1P9NA

Crystal structure of escherichia coli mobb.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
169
structure length
162
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
total genus 29
structure length 162
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1p9nA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9nA01
1M7HA 4HDOB 1ZNZA 2ZUDA 2GJ8A 1NLZA 4LBZA 1T0JB 1YZUA 1XCMA 5CYPA 4NZYA 1L2TA 4MRNA 3QG1A 1T5LA 2F7SA 3L0PA 4IVQA 4ZKEA 3U4QB 1LF0A 1E2NA 2F43A 4KBFA 1XPOA 1CF4A 4PHFA 3O8BA 1E9EA 1W4BA 3R8CA 4DB4A 3U44A 2W83A 2QTVB 5FUWA 1JXMA 1LW7A 1R0WA 4ACAA 2WIAA 3F3YA 1NNEA 1P3JA 4DUGD 1UJ2A 2BBOA 4HZIA 4IOLA 4L9WA 4WZ6A 3SR0A 3R9WA 4YLGA 4IDPA 5JHGB 4AK9A 3LV8A 4TN1A 2OAP1 5ANRB 3VFDA 1TU3A 4Q4AA 1XEFA 4NONA 1P9NA 1E79A 4Q1DA 1DAHA 2V7QA 3PUXA 3FFAA 1BH2A 2VLIA 2OCPA 1XMIA 5DNYB 2QPAA 3U3MA 3GJ5A 3EWAA 1TEVA 4EPWA 4ZI3A 4JSTA 4HAUA 4A2WA 3FWYA 5L3SB 3TVDA 2ZYUX 5F9FA 1Z2AA 5C2JB 2QN6A 2AKYA 4NYIQ 3AVUA 4V0MA 4F93B 3GLIE 2XB2A 4KBGA 2JLQA 1WA5A 1IXZA 4QGHA 4LJ4A 3RWMB 4LHVA 3QSYA 2XZOA 1FOEB 2ZAMA 4RZUA 1WXQA 2GJ9A 2R8RA 1G9XA 4NYMR 1XRJA 4JBYA 2G77B 2BV3A 4BFZA 2MSEB 2J59A 2RMKA 3GEEA 4CRWB 3KDSE 3MWYW 2WAYA 3HR8A 2RH5A 3AVQA 4LHYA 1E2JA 3P26A 4CEHA 3OAAD 3SNHA 2ZI9A 3C14C 3PEUA 4AWXA 2EFHB 1EWRA 4LBWA 2GF9A 1OH7A 4EQ6A 2VA8A 5C1BA 1P2SA 3DMDA 3TQCA 1E0SA 3FKSA 4DCTA 3FMIA 4NCNA 3DMNA 3Q5DA 1E69A 1Z6AA 6Q21A 4C0QC 2H7VA 2VHJA 1XTIA 2PMDA 1DEKA 1W46A 3L8YA 1W0KA 4IJMA 4HAXA 4WA7A 2R2AA 5KTYA 2CE2X 1T0HB 3A8TA 3NWJA 3SFZA 4DSTA 2GK6A 2REOA 4Q4JB 4GRAA 4Z54A 2JLVA 1NJFA 5SZKB 5TV2A 3W3AA 4JLKA 1L7VC 4RKEA 4HLDA 4HLUC 3THYB 1UF9A 3LQQA 1AGPA 2AFIE 4JL8A 1S3SA 3EZ9A 4QGFA 1KI6A 2P6NA 2QAJA 1T8TA 5FBLB 2EW1A 5EE9A 3X2SA 4QM6A 1XX6A 2PT5A 2Q3MA 1OFUX 1EG7A 1S3GA 5IK2A 4KITB 1T91A 5FOVA 4EQ6B 3RS2A 3AM1A 2V6JA 3IGFA 2I3BA 1Q3TA 3SFVA 4KYUA 3CB4A 1IXRC 1ZIPA 1G8YA 3GD7A 4EFLA 1KK0A 4URUR 4I4LA 5TARA 3H4MA 1E2FA 2OAQ1 1AKEA 3SU8A 2NIPA 1NJGA 4PC1A 1ZIOA 3EX7C 1WDTA 4HB3A 1ANKA 2AWNA 2GILA 1X8JA 2IF0A 4IVRA 4Q66C 1KJYA 3TVTA 2F6RA 2HF9A 2L0XA 3K9HA 1OH5A 4RD4A 1P9RA 3MG9A 1GDDA 2A3RA 5EZ5A 5JEEA 3BK7A 3AVVA 1E9CA 3L0SA 4NCIA 4DBLC 1G6OA 3QG5A 4RVCA 2NMVA 2JLSA 3GJ6A 1WBDA 1KO5A 2DWQA 2KE5A 1IN8A 3CH5A 4OBEA 1P73A 1DADA 4BFXA 4RJLA 3R20A 2WOOA 1J8YF 1HE1C 4UNNA 4DZZA 2D62A 4FWIB 4Q19A 2R6FA 1P62B 5EP2A 3DKPA 3GPLA 1CLUA 3GLHB 4V03A 2IC5A 4DLZA 4L16A 5KHOC 1VCMA 1LS6A 4JMPA 3FHTA 1JQJC 3LH5A 2J0QA 1FMJA 2OE2A 4MYHA 3UKDA 5JCZA 3GJ4A 2OESA 3DZDA 1QG2A 5FPSA 1G21E 4EPVA 5IK2D 3BB4A 1CJTC 1AS2A 2GDJA 3QF7A 1G64A 4DHEA 2KI5A 1W0KD 1JJ7A 3THYA 1K8RA 4HZUB 2WICA 2VP5A 3TLXA 3LLUA 3C4JA 3T1TA 2E1RA 3MSXA 3QJYA 1FTSA 5J5CA 3A1SA 3DHWC 1JEDA 1NN0A 1XWIA 2NO9A 1IM2A 2QGZA 1D2MA 1H8HD 1G4AE 1L4UA 2IBMA 3IO5A 3K0CA 3P1JA 4V0NA 5KPDA 2H57A 2ZI3A 3L8ZA 4BLTA 1SVOA 1MABA 2CHGA 3OFND 4DIEA 1DAKA 4P3YA 1R8QA 2OO7A 4UXJA 3IUYA 5HKKA 1P2TA 2OBNA 2QSZA 3IEUA 1SZPA 1QDEA 2Q0HA 3VR2A 2Z4SA 1MV5A 2WMNB 3GLIB 3AF1A 1W36C 4NYMQ 2TMKA 1RRCA 2FZLA 3RYTC 4TT3A 4PSAA 3ZQJA 2MMGA 2PT7A 1WF3A 2J9RA 4Q47A 4LZZA 1QVRA 2ZTSA 4L8GA 4NDZA 4LJ6A 5JZVA 2QAGA 2VL7A 4Q00A 2GAOA 1R4AA 1KOFA 2AD1A 2B7CA 5JJLA 1FQJA 1NSTA 2ZI5A 3VR3A 5C18A 3MJHA 4IOJA 1U0JA 2FG5A 4M4SA 1YZNA 3A37A 2YWFA 4AYXA 3LBHA 3E1SA 1CR2A 1E98A 3K0EA 1CRQA 4K46A 2GAAA 1VG1A 4JBXA 1LY1A 3Q85A 3ZS8A 1BKDR 2JIZD 8OHMA 1D9XA 3AGQA 2ZRHA 1JBKA 3AGPA 2F9MA 1IN7A 4S2EA 4F4CA 1JEEA 4B3BA 1OXUA 5TB5A 4D4LA 3W9YA 3CLVA 1G3IA 2GKSA 2VHCA 3AH8A 4LOAA 5KDOA 2X2FA 2SHKA 1ETUA 3CO5A 2QP3A 1SQ5A 2CBZA 5JSZA 4XSHA 4NCKA 1VKJA 2ZRCA 1G41A 1E6CA 1Z6XA 4PX9A 1GKUB 3I8SA 2ZRFA 1F2TB 4G01B 2EYQA 1N5KA 2QNRA 4L15A 1Q20A 3A4MA 3ND9A 4R7ZA 5DI3A 3UMFA 4LRWA 4RD6A 2HDNB 3QI2A 3B2EA 4PHGA 4UNQA 4A0FA 1X6VA 4JLDA 1H8EA 4XWOA 2XOKA 4X8HA 2FDCA 1E1RA 2W2TA 4Q9LA 1Z83A 1MABB 3OEEA 2ZI4A 1Q21A 4LSGA 2P5SA 2GK7A 2XTZA 3AVOA 1DG1G 4P4SA 4JYCA 1U8ZA 2W6JD 2P6RA 4HDQB 4KV9A 3NBZC 5CYOA 5LBIA 2D4HA 1YJ5A 4X8OA 3RHFA 5GVSA 3DOFA 4ZIRB 1Z3IX 2R62A 1F3OA 4M21A 3U7GA 1ZW6A 1NN3A 4EFNA 4DLVA 1E3MA 1EFTA 5KNBA 3KKPA 3TNFA 1UKYA 2FN4A 1JR3D 3NVAA 4IKEA 4IXMA 4EPXA 3CPJB 4PPFA 4RD1A 4R71A 1HQCA 4G5SA 3OIYA 3OESA 1J70A 3FGNA 2RCNA 2FNAA 1TU4A 3K0CC 4YMTA 2VF7A 3TUJC 2C78A 3GEHA 2D74A 4I1OA 1BYUA 1E2QA 2QE7D 4IOKA 3FMFA 3AVTA 2FSIA 2QPTA 3EZFA 3LVQE 1XTJA 1GG2A 1L8QA 4YQFA 2GHIA 2JGNA 1AN0A 4OI1A 3IIMA 2VQSA 3EZ6A 2CVHA 2ORVA 2ZSFA 1T4GA 1W7AA 1E9DA 4GMXA 621PA 2X77A 4F4IA 4QJ3A 4O2LA 1KO8A 1GNPA 2BHRA 2JLZA 2BBSA 4RKFA 4MDEA 3QIAA 1GRRA 4LBVA 2XZLA 1TF2A 3AP2A 3A6PC 3BOSA 1Z2CA 4KFTA 5K8IA 1SHKA 4IRUB 4L5BA 5FPTA 2W6JA 4YMSA 4Q7MB 4D4JA 3DM9B 5FUXA 1DARA 1G8PA 2O8BB 3ZZ0A 2JLXA 5JMTA 1OB5A 4DCSA 4QGAA 3PXGA 4O25A 