1P9NA

Crystal structure of escherichia coli mobb.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
169
structure length
162
Chain Sequence
b'MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 29
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1p9nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9nA01
1P75A 2WJVA 1S4QA 2OG2A 1PLLA 3EA0A 4LYFA 1MRNA 4B74A 2RCNA 4LUCA 5FOWA 3PR1A 1G21E 4ZDKA 3K9NA 5FBVB 4LPSA 3UATA 1WCV1 3DMNA 3Q5DA 5EP1A 1JPJA 2ZM5A 1YZLA 4AKEA 3KL4A 3CIOA 5HE9A 3QKRA 5L3SB 4TTQA 1QZXA 3B1ZA 3OEED 3TSOA 4F93B 1OW3B 1GNPA 1D6JA 3QSYA 2O8BA 1WBDA 2F43B 1FP7A 1VTKA 2WOJA 4OI2A 4DSTA 2FGJA 1QVRA 1RJ9B 4RCZA 1KJZA 4NYIR 5C1BA 1DTSA 5DN6D 5FUXA 3KTAB 2HT6A 3P27A 4MDEA 4U5XA 1JAHA 2WIAA 3AVOA 4R7ZA 2AK2A 4B76A 2GVZC 1NMYA 1IXRC 2BM0A 1VIYA 1G18A 2GJ9A 3R7WA 4BLSA 1P72A 4AKHA 3IILA 1XTIA 3RNLA 3SJBA 2BJVA 3K0FB 1E2NA 3L43A 1DAFA 4KI0A 2J0SA 4OHVA 4H1UA 2ZJOA 1R8SA 2HV8A 1O87A 3QF7A 3VR2A 4D4KA 3IIJA 3H0KA 1BMFA 2OXRA 1EWQA 1U9IA 1EXMA 2ZJ2A 2RMKA 4G01B 5JHGB 2QAGA 3VR1A 1XP8A 4F4JA 4TMWA 1VCIA 4FCTA 4D81A 1LFDB 2SHKA 3CWQA 2R6AA 1TU3A 2G0TA 3QG1A 1TF2A 4XOIA 3B1YA 4Z8XA 5FPKA 2P6UA 3EWSA 2P2LA 5DGXA 3DMDA 4H1VA 1L4YA 3W6PA 4D6PA 4P4SB 4BFUA 5J4LA 2JJ2D 3G82C 1SXJB 4P0TA 1Z22A 1FPMA 1IQPA 4EJSA 2IXEA 3PFIA 2CK3D 3QKRB 1S9HA 2V9PA 4LDJA 3I72A 4QRHA 2WPDD 3MRSA 4IEEA 4QJ4A 5JLJA 5FL3A 4TLCA 2R6DA 4F38A 2G3YA 2J41A 4OJKA 2YWHA 2OEPA 1T4GA 4D0LB 3X1ZA 1LY1A 4KFUA 2JLZA 1OH6A 3WHKA 3PUWA 5CLLA 1G5TA 4OHZA 3Q72A 1RKBA 1P9NA 1QG4A 4UNQA 1J7KA 5FTMA 1DAHA 2GNOA 4ASUA 2R44A 2PJZA 4BQSA 2AXPA 4TZ6A 3TGPA 2VHJA 3GLGE 5L3QA 5FPHA 5IF9A 1KDRA 2QUZA 3PUXA 4ACAA 1HYQA 4E22A 4D80A 2O8EA 3CPJB 4AKIA 4MRVA 3W8RA 5KSOA 3HWSA 3WP1B 1RIFA 3G5UA 4M53A 2OFXA 2ZE6A 3T35A 3B13B 4JS0A 1KY2A 2UVQA 3GLHE 4QM7A 1OIWA 2Z83A 3KUDA 2C2HA 1KI9A 3NH6A 2QAGB 1CRPA 4BZXA 4JLJA 4LBYA 4RZ3A 1Z63A 4LZZA 3OEHD 4ZCMA 3JZMA 4Q7JB 2W2VA 2HYDA 4WIAA 2WKRA 1XJQA 3CBQA 3DKVA 4PC3A 3RHFA 5UKDA 5C46F 5B30A 1NVXQ 1XJ0A 3NKVA 3EASA 1PJRA 1LB1B 4US0R 2BOVA 1BO6A 4Q9JA 3GQBA 2G0NA 1GL7A 5E7JA 2ZYTX 1P5ZB 4AURA 2DB3A 4BLRA 3U3MA 3U7EB 4EJSB 2CL6X 1E9BA 2PMKA 2QT0A 4QBIA 3L0OA 1IY2A 3DEFA 1ZYUA 1DG1G 2KI5A 2VP4A 3P20A 2J7PA 4FCWA 5HCNA 3AVXA 3C7KA 1XBTA 4KVAA 4KSBA 4C0SA 2Q6TA 2Q9BA 1DE0A 5CJ2A 5EE3A 4RZUA 521PA 4LWZA 5F9FA 2NOAA 3ZZTA 4LHWA 3FPAA 5JWHA 4DIDA 1OH7A 3K9LA 3VKGA 3HYRA 4KITB 3KUCA 1P61B 1T6NA 1SHZA 4M9QA 2JDIA 4B32A 5JCZA 4XVRA 4WAUA 4I99A 5EE0A 3SHFA 3IEUA 2ODBA 5CK4A 2OLJA 4HB2A 3NBXX 2QTHA 2ZANA 3AVYA 2WSMA 1R2QA 2YHSA 2AD5A 4Q01A 3B78A 4R71A 3MG9A 1GVNB 1M7GA 3AEZA 4I1UA 1M2OB 4ON9A 4A2WA 1GL9B 3U61B 1W0JD 4DCSA 1G19A 1F3OA 3D6TB 1PLKA 4TTPA 1G17A 4OBEA 1GKYA 1Q1EA 1ZD9A 3LXXA 4UNNA 3MD0A 1CTQA 5EE1A 5TVKA 3MGCA 1E2LA 3IHWA 2BKUA 2FGKA 2WJGA 3WMGA 4AY2A 1JR3A 2BIFA 2WZQA 2ZRBA 4QFMA 2QI9C 3HDTA 3PIRA 4HUTA 3O47A 4RFVA 2GWHA 4ZO4A 2BBTA 4JLPA 4WA7A 5FPTA 4TWZA 4OYHA 5CIQA 4JJZA 2OLKA 2FU5C 3SYKA 3AB3A 3RSOA 1UFQA 5LPNA 3K70D 4DLXA 3EIEA 3L8ZA 1SULA 2WICA 1G7RA 4HB3A 5BQ5A 4IVRA 5E4FA 1ANKA 1BOFA 2GK6A 2IL1A 5L8VA 3AKEA 4KAXA 4ZI2A 3BFKA 3KJIA 3SEAA 5JEEA 2ZS7A 3IHLA 2VPPA 4EQ6B 1US8B 4XWOA 2B92A 1DPFA 4B34A 5HKKA 4JYCA 4RD1A 3HU1A 2JLQA 3OFNA 4PQFA 1XNJA 1Z29A 3TJZA 4IXMA 4IJMA 3QVVA 4DLWA 3K70C 5KO2A 1E9CA 4LBVA 4FWTA 1M74A 5TV2A 1WP9A 2QZ4A 1UBFA 2QEQA 4II7A 4LV5B 1QDEA 2OCYC 2Z4RA 4W5WA 3AVTA 1LW7A 5CM9C 1OSNA 3SQWA 5EE5B 5G40A 3RRMA 4C7OA 1AGRA 5FOTA 1NMZA 1D5CA 2FFHA 2H92A 3FHOA 3KJGA 1FW6A 2VHQA 2JLYA 1E1RA 2XOKD 4O25A 2AWNA 3KQUA 1NJGA 2GEUA 1T8UA 3U3OA 4JLOA 3QEJA 3EAQA 4L9WA 4QGFA 2R6FA 1N5LA 4BRWA 5FUYA 1Q1QA 2CCKA 1E2GA 3TVDA 4HAXA 4M1TA 1Z47A 5SZHB 4TL6A 3CR7A 1HY3A 3RWOA 2YINC 4P3YA 3GLGB 3RC3A 1W5TA 4GOKA 4Q9KA 4E09A 3ZVMA 2BV3A 4NH0A 1GWNA 4LPKA 4M1WA 1XXHA 2PEYA 3IKJA 2G6BA 4HLCA 1X8LA 1ZD1A 3RAPR 3HPRA 3P1JA 5F3WB 1XRJA 2IYXA 3B1XA 3OAAD 2PT5A 1IN8A 4O2RA 2QG6A 2UZ3A 2VL7A 2PX0A 4CGZA 1KNXA 4TLDA 3W90A 1E98A 5E7MA 1IN6A 5KNDA 1W2HA 4FINA 3HPQA 1R10A 3PENA 3OIYA 3U6KA 1NF3A 4PC6A 1WBBA 3AVPA 1AQUA 1CR2A 4TLEA 2IT1A 4LHXA 3NIBA 3VR5A 2KBFA 4XSGA 2QTFA 1FMLA 4XWKA 4IFEA 1H65A 2AFHE 4WXPA 5FOSA 4OI0A 1YHNA 1Z0DA 4QGAA 3VAAA 1G4UR 4BFVA 2AHOA 2ZSAA 1OXUA 4MRPA 1EFRA 4W5HA 3I5XA 4JIMA 4ERNA 4C7OB 3ZS9A 4LYAA 3MWLA 4M9ZA 4BWYA 5EJEA 4PQYA 1LV7A 3IO5A 2ZUCA 3QEOA 3CRW1 4RJLA 1R7RA 1T8TA 2ZYVX 1N6RA 4UNRA 2C9CA 5LDDC 1P9WA 1Z0AA 2A5JA 4DLTA 4IW3B 2FOLA 3ONWA 5E3HA 3SNHA 2VHTA 1VG1A 4NCHA 5AJYA 1BKDR 3GLIA 4BZQA 3ZIAD 2WAYA 3AGPA 3B1VA 2RGDA 4D4LA 1TAGA 1F2TB 1DAGA 4XWAA 4QNRA 5KSPA 1PUIA 4GBMA 1P62B 3NVAA 4L4UA 3LX8A 1KGDA 4LJ6A 1IJEA 2FEMA 3LD9A 1G8GA 1NRJB 2GEDA 1N5IA 4JL8A 3VHLB 5ELXA 2QGNA 3QKTA 2GJ8A 2NZJA 4YMUA 2GK7A 2ZSBA 5JI3E 1T3HA 3A4NA 3BIFA 1MH1A 1YU9A 1TUIA 1OPXA 2MMGA 1RRFA 3LW7A 2J87A 4LBWA 2GCNA 1AS3A 3NBZC 4NCIA 2RGNC 5EXPA 1EFCA 3BERA 4XD7A 1X3SA 4ILEA 2OCPA 3NXSA 4IVPA 2MSCB 3BFVA 5EXXA 3QF4A 4H9GA 5TY0A 3TQCA 5DI3A 2WWXA 4DDWA 1OIXA 4IDHA 5JRJA 2ASEA 5EP2A 3WMFA 1HURA 2W6JD 3VTKA 