 1TPZA 3AQ4A 2VHCA 2DBYA 3EASA 3I8XA 3M4YA 5L3SA 4F92B 1TAGA 4OI2A 1OB5A 4EQ6A 3F8TA 4V0LA 2FPLA 3LW8A 3OE7D 4MRNA 3FGNA 2BKUA 4Z1MA 1GNPA 3S1AA 5E95A 2IS4A 1X3SA 2V1XA 4IXNA 3OZXA 4Q7LA 1GKUB 4M1KA 4Q1CA 2ANCA 3K0SA 3L8ZA 2PCJA 3PCRB 5JZVA 1W5TA 1Z6YA 4DB4A 4F7WA 3REGA 4ZV4A 3IUYA 1DBSA 2BEJA 4BASA 4GSYA 2J59A 2LWIA 3AVOA 4NONA 1J8MF 2YNMA 3TW8B 1CJMA 1FP6A 4Q1DA 1XZPA 2J0UB 2QI9C 3OF5A 3UXMA 2XNDA 2BCJQ 2EFCB 2OFOA 1S3SA 3BFKA 4XD7A 1SXJA 4D0GA 2A2ZA 1BIFA 2PMKA 1U90A 2CLDX 1YKSA 5BYKA 3LDAA 3BJIC 4X8LA 4PHHA 3RSLA 4NL4H 1QHGA 3FKSD 3QKTA 5HE8A 3GLIA 3CBQA 2JASA 2KI5A 1U2RA 2D2EA 4IJMA 4HLQB 5H68A 2HT6A 4R2IA 3PEWA 1OFTA 4HAYA 5UKDA 1YE8A 2JJ1D 3OIVA 2OLKA 3OIWA 4YDHB 2AN9A 1JJVA 2PX0A 4QGGA 1E2KA 1JJ7A 3EZFA 3MWYW 4DB2A 4BEJA 1IN8A 1H8ED 2OFWA 3B13B 3VMFA 1N0WA 5EE5B 1YVDA 4F93B 4K46A 2E87A 1E96A 1MR3F 1KO1A 3DPUA 4PQRA 1YQTA 2ZRFA 2LCFA 4LI0A 1H65A 1ZP6A 5JWOA 3R9WA 3KFXA 4FCWA 4B6EA 2RHMA 2UVQA 2VBCA 2HV8A 5AJVB 5JS7A 4Q9JA 3WYFA 4PPNA 3UPUA 3P32A 2YOFA 3RC3A 3KQHA 4N1AA 1L7VC 3MCAA 5K8TA 4P3YA 2KWIA 2QROA 2Z6VA 2GETA 2W2TA 3K9LA 2J7PA 1W36D 4C0SA 5EE3A 1E9SA 3GLHA 1V43A 3BB1A 4BFVA 2ODBA 3W3ZB 1O87A 4C0AC 2ZRAA 1LF0A 4LHYA 1JECA 2F43B 4ZIRA 1E2MA 1KTVA 4HZUB 4C2TA 1RYHA 1G8GA 2Z83A 4URXR 1XX6A 4EJSC 2ZUBA 1KI6B 3DL0A 1XEWX 3GLFA 1TL7C 4LC0A 1SGWA 2EFDB 5FR2A 2GA8A 4OL0A 3ADBA 3QY0A 2R62A 3WYAA 1IJFA 3AV0B 3EZ2A 4ZCMA 2ZYUX 4DDTA 5ANRB 2XOKA 2WJIA 4OI4A 2PEYA 4A0GA 1W4CA 1SVKA 1KI4A 2YWEA 2CNWA 3I5YA 2QAGB 2ZI3A 3NVAA 3ZVMA 3NBXX 2H1LA 3IQWA 4QJ5A 1CJKC 2ZI4A 1R6BX 4IKEA 1B0UA 1OH8A 3WNDA 4ZPXA 2OEPA 4FW9A 4D4MA 1CF4A 1QHXA 2DWQA 4XVUA 4ARZA 2AWNA 2GEUA 2VTKA 3A1WA 1CJUC 4LHXA 3FPAA 4LJ8A 1ZW6A 1ZU4A 3EIQA 1MT0A 5CB8A 3AVVA 4KJZA 2IEYA 2ZROA 2BMJA 2QMHA 2P6UA 2ZTSA 1H8HA 1CBUA 4F38A 3CF6R 4FMBB 1E9CA 5JHGB 4LGMA 1BH2A 3O8BA 3QVVA 3AF0A 1M6NA 3GJ8A 1XCGB 1COWD 1Q1ZA 1UBFA 2WWIA 1LS1A 3W3AA 1Z0IA 4JLOA 3THYA 3B1XA 2JDIA 1OIVA 1U81A 3EPLA 3CPHA 1M2OB 1JR3D 2RGNA 4MGKR 721PA 1F6BA 5J5CA 1NN1A 4JBWA 2GZHA 3AF4A 1TX4B 1OYYA 4DDWA 2GWHA 3A4NA 3NEJA 1SVSA 3DM5A 4NDZA 1W47A 3IHLA 4I1SA 3RVBA 3CR7A 1ZJ6A 3B6EA 2R6FA 1KSFX 2NO0A 2XB2A 1YZKA 2JLSA 1IQPA 1J70A 4JLPA 5B64A 4BZPA 4LYJA 3W5JA 5HZKA 5CLLA 3BFVA 3GFPA 4PAMA 2RGEA 2PZEA 5EP4A 2NQ2C 2X2EA 4BRWA 4D25A 1U99A 3BFXA 3TSOA 5BN4A 3GP8A 3HPRA 2BJWA 3EC1A 1OT3A 3T5GA 4JSTA 2PEZA 2BWJA 1YJ5A 2DFTA 5G40A 3THOA 2XGJA 4M1TA 4LOAA 4HB2A 2XNDD 4BLSA 4W9MC 3AGQA 1G3RA 3G82C 3SQXA 3MSXA 3QG5A 4XD7D 3C4JA 1SXJD 4MRVA 2KE5A 4TL7A 4AURA 3SEAA 1DAMA 1KYIA 2BV3A 5IDVA 4IW3B 3WMEA 2V8OA 3RS3A 2B8WA 5DISB 4B76A 1NY6A 4CT4B 3NC0C 2J0SA 1AA9A 3CR8A 3BORA 3ZH9B 2HDNB 5DHFA 2NZ8A 2WIAA 5E7JA 4RKFA 1XD2A 4RD4A 3B1ZA 1RZ3A 4A15A 3D8BA 3L0PA 1YZTA 4CEHB 2VSFA 1E99A 1XTSA 1LNZA 3DDCA 3PQCA 3IIJA 3X1XA 3CNNA 2CCKA 2DWPA 2CVHA 3L0SA 4S2EA 1RVDA 2J1LA 2AHOA 2IYXA 2C99A 2QE7A 1OHHA 3LFUA 2BBWA 2FSGA 2ATVA 2GTPA 2DR3A 3KUDA 3U5ZB 2GXSA 3ZVNA 4Q5IA 4RKEA 2O5VA 1FQJA 2Q3FA 1ZD9A 1RRPA 2WICA 3M0EA 1UEIA 1F2UB 3QF4A 1Z6XA 2BBTA 1XTQA 2FA9A 2Z0MA 5IT5A 3VNVA 1Z83A 1VCIA 5DH9A 3QBTA 1JI0A 2NPFA 4PC3A 2CL6X 4A0RA 1PUJA 2JLYA 3K0CC 4BQSA 5EP3A 1IXRC 3HWSA 5JS8A 3GFOA 3I73A 2Z43A 4AI6A 3CF0A 1S9HA 4TMKA 5C46F 4QHSA 2J7PD 1OH6A 1RFLA 1VCNA 5KPJA 2R8RA 3EXAA 2J0QA 1GL6A 4MRPA 2ODEA 1QHHB 4KYUA 1GTVA 5FL3A 4QNMA 2FSFA 3IIMA 4URWR 3UATA 2QP3A 5LB2A 4BLQA 4Q1AA 1G64A 3K53A 1QHYA 4FMDB 3F5FA 1W48A 3NH9A 3O47A 5DO9A 1PZNA 1QBKC 1AZSC 1UBEA 4KCGA 4Q66C 2OFXA 5GVSA 1XEWY 4LUCA 2P0EA 3M1IA 4U5XA 1OXUA 3IHWA 3LRPA 3TR0A 2XZOA 4Q1EA 4RD6A 5FPHA 4AC9A 2XOKD 1VYTA 2ZUDA 2QAJA 1E2JA 3SYNA 3AP2A 4G3XA 3QIAA 2QTFA 3AP3A 2OO7A 1YR8A 1ZUHA 1UKEA 2DYKA 2OV2A 2ZRCA 4TYQA 4KLNA 4NU0A 3ZS9A 3DOEA 4LYHA 3KXLA 3M6AA 3LVQE 4JZKA 1KK1A 4O2RA 1RPZA 4XWKA 2O8FB 3W5IA 2NO9A 1FX0B 4M1WA 1E1QA 4PO8A 1IY1A 2ZRHA 1C9KA 4OHZA 4BWYA 1VCMA 3A8TA 3HU2A 3IDQA 3WYGA 821PA 2SHKA 4B6FA 4DCTA 2J41A 2ZQ5A 4RZ3A 1XMJA 4LV8B 1CR2A 