3CX6A 4I1SA 2I1VB 4F4JA 1N0WA 3I73A 5M04A 2C9OA 4IFEA 2QBYA 4LV5B 3KJGA 3ADCA 2V3CC 1C9KA 4GPTA 3IEVA 1W2GA 2BM0A 2QENA 2PLRA 4PQYA 5EP4A 2A5DA 4B2IA 4Z8XA 4FXPA 4BPBA 3W6OA 4CT5A 4DEYA 3LXRA 1MR3F 2A30A 2WSMA 3OIWA 1KSGA 2YWEA 2G83A 1TUIA 3QF4B 3UWOA 4M1MA 1OH8A 3HWSA 1RFLA 2FWRA 1T8UA 2BDTA 5DH9A 1PZNA 4DWJA 4MQBA 1VG9B 4JVMA 3WHLA 1VDZA 3NIBA 3FB4A 1NRJB 1GUAA 4Q03A 2ZETA 2IYLD 3BRWD 3WP1B 1Z0JA 5EQTA 3UIEA 1XJQA 2YV5A 3ZZUA 1JR6A 2P65A 5FUVA 3TUIC 4IDHA 4FMDF 1LTQA 5TDHA 5KDDA 2ZI6A 2W2XA 4FIDA 1SXJC 4I1VA 4L9SA 5J4LA 1KI2A 2GETA 3C41J 3M1IA 4LYJA 4Q02A 4AI6A 1JPJA 3KXIA 3LDAA 4PXAA 5JBQA 2UKDA 2FA9A 2ZE5A 4A8JC 1CR0A 4RZXA 1S1MA 3G5UA 2NO1A 4ITRC 2FPKA 1IY0A 2ZYWX 1XF9A 2QTFA 4LGMA 1CRPA 5G41A 2O8FA 3ZQ6A 2IYUA 4H9GA 4B6EA 4PC7A 2Z5FA 1E9FA 4JIMA 4HEJA 4XD7D 3NDBB 1KMHA 1QHIA 4TYNA 3SYLA 3SYNA 2YOGA 3VQTA 2J46A 4QJ4A 2O8EA 4QHTA 4CVNA 4BRUA 3SJAA 3PENA 1LNZA 2QA5A 3OE7D 3KQHA 3G82C 3GJ7A 1BYIA 5TY0A 5KSPA 221PA 3A1WA 2C99A 4TYQA 3QOFA 1Q57A 4FD2A 2OT3B 2DHRA 2IHYA 1R2QA 5B30A 3GLGA 5AUPB 3W8NA 2YWGA 4HI0E 2OSBA 2YHSA 3PG5A 4M0LA 4M9QA 3TAUA 5KSOA 2GVZC 4KLZA 4IFBA 3B6EA 2IYQA 1G3QA 1E2DA 1OLOA 3U5ZB 5BYKA 2CJWB 2QL6A 4R2IA 2E9SA 4Z51A 1Z5ZA 2CLCX 3B1YA 4UKDA 1ZM4A 2F3RA 5HCNA 3B5JA 1A82A 2ERXA 5HKKD 1TAGA 1XP8A 1E9BA 2FSHA 2BEKA 2PZEA 2ZE6A 2AHOA 3LWNA 4HATA 2VYFA 1QHNA 3AKYA 4I1UA 4JKIA 1KKMA 1A5TA 3KKNA 4HB0A 1LVGA 3Q7QA 4TTPA 4V0KA 4OHXA 5HE8A 1US8B 3VR4A 1G5TA 5EE1A 4PQRA 5FOSA 1DAEA 3BBPA 2WWGA 1NP6A 4LV6A 4P33A 1QHHA 3D3QA 1JQLB 5J47A 1ZNWA 1TQ2A 3A36A 4MGKR 1E2EA 4KVGA 4TLEA 3K09C 1G8GA 1OIVA 1W44A 3KQKA 4Z1MA 1Z0IA 3C5HA 1IAQA 2FF7A 2DCUA 3UXMA 3MWJA 3VHLB 2RGNA 3BH7A 3TR0A 3SBDA 3C15C 4BE7B 4IEEA 3R8FA 3V4FA 2EFCB 1E99A 2PX0A 3VR5A 2WWWA 4URWR 1YE8A 3T35A 3VKGA 2V6IA 1E79D 3EXAA 4EJSC 1D5CA 1Z28A 3IBGA 4Q1BA 3L0OA 3AVYA 4BUJA 1SVMA 1IONA 3CUEF 2XJ9A 4LC0A 4A0RA 1RW4A 4B71A 2OM2A 2EVWX 1EGAA 4TMVA 2JJ2A 3UMSA 3NXSA 4KSBA 3IIKA 1AS3A 5AUOB 2YYZA 1QHHB 1OXTA 2IYXA 2BEJA 4WAUA 2O8FB 1CJKC 5CK5A 2ZREA 4A8JA 4Y0AA 4V0LA 2ANBA 3PFIA 1H8ED 3KXLA 4KCGA 3U60B 4W5WA 2O8DA 2ZSDA 1XMJA 2QMOA 2O0KA 5FH9A 2ZRBA 1KDTA 4PC3A 1EFRD 5FOTA 1NMZA 1PUIA 2XNSA 3NC0C 4MA4A 3PEYA 4E09A 4US2R 5FPYA 1RRPA 4LPSA 4Q18A 3CX8A 1HH4A 1M8PA 3RS5A 1MO5A 3T5GA 3W34A 3M0EA 4A0HA 2A7QA 1VG0B 4B2LA 3WNDA 4U7DA 2JJ1D 3MCAA 1QHXA 1ZP6A 4M1WA 4AYTA 1QZXA 1UFQA 2J0UA 4JJZA 4QBHA 1G3MA 3A58B 5ELXA 1DAIA 2Q21A 3UMRA 2J87A 4BLRA 4RFVA 3PJRA 4RCYA 1T3SA 3K9NA 3PUWA 3QF4A 3DEFA 4DJTA 2XSZA 2LKCA 2QPOA 4Q01A 1RC8A 1ZM2A 1JR3E 5CM8B 5FPHA 2FGKA 2WJGA 3SZRA 4I99A 2XX3A 1ZUIA 4PAOA 2ZUCA 1GITA 1Z47A 4E5UA 5CK4A 1NMXA 1ZUHA 1KY2A 2O0JA 5EXSA 4NHOA 4PQFA 3K0SA 3CH4B 2QBYB 1E2IA 1MO3A 3MUFA 4DB2A 1XXHB 3FMPB 2CMKA 2PL3A 5E4FA 4EDHA 2Z83A 4P0TA 2JDID 3FHCB 4QNRA 3LX8A 2YJTD 1JXOA 3SQWA 3NH6A 3OEHA 1W2HA 3SHWA 3TMKA 5B57C 3LBNA 2IW3A 4A2PA 3QKSA 4P32A 3RRYA 1OJLA 3THXB 4TQUS 2NO6A 3AVPA 4J0QA 2RGNC 4TSFD 1P2UA 3LBIA 3MWLA 4URYR 3EG5A 3WMGA 3RRZA 1D6JA 2QSYA 1EFRA 4HAWA 1K5DA 3KQLA 1OYWA 2ZU6A 2ZJ5A 4BFYA 3CBQA 4BFVA 4B74A 1MRNA 1UKZA 2YC4C 3MGCA 4GSYA 4C2TA 4AKGA 1RKBA 4BWYA 2B21A 1ZD8A 1W0JD 3BFXA 1JNYA 1G5PA 4FMDB 3UG7A 2F9LA 2PCLA 3MJRA 2XGJA 4DRZA 3GLFE 1OPXA 4FCWA 3CRMA 3SN6A 2G3YA 4QOSA 1P4SA 2C2HA 2PX3A 5FBVB 2LCFA 2JJ2D 3CNLA 1LV7A 2ECKA 3PUZA 4JSYA 1W48A 2AK3A 2OBMA 2WJVA 1E2HA 3QY0A 4OJKA 5KU1A 4EPRA 3ICEA 1IJEA 1G6HA 4TTRA 3J81k 3T61A 2HYDA 2BM1A 4IEIA 5LB2A 2XB4A 4M22A 1J2JA 2F43B 2FMXA 3H86A 3JZAA 3KTAA 3B1XA 3I1FA 3DL0A 4PSVA 3Q7PA 2UVQA 3RLFA 3V00A 1OFTA 4PZYA 3KJEA 4UQOA 2GBLC 1S9DA 3I3SR 3HYRA 1YQTA 1S96A 1X1SA 3RC3A 1OXSC 3W5IA 3W6PA 1R0YA 1P72A 1P2VA 1XTRA 2QE7A 3CX7A 4A92A 1OHHA 2PJRA 3QUSA 4US1R 4BRWA 1ZD1A 3OHMA 1YR6A 2JCSA 5FL3A 521PA 1IXSB 1D2NA 3RS4A 1XEXB 1XPUA 1XDBA 4LJYA 3PV0A 3QXHA 2V7QD 2ZQ5A 4CT4B 4B35A 4DXAA 1R0XA 5FOXA 4GDFA 2WSSA 5L3QB 3FVQA 2YWHA 3PITA 3SHFA 2WVJA 4ZCLA 4Z8YA 5P21A 5KNCA 4AKHA 1Z0AA 4D0GA 4TYYA 4XOIA 4LPKA 3AV0B 3HYTA 3W6NA 2ATXA 1X8KA 2ZE7A 3QQ5A 4NMMA 1NLFA 4QHYA 2EFDB 2J7PD 2P0EA 2ZYTX 3AUXA 2GZAA 2QRNA 1R5NA 4O2RA 4Q7JB 1NVXQ 2F55A 2ZJAA 4HAZA 1XXHE 1DE0A 3P4YA 4TLDA 2BVNA 1S2MA 2QMEA 1E96A 3KFVA 3KUCA 4GOJA 3RS0A 4B48A 1DAGA 3L43A 3LX5A 2ZXUA 2VHTA 2IHBA 2QP4A 2NTYC 1HT2E 2V8OA 2ZANA 5JRZA 4OHWA 3QNUA 5E3HA 4ZV4A 2WWHA 4JLMA 3IILA 4A6PA 1KI6B 2P6UA 2WWFA 2E87A 2RGCA 4R98A 3I72A 1FZQA 2YZ2A 1KIMA 4BZQA 3GJXC 2W6IA 4KODA 3NEJA 2O8DB 1CJVC 1N3BA 4BLOA 1Z08A 3KKQA 3RANA 4JLOA 5AUNB 1XCPA 2BMDA 1A4RA 1ONBA 1HURA 2ZRKA 2QQEA 3I5YA 2FEOA 2Q3FA 3SJCA 4ZDWA 3LY5A 4BFUA 4YONB 3VTKA 4JLJA 4G5GA 4MUBA 3AQ4A 3AP1A 2W58A 4QHSA 4HDCA 4EIWA 1R10A 4O3MA 3CKLA 1CBUA 3K09A 2CE7A 2O52A 4ASUD 2JATA 4M8NE 4ZCIA 