3TMKA 1KDOA 2V7QD 4JLKA 3E2IA 2VO1A 2ERYA 2H8KA 5G3ZA 1HT2E 5DHAA 4ZDWA 2FSGA 1NVUQ 4LYJA 2G1JA 1UKZA 5KPDA 3U4QA 4IDNA 2J5XA 2W6ID 3GP8A 3WRYC 5JS7A 4GL2A 5J4KA 1M7HA 4TT3D 1ZINA 1TPZA 1KYIA 2WWHA 4HEJA 1N25A 3Q85A 3GPLA 2WBLC 5DO9A 3I8XA 1R0WA 3BB4A 1QRAA 4DCUA 3SR0A 1G8FA 3LQQA 4A0FA 4B2LA 3CH4B 3R9WA 1MOZA 1UBCA 2GCOA 5KUTA 1CRQA 1H8ED 4TMXA 1G64A 1XEFA 3D31A 4JJKA 2XGJA 1R8QA 1R5NA 2ZROA 1KI2A 4DSOA 1Q1BA 3LW8A 2ZI3A 4B3CA 1SXJD 2C78A 2X1VA 3MJHA 3OE7A 2ATXA 1N5KA 2DFTA 1IJFA 4BECA 3PXGA 1Q57A 4LHYA 4C0HA 3K1JA 3NHAA 4KCGA 4TL8A 1QHSA 2KJQA 4A82A 4MGKR 5CITA 1NBMA 5LB2A 2REOA 4TL7A 2AXNA 4UXIA 1Z0IA 3ZQ6A 4ZV4A 5J4HA 1FP6A 4GMDA 4EKDA 2DHRA 3QBTA 4WZAE 4B6FA 3K0CA 2Z4SA 1HT1E 1Z8FA 3U7FB 1OH5A 1G3UA 3MSXA 4LHZA 4CEIB 1SXJC 1A7JA 4YMWA 5KDDA 4X8HA 1S8FA 1QG2A 3JZAA 3CRRA 1XEWX 1SKQA 2W00A 3QF4B 2JLVA 1E9DA 1X8KA 1M1YE 3PEVA 3IO3A 621PA 4EFNA 2OFWA 4WZ6A 3VX4A 2WWGA 1AQYA 4YXWA 5CB8A 4UXJA 1C9KA 5KYKA 1E9EA 1E9SA 1W0KA 1G5PA 1IOZA 4HAWA 2GAAA 4JLMA 2DWOA 2P65A 1UEJA 4DC9A 2DFLA 2VBCA 2RGBA 2UKDA 4DDUA 3FOZA 1SVSA 4NYIQ 2Y8EA 3U4QB 4EAQA 1ZUIA 4G1UC 2A2ZA 2XX3A 2YOHA 3QI2A 4Z51A 2R62A 3WBJA 1CBUA 3W5JA 4DVGA 1NN3A 3A1WA 3AQ4A 1G1MA 2WIBA 3QENA 1BYUA 1AKEA 3AKYA 2ZRAA 3W6OA 1XD9A 1D2MA 1QHXA 3I62A 4MUAA 1KMQA 5FR2A 1OHHA 4AC9A 4FN5A 4MYUA 5HCIA 4DSNA 4KJZA 2C77A 4HLUA 2ZRDA 4S2EA 3BXZA 4D4JA 2NO1A 5DE3A 1YRBA 1E1QA 2C99A 4TQUS 4IOJA 2OAP1 3GLFA 4BFXA 3R8CA 2CEAA 1DO2A 3QJYA 4FW9A 2ZI6A 4BLTA 1XEWY 5A5GA 2A5YB 4C0BA 1GAJA 3EIQA 2F3RA 3THWA 1IONA 1AZTA 2REXB 1DELA 2WAXA 1RRCA 1E2JA 1W36B 4JSYA 4URZR 3BB3A 3X1DA 5KNCA 3CM0A 1OF1A 4YDHB 1NI3A 4EJSC 5JZVA 3U60B 4CEJB 2NG1A 2MSDB 4MKGA 1EFTA 2BBWA 4AG5A 1CP2A 3RYTC 3N5CA 4PX9A 3EPLA 3WXMA 2GAOA 4EUNA 1SVKA 4AYXA 1PLJA 1A4RA 1MRSA 1F2UB 2EYQA 3BD9A 1Q3HA 4OI1A 5KTYA 3R9IA 1C1YA 2D7CA 2V8OA 4YQFA 4B71A 5L3VA 2VF8A 1VMAA 4Z1MA 3AM1A 2QQ0A 2BVNA 4WXRA 8OHMA 5F2EA 5FR1A 3ZS8A 2VRWA 2B8WA 3UG6A 3TW4A 2WV9A 3O8CA 2Q9CA 2XXAA 5E7IA 1KAGA 1XFAA 3C15C 4FI3C 2DFNA 4RZXA 3A4LA 2W58A 3LQRA 4W7SA 4A6XA 4GMXA 3TQFA 2NTYC 4C2TA 3T15A 3B9QA 2IXGA 3RSLA 3NTUA 4OJQA 3U3RA 4UJ3A 1P2UA 4P32A 4GZLA 4TLBA 2HXYA 3E70C 1CXZA 3WYAA 1DAMA 4DEYA 1IN5A 2VP2A 1WDTA 3CRVA 3NEJA 1K5GA 1YZUA 1E2QA 2CNWD 1M8PA 2C95A 3QXSA 1DAEA 2O8CA 2CCJA 3RS7A 1P2VA 3THWB 2OO7A 3EG5A 1I2DA 3NC1C 1YZKA 4XTCS 3T34A 2R65A 2Z5FA 1N6PA 3T1OA 2HLDD 2NO0A 4LK2A 1W47A 4KFTA 2JLRA 5DI9A 5EXSA 2IUUA 3RLFA 2GDJA 2DYKA 1YZGA 1ZBDA 4JKIA 2XZLA 1P73A 3DHWC 1BIFA 1WRBA 2PL3A 4DJTA 3C16C 1RYHA 4YC7A 3VR3A 4CT5A 3HU3A 4Q9IA 2WKQA 3KKMA 1KK3A 3U3JA 3BH6A 3W3ZB 5BYKA 4O0MA 2BHRA 4S35A 4Q66C 2IS6A 2GJAA 2J3EA 4L8GA 5FBQB 4GDFA 4JLBA 3K8YA 3KZ1E 4TSFD 2WM9B 4DDTA 2GBLA 3S1AA 2ZU0C 2IEZA 3QY0A 2FNAA 1N6HA 4CIDA 2HJGA 3A58B 1T3LA 1UPTA 3BJIC 1ONBA 2G77B 1DOAA 3AP2A 5FL7A 3T5DA 4B3BA 3SC3A 3EZ9A 1I4TD 2N42A 4MRNA 4AG6A 3WYGA 4D4MA 3QXHA 1V5WA 5H70A 421PA 4CRWB 2QRNA 1Z08A 3C14C 1WE2A 3BBPA 1W49A 4D26A 2QTVB 2XXAB 2FH5B 4MKHA 1A2BA 3TR5A 3THOA 1EG7A 2ZRHA 1VYUA 1AN0A 2YC4C 2EFDB 4BZPA 3P4XA 1V43A 1AS2A 3Q3JB 3QUSA 2WJJA 4FWIB 3I73A 4R98A 1DBSA 1JPNA 3QQ5A 2GZDA 1T91A 1P2TA 2XB4A 4Q47A 2ODNA 1KKLA 2YWEA 1XD8A 2FFAA 4QC2A 1IBRA 4F91B 3NBYC 4N1AA 2FPLA 2QT1A 3DVLA 1TL7C 2GTPA 3GFTA 4MYHA 4OHXA 4OQLA 1P9RA 3M0EA 4HDCA 3T12A 1CJTC 2JLWA 1JQJC 2JLUA 1W48A 4Q18A 2EYUA 4QNMA 4B35A 3UMFA 1XMSA 3OFND 4XVQA 2A9KA 2W2XA 1NMXA 1O3YA 3ZJYA 1CF4A 3I4LA 5FBWB 3ND9A 1VCOA 4JVSB 6Q21A 3I32A 1ZC3A 2GKSA 1E99A 2DWQA 3RABA 4G5RA 1ZJ6A 4R2HA 4IEIA 3MWJA 3A1TA 4EPVA 2V3CC 2GVDC 2J59A 2CVFA 4XTRA 2QNRA 3U3KA 2CE2X 1OKKD 3EXAA 2BC9A 3FMFA 3K09A 1RYFA 3DO6A 3B6EA 1XMVA 2PH1A 2VSXA 4B2PA 2VF7A 1E4YA 4TQ9A 1TQ4A 4TMKA 4YMSA 3DM9B 2ZQ5A 5HZKA 2O8BB 3IGFA 1VG9B 2F55A 3DM5A 4NL4H 3ADBA 4QHSA 1HE1C 3SE0A 3CUEF 1JR3E 4OQXA 1XWIA 1YRAA 2QU8A 3K0AA 3RVBA 2W0MA 1E0SA 5TARA 3PEYA 4OL0A 1DARA 1H8HA 1CJKC 1Q0UA 1OJLA 1FX0A 1XMIA 2IS2A 2QM8A 3B8HA 3Q9LA 4P33A 5JWRA 2YKGA 4EDHA 3B5JA 2A30A 4PAQA 3R7WB 4Q5IA 4PPGA 2EFEB 5TDHA 2C96A 3PUZA 4OQMA 2OUKA 2JJ8A 3SBEA 1D8TA 1R0ZA 3CPEA 4R2IA 4UKDA 4CZ2A 4POAA 4BUJA 1J90A 2P0EA 2F9LA 4NHOA 1VECA 4HYYA 1ZIPA 3SFVA 3FFBA 4QXAA 1OXTA 2HDNB 1VKJA 3UIEA 3UWOA 4F4CA 4MRRA 2ZJAA 1VHTA 5K8LA 2KBEA 4XJXA 2IBMA 2NO7A 4HLQB 4YMVA 2E1RA 4PC7A 3I8SA 1KMHA 1NVVR 2ONKA 1Z2AA 3SOPA 1XB2A 2CVHA 4LJAA 1KO5A 2JASA 4G5QA 2DY1A 3J81k 1W2GA 1UM8A 2D7DA 3P32A 3TH5A 2REBA 3HR7A 4EFMA 4YMTA 2C98A 4M1MA 4V0KA 1HUQA 2NQ2C 5FBLB 5FTKA 3R9XA 2NPIA 3RS2A 4GPTA 3EPJA 3GEIA 3TE6A 1NNEA 5DISB 4ARZA 1YR8A 5DNYB 1FL9A 4L5BA 4OI4A 3RWMB 2V1UA 5J47A 3X1WA 1XPRA 3CPHA 5FOXA 2PT7A 1VYVA 1C4OA 5DYIA 3U7HB 2WHXA 4BFTA 3W6NA 2R8RA 5KSZA 2FF7A 3U44A 1ZIOA 4JT2A 5GJBA 1VG8A 3ASZA 4TYNA 1W46A 4V0LA 3PVSA 221PA 1I4LD 4F7WA 1KI8A 2I3BA 5EE9A 4XIGS 4K81B 4DLSA 3TUZC 3NC0C 2ZTSA 3SBDA 2LKCA 1FX0B 2L0XA 2IUTA 2IW3A 1W5SA 4LCBA 1D2NA 1Z6YA 2FZLA 5L3QB 2RH5A 1Z83A 1JJ7A 2X2EA 4PC2A 4DLRA 4QM6A 2O8EB 2FX3A 4Q1AA 2FPKA 4TMZA 1XXHE 3RS5A 1G9XA 3LLMA 1DEKA 2FV8A 1T0JB 4I81A 3F5FA 