1S96A 2ONJA 3R8CA 3B5JA 1H8HD 2Q9CA 4BRUA 1VCOA 1N5LA 2X1VA 1ZUIA 4ZDKA 1SXJE 4YXWD 1I4DD 3MAAC 2OLJA 3KX2A 1Z6AA 1NKTA 2IUTA 1AQUA 4TYPA 3RRYA 4Q21A 4B75A 1QVRA 2JDID 2FNAA 2GZDA 1E2EA 1XMSA 2NGRA 3BWDD 2GBLA 3CO5A 1T0HB 4D81A 4PHGA 4TMWA 5HCNA 2IF0A 4RFVA 3P4XA 3RS0A 3IIKA 1Z3IX 3H84A 4EUNA 1QZXA 4CGZA 1GKYA 2ORIA 2EFEB 1FUUA 4BE7B 3VU9A 4MYUA 5SZIA 4PZZA 3RS4A 3I72A 4C7OA 3CRVA 3SBEA 3UMRA 4ILEA 5L3RA 4QJ3A 3K70C 2RKOA 3T34A 2PX3A 1XEXA 3MLEA 5TY0A 1PJRA 1ZNWA 1II0A 3C5CA 1UM8A 1WRBA 4Q18A 3WRXC 2WTUA 4OK5A 1KDTA 1P3JA 1L4UA 1VTKA 2REXB 3BS4A 4X8OA 2ZJ2A 1XTIA 3I4LA 3T1TA 4HATA 2JCSA 2P5TB 3BAFA 1Q20A 4PC2A 4OI0A 2L0XA 4D4KA 3O8RA 3ZIAA 4LYAA 1S1MA 1A2KC 4JLKA 2OILA 4JSYA 3GLHE 1KDRA 1ZM4A 1VPLA 4HYYA 4UQOA 4LDJA 1DAIA 2VIIA 3TIFA 2WIBA 4NCIA 4POAA 5GJVC 3ZS8A 2R9VA 2GXAA 4OKSA 4OHYA 1ZD8A 2C2HA 2ZSDA 1G5RA 3LY5A 1KI8A 2FG5A 4A0HA 2QEQA 1NMZA 5FBWB 4L4UA 1SZPA 2HJGA 1OKKA 4Q9HA 2VPPA 2XJ4A 4DHEA 1G3UA 1E2GA 1FNNA 2YWHA 4JYCA 2HYIC 1XPOA 4V0ME 5DLQC 4RZUA 4NYIR 2BBOA 2ZI5A 2QE7D 3QXXA 4ZDIA 4NHOA 3QEOA 3PJRA 1HEIA 3GEHA 1US8B 5FFMA 1SVMA 4K81B 3FVQA 1NVVQ 4LJ9A 5E4FA 4NCKA 2QPOA 4N0EA 4DSNA 4PQFA 2FSIA 2QUZA 4G01B 4QXAA 1Z0DA 4V0NA 5F3WB 2IYUA 1ZNXA 1EFUA 2EW1A 2F1RA 2R2AA 2DB3A 4Y0AA 4D82A 2AXPA 3X1YA 3JZMA 1NNEA 2H5EA 5JCPA 1ESMA 1JAIA 4LSGA 1XPUA 3BBPA 1J8YF 1L4YA 3CRMA 1E9AA 1VYVA 4V0KA 1W49A 3HYRA 4TTPA 4BLOA 1XJCA 4YLGA 2C95A 3UIEA 2ZR7A 2IXEA 4YQFA 3ND8A 4MUAA 1E9BA 3GJ4A 1XCPA 1P4SA 3VR6A 5JBQA 1G1MA 1HT2E 5FOWA 3IKJA 3LXRA 2ZR9A 3OHMA 2VP5A 1WP9A 4JS0A 3EPHA 3MWLA 4W5HA 4GMDA 3FMFA 4F91B 1E0SA 1MOZA 4URVR 3ZQJA 3CX7A 3WP1B 1OW3B 1OYWA 1GNQA 3C8UA 4US2R 1P2TA 4HAUA 4JVMA 3GLGE 1P75A 3T35A 4HDCA 3CH5A 1MRSA 1T5IA 2W0MA 3K8YA 5G3YA 3SR0A 3AF2A 4JT4A 3PUXA 3QNUA 1M7GA 2AD5A 3FYHA 2RB4A 4QGAA 3UWKA 5B2ZA 2F9MA 1EXMA 1VECA 1X1SA 5EZ6B 3DKPA 1E1QD 4GT1A 1KSHA 1KIMA 2NO1A 1E2QA 2XEXA 4TTQA 3U44A 2EFGA 1FUKA 4GOKA 4NH0A 3CKLA 1NF3A 3N2IA 3NC1C 2P65A 1N6OA 3FHTA 4X8MA 1D2NA 3K09A 1N0UA 3HU1A 5AJWA 1M7BA 4TLBA 2MSEB 1EK0A 4WW0A 1W2HA 3CRQA 2NPIA 2JLVA 1XMIA 1GAJA 2X2FA 1G3QA 1RE0A 4G1UC 4TTRA 2O52A 4QBFA 3AM1A 1DAGA 3U6BA 4KFSA 2IS6A 2O0JA 4KLZA 4Z8XA 3VKGA 2QAGC 1G3IA 4HAXA 3THWB 1R0XA 2GCPA 1U9IA 4MKFA 1GRQA 2GRJA 4CZ2A 2ZETA 3FHOA 4KO8A 421PA 5JHHB 5EJEA 4ZKEA 4A4DA 4R2HA 5EP1A 4Z8YA 4BZXA 3R9IA 2ZR0A 4TN1A 3W6OA 4V0OA 5L3QA 4C9BA 1E32A 3VR3A 4O3MA 1S4QA 3A1VA 2DWOA 3B78A 3FFBA 3AB3A 1BKDR 2VP0A 5JECA 3LBIA 4OQNA 1GITA 4ZO4A 1TMKA 3EG5A 2UZIR 3KFVA 5EP2A 2XTZA 1DO2A 5FUYA 3CW2A 5KSYA 5JSZA 2WWHA 2AKYA 3LQQA 4FXPA 4XWAA 3SFZA 4NZYA 2D2FA 1EFCA 2MMGA 2ORVA 1CS4C 4Q7MB 3NKVA 1ZBDA 5SZJA 3ZIAD 4NCHA 1CR0A 2RGDA 3AVWA 2G9NA 3KZ1E 2O8EA 4LZZA 4BLTA 2Z4SA 1OFIA 2ZRLA 3EWSA 4G0NA 4BFWA 2GAAA 1SKYE 1KOFA 2YC4C 4LBYA 1SKQA 2ZJ8A 3BGWA 3FMOB 1W46A 1FW6A 3HR8A 2GHIA 4LYFA 3TBKA 3U3OA 3NWJA 1LF5A 3K9HA 2IBMA 3LQRA 3VTKA 2FE4A 3E5HA 2J5XA 1ZD1A 3LD9A 4KVAA 5G41A 2ERXA 4DRZA 4EKDA 1Z8FA 5C4GB 5IRCD 1DARA 1GUAA 4GPTA 3AUXA 1OKKD 3MWKA 5KU1A 1U0HC 3P26A 4GI7A 4KBGA 3A58B 1Q12A 1UDWA 3PUYA 3QVUA 1UJ2A 4HLUC 1NIPA 3KJEA 3SJBA 3T1QA 4TYYA 1JAHA 3B9PA 1VG9B 1E2HA 4Q9KA 2AFHE 4RJLA 3KUCA 3NIBA 5AR1A 1G16A 2OCBA 5H1YA 1KNXA 2QTHA 4ESVA 2FDCA 4GL2A 5JRJA 4EPRA 2PJRA 4U00A 4OYHA 4AG6A 3ASYA 2QPTA 2ORWA 4PC6A 1XEFA 4EFMA 3QXCA 4IXMA 4PPQA 2HLDA 2EQBA 2WSSA 4QM7A 1TF7A 1G5TA 1X8KA 2VSOA 1CU1A 2IHBA 1EX6A 1G19A 1N5IA 2EFHB 2BMFA 4KVGA 4TL9A 1KI2A 4UNPA 2G3YA 2V7QA 1WMSA 4IRUB 1E2DA 4P0TA 4HUQB 4BFXA 3DVLA 2KSQA 1TF5A 4LJ5A 5FPKA 1G41A 3PFIA 1GSIA 4NBSA 4MH0R 4H9GA 4LCBA 1Z08A 1YZQA 3AH8A 1GKIA 4ITRC 1E0AA 3FKQA 1AIPA 2OT3B 2ZRGA 3CIOA 4B3DA 1EWRA 4YMWA 4PANA 4PHTA 5EE9A 4CDGA 4ZCLA 1KO4A 3B60A 6Q21A 4KI0A 2XNSA 1PUIA 4NTZA 2XB4A 3UWOA 3EZ6A 3ONWA 2ZE8A 1NKSA 2GCOA 2ZEJA 5FTLA 5DI3A 2CL7X 4D4JA 3TUIC 3TUJC 2R6GA 2GJ8A 3U6KA 1K6MA 2ZJZA 1Z6TA 2ZPTX 5AJZA 1KAOA 3TKLA 1AK2A 5CLQA 1JBKA 1P2VA 3HP1A 3TVTA 4MKGA 2PJZA 2D7DA 