4W7SA 4LJ5A 3HR7A 1GNQA 1NKTA 1XPRA 2OCYC 4ABYA 4MRPA 1FUKA 2QORA 1FQKA 3D31A 3F5FA 4LV8B 4UJ5A 5BYJA 1AA9A 2OUKA 3RC8A 4EPTA 4G5OA 1G7RA 1ZC3A 4PC2A 2IXFA 4MYCA 4NYJQ 4MRVA 4ON9A 5GVRA 2G9NA 1YRAA 3VAAA 1PLKA 2EFEB 3EC1A 5JI3E 2EFGA 4C9BA 3SEAA 5KPJA 3W90A 2VSFA 3GMTA 4MYTA 4WBSA 5FTNA 3OEHD 2ZITA 1FW6A 1P5ZB 2OCAA 3KL4A 2GJSA 4V0OA 3ZD7A 3U61B 1IQPA 2CCGA 3CZQA 3ZVLA 2B8TA 3H2YA 4YMUA 1OIWA 1N6PA 2XAUA 4GMDA 5DISB 4CIDA 1KNQA 3HDTA 3BB1A 2GNOA 3D8BA 4NCJA 3TQFA 2HCJB 5JJIA 3QBTA 4B76A 3E70C 3GEIA 2GWHA 3B60A 1R0ZA 1OE0A 1OFIA 2HLDA 3DDCA 3H0KA 5C46F 4MKIA 3RABA 1QHYA 1OXVA 1XMVA 2AD5A 1PLJA 1OH6A 2OZEA 4B3FX 3UWKA 3DVLA 1R5OA 4PO1A 3A4LA 3H84A 2XSZD 5JRJA 1S9HA 1KK2A 2H16A 1Q1BA 5AJYA 2NZJA 4TYWA 1KSHA 4KVAA 4OI4A 4WOPA 4PZLA 4B6FA 2JDIA 2VPPA 2D2EA 4QG7A 1GAJA 2I4IA 1G3UA 4JLPA 2DPXA 2VSXA 3NKVA 5IDVA 4EFMA 5BN4A 3BFKA 3VKHA 2GA8A 3P32A 1GSIA 1OV4A 3IQWA 2RGEA 2EU8A 4CGZA 4Q7KA 3AUYA 4JLAA 3REFA 4OQNA 3EPJA 2VEDA 4TMWA 2W2VA 2LWIA 3TJZA 121PA 2XTMA 1W36B 4C0LA 2GRJA 1KMQA 1MRSA 1NIPA 2A5YB 2C98A 1CR4A 5HZKA 4URXR 2O5VA 1KKLA 1N6RA 5DI9A 1AS0A 4B73A 5JS8A 4N1AA 1WQ1R 2FFBA 4TL7A 3FHOA 1G7CA 2ODNA 1CR1A 2WV9A 5GJCA 3TR5A 4F92B 1E2LA 2J0SA 3BS4A 4MKGA 5AJZA 3HPRA 3KTAB 4JL5A 1COWA 2ZROA 3A1VA 1F2UA 2ASEA 4HSEA 3U7FB 1MO6A 2HYIC 4DT1B 1KYIA 3KB1A 5FBQB 2EYUA 3DM5A 3P20A 4Q4HB 5DIFA 4DCUA 2ZVPX 4XVRA 1GILA 3KUDA 3ZH9B 1I4LD 1DO2A 1NMYA 1YZGA 2BOVA 2QAGB 4DIDA 3WP0A 2GVDC 4PO9A 3B8HA 4M2LA 1KDOA 3WMEA 1XB2A 4MKHA 1VG8A 4WZAE 2HEIA 2FSGA 1UKVY 5EE3A 1HYQA 5SZIA 4D81A 5KSZA 1E2GA 1F60A 2WJYA 2Z0MA 2ZJZA 3WYFA 3FOZA 1NVVR 3Q8XB 4KFUA 5FR2A 1E1QD 4LX0A 5JWHA 5LD2C 5BQ5A 3BIFA 1CS4C 1A2KC 4R2HA 4IDNA 4U5XA 1WP9A 4BASA 2BMEA 3RSLA 1G7TA 1N6OA 1RYFA 2KSQA 2JASA 1NBMA 3CRW1 3VKWA 4Q5IA 4PO8A 3LFUA 3Q9LA 4G5RA 3S1AA 3VU9B 2C8VA 1W5TA 2XITA 4RCZA 5A5GA 4DKXA 2JLYA 1M2OB 2ODEA 3GFOA 2QM8A 1G20E 3BD9A 3K0FA 4WXRA 1AM4D 4GP6A 2V1UA 2PBRA 2YOFA 2KJQA 4GZMA 4KYIB 1KO1A 5FTJA 4E03A 3GLFA 1WBBA 4QNMA 1UEJA 4Q9JA 3KB2A 1JALA 3NBFA 1IN5A 4M53A 1M1YE 4Q4HA 1E9SA 5J4YA 2LKDA 2ZRPA 2NPFA 1ELOA 3QEJA 5L3QA 1GNRA 1OYYA 1UBEA 5FR1A 1IY2A 2R6AA 1S8FA 3BAFA 4NP6A 5FBRB 5DHFA 5JSZB 2AL7A 1OFHA 3OEED 4XTCS 1NG9A 3EIQA 2QG6A 1DVRA 5KSYA 4G0NA 4B3CA 4NYJR 1L4YA 2XZPA 4HAYA 3CZPA 3N5CA 1PVOA 3UG6A 2HXSA 1E0AA 1TMKA 2OLKA 1COWD 3IPXA 4C0KA 5CB8A 3BH0A 2ORWA 4RD2A 4TL6A 3LW7A 4IXNA 2FJUA 4TL8A 2GXAA 1TADA 5FOUA 3GP8A 2OHFA 4F38A 2ZR0A 4UXIA 5E7JA 5K8TA 2CLDX 4D25A 1TL7C 1GOTA 2DWOA 1YR8A 3CNOA 2VHQA 4HZUA 4LI0A 4ZIRA 3RNLA 5BN3A 5EZ6B 2WJHA 4EUNA 2V4ZA 5BWMA 1G4UR 1VYTA 1Z0KA 3KQUA 1GM5A 3G0HA 2JA1A 1X86B 2N42A 3T12A 3WRXC 4YMWA 4M1YA 2AXNA 1ESNA 2WZQA 3BXZA 3WHKA 5FI1B 1Q1QA 3ZIAA 1P6XA 4DT1A 1DBSA 1T3LA 4ARZA 4OJQA 4MRRA 5EXPA 2GXSA 3NEYA 2ONJA 1AQUA 3CF6R 3AVXA 1HY3A 4A0GA 4B3DA 4BGDA 4HUQB 4D2IA 3K53A 4KLNA 1E1RD 4QBGB 3WY9A 1VTKA 1QRAA 2MMCA 3M6AA 3U3JA 3BC1A 4M9XA 3CRVA 1ZM3A 1FMLA 3PEVA 4XH9B 1GKYA 5AJWA 1DTSA 4CW7A 2CJWA 2H18A 3K0AB 1VCIA 2ZRAA 4PAQA 2IWRA 3TSOA 3ECCA 2IS4A 2P3SA 3VNUA 3EAQA 2QP9X 5JECA 4CYMA 2HJGA 3L0IB 2DWPA 2VSOA 4TLCA 5SZHB 1Z07A 3A4NA 4D26A 4KFRA 4YDHB 1Y3AA 3CPHA 1UKEA 3PQCA 1NKSA 3U3RA 1LB1B 1UADA 1Q12A 4Q4JA 1N6NA 3SOPA 4OK6A 2R65A 2VP9A 2OFOA 4ARZB 5DE3A 2P67A 5KNDA 5AWFC 4W9MC 4GFDA 4JVNA 4MITA 1OB2A 2ZSBA 2KBFA 1PJRA 3FTQA 1IBRA 1Q1ZA 2ZRMA 2D3WA 1ZNYA 3TBKA 2OV2A 3BORA 4BFTA 2YVUA 4G3XA 4C3ZA 1H8HA 4LC1A 1BOFA 1YZLA 1MOZA 2FE4A 2PEYA 5AJXA 4A8JB 1YZQA 3TUZC 1RVDA 5FTMA 1KI8A 1U98A 2NO0A 3M4YA 4D80A 1QVAA 1JECA 1XU4A 4EJSB 2QU8A 3UK6A 2QAGC 1E0KA 1NVVQ 2C03A 3B1ZA 3K70D 3SDZA 1JJVA 1KI3A 4C2UA 3QXCA 4CZ2A 5BXQC 3B82A 2CNWD 2HLDD 2NPIA 3U7EB 1NY6A 3GCGA 4ZO4A 4GP7A 5IRCD 5EP3A 5D3QA 1GVNB 1ZINA 5TMPA 1II8A 4US0R 1T5IA 4PHHA 3HJNA 1PLLA 2ZSEA 3I5XA 1YRBA 1PUJA 4XIGS 1U0HC 2OFWA 1Z6YA 4A4DA 4QXAA 4OQLA 5H70A 5FL7A 1AZSC 3FKQA 2ZRJA 1GZSA 3T15A 3EPLA 1E94E 2VP2A 5CDFA 2C9YA 1KNXA 2YINC 5D3MB 1VIAA 1EESA 4LYHA 3P4XA 2O8EB 1DO0A 2A2ZA 2C96A 1E0JA 1U9IC 4W5JA 3VX3A 2GEDA 4ZCMA 2RGDA 1NF3A 1YHNA 2GXUA 1GP2A 3N2EA 2R6GA 3B1VA 3NTUA 1ZVQA 2V1XA 1N6HA 1QG4A 4C7OA 3R7WA 1XEWY 1T3HA 3WYAA 3WBJA 4DLTA 4HLQB 4XVQA 3SYKA 3W3ZB 2CK3A 2AXPA 2WWIA 3KZ1E 4FCTA 3CONA 1XJ0A 4ZDKA 1NN1A 2QMHA 2N46A 2V54A 1TNDA 3IIJA 4M9ZA 1NBMD 3CNNA 4XTRA 3U3KA 2GXQA 5GADl 3BE4A 4DCVA 2A78A 4NPHA 3X1XA 4A1FA 3MD0A 1KK3A 4TZ0A 4H1VA 4RZ2A 4II7A 1I4TD 4WXPA 2J5XA 1J90A 3KX2A 4KI0A 1X8LA 4RSGA 4YDSA 4MH0R 3CW2A 3EZ2A 3N70A 1HUQA 3SJZA 1EXMA 3BFVA 3H1TA 2KB0A 3OE7A 4G1UC 1SHZA 1TTTA 4D4MA 2A5JA 1DS6A 2WM9B 4TT3D 4JL6A 1FFHA 3GJ3A 4N0EA 4CEJB 5G3YA 2GESA 3SQXA 2CDNA 3IPYA 1W47A 5CITA 3GLFB 1WCV1 2WIBA 5FPKA 1G8HA 1XZPA 4ILEA 4IVPA 3LRPA 1CU1A 2OBLA 