4NYJQ 5FOVA 1N5JA 3KQKA 1HH4A 3W9YA 1S3GA 1GG2A 3OESA 2IK8A 1N2CE 1X6VA 1Q21A 2B7CA 5BN4A 2FSFA 3P26A 4XD7D 5A0FA 2IS4A 1XTSA 1Z5ZA 2ZUDA 1ETUA 5KPJA 5CDFA 2ZJBA 3SYNA 3L82B 4RKEA 1KMHB 5GJWC 5JFGA 3CF0A 3OEEA 4P4TA 3TLXA 2RGCA 3AH8A 5CB6A 1GNQA 2AL7A 4O3MA 4PHHA 1LF0A 2WMOB 4UNPA 5JBQA 2XJ4A 3LV8A 5LBIA 1ZU4A 2VHUA 4LBZA 2ORWA 1KI6A 5HTKA 3KQLA 3CF2A 2XNDA 2XSZD 4TLAA 1EX6A 3DOFA 4K46A 4Y0VA 1VYTA 5AUNB 4OHYA 3VQTA 3TAUA 4CEHA 5FI1B 3K9HA 5DN6A 1AA9A 2QY9A 2ZVPX 4URVR 2ZJZA 4Q21A 4MITA 4FCVA 3L2OB 3OF5A 4Q4AA 3HR8A 1XTKA 3U44B 2WJHA 3E1SA 5BN3A 1OLOA 1S1MA 1OXSC 1NP6A 3Q7PA 1I4DD 3JVVA 2QMHA 1NLZA 5FH9A 3GFPA 4ZCIA 4D82A 3GLIE 2DWPA 3AF4A 3IIKA 2KE5A 1XD2A 1Q22A 2IYYA 2OV2A 3QXXA 4PPNA 4WW0A 5AK0A 4A1FA 3FVQA 1E79D 4TN1A 1HEIA 1OFIA 1CU1A 1R5OA 1S96A 1XMJA 3EIHA 3B2EA 3WHLA 1TUEA 1KY3A 2DCUA 2ZPTX 3A1UA 4NPHA 2X77A 2VH5R 3BOSA 5JMTA 1NG9A 2PZFA 1TADA 4DKXA 3SFZA 2YV5A 3MFYA 1G3MA 4JMPA 2VIIA 2FA9A 1W36D 1ELOA 3CONA 2JJ2A 4Q00A 3H4MA 4AYWA 3B85A 2ZI9A 1XDBA 1MO5A 5CIWA 3UPUA 4QHYA 2ZUBA 4R9UC 4B3DA 2F7SA 2NO9A 1L4UA 2O8DA 4EIWA 4X8OA 2ORVA 5BWMA 1FMJA 1XU4A 2E87A 3A36A 3CF6R 2XNSA 2WPDA 3C4JA 4RD4A 1ZP6A 5BN5A 3W3AA 1W0KD 4GP7A 1IN4A 1GRRA 1KI6B 3QXJA 4KFRA 1IY0A 4XH9B 3VFDA 4BFYA 3VKHA 2NIPA 2IUSA 4Q48A 2RHMA 1GILA 2J46A 1W36C 3EZ7A 4KFSA 4CEHB 3WNBA 1NN0A 2Q9AA 4RSGA 4DUGD 1CR0A 2PBRA 5FTJA 2D74A 3EW9A 2ANBA 1LVGA 1R5BA 2IYUA 2ZI5A 2VEDA 4IOMA 4A8JA 3CH5A 2FEOA 4Q4AB 1PZNA 4PPFA 2VA8A 3A1VA 4NYMR 5SZIA 1KI7A 1WXQA 2JIZA 1ZM9A 4TZ0A 2ORIA 2P6NA 5A4JA 1CULC 2O8FA 2VHCA 3DKPA 1UDXA 1QF9A 1IXZA 2FE4A 4Q1CA 4QBHA 2IEYA 1XD2B 4TYWA 1D9XA 4IXNA 4JT4A 2C8VA 1AZSC 1R0XA 3CNNA 4K8OA 1DVRA 2OHFA 3ZZUA 3OEHA 3AF2A 4LV8B 2AN9A 2QPAA 4X8LA 3UG7A 1NBME 1K6MA 2PCLA 3KB2A 1M6NA 2ZVQX 3T5GA 2Z43A 3WY9A 3RS4A 5B58C 2WWIA 1E2DA 1Z6GA 4DCNA 1T0HB 4PTLA 3ZVRA 2R6GA 4Q4LA 2OESA 1YR9A 2ZU6A 3MWKA 5FUWA 3TSZA 4E03A 4HAVA 1KTVA 2RHDA 5GJCA 1TTTA 4ZIRA 5F98A 1N6KA 3TNFA 1ZD8A 1E69A 2OFOA 2O8DB 4V02A 1KSGA 2QORA 1P4SA 1OE0A 1YKSA 2IYVA 1U0JA 4NU0A 1T9HA 4PFSA 1XXHB 2D4HA 1OB2A 2WJIA 1U8YA 5CJPA 1WB9A 3L0SA 3UWKA 1J99A 1OFUX 4FXPA 3VNVA 4KBFA 5HPYB 2H57A 3CZQA 4I1OA 1A5TA 4Z1MD 1SVMA 1EX7A 4IOLA 2G9NA 3ADDA 3IPXA 1VG0B 4OHWA 5FOUA 4MGYR 1FFHA 3RC8A 2IYLD 2CLDX 3RDPA 1Z28A 4N0EA 4PAMA 4A8JB 4JVLA 3UMRA 1S3SA 1YVDA 4JBXA 1W4AA 4IFBA 3ZYCA 1GITA 1KDTA 1ZNZA 1KDPA 5P21A 1YR7A 4M22A 5IDVA 1JALA 1HE8B 4BFSA 1KNQA 4BLPA 1COWD 1II9A 3BORA 1ZMXA 2O8FB 2FZ4A 3UKDA 4D25A 2IYZA 4GNKA 1Z6TA 4QBFA 1G4AE 5FTNA 1W1WA 4TTRA 3RS0A 3NEYA 1N0VC 4NMMA 2X19A 2OM2A 3VKWA 3BWDD 3QE0A 4FIDA 2B8TA 1CEEA 1P3JA 2XZPA 2IWRA 2DBYA 1SGWA 3TUJC 2GRJA 2QA5A 3QVUA 4CT4B 1UKYA 3ASYA 1CLUA 3AUYA 1ZCAA 1OV4A 3AF0A 3GLFE 4MA4A 2A3RA 4TL9A 2ZE8A 2RKOA 4M1KA 4A9AA 4DZZA 2ANCA 5JWOA 5EUMA 3ZD7A 5CK5A 1FQKA 3L0IB 3SJCA 2HJVA 1N6NA 1OIVA 3GLIB 1N0UA 1P2SA 4TMVA 3EZ2A 3LVQE 2AFIE 4ZIRB 1Q12A 3OIUA 4C3ZA 3ZQJA 4TMTA 5JJIA 5JI2E 4LJ5A 3ZLJA 2QQEA 3RANA 4TQAA 2BDTA 1PV4A 1Q20A 2WSSA 3A1SA 1NG1A 4KYIB 2QPTA 1QHIA 4PANA 3FYHA 2KWIA 1P6XA 2TMKA 821PA 3DL0A 4M9XA 1GFIA 1CJVC 4GZMA 3I3SR 1QVAA 1RRGA 3EX7C 4LJ8A 3K0EA 5DYGA 3UXMA 1DS6A 3L0PA 4G0NA 2QBYA 1JJVA 1KZGB 2HF9A 2OT3B 4URYR 5LB4A 3MJRA 5FPYA 2ZR9A 5DSZA 4C2UA 1SVWA 4DT1A 1G6HA 2Q3FA 4Z54A 5DI3B 1ZAKA 3BAFA 2J0UA 2GBLC 4W9MC 2YVUA 1E2PA 4M4SA 1NLYA 3AGQA 1MABA 3U2QA 2IS1A 4WZBE 1YE8A 4M1OA 2EFCB 2XOKA 2WTUA 4WVFA 3OZXA 2CHVA 2A5DA 3FFAA 3OIVA 1E4VA 2OILA 3TAHA 4MRSA 2EWWA 2B6HA 4M9SA 1IHUA 4HAYA 1BMFD 1UBGA 5B2ZA 1EFUA 2H16A 2KB0A 1GRNA 3MLEA 4RZ2A 1RC8A 2ERXA 3K70B 2O5VA 4A15A 3LBIA 4NKRA 4RVCA 5SZKB 5B64A 2BKEA 1NL3A 2GCOB 3GJ3A 2C9OA 5JEDA 1YZTA 4RD0A 4M1SA 5G3YA 5JSZA 2ZS9A 1E2MA 4JL5A 2GXSA 1X1SA 2RGXA 1JI0A 4U00A 1X8JA 3BC1A 3EA5A 4NONA 4L16A 1LNZA 3GJ5A 5AJWA 5AWFC 3W8NA 1U9IC 2XZOA 1TNDA 4JKYA 4AIIA 1J8MF 2QAGC 3JVUA 1LS1A 4G5GA 2QROA 4Q1EA 4NZYA 4A0GA 1KIMA 1ZC4A 1FUKA 3M1IA 1KK0A 2BCGY 2H5EA 3NDPA 1E0KA 4A6PA 3LA6A 3H86A 3DOEA 1GSIA 2W2TA 2W83A 3B7GA 1KAOA 4KODA 3IBGA 1E2EA 1HA3A 1G6OA 2HYIC 4QGGA 2HEIA 1G5RA 1OFHA 1E9FA 2AX4A 5EXTA 4DRZA 1J70A 2C5LA 5BW8A 4M8NE 4ASUD 2ZRFA 2F3TA 2ZRKA 4E07A 4Q4HA 5AJXA 1H8HD 1XF9A 4JLAA 5CYPA 4ACBA 3T1QA 1E32A 2XAUA 4Y0AA 1MABB 3FKSA 3WBKA 2AK3A 3C8UA 4Q02A 5KDOA 3KJEA 1B0UA 1TF5A 2FFBA 3X2SA 4PZLA 1U94A 4MQBA 2VP6A 2J0VA 3F0TA 4LI0A 2BMJA 3MUFA 2AKYA 2N46A 5H1YA 4B33A 2GJSA 2XTMA 3PUYA 5HR5A 3RS3A 3ZIAA 4QJ3A 3I5YA 1EWRA 2Q0HA 1GP2A 1GUAA 3NDBB 2RGNA 2YOGA 1ZNYA 2HCJB 1VCMA 2QGZA 4C30A 3LLUA 2ZREA 1JECA 4EPTA 3NH9A 3VR6A 2D06A 4F4IA 4PZZA 2V54A 5L3SA 2CE7A 2J9RA 2X2FA 4P4UA 5JSZB 2DPXA 4LJYA 1G7SA 4I1VA 3KX2A 1PVOA 1AS0A 4ZKEA 3ICQB 1Z07A 1U8ZA 2O0KA 2H18A 3TK1A 4G3XA 1T5IA 4RCYA 2JLSA 3U7GA 2BBSA 4PO1A 4B3XA 2O0HA 4UQOA 1CKEA 1KSJA 1GL6A 3GLFB 2D2FA 3D3QA 1YZNA 2J7PD 3CRQA 1E0JA 4BLOA 2XTZA 3GEEA 1MV5A 5HZHA 3MWYW 3GJ7A 3NG1A 3CW2A 4GT1A 1NVVQ 1RPZA 2Q3HA 2ZI4A 1BH2A 3CX6A 4KU4A 2GXQA 1Z06A 3ZH9B 4KYUA 2W6JA 4U7DA 1E2KA 3AV0B 1P7CA 4CVNA 2JDID 4PHFA 2QP4A 1VCNA 1A1VA 3PJRA 