2IHYA 2XSZA 1PVOA 2RAPA 5LPNA 1IJEA 2IYLD 3DZ8A 2P2LA 3GJ6A 4OQFA 1D8TA 4KYIB 3MMPA 4ZCIA 1NLZA 4J0QA 3A4MA 3L82B 1I4TD 5FBRB 2VF7A 3T61A 3T12A 4Q19A 3TJZA 5CDFA 1N6KA 4URUR 221PA 1XXHB 2PLRA 2FFHA 1FPMA 3R7WA 1CLUA 3KJIA 5P21A 4DDUA 2C9CA 4L5BA 3I5XA 4NCNA 3ADCA 2Q3HA 2QG6A 4JLDA 3FOZA 5KSPA 1VMAA 5J4KA 2ZSEA 2YOGA 3VR2A 3LLMA 4RD3A 4RD1A 3VHXA 5JMTA 1OXSC 2FJUA 2Z4RA 3FWYA 3RS7A 4LK2A 3B9QA 3U7FB 3ZLJA 4XJXA 1XNJA 4FN5A 3QKRB 4AYTA 3MUFA 3LWNA 3CRRA 2O8CB 5D3MA 1Q57A 1Q0UA 2BJVA 2Q9AA 3L43A 3QF7A 5JI3E 1ZM9A 2EVWX 5EE1A 4GOXA 4NPHA 3U3MA 1Z63A 1N6PA 2FN4A 2OAP1 2R6DA 4JLNA 3RNLA 4JVSB 1E9RA 3HR7A 3U7GA 3MRSA 4MYHA 3EPJA 3B1WA 4IOLA 1R5OA 4G5SA 3PVSA 4AKGA 4IHQA 1U0LA 1X8JA 4BEBA 4EJSA 4V0MA 2WMNB 5KDDA 2CHGA 5CITA 5LDDC 1XB2A 1W2GA 3DKVA 4AKHA 1F60A 4MGZR 1OV4A 2DCUA 4BLRA 5JEDA 4MYCA 4KSBA 1WB9A 4TL8A 2ZM5A 2W2XA 1KDPA 1BYIA 4DT1A 4TLCA 3WMGA 2LKDA 1R4AA 4YC7A 1JB1A 1HA3A 1JEEA 1V5WA 2QP9X 3LV8A 3QEJA 4TLAA 5BN5A 2ZU0C 3CWZA 3UG6A 3OIYA 3QG1A 4Q4AB 3SE0A 1W36B 4DSUA 2AR7A 4CT5A 4BGDA 2WWGA 1RRCA 1KO8A 3SU8A 3ADDA 1E3MA 1YR7A 2BKEA 4IOKA 1AGPA 1XTRA 4BFTA 3U61B 4B3CA 4RFSB 4TL6A 2KBFA 2C96A 4A8JB 1IM2A 2GDJA 2BC9A 3Q7QA 1VIAA 3ZJYA 3KL4A 2ZS8A 4HLCA 2N42A 3KB1A 4A2PA 1AKYA 5FTKA 1LVGA 1GG2A 1YR9A 2P67A 4B74A 4WOPA 3P4YA 3LX5A 1DS6A 4KFRA 1NL3A 3BOSA 1NVXQ 1NLFA 2Q0HA 3QENA 1Z2AA 5FPYA 3X1DA 4OJQA 4KAXA 2IYYA 2JGNA 2AK2A 5BW8A 4M1OA 1KKLA 2ZRJA 2W00A 3NXSA 2QNRA 4OQMA 4DZZA 3GLGA 1E2NA 2WOOA 4M1YA 2QMOA 1D2EA 2O0HA 1NP6A 1AZTA 3AKYA 4GRAA 4Z1MD 5C2JB 2FGJA 4BFYA 3CPEA 4EIWA 1U8YA 3Q7PA 4YMTA 2V7QD 3RS5A 4Q4JB 3EZ7A 3OEEA 1OIXA 1NIJA 4MYTA 5AWFC 3CZPA 3THXA 2O8BA 5JJKA 1J7KA 4XOIA 1KDOA 2O8DB 3KKOA 1KI1A 1MABB 2DFLA 2X8AA 1Q1EA 4XIGS 1NN0A 2ANBA 3WBJA 1E1RA 4QOSA 2MSCB 4ON9A 1RRFA 2VHJA 2VHQA 1RJ9B 1W0JA 2EWWA 4IDNA 4PX9A 5CYPA 4F4JA 2ZVPX 5SZKB 4EPTA 5FL7A 4EDHA 1UKZA 4M1SA 2GNOA 4NE2A 3I3SR 1ZMXA 2QENA 3IEUA 5KPDA 3EZ9A 4LBWA 3D31A 2QN6A 4UJ3A 4AIIA 3ADKA 4UNSA 1NMYA 1G18A 4R71A 5KHOC 4QM6A 2XSZD 1KSJA 1L8QA 3PIRA 5B57C 5L3SB 5M04A 1XTJA 2CE2X 1XBTA 5SZHB 4EQ6B 2A5JA 3Q9LA 2JLZA 4JVLA 5J47A 3SJAA 1UFQA 5KNDA 2RH5A 1GIAA 1JPJA 4WXPA 3S1AB 2H17A 2ZE5A 1BMFA 4B44A 1VDZA 2FEMA 4F4IA 4EPWA 2IS2A 2J87A 3V9PA 3DZDA 3U2QA 4HAWA 1ZVQA 5CM8B 3EARA 4Q9LA 2IW3A 2XJ9A 4IEEA 1DG3A 4ASUA 3TSWA 2ZS9A 3U4QB 1Q22A 4R7ZA 2YWFA 3LW7A 1HQCA 3DMDA 3G0HA 2W6JA 3MFYA 2H7VA 5GVRA 2FEOA 4E07A 1YZUA 3HU3A 3TAUA 2ZYVX 1DELA 1NMXA 2G77B 2B6HA 3PV0A 3AKCA 1GZSA 3NBFA 1TQ4A 2ZSFA 1SXJB 2J3EA 3X2SA 4ZDJA 2XXAA 5E7MA 1KY3A 4D2IA 3GJ7A 1QHIA 4JLAA 3NHBA 1OXXK 2YKGA 4DIDA 2H92A 1PV4A 4LWZA 1UDXA 3K0CA 5DYGA 1TU4A 1F2TA 3GLIB 2BDTA 3LA6A 4ZDWA 2WKRA 2OBMA 4HB3A 3W34A 4XH9B 4C4PA 1MH1A 4D0LB 2JLQA 4EAQA 2A78A 4JL6A 5JRZA 4RCYA 3PXGA 4WAUA 1D5CA 1IONA 1K5GA 2QM7A 2PZFA 3TVDA 2HJVA 2FOLA 1DAKA 3ASZA 3W8RA 3TRFA 2ZJOA 4JIMA 2A5YB 1HH4A 3BH0A 4IDPA 4DEXA 2GJKA 1ZYUA 2FH5B 2WZQA 2ZITA 3P27A 4OK6A 5FR1A 4CYMA 1HT1E 2I1VB 1JEDA 4IEIA 1T8UA 2CNWD 3KTAA 3VR5A 2CMKA 2IWRA 1W0KA 2WM9B 1NVUQ 3K9GA 2G83A 2QPAA 4URZR 5EXTA 2NG1A 3SDZA 2C9YA 1Q1BA 4Q7KA 1U8AA 2FSHA 3QJYA 4BPBA 2PZGA 5D3QA 5HZHA 4M9ZA 5FOTA 1XD9A 4X8HA 5KO2A 1QG2A 3E70C 3ND9A 5HTKA 3L2OB 4ERNA 3FHCB 1G7TA 2AFIE 3LO5A 1S3GA 3GJ3A 3GQBA 1HV8A 4O0MA 1I2DA 4ZIRB 2V6JA 2QL6A 1NG9A 1XD8A 3VHLB 4PAOA 4CEJB 4S35A 2IYRA 2CJWA 1UPTA 5EUMA 3GLFB 3QPUA 3K0FB 3PUWA 4Q4HA 4IFEA 5GJCA 4DVGA 5C4MA 1M8PA 2QSZA 1OH7A 2J7KA 2R6CA 3P1JA 2QBYA 3UG7A 3KQLA 1II8A 4AK9A 3OEHA 1AS2A 4FMCF 3EPKA 2C8VA 1T6NA 1T0JB 5TXGA 4ESHA 2OBNA 3SC3A 1EESA 3NBYC 5CYOA 1YHNA 1CP2A 1D6JA 1JQJC 1MO4A 2GF0A 1SVIA 2CBZA 2GEVA 2JJ2A 1KK0A 3KQKA 3A6PC 1G8PA 1W1WA 2ZI6A 1HY3A 4QG7A 3RSOA 1G7SA 1W44A 5TARA 1DAHA 3KXIA 3K1JA 5DGXA 1FMLA 1A1VA 3EWAA 5CDFE 2NO7A 5TV2A 2Q6TA 2IXFA 4R98A 4LRWA 1OXTA 4ARZB 1XF9A 2CDNA 2R6AA 3OEED 2XTMA 2A5GA 2DFNA 4UNQA 2XAUA 4CEIB 3N70A 1T9HA 1KI9A 3QXHA 3MJRA 4E22A 2A5FA 2VYFA 4IOMA 3GPLA 2Q3MA 