3R9IA 4EAQA 2ZI7A 2RGBA 3T34A 2RHDA 5LDDC 2NZ8A 3TRFA 3VR6A 3X1YA 4DDWA 2CNWA 4JS0A 4B75A 3HU1A 1N6LA 3QBVA 2VP4A 2J7KA 4KAXA 5JLJA 3JZMA 3B13B 4IDQA 3FKSD 4Z1MD 5CB6A 1T9HA 3A1UA 5J4HA 2IA5A 1UBCA 3RS7A 4AURA 1KTVA 2O8BA 1VCOA 2HJVA 1FUUA 3ZLJA 5HZHA 2ZJ2A 5FOWA 1FX0A 1NY5A 2D7DA 4C0SA 2G1JA 1DAFA 1CEEA 1YVDA 4RFSA 5FBWB 3T1VA 4F7WA 4MDFA 1N6KA 4A15A 4OK3A 3OAAA 2F3TA 3B1WA 3Q5EA 3GJ0A 4CEIB 1OF1A 1J7KA 1UBFA 1YZKA 5F2EA 1RZ3A 4LJ9A 421PA 4ZDJA 1PV4A 4D4KA 2KBEA 3CIOA 1BO6A 4GT1A 3T1QA 1U94A 2IYWA 4PC6A 1RPZA 1SKQA 2UZ3A 2PLFA 2HF8A 3GLGE 3LNCA 4ACBA 2WJJA 1AKYA 3F8TA 3QVVA 1QHGA 5GJVC 5BN5A 2IUTA 3RDPA 1Q22A 1B23P 1KZGB 3LAWA 2GF0A 3BGWA 3WNBA 4B34A 4QM7A 5L3RA 2PCJA 4DDTA 1EX7A 1VIYA 2QMUA 5HTKA 4NE2A 1E9RA 1KMHB 3FE2A 2IX3A 4TL9A 4ZDIA 5KO2A 2WJIA 4LDJA 1F2UB 2MSCB 4FN5A 4RD0A 1E32A 4CEJA 1N5LA 1SVKA 2ZEJA 1FNNA 3C5CA 1XD2B 5CM9C 2R9VA 5H8WA 4DC9A 1CJMA 3I4LA 1W4AA 2FX3A 2IYSA 5KYKA 2ODBA 5DN6A 2ZJOA 2ZYVX 1QF9A 2WWXA 5FTKA 1YU9A 2ZRNA 4JT2A 1HEIA 1G19A 3RVBA 4K8OA 3ZVRA 1YZTA 2BWJA 4QC2A 4B33A 4DLSA 2DFTA 2H17A 4JJKA 4DCNA 4ERNA 4S35A 1IOZA 4Q1AA 4TZ6A 4LY6A 3TK1A 2J3EA 3THOA 1KDRA 2J0VA 4KFSA 4ASUA 2IUSA 4GZLA 2QRZA 2O0HA 1S1CA 2Y8EA 4TTQA 3SC3A 5IHPA 2DB3A 1U90A 2Z4RA 1OKKD 2F1RA 4DVGA 1XXHA 4OQFA 2ANCA 1U99A 4F91B 2B8WA 1OT3A 5CIWA 4FMBB 2VTKA 1CULC 1HTWA 1N0VC 2BC9A 1GKIA 3OZXA 5F3WB 1ZM9A 3HP1A 2JLWA 1NIJA 3VNVA 2FFAA 1Q3HA 3ZGXA 3W8RA 2ZPTX 1K5GA 3QKSB 5G40A 4B3XA 1SVSA 3ASZA 3VMFA 2ZIAA 1HQYE 1DG3A 3RSOA 3KQNA 1FL9A 2AR7A 1UM8A 3U44B 4XJXA 5L3SA 5DO9A 2KWIA 1KDPA 3EPKA 3ND8A 1IJFA 5AK0A 2WOJA 5EP1A 5UKDA 1ZCBA 2RB4A 1ZU5A 1TPZA 5DYGA 3AF3A 2FU5C 3V9PA 5HPYB 1M7BA 4DSUA 1UPTA 2ERYA 4NCHA 4Q4AB 4M1TA 3OIVA 2GTPA 3KJIA 2NOAA 1W4RA 2RGXA 1G5RA 3C8UA 3NHAA 4GL2A 1XTSA 3QXSA 2EWVA 1E4YA 1E1QA 1Z6GA 2QZ4A 3K9LA 5KDLA 4OI2A 1DAMA 1GFIA 3U2QA 3DPUA 4NKRA 1ZMXA 2J1LA 1SXJA 1QHSA 1GWNA 821PA 2IYZA 2G1KA 3QENA 4DEXA 4BFWA 1N5JA 2Q3HA 3E5HA 4GBMA 5DLQC 2MSDB 3B78A 4LWZA 4LHZA 3SJBA 1I2MA 2CK3D 3TW8B 3CF0A 2IYTA 1JB1A 2CL7X 2BCJQ 4CDGA 1OKKA 3AB3A 3QVUA 2XNDD 4M1OA 4BZPA 1ODFA 1HT1E 1XNJA 4H1UA 4JLBA 2JEOA 2XXAB 4OK5A 4M1KA 4V0ME 4GOKA 3GLIA 4HUQA 2IYYA 2P2LA 1W5SA 3BERA 1Z29A 4GI7A 1UEIA 3T5DA 2WPDD 1Z0DA 1TF5A 1QBKC 4MUAA 5CJPA 5EXTA 2RGGA 3K1JA 2ZUBA 2WSSD 4R9UC 5B64A 5DN6D 5IF9A 3QPVA 2QI9C 4DLXA 4BFSA 4TLAA 4FI3C 1LF5A 2GEUA 2ZAOA 1R8SA 2WBLC 2ZM5A 3ZZTA 1ZRHA 1KI7A 1EFCA 1NVUQ 1YR9A 2J45A 4LHWA 4OHVA 5EUQB 4QJ5A 4DLUA 3E2IA 1SVIA 1WRBA 3L82B 4RY2A 4OI0A 1CTQA 1Z8FA 1KJWA 1ESMA 2VHUA 5HE9A 2ZRGA 1KHTA 4XD7A 1XEXA 4OHZA 1IHUA 4TMKA 3JVUA 2AWOA 1HE8B 3EIHA 5CJ2A 1XTKA 2Q9AA 2XXAA 4RFSB 3REGA 2B92A 3VR1A 1HA3A 2FSFA 4FMCF 2GCPA 1NG1A 1J99A 4POAA 3SBEA 4AKEA 1EWQA 3AEZA 1O87A 2C9CA 5B58C 1F6BA 3OF5A 3QKUA 1E2PA 3I32A 4BLSA 1N25A 1TQ4A 5K8UA 1W49A 1U8AA 4JVSB 3HU2A 5HCIA 2ZRLA 1XBTA 3WMFA 4YXWD 1DPFA 2IYRA 5FI0B 1GRQA 4IHQA 1JPNA 1TX4B 1CIPA 3O8DA 1II0A 1C1YA 3IHLA 3EA0A 3LVRE 1UBGA 3K0FB 1Z06A 2BBTA 3MMPA 2RKOA 3U6BA 3ZJYA 4MGZR 2WMOB 4PTLA 4M9SA 4B2PA 4B32A 1XD8A 1S0UA 1M34E 1OXXK 2CL6X 3NG1A 5F9HA 2Z6VA 4GNKA 2AFHE 2DFNA 3ZS9A 2OG2A 4NBSA 4HUTA 4URZR 1O3YA 2C04A 2IS2A 2X8AA 3T06B 3TAHA 2G6BA 3U3OA 3AF2A 3AKDA 4X8MA 2GCNA 4KSCA 5F98A 4E22A 1CKEA 1V5WA 2H5EA 2Q6TA 2BIFA 5LD2B 3NBXX 1V43A 1SKYB 2BJVA 4XVUA 3ZD6A 1F5NA 1ZJ6A 1R6BX 3EC2A 1U2RA 4N0DA 4URVR 4Q9KA 1P9WA 1R5BA 3QXJA 3LA6A 3C7KA 4MRSA 4HLCA 2WAXA 1GL9B 2IEYA 3GFPA 3RWOA 2QM7A 1SKYE 4O0MA 1VCNA 3CF2A 4Q7LA 4A6XA 4A36A 5GJBA 2ZE8A 2OXCA 1W4CA 2D06A 2OXRA 3MAAC 1HV8A 4JYBA 1G18A 1XMSA 4W5HA 3ICQB 2IWHA 2GCOB 4Q1EA 2BMJA 4TLBA 3LD9A 5EE5B 4WVFA 4MKFA 1EFHA 4AKIA 3NC1C 2YNMA 3IDQA 4NH0A 4FCVA 3QKRB 1FP7A 1E2MA 2REBA 3K70C 2C5LA 3KXKA 3PR1A 1G16A 1XCGB 2FPLA 4LJAA 5KOYA 2ZJYA 4IW3B 5L8VA 1OHHD 4C7OB 3ADDA 1ZD9A 2YC2C 4Q21A 2F1HA 1ZM7A 1LS1A 4AYWA 2A9KA 2R44A 4K81B 4N3NA 3BJIC 1NN5A 4JZKA 4C0JA 2G0NA 4ESVA 2R6DA 4BECA 2CEAA 1R7RA 1GTVA 2HCBA 3F0TA 4I81A 2JLRA 3TGPA 1DOAA 1Z22A 1ZNXA 4UNPA 3EIEA 5G53C 3NBYC 1N0UA 1VYUA 3V4RA 1DELA 1FPMA 4PR0A 5EE0A 5JFGA 3A1TA 1EFUA 2W0MA 2NQ2C 2ZJ8A 3P27A 2CCJA 2ORIA 1SULA 2HV8A 2W6ID 3I8XA 4TWZA 5AR1A 5CLQA 4KXFB 2PZFA 3I61A 2OILA 3EPHA 4Q9IA 2ZRDA 5JWRA 2OEPA 3TSWA 3AF4A 4LUCA 4U02A 5HR5A 2H1LA 2X2EA 3O8RA 3QXXA 2R6CA 3X1WA 1NVWQ 2ZVQX 1CP2A 3K9GA 5JEDA 3WYGA 3KFXA 3AP3A 3IQXA 2WKQA 1BMFD 4JKYA 4ESHA 1Z0FA 3ONWA 1CJUC 4FINA 2REXB 3IO3A 4KHZA 4KO8A 4P4SB 4WW0A 5JCPA 2RAPA 4TSFA 4DLYA 4CF7A 1SVWA 4HYYA 3BWDD 4PPGA 3ZDQA 4DDUA 1A2BA 2FOLA 2QY9A 2VIIA 5SZJA 3T1OA 5E95A 1SXJB 1U81A 4EKDA 3PCRB 3FYHA 1X1RA 3GLHA 2ATVA 1KO7A 3MFYA 4RD3A 3TIFA 3UANA 1X3SA 2PMKA 4IOMA 4HB4A 1EX6A 5JI2E 1VHLA 3WRYC 2H92A 3PVSA 4B44A 2ZS7A 3B85A 