4DLYA 2ZJ5A 3A8TA 4Q4HB 3BK7A 1OT3A 4LC1A 3AP1A 4PO9A 4XVUA 2CXXA 1N6IA 5F9HA 1B23P 4L15A 2W6IA 1ZNWA 2ZITA 4PSVA 3Q7QA 5AR1A 3T1TA 1MR3F 4TT3A 1KJWA 1NSTA 1UJ2A 4JYBA 4TYQA 2PEZA 4Z8YA 3V4FA 4F92B 1E0AA 1YJ5A 1R0YA 4PPQA 3K0SA 5D3MA 3AVQA 4GRAA 4NCJA 1JR3D 2FJUA 1H8EA 3T61A 4PZYA 4EPXA 2F1IA 4DLUA 5JS8A 2CL7X 4DSUA 1E9RA 4P4SA 1SVLA 1SXJA 5D3QA 4B48A 721PA 3GEHA 3R20A 3QKUA 3RRYA 3WMEA 5FI0B 2IYWA 1G7TA 4HB0A 1RE0A 1ZNXA 2EU8A 1FTNA 2AR7A 3O8RA 2N1BA 3VX3A 2OCBA 1W4RA 4V0MA 4CDGA 2R2AA 4PR0A 4ZKDA 4LJ9A 2XNDD 5LD2B 4JLVA 1XPUA 5FTLA 2DFKB 1WA5A 1RFLA 3EC1A 3M4YA 4RD3A 3X1XA 4MYCA 2ZRJA 1XCMA 2O8CB 2PZGA 1E2FA 4HLDA 2BMFA 3BE4A 5HKKD 1LF5A 4QBGB 2DR3A 3IDQA 2YOFA 3QNUA 4JVMA 2R6CA 3TSWA 4E5UA 1KSHA 2ODWA 4LYHA 1WQ1R 5KU1A 4HZUA 3AKDA 4W5JA 4RFSA 2IA5A 2WJYA 4ZPXA 2P6RA 2FPMA 3LBHA 4D0NA 1XZQA 2IYQA 4URWR 4B3FX 2UZIR 1NY5A 3IEVA 2QM7A 1NN5A 1ZUNB 1SZPA 2VYFA 3KJHA 1W4CA 3KQNA 3CNOA 3U6BA 1LTQA 3ZGXA 5EQTA 2C04A 1E2IA 3S1AB 1SKYB 2OBLA 3BH0A 2JJ1A 1YR6A 3CO5A 3CB4A 1AKYA 5D3MB 1E1RD 1KO7A 2GETA 2ZEJA 2I1VB 4DB2A 2H7VA 4EPWA 3ADCA 4KBGA 3ICEA 3CKLA 2QN6A 3AP3A 4FMDF 3VHXA 1GDDA 1FZQA 1Z3IX 3N70A 2J1LA 2HT1A 1QHHA 3FTQA 4URXR 1G3QA 1N6LA 2B7BA 2GCPA 4DCVA 5DIFA 2JATA 2YZ2A 3NBFA 1UBEA 1XEXA 5CDFE 5DHFA 3CX8A 1TEVA 2ZRCA 1S2MA 3B1WA 1JAIA 4IKEA 1D9ZA 1CJUC 3THYA 4A36A 2OBMA 4KHZA 2IC5A 4PO8A 3FHTA 1MO4A 3ZVLA 3AF1A 2CL0X 1UADA 4EPRA 3ADKA 3CLVA 4GFDA 1N3BA 2ZRLA 3PITA 4JL6A 2VP0A 4BLQA 4DCTA 3ZVNA 2CJWA 2A5GA 2YNMA 2JIZD 2O0JA 2ZR7A 4HZUB 4B2IA 2QE7A 4URUR 2YJTD 5H8WA 4GOXA 4DB4A 2Q3MA 4A0HA 4RFSB 4OK3A 4PAOA 1OXXK 2ZRIA 2ZR0A 2IWHA 2IXFA 3FDIA 4JLNA 2AD1A 2XEXA 3NWJA 1XTQA 5HE8A 2IHBA 5KSYA 1KI3A 3PCRB 1JXMA 5K8UA 5K8IA 1QHGA 4GP6A 1QBKC 4P31A 5CYOA 1UAAA 5G53C 3DZDA 2WWYA 1EFRD 1TQDA 3U5ZB 3KB1A 3OIWA 5CM8B 1U90A 4C0LA 3UANA 4A8JC 2WWFA 5JCPA 3N2EA 3OHMA 4NYMQ 5IK2A 2GJKA 2WMNB 1ZM2A 5E95A 1OYYA 5C18A 1X86B 2PCJA 4NE2A 4US1R 3CNLA 5JECA 5M04A 3KKOA 4RY2A 3UMSA 3PV0A 1VDZA 2PLRA 4AK9A 3I1FA 4JBYA 2IHYA 4UJ5A 3IIMA 1KKMA 1QHHB 1XCPA 3K0AB 1ZM3A 2CMKA 3C41J 3G0HA 2F6RA 2ZJ8A 3D7MA 4Q7KA 3UK6A 1KZ7B 2QPOA 3P4YA 1QHYA 3KQHA 1XEXB 1GZSA 2G1KA 1VIAA 2WOOA 2EW1A 3AUXA 3REGA 1NJFA 1T3SA 2QSZA 3LDAA 2P67A 2ZSFA 2CNWA 4OK5A 2QMOA 2FMXA 4ZCLA 2V1XA 4EQ6A 1US8A 4LV6A 4AWXA 1DG3A 1FOEB 2G83A 5SZJA 4BEBA 2RAPA 2JEOA 5GJVC 2HLDA 4A4DA 4MKFA 1G8HA 2GESA 4HZIA 3W34A 3THYB 1AJEA 1S1CA 1Y3AA 4DBLC 2V55B 2EVWX 1G3RA 3BS4A 4BGDA 4JZKA 2EWVA 1AK2A 4US2R 5EP3A 2GZAA 3SYLA 2CJWB 1UF9A 4D2IA 3FKQA 3O8DA 3ECCA 5IHPA 3GJ4A 2ZRNA 3QXCA 4Q4JA 4TSFA 1N0WA 2FSIA 3EC2A 3CZPA 5B57C 1ZCBA 4FMDB 1IM2A 3B9PA 1ZUHA 1MKYA 2ECKA 5AUQA 1K5DA 3HJNA 3A4MA 4A2PA 1W44A 1NVWQ 2X8AA 4QKQA 3I92A 3AVVA 3VU9A 5G41A 2ZI7A 1ESNA 3SS8A 3TVTA 4ARZB 4ABYA 3MAAC 2QP3A 2PZEA 4HB4A 5TMPA 3TRFA 4ESVA 1XTJA 2D3WA 1UEIA 2HCBA 1FUUA 3GMTA 2W0SA 4LRWA 4ZDJA 3GLGA 3R8FA 3B60A 4CF7A 1KO8A 4HAZA 4KO8A 1L2TA 4LSGA 2FWRA 2QMEA 3WRXC 1GTVA 4DDVA 4BFWA 3GLHA 2OBNA 3FMPB 3VR4A 1KOFA 4CYMA 4JSTA 4AKGA 1U0HC 1KI4A 2GA8A 2I4IA 1F5NA 5L3RA 1E2HA 3WP0A 1HV8A 1IY1A 3OE7D 1Q1ZA 4M2LA 3GJ6A 4EFLA 5GADl 2ZS8A 2WSSD 2CLCX 1ESMA 2BMEA 3PEUA 4IOKA 1OFTA 2ATVA 1NBMD 1U81A 3I61A 1D2EA 5EZ6B 3SI7A 3FWYA 3IQWA 1FQJA 4MH0R 2HF8A 2NGRA 1HTWA 4IDPA 4I1SA 4EPYA 3SDZA 4DXAA 3GJ8A 2RB4A 1NIPA 2ZXUA 1OKKA 1GRQA 2P3SA 1IN7A 4Q4JB 5JRZA 4MDFA 2C9YA 2CK3A 4KLNA 5C4MA 5K8TA 5FUVA 2YWGA 4GI7A 4ZI3A 4PHGA 4YXWD 4LHVA 2IYTA 5J4VA 1PUJA 4M0LA 1KSFX 2Q21A 3A6PC 1IXSB 3K0CC 4LJ4A 1FNMA 1SQ5A 3REFA 2ZETA 1G41A 3LBNA 2P5TB 1UKVY 2VTKA 3TKLA 2JCSA 4QJ5A 3VU9B 1A2KC 1UKEA 1WMSA 3K9GA 3CRMA 2F1RA 4BASA 4WOPA 2OSBA 1EESA 2K5UA 1G20E 2ZSDA 3BH7A 4NDZA 2J45A 2FFQA 4N3NA 5AJVB 2VSOA 3X1YA 1NKSA 3SQXA 1F2TA 3WNCA 3C5CA 1IAQA 1L8QA 2LKDA 1ZVQA 1I2MA 4JLDA 5EUQB 5FBRB 4QL3A 3TBKA 1G291 4OQFA 1W7AA 1E94E 2O52A 3GJ0A 3GLHB 3SZRA 1F48A 3GCGA 3TR0A 5J4YA 4YLGA 3TW8B 3BGWA 1BYIA 1JEEA 1SVIA 5KHOC 1R6BX 3EZFA 1OHHD 2NZ8A 2A5FA 3IBYA 4FD2A 1JB1A 1VHLA 4IDOA 1GIAA 2BM1A 1GM5A 2GXUA 4LJ7A 1MT0A 4QGHA 2PJRA 4MGZR 1E1QD 5FFMA 3DDCA 2XB2A 2G88A 1EK0A 5H68A 1CR4A 2GF9A 2QAJA 2F1JA 4FMCF 4DIEA 2R9VA 4PHTA 1KJYA 2PLFA 1OXVA 3W5IA 3QPUA 2A7QA 1RVDA 1NSFA 2BCJQ 1NY6A 4WBSA 1DO0A 1T5LA 1MO3A 4HLUC 1ZM7A 4B3GA 1EFHA 3QPWA 3N2IA 2EFHB 4JBWA 3TUIC 3SN6A 3K53A 3FKSD 2XTNA 4NCKA 2B21A 4OKSA 4BE7B 1FTSA 1Q44A 4Q1DA 4Q9LA 2F1HA 3LX5A 5J5CA 4Q9HA 3LFUA 1OH8A 3KXLA 1QHNA 1W4BA 1NIJA 4IDQA 3KKNA 4U02A 4ITRC 4NYJR 3THXA 3Q8XB 2P5SA 2ONJA 4X8MA 4Q1BA 4C0KA 3ZZ0A 1AM4D 4HAUA 1W0JA 2VP9A 4NTZA 4BFZA 1JR6A 2ZYUX 1XTRA 2LCFA 2ZIAA 1KI1A 2V4ZA 5J40A 4LOAA 5EZ5A 1II0A 3T1VA 2AWOA 2PX3A 5AJZA 4C0AC 4IHQA 1E6CA 2JAQA 4Q19A 3L8YA 4B43A 1RRPA 5KDLA 3IPYA 4CEIA 3AVUA 2GHIA 3ZD6A 1G8YA 1ZU5A 2QL6A 3H1TA 2RGGA 4LX0A 1KO1A 4UXHA 3GJXC 4LGMA 1OB5A 1S0UA 4DLZA 4JVNA 1SHKA 2E9SA 1RZ3A 2ZRGA 4HSEA 2ZAMA 1HQCA 2CCGA 1U98A 3D8BA 2ZE7A 4N0DA 1XPOA 3SJAA 2GZHA 4OQNA 2IF0A 4MKIA 4HDQB 5LD2C 2XSZA 1XCGB 2F9MA 2OZEA 1TMKA 1NN1A 2JA1A 4V0OA 2YWFA 4BRUA 4UNSA 2H1LA 2QMUA 