4GP6A 3KKQA 4MQBA 1N5JA 1U8ZA 2HF9A 1Q44A 1E79A 1E4YA 4TSFA 5AJYA 1J90A 2IYQA 4DLZA 3GCGA 1X86B 2WVJA 1WCV1 1E1RD 1MV5A 1W0JD 4V02A 4AYWA 1AN0A 3AKDA 1I4LD 3C14C 5FL7D 1X8LA 2DY1A 4M22A 3VAAA 5KTYA 4W7SA 3BD9A 2A7QA 4XTRA 3SYKA 4B34A 4O2LA 4IVPA 2ZE6A 5FOXA 3WNCA 1JXMA 2WOJA 3VR4A 3IQXA 4B3BA 3W8NA 1UKYA 1ZNYA 2GVDC 3H2YA 4MGIR 1Z06A 1IBRA 1P2UA 2W6IA 5CJPA 5DN6A 2PL3A 2IA5A 1TEXA 2BM0A 2YWGA 4JL8A 3ZGXA 4N3NA 3H86A 3RHFA 4CW7A 3BH6A 1DO0A 1G7CA 3PR1A 3IBGA 2F6RA 1SULA 5AK0A 2R65A 1OHHD 1WBDA 1XJ0A 5AUNB 1XRJA 4L8GA 4GP7A 2CEAA 2Z5FA 5FI1B 2J9RA 2YJTD 5K8LA 1TQ6A 1ZCAA 3DO6A 1Z0KA 8OHMA 1P5ZB 2HXSA 3B85A 2ZI7A 1NVVR 4ASUD 3P20A 1KY2A 1PLKA 5EXPA 2J0UA 2D7CA 4PO9A 2REOA 2EYUA 5HPYB 4D26A 2W6JD 3OFNA 4FINA 4IOJA 3QPWA 3BIFA 4RZ2A 5KOYA 1GDDA 1IHUA 1G5PA 3NEYA 4JKYA 1AGRA 4M9SA 4WIAA 1TUIA 2G0NA 2B8TA 3LLUA 2ZU6A 1E2LA 4PR0A 4A6XA 4MRSA 1U94A 3OAAA 3Q3JB 4TQAA 2BCGY 3WXMA 2B7BA 1XD2B 2JLRA 3FE2A 1RW4A 5FTNA 2RGAA 5JI2E 1NG1A 2F9LA 4NYMQ 1W5SA 2V1UA 4IFBA 5K8UA 3JVUA 2V3CC 1F48A 1D9ZA 1UAAA 1PLLA 4OQLA 1EGAA 4M2LA 4NYMR 3SYLA 4HB0A 3U3RA 4ZI3A 2XX3A 3FB4A 4Q48A 4PSVA 2AKAB 3PITA 2IX3A 3EA5A 5DNYB 2QSYA 2DPXA 3NTUA 5LB4A 3W9YA 2VO1A 4E03A 3L0IB 5A0FA 3A1TA 3RC8A 1MO6A 3WP0A 2OE2A 2WAYA 3KKNA 4JLBA 4L15A 1W0KD 4DUGA 1UBGA 2ZE7A 3I32A 4CRWB 4I4LA 5J40A 1NY5A 3LBNA 2VP9A 2IC5A 3QKUA 3CH4B 3N2EA 1IN6A 4UNRA 3QKRA 3ZD6A 5EUQB 4IVRA 3R8FA 2I4IA 2F43A 3NG1A 1II9A 2ZRBA 3NDPA 4IVQA 4EFNA 4HZUA 4LJAA 2FX3A 2YZ2A 1T3LA 4PQYA 4TYNA 1F3OA 2VHUA 3I92A 1KI6A 3R20A 4M4SA 1XP8A 2G0TA 2NZJA 1NN5A 1GRNA 1NN3A 2FWRA 1DPFA 3PEUA 121PA 3I62A 1VG0B 3IPYA 3FMPB 4C0KA 3DMNA 5H8WA 2ZRIA 4Q7JB 3VX3A 4DCVA 2C9OA 3TR5A 2PCLA 4JYBA 1SHZA 5CJ2A 4Q02A 4QKQA 1E94E 1EFTA 3DEFA 2YYZA 1RYFA 3ETLA 5HR5A 1LTQA 1Y63A 2F1HA 3RAPR 2JJ2D 2QAGA 1EX7A 5TMPA 1G17A 1KNQA 1W36C 4JJKA 3DM9B 2HXYA 3BERA 3QBVA 1NRJB 4HDQB 1N0VC 2OESA 1BS1A 2IXGA 4QBIA 4B32A 1CULC 1GVNB 2BEKA 4RSGA 2FFAA 4DBLC 1OXVA 5IK2A 1DADA 1ZM3A 4A8JC 3CX6A 1KZ7B 1W4RA 3SHWA 1U0JA 2F3RA
chains in the Genus database with same CATH superfamily
5HWSA 1V7CA 5ALDA 3H5LA 1DIOB 5FBLB 5JCJA 3OQHA 3P9PA 5TX7A 3RUHA 1T5SA 1O8CA 2NZXA 3AP1A 5JPIA 4Y0VA 3K70D 2IP2A 3UTCA 3TIVA 3L02A 1CJTC 1ZRMA 1LJLA 2Z56A 4U39A 5KNCH 4XIFA 1TT7A 5AMXA 2BR3A 3RU2A 1T1EA 2N3ZA 4NBFA 2FRDA 3FNHA 2PWYA 4GMFA 3WTBA 1OI3A 1EFRA 4EHNA 1NJ8A 2EZTA 2Y1LA 2ZIAA 1G6OA 2QGFA 3G2OA 4I81A 1UF9A 2G9QA 4KMSA 1RS0A 3FX2A 5AYVA 4BKRA 4CLRB 6ADHA 4JQZA 3AVTA 4OP3A 1L4NA 4M60A 2JF0A 4ER5A 4BQIA 4L07A 1T8TA 1JP7A 3B3FA 4A9AA 4X64B 5IP7I 2KBEA 1TJ4A 2O2GA 2W6ID 3LVBA 3K32A 4Q03A 3X2EA 2QLJA 4UJ5A 5IDYA 2GSDA 4OBXA 5EUBA 1GILA 2BW0A 3PQ2A 4QJ4A 4YRSA 2JVIA 2XA1A 3QKSB 4P54A 3WY9A 1RYNA 2ZRPA 3E3NA 2Y99A 4A6DA 3DTNA 2LR0A 4TTIA 4W1QA 4O1IA 4ROTA 1P0QA 1GPH1 3R9WA 5DB4A 4C7OB 3R0XA 1FQKA 4XGQA 3CWCA 4MUKA 3G9TA 4UKDA 5IH3A 4H08A 3QWIA 4YMVA 4ZTUB 1EE2A 2ZCJA 3AHCA 2F8TA 5DIFA 1ZITA 4HNSA 1UM9B 3B6KA 4YH1A 2HA2A 2VJKA 1V1MA 4JKOA 1WG8A 2VDRB 2ZIXA 4LZPA 5LZ5A 3TZ6A 1OLSA 1ZR4A 2NYVA 2VP4A 2IYWA 2ZRDA 4G0OA 4Y2PA 5IM5A 3TQCA 5H02A 4QE3A 3TPCA 1JH9A 1YU9A 1VQNZ 1MW9X 4GLLA 1QQAA 1QRUA 2P2GA 3P2KA 3WP0A 4XSVA 1J99A 1YBFA 2CFSA 3FR8A 4P4TA 4NCAA 3VPXA 1COWA 1MB4A 4E1AA 3SZMA 1J0DA 4QT4A 1GM5A 4JJZA 3H3JA 4H0CA 5KJ6A 2HRQA 3DLCA 1A72A 3GD5A 3ZWNA 4IYJA 3SNKA 1Y81A 4GPBA 1THZA 3QRWA 4BP8A 3G6EZ 2PIAA 1A7UA 3R9XA 1WSAA 3AVQA 2VUTA 3I53A 3PPWA 3QLUA 3WRYC 1JR6A 2O1XA 2Z2IA 3SLKA 1JDBC 2WDPA 3LQYA 4DSOA 1JQLB 1RM5A 1OJLA 5AM2A 4G1MB 2PZAA 3AI3A 1AB6A 1JT9A 3LHDA 3DZFA 3P94A 3AC0A 1ZSVA 4BX8A 4XQ9A 3VGPA 1YTUA 3TTYA 3A1UA 3R23A 3HACA 2CZQA 3A9VA 5GPBA 3SDSA 2AQIA 1T4CA 2CLCX 4BPRA 1Q3TA 1Z0JA 5HKBA 5I45A 4FFDA 3W5SA 4DTCA 5BW4A 5KNBA 3COJA 3RR2A 2QI9F 5DSXA 4W6ZA 1WHTB 3J7TA 4E7PA 1NBMA 2ZTLA 3BWMA 3C16C 3ICVA 4KXLA 4B80A 4ZCRA 1SXHA 2YHUA 4FEGA 5THKA 3D1JA 4QFMA 1FMJA 3HCPA 4AECA 4QZVA 1LA2A 1IBKB 3IVCA 2PUHA 5M7EA 5J2UF 5AUQA 2W22A 2JBHA 