1UDXA 1ZUNB 2FGJA 2NGRA 4NTZA 4LK2A 3SS8A 1JAHA 2BMFA 1P61B 4UXHA 5JHHB 5CLLA 5AJVB 1I4DD 3EASA 3DKVA 1JAIA 4X8LA 2VF8A 2DFKB 3CRQA 3IHWA 4TYPA 4AC9A 4AG5A 4C4PA 4QGGA 4B47A 4QBIA 2Q9BA 1N6IA 1Z6TA 1RJ9A 3TH5A 2GEVA 4BLPA 3RAPR 2IT1A 5A0FA 2CHQA 4ZKDA 5TVKA 3DO6A 1GRNA 5DGXA 2WKPA 1W36D 2IUUA 2DYKA 4IDOA 4D0NA 3U7HB 2QT1A 3GJ8A 4Q4LA 2GZHA 4YC7A 4M1SA 5A4JA 4YXWA 3ASYA 1N5IA 4DSNA 2JIZA 4DSOA 3CWZA 2HXYA 1KI9A 5JS7A 4EPYA 1P60A 3PUVA 2CLSA 3OFNA 3WBKA 3CM0A 1WE2A 2XJ4A 1MO4A 1ZBDA 1ZYUA 2ZR9A 1I2DA 4YMVA 1N2CE 1RE0A 5IT5A 5E7MA 1KO4A 5JWOA 1KI1A 3W5JA 1NL3A 2Q9CA 5AUQA 4CEHB 2AN9A 1RYHA 4UNRA 2OLJA 3KJHA 3THWB 3LO5A 2A5FA 1II9A 4LHXA 3O8CA 4OL0A 1UDWA 3EARA 4TMTA 5DSZA 1Y63A 4DLRA 4NU0A 4TMXA 3PIRA 5J40A 5D3MA 1G17A 3NHBA 2RHMA 1IN4A 4NYIR 3ETLA 4UNSA 2ZR7A 4A82A 1FTNA 3AF0A 3ZIAD 5JJKA 2DFLA 4LYFA 4LYAA 2WTUA 1K6MA 2QT0A 5H68A 2FFQA 1TQDA 2N1BA 4OQXA 1RIFA 1WB9A 2B6HA 4XWAA 4DDVA 3B7GA 3LXXA 5E7IA 2YKGA 4Y0VA 2AK2A 5J4VA 1M74A 2AX4A 3K0AA 2G0TA 4LJ8A 4P4UA 4QRHA 1J8MF 2GCOA 5KUTA 2ONKA 1XJCA 2D7CA 3AKCA 4A2QA 4ZI2A 1MT0A 2FH5B 1P7CA 1Q0UA 2QQ0A 4PZZA 3QKTA 1ZU4A 2GJAA 1XZQA 5DI3B 1MKYA 5LB4A 1H65A 1D2EA 1NBME 1W1WA 1XTQA 3EA5A 4FW9A 1KSJA 5H1YA 5FUYA 4P4TA 2G88A 2K5UA 2IYVA 3FDIA 4RZ3A 1S4QA 2BKUA 3N2IA 4JT4A 2NG1A 4P31A 5J4KA 4OHYA 2UZIR 3C16C 4HLUA 3QE0A 1U0LA 1RJ9B 4XSGA 2C77A 3GLGB 4U00A 2OFXA 4BQSA 4AD8A 4BZXA 3HU3A 1VECA 4D6PA 1WMSA 3TE6A 1JI0A 2VH5R 2XNDA 4TQ9A 4AY2A 1XFAA 3CRRA 3KKMA 1KJZA 1YKSA 4AIIA 3KKOA 1BS1A 3CR7A 3I62A 3O47A 4UJ3A 4BLQA 2OCBA 4PSKA 2QGNA 2CHVA 1OW3B 1D8TA 2AKAB 2JJ8A 3GLHE 5EUMA 2PJZA 2BKEA 3CR8A 3X1DA 721PA 1G8FA 3FMOB 2NO7A 4QKQA 2VBCA 1GIAA 1US8A 1YR7A 4OQMA 3ZVMA 5EXXA 2VO1A 2X1VA 3VHXA 3R9XA 1G7SA 3AVWA 2BJWA 1AJEA 4C0BA 4MGIR 3QPWA 1E9AA 1IY1A 2IXGA 3HPQA 4TQAA 2WWYA 2JLUA 1ZC4A 3ADKA 2CXXA 4PANA 1TF7A 2O8CB 1KY3A 1ZCAA 4Q9HA 2PH1A 3QEOA 3PEWA 1W0JA 5TXGA 4WZBE 3GQBA 2DY1A 3D7MA 1KSFX 1SGWA 3MRSA 4BEBA 2IF2A 4EJSA 2JAQA 1XEWX 4NL4H 1AK2A 3IKJA 4Q1CA 2H8KA 1KGDA 4BEJA 1G3RA 4C0AC 4XWKA 3EZ7A 2ZS9A 2QEQA 3EWSA 1RRGA 2C95A 3R7WB 3X1ZA 3SI7A 5CDFE 1Q44A 2ODWA 1TEXA 2ZRIA 4KU4A 1F48A 3UATA 4PFSA 4B3GA 1U8YA 2ZS8A 4QBFA 5B2ZA 3B9PA 3VX4A 4PAMA 1TUEA 1KAOA 3BB3A 4FMCB 1SVLA 4TMZA 2A5GA 4ZPXA 5C4MA 2VP6A 3RS3A 1T6NA 3TW4A 2CCKA 2CL0X 4Q48A 2BCGY 2YOHA 2VP0A 2ZJBA 2EQBA 2FPMA 4WIAA 3AKEA 5CIQA 1D9ZA 4E07A 1NLYA 1E2KA 4L4UA 4C0HA 4B43A 5EJEA 4FWTA 1NSFA 3B9QA 5DYIA 3K8YA 4LJ7A 1GL6A 2V9PA 3OIUA 5C4GB 4DUGA 4PPQA 5FFMA 2IL1A 1VYVA 3U4QA 1BMFA 1Z63A 1C4OA 2X19A 4OKSA 1AZTA 1AQYA 1LFDB 2D2FA 4G5QA 3GFTA 4JBWA 4JLNA 3U6KA 2FFHA 5G3ZA 2GZDA 4QFMA 3WNCA 3RRMA 2JJ1A 3DOEA 1FX0B 2RGAA 4GOXA 2CVFA 3I92A 3K70B 1B0UA 3WXMA 2J7PA 2XTNA 4KJZA 3ZYCA 3DZ8A 3THWA 2F1IA 2J41A 2ZU0C 4HAVA 1BIFA 2J0UB 2IS6A 2IXEA 4MGYR 2PEZA 3LW8A 1F2TA 3LQRA 5K8LA 4PHTA 2WKRA 2IK8A 1E4VA 5GJWC 1SXJD 2IEZA 2W00A 1A7JA 3ADBA 1M6NA 3BH6A 3TSZA 2W0SA 2EWWA 4QL3A 1GL7A 1G291 4JVLA 4OYHA 1G1MA 3QKRA 5L3VA 1Q1EA 1VMAA 2HUPA 2P5TB 1P75A 2WPDA 2F1JA 1ZAKA 1CXZA 3IBYA 3ZVNA 3Q72A 1AGRA 3UPUA 4LBYA 2DBYA 1OSNA 1KK1A 3NDPA 2B7BA 2QUZA 2O8CA 3TKLA 2HT6A 1KI4A 1NI3A 2I1QA 3Q3JB 2HT1A 2XOKD 3CWQA 1SXJE 1FNMA 3SE0A 1TQ6A 1AIPA 2WHXA 1M7GA 1XD2A 3CPEA 1II8B 1VHTA 4MYUA 1XD9A 3THXA 2PZGA 4HB2A 3EW9A 1JR3A 3QPUA 3FFBA 4V02A 1MH1A 1RRFA 5BW8A 2V55B 2GBLA 3D6TB 4D0LB 5FTLA 2ZSAA 5LPNA 2XEXA 3L2OB 1FP6A 1VPLA 1OIXA 3MWKA 3PUYA 5DHAA 3JVVA 1KZ7B 1A1VA 2QTHA 2BBWA 2FV8A 4LCBA 2DR3A 3S1AB 2VRWA 3VU9A 1KAGA 4PPNA 2Z43A 3NH9A 2IS1A 4AG6A 4C30A 4CEIA 2FZ4A 4JLVA 1U9IA 4Q1FA 5FL7D 3RRNA 4A9AA 3FPAA 1UAAA 3LLMA 2QROA 2GJKA 1IN6A 3MLEA 1EK0A 4DLWA 4D82A 2FEMA
chains in the Genus database with same CATH superfamily
3LWBA 1EP2B 1A9OA 2WVGA 3CZMA 1J8FA 3MJTA 4TGLA 3SXUB 1T5DX 2R87A 3NFZA 3KOMA 3IAHA 5AXDA 1X7GA 3S68A 5THQA 1C2YA 1L2TA 4NZYA 2O57A 3PA6A 1A9ZA 4MRNA 5BNTA 2HWUA 4IM7A 2PZKA 2WFAA 3L6RA 3JATB 4GYKA 1E2NA 2F43A 4RADA 3UOGA 3WHIA 2YXLA 3G2QA 4PLGA 3O8BA 1S2LA 1W4BA 4Q1VA 2EGHA 4C21A 3IDSA 2W83A 3H1PA 4G07A 2BEUA 2PVCA 2WIAA 4URFA 3GJZA 1Q7Y2 3IEIA 1P3JA 3WLEA 4DUGD 4M7OA 1R0RE 2ZUUA 4D8VA 3SR0A 3R9WA 4WXYB 2GPSA 4UU7A 3MUOA 2O3JA 3LV8A 3M2TA 3TTSA 1RJDA 1VBMA 1YOVB 2OAP1 3E5MA 3NATA 3QKIA 4GKVA 1XEFA 4IZ6A 4HDNB 1E79A 3VFDA 1CC1S 4PZCA 3PUXA 4CMGA 3FFAA 2XV1A 4XOUA 3LPLA 1BNCA 2J4DA 3NU1A 1Q0SA 2QPAA 3SVZA 1D3AA 3GJ5A 3U3MA 5ALNA 2PM8A 4JSTA 3DZBA 1AKUA 3FWYA 5L3SB 1BX0A 1YCGA 3RU2A 2AOUB 5C35A 2WQZA 2ZYUX 1FRFS 2QN6A 1E7WA 4R0VA 2FWIA 3PEEA 3R0JA 2YL2A 2IVFA 5EMLA 2AA3A 3RVMA 3ZCPA 2XB2A 1WA5A 4QGHA 3LUDA 4LHVA 3CT4A 3IDFA 4NEHB 1FOEB 1UOPA 1WEHA 4M87A 1GPDG 1QLWA 1DBRA 1G9XA 4NYMR 2D54A 5KNDH 3VDMA 4BV9A 2BV3A 4FM9A 1J5EB 2MSEB 3KETA 