3BFXA 3LNCA 4I4LA 3DZ8A 3FMOB 3E5HA 3SJZA 3V9PA 2HUPA 4G5SA 1GKUB 4M21A 5FL7D 1CIPA 2CLSA 4J0QA 3KKPA 2RGAA 1TF7A 2BEKA 3THXB 4AYTA 2JLXA 4A92A 2OCAA 1TX4B 2YC2C 4BEJA 2I1QA 3DPUA 1YQTA 2CHGA 3Q5EA 2XITA 4PQRA 4Q03A 1P60A 4C4PA 1BS1A 2NPFA 4HI0E 3V4RA 4IRUB 2FSHA 1E79A 4FMCB 2QRZA 3KDSE 3LAWA 2BBOA 2D2EA 3B82A 5C4GB 3SU8A 4B47A 4FMBB 1U0LA 3WNDA 1J8YF 4AI6A 3LWNA 1G8PA 2A78A 5JJLA 1AGPA 3HU2A 1II8A 4MGIR 2ZAOA 1Z6AA 2V6IA 3MCAA 1WF3A 3CX7A 3FB4A 1DAIA 3H2YA 3KKQA 4V03A 4DHEA 4KV9A 3QIAA 2BEJA 2GEVA 2FG5A 2AKAB 1X1RA 3LRPA 3QBVA 4Q7LA 5CLQA 2FDCA 4CEJA 3QKSA 2WVJA 2OE2A 4A0RA 2HXSA 3QG5A 4PSKA 4KSCA 3KXIA 2ZSEA 1RW4A 2RGEA 3HP1A 2IX3A 1KK1A 4ZDIA 2NMVA 3KXKA 2WWWA 1F2UA 2VQSA 4QG7A 1M7BA 1AIPA 121PA 1UDWA 1CJMA 2VP5A 3MMPA 4GSYA 4IVQA 5TXGA 1Z2CA 3FMIA 2QSYA 4DUGA 3OAAA 3PUVA 2J0QA 2VLIA 2KSQA 2Z0MA 1N6OA 1CS4C 2J7KA 4TYPA 2ZRPA 2JGNA 4RKFA 3EPKA 2YYZA 2FN4A 5JHHB 1ZM4A 2JJ1D 2IYRA 4V0NA 2WKPA 4QHTA 4ESHA 3AVWA 3WYFA 1HQYE 2IF2A 3TIFA 5ANRB 1XZPA 1SKYE 1Z0FA 4Q1FA 1KHTA 2V6JA 3GD7A 2GXAA 3M6AA 1U8AA 2QBYB 4NCNA 3ND8A 2QENA 1J2JA 2NO6A 2ODEA 2GILA 2VSFA 3RRNA 5AUPB 1MO6A 1Y63A 5GVRA 1F60A 1JBKA 4DT1B 4A2QA 3CWZA 1DADA 3K09C 1E3MA 3V00A 2EFGA 3FE2A 4L9SA 3PQCA 1SXJE 2J0UB 4PC1A 4HUQA 3LVRE 2MSEB 3EZ6A 4KXFB 4DLVA 1G16A 3BRWD 3EPHA 2BJWA 2Z6VA 3QPVA 1YZQA 1II8B 1K8RA 4BPBA 1OYWA 4XSHA 2BWJA 4AD8A 3HYTA 4B44A 1KK2A 4B73A 3CR8A 4Q7MB 3GFOA 3RRZA 4MYTA 4V0ME 1CR1A 4DEXA 5BXQC 4C0QC 2H17A 5KNBA 4HDOB 5GVSA 3QKSB 4PXAA 1M34E 4C0JA 1JXOA 1Z0JA 1Z0KA 4B6EA 3F8TA 4TYYA 2ZRMA 1FNNA 1F6BA 4M1YA 4G5OA 1R4AA 5IT5A 4B75A 3AF3A 3IUYA 1VPLA 2PMDA 2QE7D 4KVGA 3O8BA 2OAQ1 3LY5A 1Q3TA 1TQ6A 4HATA 3VNUA 2QP9X 4RD2A 3EWAA 3IQXA 1KO4A 2D62A 1JQLB 1TU4A 5IRCD 4KLZA 1LS6A 1XX6A 3C5HA 2XJ9A 2LWIA 3PEWA 1L7VC 3LH5A 2F43A 2CBZA 3FGNA 5DLQC 3A37A 1G3IA 1NKTA 2ZE5A 2CDNA 3FHCB 3PG5A 4YONB 1RJ9A 1ZRHA 1G7CA 4QOSA 3KFXA 3KTAA 4C9BA 5IK2D 1Z6XA 4MUBA 4GOJA 5BYJA 3QOFA 4O2LA 2BMDA 2IYSA 4OK6A 5EP4A 1E96A 2GF0A 4NBSA 3H84A 5AUOB 5JJKA 1COWA 1TEXA 1ZW6A 3EARA 3VMFA 1S9DA 5DH9A 5FPSA 2EQBA 2ZJYA 1TQ2A 1EGAA 2V7QA 3NHBA 3LXRA 3LO5A 2MMCA 3K0FA 1GOTA 2CHQA 1A82A 5C2JB 5KOYA 4HUQB 3KFVA 3AKCA 3F3YA 4YDSA 3SHWA 4CW7A 4RD6A 1DAKA 4DWJA 1U99A 2OXCA 1GNRA 1XJCA 2ZYWX 1E9AA 4PSAA 2C03A 1ODFA 3ZDQA 1GKIA 4LC0A 4LY6A 5TB5A 3BB1A 1JEDA 1NLFA 4D0GA 3ETLA 4NP6A 1U2RA 1SVOA 3T06B 1JNYA
chains in the Genus database with same CATH superfamily
1RI2A 2I65A 5CNIA 3SLGA 4UDOA 2DPMA 3PA6A 1PLLA 2QLLA 5IMSA 4AZ0A 5BWBA 1L5KA 4LPSA 1E3TA 1WCV1 3DMNA 3FWKA 3QFHA 2JAUA 3UATA 3ELDA 5JVDF 3CIOA 3QKRA 4CTOA 4KQMA 3MTEA 4TTQA 3DL7A 4EL5A 5L3SB 4ZP1A 1LXCA 3LPDA 1OA0A 2LP4Y 1Q811 1FLDA 1GQRA 2XCOA 2B3DA 4RW0A 3UH0A 3VPDA 4F93B 1JVNA 3SSOA 3QSYA 3JAWB 3ILXA 2H2FA 2O8BA 3H9JA 1EUCA 4KIFA 5FAXA 4FGWA 1YJAA 1QOQB 2O1SA 1U7UA 1WW3A 4CIAA 2NU8B 2V8JA 2FGJA 1M0TA 4RCZA 1JDPA 2WDPA 1E9VA 2V3VA 3NT2A 5DN6D 2PHZA 3DBVO 4S05A 2QX8A 3U50C 2X8LA 4LZAA 4MV1A 3C7CB 4U5XA 4B8WA 2YRWA 1T2DA 1YI1A 4R7ZA 5H7XA 2QSUA 2AK2A 2D8MA 2OO5A 4NX2A 4B76A 3DWFA 3CVWA 3WVNA 3DNPA 1N3YA 3JQ9A 5EZSA 3BWEA 1NMYA 2DZDA 3E81A 3HDHA 3WJ2A 1ZG3A 4ED9A 1CQZA 1IU9A 2JZOA 1TD1A 3IILA 1EGHA 1TQ8A 4QYIB 5C53B 2IUEA 3HC7A 2X8JB 3KALA 2EJCA 2P4EA 4GX1A 1Q7TA 1MA0A 3OJEA 4PNPA 4C4OA 3BEDA 5HUHA 2V7PA 3DC2A 4TV8F 3LX6A 1YULA 3F5DA 4KN5A 3IIJA 3M3DA 2XVXA 1BMFA 3QPBA 1EWQA 1JU3A 5JVDA 2BJOA 1EA5A 3I2FA 2CLMB 3NONA 2B2NA 1K2VN 3P45A 4KDCA 2CLFB 1VLJA 5JHGB 4G8BA 1W25A 3GMIA 3PT5A 4S12A 3G6EZ 4TMWA 4YQYA 1DRKA 4BX2A 2LW7A 4ZI7F 1NXXA 3N9IA 4Y1FA 1N5DA 1NFFA 2Q0QA 4B7CA 5FPKA 1WTCA 4QFDA 2UYHA 4W1RA 3PC4A 2QRVB 1OGYA 3EWSA 1AKNA 3UJ7A 5KWVA 5IUJC 3TB6A 4D6PA 4P4SB 4MIEA 2Y1KA 4RGYA 5AI0A 4BMPB 2EX4A 2L18A 3ZWCA 1Z0SA 1YBHA 2IXEA 3PFIA 4F6LA 2P9JA 2CK3D 3QKRB 1EVEA 2GM9A 1LPMA 3JQDA 1XCBA 3TCKA 2V9PA 4LDJA 4LF8B 2P62A 5FX2A 4MQFA 3TG8A 1PDOA 4IIBA 4DCJA 2YCBA 4IEEA 4QJ4A 3GJZA 3ZR4B 4K6HA 3HZHA 4OQQA 2G3YA 2J41A 5AKIA 1NOJA 2PSJA 2ZYAA 2YVAA 5I7HA 5KSWB 2AZTA 3D43A 2FEXA 1LI5A 4HVTA 4KFUA 4DG9A 3WHKA 4TV8A 2D2VA 1LRKA 2H9YA 2B6NA 3MT0A 3PUWA 4XA8A 4OHZA 4AZSA 5DM1A 3U31A 5L53A 2C3UA 3FZGA 2O5EA 1P9NA 1C8KA 3H5VA 5AQ1A 1QG4A 5KYYA 2NAPA 5AKZA 1J7KA 2RIQA 1Z16A 3FCCA 3GYBA 4POOA 1DAHA 3B36A 4J03A 2R44A 2CXRA 4PAWA 3G711 2AXPA 1GQOA 4FZJA 3VKGA 2FWPA 3L1JA 1LJLA 4KQ9A 5EKXA 4ZI7A 2XTAA 3GX1A 3RE1A 4XB6B 3GLGE 5IF9A 1KDRA 2P2YA 3LRXA 4YR9A 2FPRA 4P6VF 1R6XA 4YA6A 4KPGA 4UOEA 1YQWA 4J2OA 1KQFA 3JALA 3WP1B 2VBGA 4ENTA 2RG1A 3G5UA 1LDGA 1R6DA 1BGWA 1KAEA 2I2AA 3PZBA 4M53A 2UVQA 4Z7OB 5KJFA 3ADPA 4B79A 1L8XA 3EUFA 2CFIA 3D8NA 1OIWA 5JVDB 2IUYA 4DSAA 4PG5A 3T4XA 1KI9A 1DC3A 1JQ3A 2XXJA 5IC4A 3FOEC 1U3TA 5CDHA 3D7LA 3I561 3LL4A 3DZGA 2IKSA 4LBYA 4RZ3A 5K0CA 3OEHD 4YRKA 4ZCMA 1FW8A 3N5KA 1LUAA 2HYDA 4LXHA 4WIAA 3OQOA 3S1RI 1Q17A 1FFYA 3WDKA 4D42A 2NQTA 5B30A 1NVXQ 4YI5A 3ITEA 3KTDA 3EASA 5CIYA 1LB1B 4M83A 1OAAA 2BOVA 3PNMA 5AESA 4RVFA 1AKVA 1GL7A 2Q5FA 4QYWA 3S8MA 1NFRA 1OBOA 4H3VA 4JLUA 1E9BA 4TXJA 3SP1A 5KC9A 3HRKA 1O96B 