3L8DA 4OCZA 1EFKA 1KPHA 1VFPA 3H8WA 3CHYA 1SXJC 3DYVA 3JAMf 4FLMA 1LRJA 4KRGA 1MO3A 5B7QA 1U0RA 1MEEA 2H5LA 2VXOA 2HF8A 3IUJA 3ROTA 3KETA 3U4QA 3OEYA 1YA6A 1QO0D 4WXRA 1QXSA 4AJNA 4CL8A 4DUGD 1DKRA 3DJFA 3H4TA 4HG2A 3CB4A 2YFYA 3TAHA 1KMHB 5T57A 1JL3A 2ZJBA 3OBIA 5E1BA 4REMA 1XRRA 4BP1A 3NAGA 1YMVA 4HK4A 4NDNE 2EZUA 2VHYA 1DIBA 1N5KA 3AF1A 4IGIA 2J6IA 1N92A 4IIJA 4UFNA 3EZLA 2O5CA 3AUYA 4G84A 2GLTA 5TGDA 3D7MA 1VPVA 1CNEA 1NC3A 2HPAA 3EIWA 2WYHA 4NG4A 4AXXA 5J2TF 5EQTA 5HKAA 5KQGA 7AT1A 3IC5A 2WU1A 5ECGC 1C7ZA 1KJIA 1Y4ZA 1KAMA 3T9BA 1I4WA 2A5DA 2VRCD 3IOMA 4WNCA 4MWDA 4HNAA 1T3HA 1JG3A 2Q6VA 3LUCA 1Z4QA 4XYEA 2PFKA 5SYNA 1E5QA 3GB9A 3HA5A 3O4FA 3NDBB 3NGXA 4NZPA 5JVDB 1BVUA 1NUHA 1K88A 2GYVA 3HB1A 2PKXA 1E1NA 2B99A 2F1JA 2A33A 3D8TA 4DTIA 2QB5A 3I0NA 3PU6A 1TKCA 3WQSB 3RLFA 3SPXA 4QECA 4W5OA 1X3LA 3FUUA 3QFCA 4KFTA 4MCIA 4ZO7A 5IZ4A 1NVWQ 3MWDA 3PXXA 1SA0B 3FTQA 1X1BA 3IP3A 4MZDA 2X8LA 3SJZA 4E3ZA 3ETCA 3DVSX 3QE2A 3ZNPA 1W4AA 4DA4A 1AY0A 1N6RA 4ZP1A 5H9WA 5E1OA 1GU1A 3T1OA 2IF2A 1K5HA 1YVRA 1JJIA 2IBTA 1QRAA 3B1YA 1TW3A 3PDCA 3WIVA 1DUVG 1D6MA 4C4OA 1Y1SA 5LP6F 5H81A 5LYJB 5GONA 1F7UA 2NUAA 1A5TA 3KLNA 1BXRA 2EDCA 4KTTE 4M0LA 5G2OA 3GTLI 3VSDA 3VYTB 2PL5A 1WJGA 2BMDA 4QRIA 5AVQA 3MM4A 4JB0A 1NJ5A 2FUNB 4KR9A 4DYDA 3AUUA 1Y48E 3JQGB 3FRHA 5FUXA 1KQNA 4PNZA 1NW4A 1NBHA 2X4GA 5ERGB 1D8AA 3U80A 4QXRA 4MQFB 1DJLA 4XSGA 2GS9A 2AL7A 2V55B 3U7EB 5T4EA 2AR0A 1SCUB 4F9EA 4JQCA 5KYKA 4KQIA 3CCJ1 1TCBA 2I8LA 2J09A 3QU7A 5EYPA 3TSZA 4V1CA 5K2OA 4MARA 2C2WA 1YDFA 3KJGA 4BXOB 1NHWA 3H8SA 1I01A 5HKKA 3EXEB 1VQKZ 3AEQB 3PJDA 3SXUB 4ND8B 4WVLA 4D3XA 4K9SA 4C7KA 4RTLA 4LGCA 4M8NE 5JWRA 3UHOA 1D1QA 3ML1A 1CY1A 4PRKA 4UFOA 3LK6A 2ZP1A 3MCWA 2V7UA 2O7RA 4UTVA 2WT8A 1UDRA 3OJWA 4RD2A 2H1HA 2PKEA 4KWIA 2BFOA 3RUFA 3VVCA 4DC9A 4NK5A 3OIUA 4QREA 3SHQA 5LZ8A 5GOTA 2HY7A 2Q28A 1Q3KA 2W2LD 2J33A 2NVWA 3AHFA 3HZOA 3ZQ6A 6CHYA 3ZQKA 3OOJA 1GAEO 1HL3A 3ZCXA 5L3QB 3VPFA 1WVMA 4D7AA 1QM5A 2F3UA 1Q91A 4HWGA 3UMVA 4MAMA 2IIVA 4L22A 2ZYWX 3VX4A 3ZG6A 4DLBA 3H0KA 1R0SA 2DFKB 1H6AA 2QU8A 1KARA 1SWVA 1T0IA 3LG2A 3EVNA 4H7JA 4N7BA 4XAQA 4R1SA 5LYYA 1FFEA 4E31A 1M8FA 3AJ8A 3AFMA 2JFVA 3KOZA 1HQYE 4GRDA 3K6SB 1VKHA 1ISJA 4A6PA 3SICE 4A3DI 2W83A 5CDGA 1I32A 1AJEA 1JSXA 2RHGB 3E9NA 4L9WA 4TS1A 4Z0HO 3RYTC 3HJBA 5REQA 4Z7NB 1Y34E 2W11A 2WV7A 1PR6A 2ZDQA 2WUDA 4TYWA 3PYLA 4I1UA 3ILVA 3LAWA 5FUWA 3H4MA 1T3SA 1UXGA 4JNCA 5FHQA 4AJEA 2WSSD 3KBOA 5FBQB 1VLQA 1VQMZ 2GI4A 1ONOA 1A4UA 1PJ4A 4CM6A 4JASB 2RG7A 3QVGB 4UCQA 1Q1QA 1EHCA 1RD4A 5GWXA 2H0QA 3LP6A 4GQAA 4JBHA 4BB0A 3K0AB 2Y0PA 4A1OA 4Z4GA 3CN7A 5ESXA 3AJ9A 2QZZA 3RG2A 3BE4A 3VZBA 4NV3A 4AO6A 4YMLA 3WK8A 2I33A 1XZBA 2NVYI 4I14A 4XKJA 1IB0A 2ZAOA 3NHWA 4WKNA 3WAGA 1CUEA 4X60A 2HHLA 3DV2A 3UANA 4DLYA 2XZPA 3KTDA 3UAVA 2FWMX 4Y7NI 5E1MA 1PR0A 1DC7A 2DSTA 2VDUE 1KAGA 2Z08A 4UXJA 4EYEA 3IE1A 3HSYA 2WNSA 1WCWA 2QY9A 1G9XA 3RHTA 3D3KA 4J0IA 2AK3A 4WCFB 2PY6A 3PDHA 3T7JA 1YITZ 1ZESA 3LCMA 4DMHA 3EE6A 4ZYYA 1N0HA 3F7NA 3M6VA 3C7CB 2CF5A 3OLXA 2O2ZA 3BHMA 4NBRA 5HFNA 3IQDB 3TD2A 2JEOA 1XRMA 3VQTA 2QJWA 2ZS7A 3P2IA 4HHEA 1J22A 2WG2A 3T3EA 1HE2A 1S02A 2K5UA 3WHIA 1WF3A 4IS2A 2UZ3A 1M73E 3L0CA 2K6GA 4KU4A 3COSA 3HV2A 5EFZA 3TL3A 4CTKA 3PTZA 1MX3A 2GR9A 2VC2B 4PLGA 2VHTA 2IK8A 5FJIA 5JR3A 1SKBA 2OK7A 1CUAA 2GJ9A 5EXSA 1AS3A 3MC1A 2D74A 4IVNA 2DC1A 4OUDA 1KH3A 4MONA 1XWIA 1IHOA 1PJTA 2ZYAA 1YRBA 3IHTA 4BOYA 1N9ZA 4BFZA 1CQJA 4YONB 2PJDA 1DGQA 4W8GA 1E9FA 3ZHUA 1WMAA 2GM3A 3DBLA 3PS9A 1I5EA 4GNRA 5SY6A 3P0IA 4N9QA 1LQLA 3AVPA 1OWLA 2GKGA 4IIYA 1CRLA 4BP3A 1GEEA 4LY6A 4KYVA 2V7EA 4LXXA 2BFAA 3KB8A 4MVWA 2FSSA 1CUXA 2F8LA 2QP4A 1UPCA 1IXZA 4DREA 3O9MA 1L4EA 3BA1A 3RWBA 1IN5A 4BE4A 5KZMB 4DV4B 1M74A 2XDWA 2FUG6 1UP4A 4Q47A 5ECYA 1JZSA 3E8XA 1LV8A 3RV3A 4J1TC 4PSKA 1AB5A 1YIOA 3IBSA 4JLWA 3EYWA 4QEDA 2GCOB 3DBHB 4IH9A 5DI3B 2ZZKA 4ENVA 4ACBA 2CE7A 3N8NA 3IT0A 4RGQA 3DKKA 2EG5A 1AKEA 1YJWZ 3HPQA 4EGSA 1XDSA 