2J59A 3AZOA 4CWAA 4ARAA 3GEEA 5H4HA 5B1SA 3KDSE 4CRWB 2VTBA 1JEYB 1BW9A 2R8ZA 2YWRA 1RAHA 4DZTA 2RH5A 1D09A 5A9SA 3GVCA 3AVQA 3R74A 1E2JA 3UGQA 1DX4A 4L50A 1CDZA 1KQSY 3GVIA 3SNHA 5M2QA 1YHZA 3RFUA 2OV4A 4ETMA 4D9CA 1EWRA 2PMWB 4LBWA 2GF9A 3NLLA 3A9TA 4HH3C 1F0YA 2XMQA 2IHNA 1WIIA 4DIMA 2WFZA 2XI4A 2X6QA 3DMNA 3WG9A 1E69A 4WBNF 4J03A 4X41A 5GM2A 6Q21A 5KTSA 4WFIA 2GN6A 2RD2A 3VOBA 2ONCA 1XTIA 2PMDA 3L8YA 1W46A 3PFKA 5ALSA 3SBOA 4HAXA 3WV4A 4BDTA 5KTYA 5LQCA 3PC6A 5M34A 1EU1A 1IH8A 3A7DA 3OM8A 2GK6A 4RTLA 3B3GA 5ITZA 3LYHA 2REOA 1KWGA 3ZWNA 4LZAA 3KVOA 5KQSA 1N8TA 1GPAA 3WAGA 4YRAA 5TV2A 3QE3A 2GKGA 1CD5A 2RHWA 1QIJA 2ZIXA 2IW1A 3U5TA 1N2JA 3I1JA 4UM9B 3THYB 3LQQA 3RGGA 2LVBA 1C7QA 4MVJH 5C8ZA 1T1RA 1U0TA 3EZ9A 1OAOA 3A6DA 3GUZA 1EA5A 3W1WA 4DA0A 1VLQA 1HEUA 1OZFA 4QM6A 1M33A 3WNVA 1AX9A 1K9M2 4JMLA 3QMWA 5CXQA 3O8OA 4DNXA 2Q3MA 4KV7A 1K66A 1SA0A 1XAGA 2YV2A 2FPIA 1EG7A 5IK2A 4KITB 3GO4A 5L7WA 3VR2D 3MS7A 3AM1A 3PRJA 4Z0PA 2QZJA 2RIRA 3VRHA 4D3ZA 4PRYA 5EMHA 4EUKA 5AI0A 4TUYB 3WZ2A 1Z35A 1GZHB 1G8YA 3GD7A 3S2HI 1YJWZ 2Z1NA 3CR3C 4ENRA 4EFKA 1APBA 5IEBA 2JZNA 3UJPA 2CFTA 3UUWA 4I55F 1QRTA 2D2IA 1NJGA 2XRZA 4DG8A 1PKEA 3CCL1 1T0UA 2VZEA 3D1JA 3ICPA 4HB3A 4ECEA 2AWNA 1ML3A 4YAEA 3G2IA 3IOCA 4DQKA 2PGOA 2ABWA 4MXDA 1NX9A 1VSQA 3EVEA 5JYBA 4RD4A 1P9RA 3MG9A 1GDDA 3MTDA 5I9LA 3A6ZA 5EZ5A 1E9CA 3WL3A 1GO2A 1YZHA 3U3ZA 2XH8A 4YASA 4OLJA 4ESEA 1MQAA 3G8YA 3L4EA 2KE5A 4ADSG 3CINA 1BKSB 3CH5A 3K8QA 2O1WA 3HQ4O 1XO1A 2MU1A 3U4HA 1JDVA 3MBKA 3MJ4A 1HE1C 4UNNA 2DBZA 4NRDA 1UBRS 2RPRA 2AOTB 4I55A 5TR9A 1TVMA 3E3LA 1VQ8Z 1TRKA 4ROTA 4DV1B 4A27A 2HPVA 3GLHB 1P80A 4N9WA 4Y6LA 3LT0A 2DPHA 3OMWA 1YB7A 1LS6A 2ID7A 3LH5A 3LUKA 3FSGD 4JASB 3O0TA 2QXTA 1H1LA 3UKDA 2VDVE 1JEYA 3NR2A 1USVA 1WDLA 1K88A 2WEKA 3LUBA 3VNRA 1BMQA 4L95C 5CT5A 3HM2A 2OESA 4MLDA 4BMOB 4HDSB 4FFDA 3HVKA 4KWHA 1G21E 4P5DA 1T0PA 5KTOA 3DJYA 4MVYA 2ES4A 4AY3A 3ZW8A 5IK2D 2AE2A 1AS2A 4DHEA 1G64A 1JJ7A 1QRRA 2JF0A 1N2CB 2FKNA 3TOCA 5LUAA 2IGTA 3TJRA 3H9JA 1PQWA 3DF7A 3TLXA 2F48A 4HNTA 2G5CA 4AJ4A 4EYGA 1GGFA 3MSXA 3QJYA 1FTSA 2P6OA 5IT9f 3R7SA 2IFTA 1RBMA 2RBKA 4G6ZA 2WT8A 2WF7A 1NN0A 1RYBA 5EZQA 3IT3A 2AG0A 2ID8A 3HUTA 1D2MA 2AMJA 1L4UA 3G79A 3IO5A 4V0NA 1U2ZA 3GELA 4O1HA 5PNTA 4ETIA 4PN7A 5KPDA 2H57A 3L8ZA 2JUBA 1I0ZA 1SVOA 3C3KA 2Q2OA 5CYFA 5LR6A 1QAQA 3VU0A 2QR3A 5EVCA 2C7RA 4NX2A 3CN7A 2XUKA 3H2GA 3OFSA 5K0TA 4JXZA 4MS4B 4OYYA 3F2VA 4GWGA 4AUKA 3S8EA 1XMOB 1R8QA 4D3SA 3R24A 5C8VA 4BNTA 1JG2A 1P2TA 3ESZA 2FW6A 2VK8A 3RH0A 1QDEA 1M0SA 3E9ZA 3VR2A 4YT2A 2Z4SA 3CCQZ 3A3PA 1RLYA 2AZ4A 3FUXA 2A84A 1TIPA 4HXYA 2X0JA 3AF1A 2XE6A 3EUWA 3U81A 4F2GA 3GLIB 4UUQA 1B93A 1DC3A 2B36A 2PUDA 1ECJA 1UPFA 4LZZA 3S29A 1Y4SA 2K7ZA 3FI0A 3IUJA 2HWKA 3LSYA 3Q3VA 4L8GA 2OK7A 4F45A 1Y3BE 4LJ6A 3H18A 3PQ7A 2J9FB 3O4GA 3UMYA 4BMZA 2HHHB 2GAOA 1ZKMA 5B53A 3O3NB 5BURA 5JD6A 1FQJA 3GV0A 2OQRA 4IOJA 4RH3A 2FG5A 3AIKA 5MDHA 4RQTA 3A37A 2YWFA 9MHTA 3INYA 3J7TA 4AYXA 1UJMA 3LBHA 2QTVA 3RT7A 1E98A 2QKDA 1M8JA 2VXOA 3CNEA 2OP1A 1VG1A 3H16A 3NGMA 1I7SB 1UJ4A 4GW3A 3CCLZ 1BKDR 2C8LA 2MYNA 1DP4A 2OV6A 3HP7A 4CE6A 4PFJA 2FK7A 3AGPA 4PGGA 4AIRA 4YV2A 1MC1A 4S2EA 2O19A 3ICOA 2PMCA 3AJ9A 4RIHA 2VTBB 3GCDA 2RT9A 2AYYA 4NH1C 4QE3A 1ZGJA 3CLVA 1MORA 2QOEA 2D59A 2SHKA 4IMIB 4Z3OA 1T4CB 1E64A 4AO6A 4EL0A 3CO5A 4J4TA 4YLYA 1SQ5A 2CBZA 3VVMA 1MEJA 3PBKA 4XSHA 2IXTA 2QT9A 4PX9A 2JHFA 4EBFA 4PM4A 1J4AA 1L7XA 2VF1A 2C57A 2ZRFA 3ZQ4A 4IUYA 4L15A 1ZJ4A 4UREA 2FUNB 2ETVA 4R7ZA 1PYDA 5DI3A 3RU7A 4LRWA 3A6FA 4EB6B 2CLKB 3S44A 4B4UA 4XI9A 2C92A 2HDNB 1HDEA 3TEMA 3NKLA 4UNQA 4A8PA 4H7HA 1KE2A 1X6VA 2QTTA 4A0FA 1DQRA 3UW1A 4KWCA 4X8HA 2EKPA 3ETGA 3L1IA 1Z83A 1MABB 1R66A 1XRNA 1JDUA 1GPMA 2ZI4A 3GGJA 3IPRA 2WAAA 1L5GB 2P5SA 3UT0A 4KMOA 2KI7B 4H6PA 1CZRA 4WNIA 4P4SA 7ABPA 4JYCA 5DKFA 1T10A 2P6RA 3WIOA 1Q3KA 3TLZA 2WSLA 2YN0A 4KV9A 4L28A 2BE9A 5CYOA 3RHFA 3SHQA 3I04A 5E9QA 2VJQA 4PAWA 1RZVA 3EZYA 1U02A 1NYQA 1T13A 1M1K2 3TMYA 1FFCA 5CVVA 2J67A 1QH1A 2NLOA 3LT4A 3OT5A 5DX1A 3KWJA 1NASA 3OIDA 3CXCZ 3U4MA 3NHKA 3I5AA 1ZA2A 4BMXA 3D6FA 1E3MA 4EG7A 2ZPAA 1XQWA 3I01A 4PPFA 1HQCA 5LP6A 4G5SA 3OIYA 3OESA 1J70A 4JC8A 5IH7A 2FNAA 4DG9A 2GAFA 3GEHA 1AKVA 4MWGA 1USKA 2AMLA 1JVSA 3E23A 4YJHA 3WKAA 3I39X 2G1UA 2VCHA 3AVTA 3EZFA 2BZGA 2IY7A 4OO3A 1JSZA 1GG2A 3INRA 1L8QA 2VHXA 3BHMA 4AWAA 1G2OA 2GHIA 3OWHA 3KJNA 4OI1A 2JFUA 4Y2YA 1YJN1 2J9XB 2SICE 2ZSFA 3VVLA 1CHNA 4GMXA 1KZHA 3VA7A 2X77A 4QJ3A 3ZJ5A 1X7ZB 1UM9B 5IX8A 1Z5WA 1KO8A 1N3LA 1YMUA 2AW5A 3F3MA 1QR6A 3DWIA 4R81A 4MDEA 2PWAA 5LZ5A 1P1IA 3EXFB 4ZEVA 1K7YA 1KVTA 1TF2A 1JKIA 3ELUA 5HG0A 2JCYA 4AZ0A 3BWVA 3I6ZA 1Q7EA 1ZO8A 1VGVA 1YL6A 1T2AA 3O9VA 5TMDA 4JI6B 7REQA 5IAAA 4IRUB 4DUYB 