4G1EB 2FW0A 4RGQA 3U3DA 1B73A 4CDGA 3ETNA 1JDNA 2KI5A 2V7BA 5JO9A 3AVXA 3K20A 2Q3JA 2XD4A 3P0JA 4RMIA 3HOZI 4N3CA 3C7KA 4XFJA 2ZSHA 5E6RA 2DHEA 1XBTA 3QNMA 3CFYA 2Q6TA 1YT5A 1WQ3A 4KWTA 4XPZA 4JY7A 5EE3A 2R7ZI 4RZUA 2XQJA 521PA 4EG0A 4I8DA 5DKFA 3GPCA 1DRUA 2K87A 3CZMA 3K9LA 1ULZA 3TDHB 4D4IA 3KUCA 1SHZA 4N65A 1EP9A 5KYYB 1DC4A 1P8AA 1G8SA 3EZNA 1G21B 4WAUA 4I99A 4WX2B 4XVRA 3T9DA 3ZI0A 2ODBA 2FK8A 4CHGA 4H1WA 4ZYYA 3J80A 2QTHA 2HDWA 3H5OA 2WSMA 1KVTA 2YHSA 2HCFA 4H2DA 1SRRA 4JZYA 1JWHC 1GVNB 1M7GA 1VE5A 1RLOA 3MG9A 1GTJ1 4KH1A 4Y2PA 3FMGA 3GNQA 3GXOA 3BGIA 3A4TA 1BXRB 4WMLA 2WE8A 2AEMA 4HAOA 1T1SA 3K2QA 1G17A 4MKRA 3FWPA 1B6SA 3JALB 4RULA 5A6VA 2AZDA 2B9EA 3H5NA 2IHJA 4YYEA 4YCLA 3MGCA 1M6WA 2COUA 2PH3A 3PC6A 3O7MA 3WMGA 1I2CA 3KB8A 1BKYA 5TC4A 5DX8A 2QI9C 3GUVA 3HDTA 4WFQA 2PMCA 4HUTA 1JHUA 1LPPA 1XU9A 2XUPA 3NU1A 1TFUA 2GFHA 3DR5A 3O9ZA 1Y8ZA 1W19A 2P9CA 4ZO4A 1GCGA 2BBTA 2DE7A 2FPUA 4JLPA 3AY6A 1U8XX 5BOVA 3UGJA 1CUGA 1P1BA 1T10A 2FU5C 1ZH1A 4QT0A 1H3EA 2DOKA 5EHXA 4DWWA 5CNMA 4EEXA 1J0EA 1JMKC 1D2AA 3NEAA 1VMIA 1LNSA 1EK1A 3VGPA 3VDRA 2ZJFA 3EIEA 3O83A 1SULA 4RL4A 4N5IX 2WICA 4HB3A 3F8SA 3B5EA 2OTJZ 5LM3A 2HU7A 2XRZA 3GJYA 1ANKA 5GM1A 4ZEXA 4D41A 2NNWB 2IL1A 3LUJA 1WW9A 4KAXA 4ZAZA 4ZI2A 4NVRA 3FPBA 4CLEA 3EIWA 4MDYA 2HSJA 2Z56A 5JJBA 2O2CA 3QWIA 2X9QA 2ZB2A 3KJIA 3T95A 2UUAB 1RP1A 3SEAA 1TMYA 2WZDA 5E6RB 4AZ3B 2ZS7A 3HCOA 3IHLA 4EM6A 1I3CA 1US8B 2HUNA 3VO9A 5LA6B 4XWOA 1DPFA 2FQWA 2WU0A 3QW2A 4B34A 4JYCA 5BUZA 3LPCA 2GEKA 4PQFA 3BF8A 1KRHA 2J08A 1I1NA 2HF2A 1J56A 2X9VA 4LIPD 3WKDA 4DLWA 3FDJA 3HUTA 5BT9A 3ZDDA 1TW2A 4UTOA 2EKBA 3LQKA 1WP9A 1JJAA 2G76A 3CCVZ 1W85A 2IELA 2QZ4A 3R6WA 1P1HA 2D1TA 3HRIA 1A9QA 2ONCA 3LP5A 4GUAA 4UUMA 4HXFB 3Q3HA 4BBSI 1IB0A 1B8NA 2DCMA 4P1ZA 3ND6A 4GMFA 4IGIA 1UBOS 5BURA 1IDOA 5CM9C 2JGAA 4YIHA 2E6UX 3RRMA 5C0OE 3CT6A 3IEMA 3HVRA 3ZE1B 1D5CA 1HKHA 2H92A 3NHPA 1DDIA 3SG0A 3WLJA 1Y6FA 2Z8XA 4GZ6A 1F51E 2PRSA 3PPIA 2C7PA 4DMCA 4H6PA 4O25A 3W5AA 2Z6QA 4M8KA 10MHA 4EAAA 1NJGA 4JC0A 3HCAA 3L7YA 1NVEA 3CTPA 3E0QA 4JLOA 3QEJA 3IAS6 4L9WA 4G4SP 4DUZB 5AKJA 3LL7A 1VQMZ 3A70A 3W04A 4KX3A 4OHBA 3RYHA 2DGDA 1KEKA 1XQWA 3QU5A 5DTEA 3D7KA 4ZVNA 4GU5A 3KAQA 3WGUA 3GHYA 3AIKA 3L7BA 3ZQUA 4B6GA 2HXGA 2FZCA 2QTWB 1XZDA 1D6MA 2TMYA 3GLSA 3ZVMA 3MONA 5EIHA 2V7VA 3ODGA 4D8YA 5DW3A 4MH4A 1XHLA 3QUCA 5AW9A 1E6LA 3GKQA 4IMPA 4JT8A 3RAPR 2NAFA 2ZBVA 4C3VA 1O9GA 2PA0A 3FI9A 3GJSA 2X6RA 1HMYA 3HZRA 4PLGA 4FQ7A 5F3WB 5FLMI 1DDGA 2WY2D 4E5NA 2IYXA 1C7ZA 4O2RA 5A7GA 9LDTA 1VE9A 2PX0A 5M29A 2XUZA 3W90A 5B7QA 1IN6A 3SPXA 5KNDA 1IBKB 3CUVA 1FDUA 3GFVA 5WRFA 4BNTA 3HCEA 3RTAA 1R10A 1Y1TA 4AZTA 1U0BB 1GT6A 4Y9SA 3UB3A 4A23A 4I4NA 1R8YA 1X1CA 4PZAA 1NF3A 2WIKA 1Z2NX 4NNOA 4QOGA 4U5QA 1Q821 1YFZA 4H59A 1WBBA 4FFRA 2JAXA 1X7ZB 3RSCA 3JTEA 1W85B 2IT1A 3NIBA 4ROSA 3SX0A 1SK9A 2QNBA 4XSGA 3WRWA 1C2YA 3LA8A 5I9IA 4IFEA 4WXPA 3L7NA 1WCIA 4RBNA 1Z0DA 3J81f 4EF6A 2I4LA 3DLPX 1DAPA 1G4UR 5T7BA 1MN6A 2VSQA 3SKXA 1CUXA 2JZCA 3VMMA 3C3EA 2VJMA 4A8JC 3I5XA 3B9RA 3ZDRA 1TJPB 2ISQA 2HNKA 3ZS9A 5BV1A 2JA8I 5B1IA 3MWLA 4M9ZA 4DUPA 1QFYA 1QZZA 3CHYA 4KYVA 5JS1A 3IO5A 2ZUCA 3S2ZA 2IODA 3SSAA 4KUHA 2JHAA 3FUVA 2ZB8A 5LP1A 5HKAA 2HDHA 4GI3A 4V0RA 4ZQFA 4DSZA 4UNRA 1K8A1 2C9CA 3RVPA 1JWLA 1IZYA 2RFLA 4RCVA 4DLTA 1ZQ1A 3PIDA 2HJWA 2GI4A 1W9HA 3JYLA 3P9KA 2X8BA 2OK8A 1IOLA 1RHUA 4YMGA 1NBOA 2HZ7A 4ZCQA 1PS8A 2PA3A 1T13A 4BZQA 4XGIA 2JAWA 3MJSA 5FTWA 5CCBA 2WP8J 3PTAA 4LXXA 1D09A 5AW1A 1F2TB 4G0UA 5EG5A 4QNRA 1PUIA 2PH7A 1P62B 3E1KA 4TRRA 2NVUA 2QG9A 4L4UA 5JAZA 1D0VA 3L8CA 1SC3A 3PWSA 2ODQA 2FEMA 4DXHA 1G8GA 3L7KA 3FPEA 4JL8A 3P4UA 4BMOB 4MZXA 5KVAA 5B12A 1T3HA 2QOEA 3G0DA 1UMKA 5JFOA 5JI3E 2RCYA 2EP7A 3AHDA 1YU9A 3KVNA 4BKMA 5JXJA 1L8AA 4HD8A 2VAVA 1TUIA 2FR8C 1KQ3A 1AUVA 1CERA 3DTVD 2J87A 3H99A 2GCNA 4LBWA 1J09A 1JDBC 4LFCB 2VNSA 3UTCA 3CLKA 2GJ4A 4X93A 3BERA 2QEXZ 4O02B 5C1OA 1VPTA 3NXSA 4X54A 1GA1A 3FFWA 2MSCB 2RB5A 4WFJA 1DNPA 1EMDA 1KYXA 3QF4A 5EXXA 5TY0A 5DI3A 2WWXA 4DMFA 3H75A 4HK4A 1ZA1A 1OIXA 3TXYA 4DDWA 2DWUA 5LD2C 5DDIP 1OZHA 3RFUA 3HI6A 1D0IA 1WCIB 1HURA 2EWMA 3GLKA 1JTEA 2ZYDA 2W6JD 3LO8A 3VTKA 1KPHA 3DF9A 2NP7A 3I39X 1M6VA 3CCEZ 2IOHA 2VO1A 4J6FA 4OM7A 2Q46A 2REQB 3CJTA 1M6EX 4PYOA 1RS0A 4QPCA 5EAIA 5G3ZA 1P1KA 4XRGA 2IDZA 1YJNZ 1L3CA 4X95A 5DT2A 2FSGA 4CIYA 1RIIA 4OBXA 2Z2YA 3PUJA 3PU6A 4BMDA 3F2IA 2JVIA 2XNKA 3IVMA 3ZHCA 3SIPA 1KP3A 4J7AA 2GA9A 1ZINA 5AXAA 5C80A 1TPZA 1KYIA 3BGDA 5KAPA 4DM4A 4IQ4A 1R6VA 3UENA 1FNSA 1N25A 3KLNA 1NNI1 3UN1A 3OJWA 4LQLA 5DO9A 1R0WA 3BB4A 5ED0A 4X61A 4BNZA 2AOTA 3CH4B 1MOZA 4NZNA 4RAQA 4BXXI 4BRZA 1X15A 1ACMA 4HTAA 1TKBA 5DM70 2W6MA 4JJKA 1QFMA 4KXYA 4NICA 2EP5A 4ND2A 4KQGA 2WWRA 1UPBA 4DSOA 1BCRB 3LW8A 2ZI3A 4B3CA 5TMBA 1IHOA 1SXJD 2Q29A 3GROA 4J0IA 4YQEA 5IHXA 2IPMA 4C43A 4HVCA 3S28A 2IH4A 1ULAA 3MJTA 2Q8NA 4HYEA 3PXGA 4C0HA 4BECA 4D5GA 1QHSA 1Y1WI 1JHDA 1UBKS 2XQVA 2KJQA 2RJNA 4A82A 5CITA 3G8YA 4XGNA 4CDNA 3C5EA 4TL7A 2AXNA 3G17A 3GCWA 5F78A 4EKDA 1EIWA 1NXWA 2O3QA 2Q5CA 4EY5A 