3ACDA 4R3NA 2WTMA 4FMPA 2OBYA 2CK3D 1VKZA 1F4VA 2QMYA 4F4HA 3C2QA 4WFJA 1J5EB 5DYTA 4FXOA 2FOIA 3IQZA 4ENPA 3WDKA 4BZQA 1E3JA 1Y3AA 1NASA 1YKGA 1DB3A 2X41A 3O2QB 4FFOA 5CNJA 2N1BA 2WF9A 3PGXA 1JG7A 1SM4A 5F33A 5CA0A 2DRIA 4B0OA 1C14A 3DE3X 3T6KA 1RJWA 3G0CA 4JJ8A 3L92A 1UMDA 2R8PA 2E1PA 1OTYA 4DLVA 1W94A 2YV5A 4Z54A 3EOZA 2IUSA 4RMHA 1K97A 3AX6A 3F5SA 2EWMA 4D9FA 3PHBE 3OOYA 1PR2A 2IHTA 4GYYA 4G5QA 4IS3A 3OTOB 2X4DA 1IATA 3QUBA 1BMTA 3LXUX 4OMUA 2ZRQA 1RWPA 1DCMA 4K28A 2WC1A 4UTRA 2V9CA 1CIJA 2XW6A 3TDMA 3EFBA 4BTEA 2HMYB 2QX7A 3GH1A 4A3LI 4G65A 3SR3A 2BYTA 3GJZA 2GKOA 3E7PA 3V34A 2ZXUA 2UUAB 1P1HA 4FFPA 1J00A 3K6KA 4NFHA 5FV7A 3ZTYA 3CEHA 2ADOA 4FIZA 1MZVA 3TO5A 3THWA 2GXQA 3JCZA 4D9CA 3W1EA 5D85A 3J81k 1GFWA 2JPDA 1E3IA 2Q99A 3KOYA 4OKIA 2EJWA 3MILA 1O96B 2FW0A 3VHXB 2AKEA 3WJAA 1D2MA 2FFBA 1B23P 2RGCA 3GLHB 3CC71 1CKEA 1Z4LA 2QAIA 4FGSA 3EVEA 4LVOA 2H06A 3VKHA 2VYVA 4II3A 4EUHA 2ZB8A 1TMYA 2XUAA 3QU9A 4MQEA 1SXPA 3K6JA 2ZW9A 5D3MB 1KFJB 1L4FA 4D9GA 1OTXA 2XA2A 2ZAIA 1AM4D 4JT8A 1H6DA 3PF8A 4RSRA 4O4HA 3U7QB 3W5UA 1QF6A 3BCSA 2FKAA 1PYGA 2P9HA 3IILA 1JQBA 3QFTA 1UDBA 2VF8A 3O8DA 4RNCA 4IZ6A 3S2FA 1Q95A 4CETA 4EPVA 2P6PA 3CW8X 1CIPA 3GDFA 2ZJ5A 3LMKA 4PR3A 3GBSA 3TK1A 4B33A 3CCL1 4LSMA 1RBYA 1KRXA 1E9DA 4DIBA 2W5UA 5A3VA 2QQEA 3OY7A 1NT4A 1NJGA 5C5DA 4BY9E 3I4CA 2ILTA 4OFWA 2WM8A 2A9FA 4NU6A 3I5AA 4XUCA 1CJVC 1NJFA 2I6TA 1TJNA 2NSLA 2QX6A 2RT9A 4U3JA 5CVJA 4EBFA 2QG4A 2IYTA 2AJTA 3M2PA 4NNJA 1CUJA 4US0R 5AXDA 1R4ZA 3EAFA 3T1NA 4Q00A 1VKOA 4E08A 1N34B 4NYJR 5BSFA 4H31A 3V4OA 1Q0PA 2ALJA 3GH3A 3KZNA 2EGUA 3QGMA 4YCSA 5NULA 4KXFB 4XTCS 1PFGA 1V8BA 1QVAA 1TKRA 2WIFA 4RPJA 4RCZA 1E5LA 2MSDB 3LUPA 4D0RA 3H5AA 1P1IA 1TRHA 1GQRA 2W7TA 1S0UA 1E6LA 3PQDA 4M86A 1J56A 4O4LB 4W9RA 5D5PA 3W05A 5ICEA 2WBLC 4GECA 4S3MA 1UDAA 4CODB 1K8YB 2GM9A 4LRTB 3CF4A 3HNPA 1W581 1YR3A 3GN1A 2IT1A 3QKSA 1IL0A 4KBFA 4KKXB 1L4KA 4U5QA 3TQIA 2G28A 1CQWA 2HI0A 3I45A 2GCNA 5D3KA 1VL1A 2OHXA 1WLSA 5LD2B 2KPIA 3JQCA 4JB8A 4D45A 4H7HA 5EIBD 4H1HA 1XHLA 1RLJA 1ZRHA 1E5XA 1U2GA 4CIAA 2V9PA 4L73A 5CXUA 2FFQA 2YIMA 3GEEA 2HEIA 3ZJ5A 1W5EA 2NACA 1WU8A 4Q1BA 2WJPA 5AI6A 3ZWXA 4C0XA 1LDBA 2QQFA 1KGSA 1L2TA 1UM9A 2RK6A 1IHDA 2VLBA 3S28A 4X6AI 1ZC3A 2QGZA 3O92A 1O7JA 1Z29A 2X9GA 3PLRA 4ZK6A 3LH5A 5ICMA 3A3KA 4P3NA 1FPQA 5IANA 1PRYA 2R85A 3L7DA 3LLCA 3R77A 5KOJB 5SV2A 3ZD7A 4I4NA 2WIGA 2IPOA 4LV6A 2EHDA 5CVUA 1KOLA 2PSHA 3TNLA 3GLGB 2NV0A 3P9QA 2IYSA 5DYNA 5KSOA 3ACCA 3HJUA 1S2LA 4AZ3A 1GXSB 2HK6A 5JYEA 1Y4UA 3VNUA 2QRHA 2NYAA 1ID8A 2P5UA 4FCVA 1B3RA 3R7DA 1VIYA 2OG2A 3FTNA 3M89A 2P6NA 1JH8A 5K3SA 2VL7A 3HKCA 3I0ZA 1CY2A 1JFRA 2QOEA 1JG2A 5K3DA 3EIXA 4GW3A 5F7JA 4C4XA 1CS0B 1ETUA 1VI5A 1KC82 1WOYA 4H35A 4XM1A 1O6GA 4B9EA 2Q6LA 4F2WA 1ODLA 3FBWA 4ZZ0A 3JVVA 4B5LA 4ND4A 4HPWA 5EC8A 3OM9A 4NS4A 1VHDA 2WHXA 3TMKA 3HRKA 5KYNA 2BMWA 3Q72A 2XB9A 4MWZA 3OX4A 2SBTA 4U4AA 4IYRA 1Z0FA 4NRDA 1VYHA 4AY2A 4FYIA 1LJUA 2O0KA 2I1QA 3EVBA 4LF4B 1SCAA 2JL1A 2J46A 1U1DA 3W2GA 1Z5PA 4J1NA 4B09A 2PAFA 3UHAA 4INZA 5LOVB 1JIKA 1YE5A 2FV8A 3QE0A 1P8JA 1DAFA 4QBGB 3TFOA 3A3OA 4ZJUA 4WLOA 4P4GA 1KMHA 3HXOA 4JI3B 3BIXA 4LISA 4U7PB 4HSEA 3N0VA 1ZRSA 3W9SA 2K7FA 2O2YA 1E2BA 4MKIA 1FFHA 1O9GA 1YI0A 2WMDA 3LDGA 3M1YA 1AZWA 4AF8A 4ZV7A 3H1TA 3P9XA 4YT5A 4DIEA 1MOQA 1U0GA 3KQUA 1FP7A 3GG9A 3HXPA 3EGVA 3VZPA 5DGHA 3HYSA 4BUZA 3ZBQA 2FPMA 3RTBA 5BNTA 3BC1A 4FYMA 2FRVA 1JBEA 4JBYA 2ZYTX 1IOZA 1EK5A 1GAWA 2DKNA 2R4QA 4B84A 3C5VA 4NFYA 3V42A 1P33A 2PAAA 4RIHA 1AMUA 4CL2A 1F3LA 2HGZA 4P32A 5GIOE 2C57A 3TKYA 2Y0CA 2BI4A 5EXDA 2QUAA 5ELXA 3CUUA 2A57A 1JDUA 3CUEF 4H1UA 4GL4A 5FOSA 4C2UA 1HKUA 1C1YA 1FDWA 4NB9A 2LIYA 4RZXA 2EGTA 1LPMA 1N6IA 1Z22A 1RC1A 3ZEIA 1ZHHA 2AXNA 1T1IA 3NRCA 2OHGA 3RI3A 2ZUCA 4LRXA 2CXXA 1JR2A 4DDHA 4TMTA 1V9SA 2RGBA 1M1NB 3UGQA 3KM0A 5E7IA 4F8JA 1SKYB 2O8CA 2O48X 4UU7A 3HUDA 2PT9A 5ER6A 4QOIA 5T6MA 1XI2A 1SA0A 3E9MA 1U7HA 3G5TA 1EKXA 1THMA 3HCAA 2YL2A 1WKVA 