4L5BA 5ALVA 2W6JA 4Q7MB 3VYRB 1ID8A 2I67A 5K8CA 2TMYA 1G8PA 1XAIA 2Y0DA 4M9CA 1X7YA 4K9QA 5JMTA 1OB5A 3LHSA 3R0ZA 4EA6A 2IYOA 2QN2A 3CX6A 3IFSA 2C5GA 2GVNA 2XGMA 1I24A 3QPAA 4LV5B 3TN7A 1LJUA 1MAHA 1T8WA 4KX5A 5AYVA 2V3CC 1C9KA 1XYGA 1W2GA 4YJHB 5TQJA 2A5DA 3KHUA 5LXTF 1IPFA 2CN1A 3VR4H 4EF5A 3PGXA 1PL0A 2ENWA 4PZ0A 2C29D 2GN1A 4FXPA 2PZLA 2Q41A 4X1KB 5DP2A 4YFYA 3QHPA 2XBLA 2WY2D 1EG2A 2WUDA 3PI6A 3RIHA 5AKZA 2WTMA 1O95D 5HF6A 5EPUA 4WXHA 4FBGA 5HBGA 1VJTA 4M1MA 1WEKA 3M34A 3ZU4A 1ZMBA 1JWBB 4MPTA 2EP8A 3D54D 3G2MA 5AVVA 2OQIA 2BDTA 1YBMA 3TSYA 3C7AA 2B8NA 1E5QA 2JAXA 2C3YA 3ZNNA 1UJCA 2VNSA 3FPCA 5ED0A 3DPIA 4MS1A 4DW8A 3GTMI 1X9GA 3ZX5A 1A50B 4YUYA 3BRWD 5E8JA 2B5WA 1Y3DE 3EGIA 5EQTA 2ZPUA 3ZZUA 3TUIC 1A0OA 3RK1A 2A57A 3OKFA 4IDHA 4FMDF 5BWOA 2QLLA 4E3ZA 5H9VA 5TDHA 5KDDA 2PL1A 4RXMA 2Q3JA 4AJHA 4N47A 3WAKA 1ZZGA 4K0RA 3DEJA 1JVBA 2E48A 4RHFA 5LQUA 5B3LA 1SXJC 3DL2A 3VPBA 4L9SA 5J4LA 1KI2A 4BO6A 4AXXA 3TLEA 1JPJA 1WPQA 3LDAA 1R6XA 4JLSA 5JS2A 4M88A 2UYHA 4BXOA 4QRIA 1X7HA 2FE1A 2P75A 3JWIA 1K731 1SBZA 3CCBA 4FR5A 4XFKA 4H59A 2NO1A 5HM8A 3SQDA 1H9BA 2A59A 3KB8A 2AMVA 5AKXA 2O8FA 4M9UA 3L0ZA 4H9GA 2YHUA 4IDEA 4PC7A 2OG1A 5I9TA 2WU8A 1E9FA 3N2LA 5DM0A 5I8ZA 3CVUA 1QHIA 4TYNA 1WETA 3SYLA 1QFSA 2Y0PA 4BYMA 1OU4A 4MW1A 3CCE1 4R8LA 2PNJA 4BRUA 2OA0A 2FMTA 1M6EX 1LNZA 3MZLB 1V3QE 3PC4A 1NXOA 1KC81 1SPBS 4N3CA 1ZBQA 4YP0A 1SK8A 5KYVA 4G0VA 1MOQA 1F8YA 5K3OA 3QOFA 4BIIA 2XGGA 1NXQA 1UWVA 4HS9A 3P9QA 5FBZA 5LNK1 2IHYA 5B30A 5BPHA 3OLXA 1YAJA 2YWGA 1JR4A 3FOAA 3KS9A 4HI0E 4M0LA 3FWKA 5EJ2A 4W9RA 1AHPA 3IAAA 3TAUA 4JYAB 1F20A 2N75A 3HDVA 1EFPA 1Z7BA 2H3EA 2V7UA 1OLOA 5HUQA 5F4ZA 5HKAA 4BO4A 4Z51A 3CZ5A 3QU9A 3IV9A 4HRVA 1Z18A 1ZM4A 3AR6A 3O6VA 3RSSA 1V11A 1U7PA 3WLSA 3O94A 3USZA 4KN6A 1THTA 3JWEA 1O97D 4D1YA 4EVSA 1E9BA 5A0TA 2ZE6A 2ZWIA 5CPBA 1IQ0A 3VZSA 1Y9JA 4I5DA 4YALA 3EGWA 4JKIA 1A5TA 3KYIB 4HB0A 4PIVA 3MUEA 5GONF 3HXMA 4X7BA 1BDHA 1R6VA 1PR1A 1F6WA 1JLLB 3UENA 4Q3BA 4ZEMA 1H5NA 1G5TA 1XC7A 2FOIA 3L7BA 1DAEA 3BBPA 1VE1A 2QREB 4P33A 4WZZA 2NU6A 5CFQA 3CKYA 3QWBA 3SR4A 1XDDA 3BWXA 3RIGA 2QTBA 3RTEA 1B73A 3GMDA 4H27A 2AMYA 4CCWA 4ER3A 3W5HA 1E2EA 5DWVA 5JD5A 2XB9A 3ZQUA 3HI6A 3TFWA 5AKGA 4ZTUB 1S3IA 1VJ1A 1W44A 1AC5A 1UMDB 4RHTA 4DA8A 1WOYA 4XGNA 2RGNA 4G25A 3TR0A 5LKAA 3TD2A 1Q7GA 3SBDA 1OLSB 4XYBA 4IEEA 3GFGA 1LBQA 5GONA 4YCBA 3M5CA 4P9NA 4ALLA 1MDBA 1ML8A 1YE8A 5CVTA 4V3CA 1E79D 4EJSC 2E55A 4F6RB 4XB6B 3IBGA 1CVIA 2W2LD 2PVSA 4Q1BA 3TZKA 4RZIA 4RVUA 2ALJA 3ZIDA 3IVRA 1QCDA 1UMKA 3ND6A 1RKUA 3LRTA 4WCFA 3EIOA 4K3UA 1IONA 3DPSA 4FQ7A 1XZAA 3DZFA 4RPKA 4MW0A 2I34A 1IEVA 2YFKA 2WJZB 2EVWX 2I91A 4O29A 3OTHA 4ZOBA 3U3XA 3L93A 1M2VB 3ESBA 3I2JA 1L4NA 3R4CA 4RABA 3S81A 5G2OA 1MDFA 3NXSA 1Q19A 4EA9A 2LR0A 1AS3A 3G8AA 3ROZA 3UQYS 2LPMA 4PSUA 1LZKA 2NU6B 4WAUA 2BEJA 1AO3A 1GJRA 3FDXA 2VH2A 2GD1O 4O4HF 1ESCA 4K88A 1BD3A 2IHKA 3DWGA 1VHWA 2GF2A 3AHFA 1NWHA 4MZDA 4ZVLA 1SUIA 3RK4A 1BQEA 3HO8A 2OAEA 3URKA 3SP1A 1H8ED 3KXLA 4BKPA 3ZHUA 1RI5A 2WFLA 2AI2A 4JQYA 4YUWA 2EDAA 2O0KA 5FH9A 1XZMA 2GPYA 5K7SA 3AEQB 3F9RA 4PC3A 4E2XA 1XVAA 5G0UA 3AU8A 4UBKA 4J94A 2ZFUA 3NC0C 2VI5A 1RAAA 4RF5A 3CLKA 4E09A 4O33A 2PKYX 4Q18A 4LPSA 3CX8A 1K27A 3T5GA 1MO5A 1O7JA 1AUXA 1P7PA 4U7DA 3TCNA 1L8AA 1DV2A 3TNYA 4GC5A 4PYMA 3MCTA 3NWEA 2MJLA 4KOEC 2JRCA 2CXHA 2QLBA 2VTEA 3IERA 4EJ2A 4IJ6A 4KUHA 2VHYA 3ROGA 1ZGAA 3FYUB 3NYRA 3B6ZA 4JJZA 3GLUA 2YV4A 2PR7A 4PFQA 2C1ZA 1DAIA 3HYNA 2Q21A 3UMRA 2KW5A 4BLRA 4CDRA 4H4EA 3NKFA 3U3DA 3WKEA 1M1XB 1Q1AA 2XYPA 1EGVB 3C6MA 3QF4A 2CMHA 2WUVA 2C94A 2K87A 4QDZA 1P1KA 4DJTA 1L4KA 4MUJA 1K8ZB 2PE5A 1RC8A 1D4OA 4BVLA 4ZYYA 1JR3E 3VSAA 4LF6B 1TCCA 5EJ5A 2D2VA 2CVZA 2FGKA 2G4VA 7GPBA 3CE9A 1M901 1ZLYA 4BV3A 1H2XA 1NT4A 3PGLA 4RKQA 1Z47A 4DAOA 4DMCA 4HC4A 2YJ6A 4Z4HA 3RAFC 1J0EA 4MUHA 4S1WA 4KPUB 3WHPA 2O0JA 3F67A 3HC7A 7MHTA 1E6EA 4NHOA 3K0SA 2QBYB 3CH4B 1YRQA 4DB2A 5K6TA 3FMPB 4K28A 3BAZA 2VDOB 4EDHA 3S2DI 3VYTB 1V25A 1C4WA 3P9KA 3EMBA 3FNRA 2BL4A 4RIEA 3FHCB 3JQ8B 1F0KA 1GVHA 1NUQA 3O1HB 5B3AA 1XTUA 4LRYA 1P3Y1 1W2HA 4EWCA 1GQYA 1OI7A 4YRQA 5ITSA 3KOXA 3UTCA 2QRMA 1JR2A 4A2PA 3GRFA 1RI4A 2FP4A 2I54A 3H4VA 4ID9A 5TPZD 3UAVA 2WZBA 1KDYA 3THXB 4TQUS 4C0WA 3AVPA 4EL5A 4J0QA 5KYUB 2ID9A 4GLLA 1K3TA 9ATCA 3FN4A 4CTKA 4RHXA 1IPHA 4CU5A 3YASA 2XGSA 3EG5A 3F7TA 3WMGA 2DHEA 3H5LA 2IEDA 2QVGA 2WU0A 5AMXA 2ZU6A 5LJIA 1CUHA 4Z4QA 3CBQA 4ZVSA 2FPUA 3X1KA 3PQ3A 4B74A 1N2XA 2BTEA 2CLEB 4ZQGA 4C2TA 3V55A 3ANNA 1AGNA 2JD2A 3B1FA 2QZPA 4NFYA 2E7ZA 1NVDA 2QRPA 1BGWA 1HYGA 3DXXA 3UG7A 4EKGA 1UK6A 2PCLA 3EVBA 5IC6A 3X0DA 3MXOA 1C9EA 4FCWA 1ZGCA 4FKZA 1BAPA 2JHGA 4IHJB 3RIXA 3SC2B 4IAOA 4YO7A 2G3YA 4QOSA 3SN6A 3SXUA 1TCUA 3PSHA 3S2ZA 1JZSA 