3QBTA 3GGCA 3KJZA 4B6FA 1B26A 2Q3LA 3B70A 2VDOB 1L5GB 3QVWA 1Z8FA 2DQKA 5JCJD 1JS1X 1G3UA 4JC4A 5DSXA 4J16C 4CEIB 7GPBA 3K9WA 1SXJC 3AI3A 1EDBA 4JYMA 3PX7A 4QU5A 3ZTWA 5LR6A 2GCIA 3TSAA 1Y7IA 1QG2A 2JI6A 4X6YA 3QF4B 2W00A 2XQKA 1TD9A 2UZAA 2CJFA 4HH4A 3A2MA 1XJ5A 1MFPA 4EG4A 4OD0A 2OFWA 2W6ZA 1WPGA 3T9EA 3JQ8B 4LOJA 3N76A 1KTIA 2AOUA 3GLQA 1VP9A 4UXJA 5CP8A 5HF8A 4ZVPA 1IZ0A 1E9SA 3GMDA 1G5PA 1IOZA 1HE3A 1NUQA 2GAAA 4HAWA 1T29A 1YS6A 3AU9A 3D02A 5CR9A 3FHJA 2V58A 4BMVA 4DC9A 1RXUA 1OYVA 4AYBA 3WE7A 3FJYA 2VBCA 5CT5A 4AROA 4WBNF 5IKMA 1GYQA 3U62A 1CNFA 1SVSA 2J3HA 2P1RA 2Y8EA 3H5LA 1IAVA 4JDUA 1ZUIA 4NYIQ 4OH1A 1C7IA 2DBVO 4JD5A 1RP7A 4ZD6A 3K0KA 4IJQA 5I9SA 2HQSA 2YOHA 5D3ZA 3W5VA 4Z51A 1E20A 1TJ3A 2R62A 5H4HA 3TLGA 2CLIB 4BKPA 1XMQB 1ZCFA 1MH9A 5E0OA 4IWNA 4TZKA 4GF5A 5HCUA 1N75A 1DKRA 1SOVA 2IPNA 4YWJA 3ORFA 2AOTB 1NN3A 2BKVA 2VDPB 2ZWIA 2HD4A 3A1WA 1G1MA 2WIBA 3QKIA 1BYUA 1W93A 1KEEB 2GYYA 2QN1A 3AKYA 1K08A 4WDQA 1XD9A 3TKYA 3SY8A 4PZDA 1KMQA 5P8WA 3SCZA 4EVSA 1OI7A 5FR2A 1E64A 1NGSA 2H8GA 1TUGA 2DQYA 4DSNA 3MHPA 5CG2A 3T7DA 1LW6E 6REQA 2WZCA 1FDOA 4COOA 5A9RA 4CMGA 3BXZA 1GXSA 1NQOA 1NXQA 2C99A 4TQUS 2OAP1 4RHCA 1P2FA 2Y1LA 3TEJA 1TIKA 2EP8A 4O1HA 4YRCA 3KJXA 5JASA 1DO2A 1QO0A 1O08A 5TGTA 1XEWY 3LGAA 1A72A 5JSUA 1ZH4A 3EIQA 5B6JA 4F0JA 4DV6B 2REXB 4QA9A 4CCSA 2DR0A 4WBNA 2VHYA 5KTTA 2EFJA 4FQ5A 1VJCA 1RXCA 3DLAA 1X3WA 4WXHA 2VQ6A 3BB3A 3A0RB 4PZEA 3SBOA 4ZYTA 1P2GA 2ZQYA 5C7YA 3DO8A 1RJDA 3HRHA 4CEJB 3A6ZA 4YCDA 2Q45A 1TFIA 3VZRA 4AG5A 3RYTC 3LWDA 1F4LA 2GAOA 2AOUB 2P4SA 1SVKA 2YNMD 1D4ZA 4XYGA 1AK9A 1A4RA 4YV1A 2D5LA 3AWIA 3BD9A 3CEHA 1C1YA 1KZ4A 4M86A 4QYTA 4CL0A 5B6PA 1R88A 1OROA 4HR7A 2A0WA 4J2TA 3T38A 4Z1MA 5D1HA 4ZOLF 3P9XA 3L18A 2DUJA 2M6NA 1AKMA 5ER6A 4DREA 1ZY2A 3VR0A 3AM1A 1C8VB 2NACA 3COSA 3LCUA 8OHMA 2RD2A 2FCRA 4S1WA 2HHCA 3OTQA 2VRWA 4BAGA 4X00A 3TLGB 2QSJA 4N41A 2H5LA 1OA1A 2HK9A 4KXLA 1HQKA 2YNMC 2YBDA 2JS7A 3FUTA 3RG8A 5A06A 2E49A 2VWQA 3EMDA 3PIIA 1XFAA 3P9YA 4FI3C 3NBAA 5AW2A 3PCXA 3NTOA 3ZE8A 1SMKA 4FDUA 4GMXA 3ZUGA 5CTAA 4A6XA 4B2LA 2AEJA 3ZHTA 2J6AA 3ILHA 3N75A 3RSLA 4WL0A 2DH6A 3BDAA 2GVNA 1Z2DA 4OJQA 1CFJA 3OLCX 3U3RA 2X5KO 1I5EA 4UJ3A 6REQB 5IWCA 4RA6A 3E70C 4PYMA 3WYAA 1GXSB 4IIVA 2O2SA 2BZSA 1V48A 1CZKA 1M6HA 1YIJZ 1WDTA 1NT2A 1T8SA 1QYDA 3NEJA 3ZWWA 3NV7A 2G7MC 1TWGI 2CNWD 3LS2A 2R0QC 1JG6A 3QXSA 3DDZX 2CCJA 4L02A 4BKOA 4NENA 3NC1C 4H6WA 3ESXA 1YZKA 3ZCUA 7ADHA 3W5CA 1FYDA 1TM1E 5THQA 1N7GA 1GUZA 4ZOLA 2HLDD 3HBFA 1IEQA 1FP4A 3RLFA 1R15A 3FF1A 3G59A 1RAIA 1KF0A 1NZDA 1YZGA 3AM3A 2TSYB 3KDPA 3DHWC 4X91A 1ODTC 3UYLA 4B4VA 1WRBA 4EUSA 4DJTA 4CT5A 3E4DA 3TLCA 5HX7A 4JR2A 3ZGVA 3BH6A 1LX7A 3F1LA 1PEKE 5L4NA 4ZVLA 4S35A 3QVSA 3O8LA 4Y2HA 4ZTUB 5FBQB 3ZE0B 1EVIA 4FFLA 2I34A 4HNRA 2YW2A 3BZBA 4YRAA 4DMKA 3MGKA 1XLUA 3NX4A 2HRRA 2GBLA 4UHFA 2I7VA 1OB2A 5MFPA 1YMQA 2HJGA 3IBFA 3EDQA 3A58B 3F4LA 3EDYA 5AHRA 1KQGA 1T3LA 4D92A 1V4NA 4BVLA 3D6WA 5T64A 1DOAA 1ONBA 2F9FA 3AZQA 3OIGA 3AEKB 4B3BA 1GFZA 4JWTA 2BGGA 2N42A 2NUAA 3ENQA 4DR6B 4K3UA 3ISTA 5H70A 2ZUWA 2EW8A 1Z08A 3Q88A 2VG8A 4YDQA 1BE8A 4LC9A 3T7JA 2HRQA 4D26A 1XDSA 5AVSA 2B8JA 1N8SA 4DMHA 3D7RA 1NF9A 4MKHA 3K30A 4YN3A 2D54A 3DP9A 2ZB4A 1BA3A 3O1IC 5F33A 4NCAA 3P4XA 5TMDA 1AS2A 3Q3JB 1J9ZA 2VI5A 1BEUB 2LV8A 3QX7A 2Z9CA 3SC2A 2XB4A 3IQFA 2ODNA 2D59A 4R16A 4IIGA 5FEUA 2Q2OA 1N4DA 1XD8A 5E2BA 3FKJA 4KRYA 3CC4Z 3A3YA 2WHPB 3NBYC 4N1AA 2EEPA 2M32A 4B4WA 4B85A 2B1IA 2QT1A 3V1UA 1K4MA 1TL7C 1SKMA 3OSZA 4C14A 5IXYA 2IYFA 1IJKA 2JLWA 5H3LA 1O94D 4QPZA 3RODA 3SXJA 3M5PA 1SPXA 3T12A 2BGJA 5D7BA 5AM3A 3NALA 4QNMA 4B35A 2QTAA 3OFND 4ZOLB 2W2XA 1NMXA 1FP4B 1O3YA 1S3FA 3M89A 3CCS1 1P3DA 4WLEA 3I4LA 5IP5A 2NSYA 1VCOA 2QTNA 1TGYA 2BGIA 2VOEA 4P0QB 2PFKA 1U28C 2GKSA 3D8RA 3UV6A 4A3KI 1IM8A 4P36A 1ZJ6A 1QF6A 1XCLA 2DWCA 1KZHA 4YYZA 3OT5A 4I66A 1G4HA 2C7BA 4Q3AA 4XTRA 1U1CA 3MT8A 1BU8A 3R6LA 3R6DA 2F3PA 4MK4A 4LY9A 2UDPA 4TT8A 1RYFA 1QQBA 4GKAA 2C07A 2F00A 1O94C 5EHNA 1R8XA 1XZHA 2HU5A 1XQ6A 1XMVA 2PH1A 2VSXA 1XVLA 1PNTA 2HL6A 4UREA 4TQ9A 4C5AA 4D3ZA 5DYWA 1CETA 2JL1A 3GRCA 3VC7A 4RPHA 3DM9B 2ZQ5A 4OYLA 4NV3A 3GZJA 1XNQB 1KAHA 2F55A 2P35A 4AY3A 5JMWA 1PQ4A 2NUAB 3Q0EA 5J1TB 2ATIA 5BW4A 4A0SA 1ZMTA 4NI5A 2VYND 4NXNB 3SXPA 3PHCA 4PSUA 3WTBA 3GTMS 2Y1GA 1H2WA 1ODKA 2B82A 1ZGBA 1JJFA 3K0AA 3SLKA 1VQ4Z 3I9MA 3PNQA 1YE3A 5CHYA 2Z2IA 3QUQA 4CNQA 3H1FA 1W6RA 4RF2A 2RH8A 1DARA 3WWEA 1OJLA 1XMIA 3QFSA 4MWGA 3BRWA 4OSEA 2IS2A 3KIPA 3BHIA 1GGFA 2QA41 1NYTA 4EDHA 4PAQA 2H9AA 2EJWA 4E5VA 3SC2B 4PPGA 3WL8A 2C96A 3PUZA 3UKJA 1EDDA 2OUKA 2JJ8A 1MTZA 4Z1OA 3BJZA 2XRFA 1R0ZA 2XMPA 3CPEA 4K6FA 3A9WA 3OICA 1SIOA 4UKDA 1T2CA 1AV6A 2DQSA 3PEEA 1C8LA 4MUIA 2ZIXA 5FP0A 1GA6A 1JJBA 3J81b 1I10A 3O91A 1ZIPA 4BQQA 4FCCA 5IDQA 1OXTA 1H2XA 3KT6A 4F4CA 4M60A 4FSXA 4IIDA 4E7PA 1Z7WA 4HLQB 4DZRA 2OXTA 4JUIA 1KMHA 3IMCA 4TRNA 4JNCA 2YWRA 3AHGA 3AUSA 3D4OA 3E27A 2ZJ1A 4FMPA 4ME6A 1KO5A 1NDQA 2JHPA 4B6QA 1ESZA 1RBMA 1TA4A 4OXKA 4RK5A 4EA7A 1K89A 3HR7A 2OZPA 4WFKA 4EFMA 2ZUVA 3KOOA 