1FU4A 1SFOI 3ICWA 2FZKA 1SUFA 3RUAA 2BEWB 3PTLA 4M7WA 2X77A 3OX3A 5KTKA 1ZIPA 4NX2A 3NU1A 1C0LA 1JDTA 2AE1A 1GPUA 4IV0A 2FZVA 1LV7A 4MVXA 5LJIA 3HDTA 4H7FA 1FNBA 2P5SA 4R9UC 1YUBA 3GZNB 2C5HA 2CXUA 2FWAA 3UB3A 3EULA 3OEHD 1UFVA 1PLJA 3B8HA 5AD1A 1KMQA 3QXSA 1GV1A 1O08A 2PX6A 2REBA 3L8GA 4BO0A 4EENA 1O5OA 1R9GA 2PBRA 2QSJA 3UMFA 4R5MA 3CBGA 1C7EA 1LJ8A 4YYZA 1U9IC 1NUIA 3U4DA 2VQ3A 4S24A 2X0DA 5EMHA 4BZZA 1WUTA 5JSUA 4HRYA 3O4HA 4YO7A 2BFDB 1V8ZA 3JQFC 5JFTA 3Q0TA 4B4WA 3I4NI 1RHKA 2RPRA 2QD5A 3EXEA 4CG0A 1QHNA 1UQUA 3MIIA 3SQLA 1MB2A 2BVNA 2C4TA 5AW3A 4DV0B 1VSVA 1YF3A 3MQFA 3D0QA 3UGTA 5ARDA 2QUKA 5COAA 1JGTA 3DE0X 3KKMA 1X94A 3NANA 5GINE 3DO5A 1JFFA 4R69A 5FTMA 2DKOA 3GBPA 1BOFA 2IY9A 5FA5A 1OPRA 2HSDA 4ZEXA 5C1OA 3LY7A 3R5JA 1L6IA 3QPVA 5G0TA 5JE8A 1RACA 4BQFA 1M0TA 1GQYA 1FQOA 1DDOA 1YV9A 2OUKA 2V6IA 3AHGA 3MOSA 3N3BC 4QRHA 1P7CA 3WHLA 4B71A 5L8VA 3Q9NA 4D1YA 2BUCA 3CMAZ 1QF9A 2HNBA 1K8RA 2B83A 1IZZA 5E3HA 4DCUA 1I6HI 5B30A 2I8CA 2XUZA 2QBYB 2C2OA 3K6SA 4IUDS 1II8B 1M901 3T3IA 4F71A 5IAGA 1IPFA 5LZ4A 4NMWA 3EEOA 4WZAE 2NAFA 4UDNA 3AG6A 2H1IA 4CM9D 3F1KA 3GRAA 3X1JA 5ALLA 1NE2A 1Z12A 5ALRA 3V4RA 1KJJA 1O58A 1VBFA 3R0JA 2CGEA 2HZBA 3L0YA 2BEUB 4P4LA 1C1HA 3AOEC 1VQ9Z 2G1JA 4RA6A 2DPGA 3ODGA 5CNIA 4NABA 2QYHA 1WA5A 3ROQA 3WMRA 1U28C 1SQFA 1H4VB 3NC4A 2A0XA 1JLRA 4BX0A 2OWDA 2N0SA 3W8FA 3K0AA 1DMSA 2HJWA 1XCMA 2RKWA 3KWFA 3OTGA 1PIWA 5BMVB 1Z6ZA 2IZZA 4ZHSA 1LPAB 3NP7A 2D59A 1T26A 2J85A 3K9QO 3LPLA 5F1PA 1CT9A 4PLYA 1JEOA 1I50I 4U8HA 1P6XA 1E7SA 3D0KA 3ZV7A 2D1TA 4LBVA 4LJYA 4I1YA 3BMQB 3FPEA 1KFEB 2JAWA 3AWIA 3F4BA 1X15A 2AOVA 2QVYX 5IWCA 4EG6A 3UUFA 2AGVA 4ZYZA 3AEXA 2QMUA 2H18A 4BUJA 4Z2AA 3ZVKA 2WY2D 5BSHA 4WCFA 1T4BA 3DLTA 2ZSBA 4BY7I 3KPWA 3D7KA 4KN8A 1CFJA 4NMMA 4ISCA 3RUEA 4AUNA 4PN3A 3AHIA 3RRZA 3KQNA 3U13A 1O77A 4DWOA 3BTOA 1PZEA 3RVSA 2GAJA 2FPOA 2IE8A 2VQ6A 4KWHA 1K5DA 4JOSA 3DVRX 4HXEB 3KRTA 2G1PA 2JIBA 4QPJC 4G0YA 2BN4A 3EASA 1OB5A 3Q12A 1TAGA 5BURA 4FDVA 5E4YA 3RFXA 3CZRA 1EP1B 4V0LA 1AK9A 1JG6A 1XVIA 2BP7B 1PQUA 3CB2A 5FNZA 3OE7D 4BX3A 4D5GA 4CMIA 4DQXA 10MHA 4MRNA 4OJYA 4XIJA 4HEQA 3FCYA 4Z1MA 4CL3A 3PCTA 4YGYA 5BXYA 2RI6A 2V1XA 5F52A 4F6RA 3DGFC 5H82A 2H4XA 4Q7LA 5FO0A 1TWFI 1CZHA 1FSFA 3M8KA 3KB6A 3AF5A 4OQQA 5IVDA 3PE3A 1DEAA 1ZCZA 4ITVA 3ZXIA 4BNTA 3K0SA 5BP7A 1VMDA 1ZK0A 3PCRB 3RAGA 1W5TA 4AP6A 5DRYA 1YS9A 1V8OA 2O50A 3NOVA 1E7QA 3Q7RA 3QLTA 2WQ7A 2VTBA 3OLZA 2AMJA 1GG8A 1CZRA 5GY7A 1QJ4A 3KT3A 3VGJA 3AVOA 5K3EA 1MGPA 1QOQB 3GFVA 3NWPA 2AW3A 3CD6Z 2YQ4A 2QI9C 3CPSA 3CT4A 4QOFA 4DR3B 3S40A 3WK6A 1XUOA 3DBHA 2IQ5A 5PNTA 2CXRA 5A3RA 1YHQZ 1N4DA 1SQ6A 2Q27A 5TLSA 1ONNA 1JLLA 1QTRA 5BN1A 1LSSA 4DA7A 1YZ3A 1C30B 5JANA 2CLDX 2XBMA 1YKSA 1RQFA 3EDOA 3SHVA 1W2BZ 3ER6A 4S1PA 5JXIA 2JAHA 3FKSD 5T7BA 1X3WA 2PU7A 4NCBA 3LYHA 5CFRA 1PCXA 2PRSA 4J6EA 2JASA 1H0KA 1PJLA 3GTJI 2DQYA 4DGQA 3GVIA 3NHRA 2HT6A 3LQFA 3PEWA 3DEAA 2D13A 1BN7A 3JWHA 2R7AA 1YS7A 4FGJA 3GFRA 1JLHA 2FW1A 5FADA 4YDHB 1RPJA 2QN1A 3RK4A 2HJHA 3W8EA 1Y89A 1JJ7A 4EWLA 2A1TR 1FCJA 1EG2A 2JJMA 2PL9A 3L05A 1IN8A 1C3LA 2C5GA 1V35A 4S04A 4X44A 3VMFA 3OUUA 2EEPA 1V8FA 5EE5B 2YWDA 3L4SO 4JX9A 1EI9A 3A6LA 3OM8A 6AT1A 1MR3F 5E8JA 3VDXA 2WIDA 2TS1A 1YQTA 1IDN1 3FFTA 5K0EA 1NOJA 4LI0A 4AMYA 4ZV9A 4ZEVA 4FCWA 1DTWA 2QJFA 3IA7A 2O07A 3QX3A 3FSEA 4U8GA 4D8VA 1M2NA 4M8KA 4PZ0A 4QQRA 5K03A 4EKIA 1RCTE 4CFYA 3UPUA 3P32A 1G6KA 3BG1B 2B35A 2QF7A 1U0TA 4R2WA 2O2DA 2SCUB 1L7VC 3HEAA 4KR6A 2NU9A 2DVMA 3ZGZA 3ZE6A 2B20A 2KWIA 2GETA 3KR0A 2J7PA 1I9GA 2GPTA 4C0SA 2ZQZA 3GLHA 4ISBA 1V43A 3BB1A 3JQBC 4JEMA 1QPGA 4NENA 3IDSA 4OU4A 1LF0A 5KWVA 2F43B 3M9WA 1E2MA 5C31A 4AY4A 4B7UA 5DGCA 4A91A 4EF5A 1QX4A 2OCXA 5LP6C 4EJSC 4ZTZB 3OFKA 4GHWA 3VBCA 3ZWWA 2AQKA 3KL2A 1TL7C 1TIKA 2WJZB 4LC0A 1SGWA 1I6WA 4RGVA 2GA8A 5FR2A 3QY0A 2GYWA 4YP5A 5SICE 1W85B 4ZT6A 1ZOOA 2VA9A 2ZYUX 4DDTA 1CQIA 3BK2A 1JG4A 3OQOA 2WJIA 3TMYA 1KRHA 4JUFA 3ZE2B 5H0IA 3ZN2A 3OURA 4CMHA 