5E1MA 1WXWA 4JBIA 1VKNA 2O2DA 2ZRQA 4TS1A 4ZN6A 3R9XA 1W4ZA 2B5OA 3G8BA 4YNBA 4CFYA 4XZ3A 4DOMA 5H9VA 4DABA 3HKZA 2CDRA 4R2KA 5DISB 1U3WA 1DKQA 3RSFA 5F7XA 5J47A 3K4HA 3OF3A 3CPHA 1CRLA 1JT9A 4ZAFA 5JCOA 1BU5A 5DYIA 3U7HB 4BFTA 1LQ2A 2CMGA 5KSZA 1J25A 1WEHA 3M49A 3TEMA 3RAJA 3WKEA 1USIA 4WI1A 5DM4A 1AMNA 4JT2A 1BVUA 3U44A 1I7QB 2FMHA 3BZUA 1B15A 1Q0LA 3ASZA 4RZSA 1GZ3A 1A5ZA 1H66A 1NNSA 1NQ5A 221PA 3DLTA 4F7WA 4MWDA 2I3BA 3ECSA 4WACA 3UUWA 2Y68A 2AT1A 1V8PA 3MERA 4YGYA 3SBDA 1VBNA 4LCBA 3RIXA 5KB3A 3EPKA 1V7PC 3PPYA 1U7ZA 3LG2A 4Y2XA 3FJ1A 2Y0EA 4FOLA 3IALA 5IZ4A 3DAYA 2X2EA 3QX9A 3WKAA 1Y37A 1NE2A 4FLFA 3UV7A 2O8EB 4Q1AA 1YGYA 4G0VA 1B8VA 2OBXA 4TMZA 4DVJA 1XXHE 1H3NA 5LSAA 1Z13A 1U7XA 1DBIA 1C0EA 1XC7A 2J32A 3OH8A 4I81A 4MS3A 2Z9DA 1Z56C 2VYCA 4NYJQ 5FOVA 1DT5A 1IK6A 1PS9A 3W9YA 3SWWA 3AR9A 3OESA 2TMGA 5ARBA 2BFWA 1DAOA 3C74A 2F4MA 1Q21A 1Z6QA 4YJGB 4S3MA 2ZUDA 1IUKA 1J2TA 1RHMA 2OQ2A 3FRIA 3I2YX 3MRTA 2PPLA 4W1PA 4DE5A 4ZRDA 3QE4A 1KMHB 5GJWC 4B45A 3CF0A 1WDMA 4XJTA 2DUWA 3SBXA 3V4LA 3QEBZ 1VQ8Z 1MP0A 1R9GA 2AL7A 4MCJA 1NONA 4F3NA 2VHUA 3FTDA 4LBZA 2ORWA 1UJMA 2NP6A 3CF2A 1HDZA 3DMHA 4TLAA 2G5GX 2JI4A 3R9XB 4KNVA 2GEJA 5AHXA 5D5QA 4EEKA 2WB1A 4J0DA 3VQTA 3TAUA 1YCHA 4CEHA 3WJAA 4EARA 1YUNA 1NR5A 2ISCA 2XCLA 1AA9A 5FWDA 2BSAA 5F12A 4AG3A 4L28A 3D8TA 4XJSA 2GN8A 1L7AA 1Y34E 2UU9B 1L5VA 5A6SB 3CZAA 4KNYA 5JAOA 2QLNA 1Y5IA 3CN9A 3F4BA 3VTFA 4H3HB 1BA2A 3ABIA 3AI2A 3DBRA 3DSRA 3IQZA 5BY2A 3U44B 2WJHA 1JAYA 1OLOA 3N8GA 4NECA 4OFZA 1DEOA 3AB7A 4B31A 4AUEA 3A6GA 1XTBA 1GLGA 3NPAA 4INOA 1I9GA 2O4UX 4DBLE 2ZP1A 4FDTA 2YADA 1HE5A 1O6FA 3AL2A 1SAYA 3DTTA 3AF4A 4UHJA 1XD2A 1Q22A 3OZTA 3O2NA 4HWTA 1ZJZA 2JNYA 4P7FA 3L6BA 4MONA 4TN1A 1R5OA 1S96A 1CU1A 2JIPA 4DV2B 1PD1A 1TUEA 1SXPA 4R9SA 4A3GI 4GMKA 2DCUA 2YYYA 3TZQA 4YPVA 2ZPTX 1OMOA 2FW9A 5JCXA 1DRJA 3IX0A 5JMTA 2BH9A 4MS3B 1TADA 4KIGA 5CLJA 2IXDA 4FEYA 4EMTA 5IJ0A 5IPFA 3THSA 4KAJA 4M9RA 4C7MA 3FZYA 2JJ2A 1HXHA 3H4MA 4J0EA 4R51A 3RUIA 1ND6A 3WB9A 1XRPA 4CE6A 4DNXA 1SUCA 4QHYA 2VZ9A 4DMGA 4B3DA 2C3MA 5FPQA 4BNJA 2CDBA 1SQ6A 4X8OA 2HMUA 2C31A 2HMAA 4Q3LA 5D00A 1FMJA 3K4QA 3ZU5A 3CF6R 5EMJA 2ZJ0A 2XNSA 5BSMA 3ZWYA 4QTTA 4EGCB 2YWDA 1T9BA 3KZVA 2WILA 4JGBA 2P4UA 4KFRA 5DM60 4XH9B 1UIMA 4O2AB 4BFYA 2NIPA 1QVGY 2IUSA 2IYPA 4Q48A 3TDNA 1WMAA 4KR7A 2J46A 2X6TA 3AXTA 4UM9B 3GL9A 4KFSA 3JR7A 3WNBA 4CEHB 1K2WA 1FJXA 2AJTA 3OWXA 2H59A 5I3CA 1NWCA 1CR0A 2PBRA 1OUMA 3STXA 2YTZA 3BBLA 3E7WA 2GUWA 3EW9A 2ANBA 2CNKA 3RRJA 3JVEA 3QOYA 7MDHA 1RC0A 3NVDA 4F45A 2W8ZA 4IOMA 4A8JA 2AMYA 3GT3A 1PZNA 4PPFA 5SZIA 3DBRB 3VZSA 4NBAA 2JIZA 3HK2A 4YALA 4QDOA 4P3NA 1N2ZA 3QIVA 4MW4A 3VMIA 1MC4A 5A4JA 1CULC 1H23A 5IXSA 2O8FA 5DNAA 3PJFA 4NOLA 5A2QA 5BSGA 4UM5A 3VVLA 2XUGA 2IEYA 1XD2B 2C3OA 2P28A 4MI1A 4F86A 5LNK1 4JXZA 1GPBA 3ZK8A 3T1HB 4TYWA 3AONB 4BV8A 4MD7A 3MTIA 1T0UA 4UM8B 2Q5IA 2R8BA 5DWQA 4CG1A 1HTBA 2P5UA 3DMTA 1XZKA 4FDMA 3ZZUA 5CXUA 3AF2A 4N6GA 5CFOA 3AUFA 2GCGA 4XWWA 5ALOA 4KE6A 5AJTA 4DY6A 2M6RA 4WK0B 3GGDA 4F06A 1XNHA 1NX9A 3DNFA 3HCPA 3P5SA 3T5GA 5IJ0B 4HUJA 1Z6GA 4C4AA 4PTLA 1VQNZ 2GDZA 2RH9B 2Z30A 3ZPXA 2QN2A 3SYTA 4C7KA 2OESA 4W5RA 3MWKA 3TSZA 4Q16A 5FCDA 4HAVA 5GJCA 2RHDA 1HLDA 3KWLA 5KNBD 2EDAA 4MLZA 1N1EA 4YRTA 3TNFA 1GQFA 1ZD8A 1E69A 2OR3A 1RYYA 1XDUA 2GCEA 3AEQA 3ZJUA 1OE0A 1AO3A 2H1IA 1T9HA 2D4HA 4QTTB 5B55A 1ZH8A 4HJRA 3HBLA 3IMEA 1QSGA 1U8YA 3B38A 4FX5A 2JFUA 2CJYA 3LHSA 5JMPA 3VV2A 3VNVA 3CG4A 4KBFA 4GM1A 5HPYB 3K1ZA 4KKVA 1LD3A 2QVGA 3CS3A 3D6AA 4LXGA 5KYTA 2D8AA 4B3RB 1FXWF 1N2CB 1EE9A 2B7LA 4OHWA 5BVHA 5FOUA 4EA9A 4MGYR 3NHRA 2VPQA 2EARA 3U9TA 1DFIA 2IJGX 2H5JA 1HT3A 3GJRA 3RC8A 1QYCA 1G8MA 4K9DA 3A6HA 3OCXA 5IARA 3TQHA 2A0XA 4A8JB 1T36B 3I1JA 2GTHA 4CIWA 1SZDA 1W4AA 3C1OA 2WD7B 4YP1A 1QIIA 2GN2A 5J63A 3N2YA 3N0VA 3NIWA 1LVHA 4UTNA 4B81A 1XIVA 5EJ2A 2H85A 2HDOA 1HE8B 4BLPA 1KNQA 3O4HA 2CBGA 3BORA 1ZMXA 2O8FB 3UKDA 1BWPA 4YJKA 4HQKA 3L4SO 4KUEA 4DPLA 5ABPA 4TTRA 3WHIA 3NOQA 1I6KA 3GG9A 4TUYF 1MD9A 1N0VC 4KPEC 3F6PA 5EWMA 1CVIA 1P45A 3DYVA 4J7XA 1UBJS 2B8TA 1G20A 1P3JA 1JFFA 4EGJA 1RPJA 2PMFA 1SGWA 3BKXA 5CJJA 3FSJX 5GOZA 1Y4SA 1J24A 4OCZA 5HA5A 2W7TA 2GR9A 1W73A 2XDQA 4X7PA 4EI8A 5KYXB 2DJIA 4NJEA 2OMKA 1JHYA 2VSNA 2WNIA 1ZVJA 4MA4A 4TL9A 3OOEA 2RKOA 3EISA 4M1KA 1X7GA 4PFKA 3PL1A 4R3UC 3RTDA 3X1JA 5EUMA 3UUEA 3WWYA 4DIOA 2HPHA 3ZD7A 4YAEA 4LF6B 1FQKA 4UBJA 1RWVA 2J31A 1Y5MA 2FRDA 1FXWA 2ECPA 3SJCA 3GLIB 4TMVA 3KAPA 2NYUA 2AFIE 1RVV1 1UP7A 2FB9A 2H6EA 3BKWA 3MTQA 1CF2O 2MYPA 3BX1A 4G09A 5ILGA 3SMVA 3KQMA 3OIUA 4ML3A 3STYA 4TMTA 4N47A 2Y3IA 3TE5B 3AEQB 3RANA 4JI3B 4TQAA 3ZZMA 1C3LA 1JKJA 4P4GA 4HVLA 4QX6A 1CEYA 2I33A 2WSSA 3IQEA 4KYIB 5CFLA 3PRHA 2I87A 2QPTA 3LP6A 3HM9A 1QHIA 4AS1A 1MNAA 4KFCA 1NDUA 2DHDA 1XSEA 1A9YA 4DLAA 1E63A 2IFTA 2TMKA 3IP7A 4KWHA 4RQUA 4TUYA 3FNIA 4ER5A 1O1YA 3H16A 5BVHB 3DQPA 4JCCA 2RKBA 1GFIA 4DEVA 3CLSD 3I3SR 3KYDA 3QSGA 3MPOA 5KQGA 4CM3A 3WWDA 3M4OI 3LXUX 3K0EA 4LJ8A 5DYGA 1DS6A 3L0PA 1IZ9A 4BVHA 1JJVA 4WCFA 1GCAA 5B3KA 2QVXX 3C3XA 2VS1A