1EZZA 3TLEA 4DIMA 2DXIA 3DZKA 5E6UB 5FWAA 1B3BA 4MVYA 2YWEA 3DMTA 2CNWA 5ITZA 2NM0A 3NVAA 1JA0A 5IT4A 3ZVMA 3IQWA 4HAOA 4OGKA 1T8WA 4X20B 3RUCA 4Z9AA 1R6BX 1B0UA 2H51A 3ZWCA 2HRCA 2AN4A 2B7LA 2EX0A 5HS6A 2Q3CA 3R5KA 5LLSA 4D4MA 3NVDA 4AX8A 4I9NA 4LF8B 2QA4Z 1QHXA 3CGGA 1YOVA 2I8AA 4LOJA 2IE0A 1QLHA 3GA7A 1N78A 3W1WA 2VJLA 2ZSIA 5JDIA 2KW5A 3DE2X 4LHXA 2R1ZA 4Q24A 1K3TA 4C87A 4BMOB 5JRDS 5IT0A 4JQYA 3EIQA 2J6HA 3LLSA 3L1IA 5IM4A 2XF8A 4IIDA 1TVKB 3C97A 1VJ1A 4AP9A 2DE6A 2ZROA 1M2VA 4YQEA 4FU0A 2P6UA 4ATNA 3CF6R 4FMBB 1E9CA 5JHGB 3LTNC 2C58A 3H0EA 5BNWA 4XFKA 2IY7A 5DKFA 4GKJB 1NBEA 1NKVA 3AR3A 1M6NA 2IHNA 1XCGB 1RQ2A 3MWEB 2SKCA 3RIYA 1X1QA 2I1WA 1LS1A 3R3SA 1GNSA 1L9XA 2ZIEA 3BQNB 4GOND 4I3HA 3FI0A 3JZIA 2JDIA 4HTFB 3HFJA 9LDTA 1CDEA 2E6KA 1ISRA 1M2OB 3OZUA 2D8AA 1JR3D 2TRSB 4HAIA 5EWMB 1RHJA 1VHWA 1JU3A 2H2AA 3HJGA 1F6BA 4LDZA 5CAEB 1A5AB 2P2YA 4G89A 4JBWA 2FSVC 3ZWKA 2GZHA 5B2EA 3D5EA 1OYYA 1N2OA 4DQYB 2GWHA 3S1RI 4BBAA 4OP1A 4B9AA 3IA2A 3JQ7B 1F8YA 1N2XA 4UHBA 3VO2A 2HBRA 3B6EA 1IRIA 2O3RA 4UEOA 1PKXA 3EFHA 2XB2A 2WF5A 1YZKA 2FAXA 2HDOA 3Q9UA 4ND7A 4WV3A 1NTOA 2H2DA 5FULA 1B7GO 2XMCA 3DBOB 1D2GA 2VDOB 4O08A 3D4OA 3O0DA 1LLCA 2JGEA 2CKMA 2H5IA 5C51B 5CDUA 1XVAA 3BE8A 3W5JA 1ZY2A 3P9NA 4MDEA 1Q812 2CD7A 1TDJA 1WUJS 1QIGA 2C9DA 3DOHA 5EP4A 3D3JA 2G76A 3C8DA 3STWA 2HBQA 1JV2B 3T7DA 3C6BA 2F64A 2XBLA 1CS0A 3ED1A 1EFVB 1EH5A 3PXCX 3DEKA 3UFXB 4LYGA 3WLLA 2BJWA 5C32A 1CUUA 1DP4A 3WIOA 2E4YA 2XGJA 3NR2A 1QQ5A 2HLHA 5AI4A 2XNDD 3AFOA 3ND5A 1M6YA 1T1JA 1TJ5A 2G72A 3CUKA 2MCFA 3DUWA 3G82C 1NQTA 4NFRA 4JFAA 4F8EA 3SQXA 4EJ0A 1CSEE 5JLAA 2JVJA 4AIRA 1XYVA 5BVHB 2KE5A 3SEAA 1KYIA 4WPGA 3VH3A 1UKAA 5CEEA 1SUIA 2O2SA 4UQPA 3R09A 3BSWA 3U16A 5LOVA 2OA0A 3CR8A 1RTTA 3BORA 2H52A 2HDNB 3ZH9B 2BISA 1M3SA 3JVEA 1XD2A 1AKRA 3COWA 4Y9TA 1SELA 3B1ZA 1RZ3A 2CVOA 3GGJA 1YZTA 1J0EA 3N2YA 5A5FA 2FP3A 2H11A 3L1JA 1STOA 3PQCA 3X1XA 4YEDA 3S44A 5IJWA 4C4SA 2DWPA 5IARA 2CVHA 2AJCA 1YVEI 5K0FA 1K7CA 3TTSA 2RG1A 2G71A 3G6WA 3WV4A 2BBWA 4ZANA 2ATVA 4H4DA 2DR3A 3CR3C 4EY6A 2UYCA 1M0EA 3X2FA 1N9GB 3B1FA 1C9NA 4Q5IA 8LDHA 1XWWA 5ITWA 3RIEA 3T52A 2EBFX 1NW5A 1FQJA 2ZWOA 1MB9A 3QOYA 2Q3FA 3MTQA 4MV3A 3T9DA 5CA0F 2P1RA 1U5CA 3PL5A 4TTTS 4J3JA 4M0EA 1Q84A 2X0IA 3WWEA 3PYXA 3H9QA 2VF5X 4WZAA 4GE0A 2O4HA 1Z6XA 2FA9A 5D6NA 3VNVA 1PJBA 1W6RA 1Z83A 4BMVA 3ZW7A 3BAZA 3KOMA 4KEAA 4ZZ2A 4PC3A 3U56A 3DTVB 4D9IA 1DZ3A 2C1XA 4BQSA 5EP3A 4KVZA 2WUGA 3F7OA 2XMSA 4WN9A 2Z43A 4AI6A 3CC41 1S9HA 4YHHB 4K9OA 4QEZA 2DETA 5KPJA 3WL5A 4PG6A 5B7NA 2O54A 1B8PA 4RPGA 4DWWA 1SJ9A 1GTVA 3X43A 2IOQA 2QP3A 3LPNA 1MQSA 3KXPA 2P5YA 4Q1AA 5FBZA 4H59A 4LDQA 2C88A 5C81A 1QBKC 1J06A 4ARIA 2QTCA 2V7TA 4KCGA 4G56A 2NVXI 1MD9A 2OFXA 4R4JA 4BJ6A 4QYXA 5GVSA 5JCXA 4EKGA 2BH2A 2AZMA 2YR0A 4OA5A 3U4MA 3M1IA 1XF1A 4XX2A 1M54A 4Q1EA 5FPHA 2AOTB 3JAWA 3IJ5A 4D96A 2Y1XA 3AXTA 2O19A 4A27A 5IC4A 1Q2UA 1RABA 1X0XA 1E2JA 5AW2A 4IG4A 4G3XA 1ATZA 2OHOA 2Q3LA 2QTTA 1NM5A 3BXOA 2P78A 3CO0S 3EHEA 3O6VA 2HA0A 4KNVA 4O4HF 4TYQA 1Y1VS 4NC9A 2CXOA 4KR0A 3ZIDA 4NU0A 4UBOA 5TMBA 2WABA 2BFDA 3GPIA 3UK1A 2Z9BA 3AEUA 2YHBA 5TVGA 1KK1A 4K0RA 5FXMA 3RD5A 1Y80A 5H80A 3RPEA 5F5XA 2QZPA 5DHSA 3U7HB 5COQA 1FX0B 2EEZA 1WZNA 2WQZA 3KR1A 1XJ5A 1C9KA 3CCBA 4BNWA 4DUYB 4R1NA 3WYGA 1KAEA 4ZVNA 4B6FA 4DCTA 1GARA 2J41A 4MAAA 1JDJA 1M1ZA 4DJDC 4RZ3A 3OHPA 1H1LB 1S8OA 2FK8A 1S96A 1OFUA 3WL8A 2C0PA 3PNPA 3LXMA 4WFKA 5JADA 2FLWA 3IDZA 4G4SP 3E6AA 1WXFA 4GBJA 1SUSA 4ZAVA 1XIVA 3S2SA 3B6MA 2W48A 1O94D 3N05A 3WAKA 1R6TA 4KXWA 2ODTX 4BV8A 1EK6A 5FWYA 1TD9A 2BKVA 2A0KA 1YNOA 3KX2A 4WKGA 4DWVA 1QPBA 2G9UA 2PZ8A 5AP9A 1Z26A 3WGNA 3RRYA 5AIAA 3VR4H 3PJGA 1GZ5A 1B1CA 2H85A 2NGRA 4GXNA 5AKHA 4D81A 1GRCA 4ZVLA 2NO5A 5L95A 1RHQA 3JQ6A 1JDNA 1V3UA 3G4S1 2VRNA 1QGUB 3ZE8A 1PZMA 3RS0A 2ADFA 5KCZA 3OM1A 3H84A 3ENZA 2YDXA 1GKYA 1VKNA 2ORIA 3S81A 2PZLA 4JHXA 5EMNA 1FUUA 2X9QA 3TIGA 3WWYA 1HETA 3PFBA 4BNJA 3G17A 2XGGA 1BQEA 3RS4A