3IXQA 4X65B 4POOA 5G1NA 4IGKA 5C9ZA 1DHRA 1LV7A 3PUZA 3MONA 2OBMA 3E05A 4OJKA 4RHEA 3UT6A 2NZ2A 4HWKA 5EGNA 3BE8A 1G6HA 5ARDA 3WWEA 3VUEA 3J81k 3T61A 3LRXA 2J4FA 2BM1A 4W8HA 4CFSA 4JXXA 2QQ5A 5LB2A 2RBLA 1W30A 4HYTA 3WWOA 2PZJA 3R3XA 5KTPA 2BMAA 1J2JA 1Y6QA 1MX3A 4FP9A 3B1XA 4HPXB 1TUGA 2UVQA 1RTKA 4ZARA 3SVLA 4OSEA 1CYDA 4PZYA 4UQOA 4ZXPA 2UZ0A 1S9DA 4NABA 2BP7B 1FJXA 2ZJ0A 1OX4B 4DA4A 1S96A 1FUYB 1QF8A 1WKBA 2FOXA 1UOQA 2Z3ZA 1FBNA 3NONA 3PE6A 4V0SA 1P72A 1P2VA 2QE7A 3W5IA 4H3HB 1JFTA 5LBTA 5KYYA 3MS4A 3QUSA 4BRWA 5DBFA 3WAJA 3P9RA 3AIOA 2W7TA 1W52X 3CH7A 3OHMA 5FL3A 5AW0A 3QYPA 3EE6A 3S4YA 5GZ3A 3ILHA 4LJYA 4NEGA 4R1LA 5JDCC 1CY0A 1I33A 2WM3A 2V7QD 2YXBA 2ZQ5A 3KCNA 4LKRA 2SECE 4B35A 1KH1A 4BMYA 1R0XA 4CT4B 4KR7A 4NZNA 2EEPA 1MPXA 2GZSA 5L3QB 4DMRA 2PUAA 5K05A 1C1HA 1RWWA 5A4MS 3R6GA 2VK2A 4R9RA 3QTTA 1BJTA 2WVJA 5IDQA 3VJRA 1TM1E 1RM5A 4FB4A 1B8PA 4DLBA 5KNCA 5AVUA 3O0DA 4GSKA 4IDGA 4BB0A 1M6YA 3HYTA 3W6NA 3NDIA 2GZMA 3QQ5A 4HP8A 4HRXA 4FOPA 2H6EA 3OOYA 5LZ2A 2POQX 2Y0BA 3NTXA 3AUXA 2GZAA 2XE4A 2UXCB 1NVXQ 2ECQA 3AI3A 1WOMA 4FEEA 4EMSA 1KETA 5CA1B 2FCAA 2HZ7A 4CT0A 1XXHE 1CQPA 1DE0A 1R9JA 2KYRA 5FNVA 5EI5A 2FK8A 3HOUI 2BR5A 4IKPA 3SYTA 1JIQA 2AUMA 4KDRA 5I51A 5IASA 2BVNA 2QMEA 3WIDA 5K2OA 1J2YA 4YJFA 1E96A 1KJIA 3RYHB 4BBZA 3L43A 2ZXUA 3OCUA 2V8OA 2QP4A 4UTZA 5A04A 2PH3A 1LC0A 4OHWA 5E3HA 1TW3A 5F3DA 2WWHA 1V4VA 4LG1A 4QTTB 4KVZA 1TZKA 2B5VA 3TZQA 3PUIA 1C8BA 3NOOA 5DYTA 3JALB 3ZCRA 3H2BA 1KPHA 1TTQB 2I03A 4KODA 1NM5C 2Y0CA 4BV2A 4EWLA 1CJVC 3H83A 2HNBA 1GZVA 2X2OA 4A3EI 3KKQA 3DCNA 4PCAA 1EJ2A 2BMDA 3RC9A 3KYDA 1ONBA 3CIFA 3H2SA 4UM7A 1PDWA 1XIVA 5FWDA 2XE7A 4DVJA 3P9XA 3BXXA 3MJSA 1WSAA 5T3UA 2XDAA 4ZDWA 4B4WA 1RXWA 1ORDA 3OQIA 4YGYA 3VHXB 3VHRA 3VTKA 2JCVA 1L1QA 3ITKA 4G5GA 4MUBA 4UE6A 4Q12A 3U48A 5KYYB 1R10A 2JGLA 3IOEA 4MUMA 4PCLA 1CFZA 4R2KA 2CE7A 2HA0A 2O52A 3ER6A 3O83A 3PZRA 2QX7A 3HR7A 1TCAA 4HYQA 5G4KB 3B3JA 4C1NA 4PYLA 1PJZA 1UZMA 1FQKA 5CFRA 1QNFA 2CFIA 1AA9A 2Q5IA 3PPXA 4AU1A 1T2EA 3T99A 3LXUX 2Q5OA 3RC8A 1T6BY 1KEPA 2CNOA 4P38A 2G5GX 1XZJA 4NYJQ 4PC2A 3VAAA 1OH5A 1YRAA 3SS9X 3EC1A 5JI3E 3NUZA 2Q1UA 2BGIA 4XARA 4J7XA 4F4DA 2VSFA 3GMTA 5LFAA 5IJWA 4RJKA 2OOYB 5FTNA 2ZITA 3KRTA 1DRUA 4CL0A 4WCDA 3KL4A 2DPYA 4IIBA 1FW6A 1VIDA 1SHJA 1D2CA 5B36A 3FSJX 3U61B 1IQPA 2CCGA 4LJSA 4L74A 3DHEA 2B2CA 1U9YA 4D8TA 4YMUA 1YMQA 3QEBZ 2X8JB 3HUUA 2W6PA 4GMDA 4JUCA 4ZT6A 1MIHA 5DISB 2NZWA 4IIJB 4CIDA 3SZLA 4Y9TA 3TGLA 2C8KA 3FVVA 4IUCS 3MELA 3L7IA 4YJ2F 5AVKA 1HDXA 4B76A 4CM9A 4PG6A 2GWHA 3A4IA 4K6CA 3ADPA 4RWEA 3OO1A 3VH4A 5IZ4A 1OE0A 1O94D 1OFIA 2HLDA 3DDCA 2BY4A 1IQRA 1YC5A 1KP2A 4MSUA 4N8EA 2NXWA 2VAWA 4MONA 2Z5VA 1SBNE 2NYVA 3QFTA 1GQ2A 2XLCA 3ZV4A 6NULA 3DVLA 1R5OA 3A4LA 3U39A 3H84A 2XSZD 4QVKA 2LEXA 2HJHA 3CLSD 4Q6BA 1X2EA 5ARCA 1R1DA 1KK2A 1S9HA 5JRJA 3GQVA 3AZQA 3MYYA 2NZJA 5A5FA 3TL3A 4FGUA 3KLBA 3LC7O 4HTFB 4WOPA 5CNIA 1EZ1A 2JDIA 1NVBA 3M6WA 5EIBC 1Z33A 3LPMA 1WCXA 2BRUC 3NIWA 2ZB4A 3R6WA 3AXTA 2I76A 2WUEA 5LLDA 1SCBA 2VSXA 4Y2SA 5EESA 2QSUA 5IYZF 1XG5A 3FZYA 1K63A 4TTAA 3UTDA 4BO2A 3OP1A 3BFKA 1GSIA 1OV4A 3II6X 4XUDA 2RGEA 2NUTB 4CG3A 3WGJA 1T26A 4BQQA 1WZEA 2ICAA 4Z4CA 3KT3A 4JLAA 3EPJA 1QGYA 2UUAB 1RT9A 3JS5A 2VYVD 3HB9A 3O92A 2YS6A 4OSPA 1W5FA 4KTTE 1RAIA 5AIBA 1KMQA 3ZNOA 4U7PB 4XGRA 4A93I 2A92A 3IBFA 4E1VA 1H4QA 2Q27A 3PNQA 1KKLA 1NXPA 3BWCA 1XA0A 1LZLA 1WLYA 1XQ6A 1BROA 3R7FA 4EELA 1X74A 3QV2A 3ZCVA 3B7WA 4UM5A 4COKA 4HWOA 3FPEA 2AKEA 1UFOA 1U3UA 2BFPA 4NB9A 2BF4A 1IOLA 1D4FA 5IUJC 1B1CA 1CR1A 1OA0A 1TAQA 3GT4A 4TT8A 4Q7QA 5AW1A 2P30A 2VYCA 4JROA 5SYAA 2PU7A 3V4OA 3LA8A 5JFOA 3VVCA 1O94A 1QWOA 2YCBA 4JL5A 1HE3A 2ZROA 3A1VA 4P4GA 5DOVA 5FJIA 4GYWA 1FTGA 2HYIC 4DT1B 1KYIA 4A03A 3PF8A 3CLUC 4Z4IA 1Y8QB 5HMLA 3ESXA 3SXJA 1AKTA 2OOXB 1USWA 2ZVPX 3EXG2 3QV1A 4HNQA 4XVRA 3LDHA 1QKKA 2XA1A 3E9CA 5TF0A 4UFPA 3H04A 1DO2A 1YZGA 3WZLA 3QM1A 3QPBA 3Q6MA 1I3MA 1KDOA 4WKNA 1OZGA 3G5MA 4I8XA 1WBJB 3ENVA 4L07A 4MD8A 4UMEA 1UKVY 3TQOA 3OPVA 1W0CA 2R7ZI 1HYQA 4GL4A 5SZIA 3W4JA 3FOZA 3MT8A 1ISFA 1NHWA 3CKKA 4YIKA 2DLCX 1NVVR 4FK8A 4KFUA 2VT6A 1C1DB 1T1SA 3UWSA 5HIKA 3RADC 5BQ5A 2UYOA 3BIFA 4X6AI 3BPSA 3Q7RA 1K0FA 1J56A 1NYTA 4IDNA 4TN5A 5AJUA 5TVGA 3SM3A 1P2FA 2YUTA 4MTLA 1RYFA 4EFDA 3CJQA 3HY3A 4XX0B 2HU2A 1E20A 1ZONA 3D8UA 3E1GA 3K0HA 3PHGA 4UAVA 3HFRA 4YP5A 3LFUA 4JENA 4ZEWA 3IQDB 4A73A 1W5TA 2XITA 3IAXA 4RCZA 5A5GA 1D2HA 2JLYA 1M2OB 2ODEA 3GFOA 4XA8A 2QM8A 1G20E 3EGCA 1WR8A 4GP6A 3E3NA 4BUZA 4ZK2A 3GLFA 1WBBA 3UMBA 1THGA 1ZH0A 1YZYA 4CNBA 3KB2A 1JALA 4JQSA 1LQLA 4REQA 1QGED 3DR3A 3TL2A 5DNCA 3IMKA 3SF8B 1CQIB 1E9SA 2Q45A 3VC2A 2AFHB 1EEHA 3HNPA 3RYHA 4FR0A 1A77A 3KJZA 4BAGA 5FR1A 3UK1A 4GD3Q 4ZAWA 3ZXXA 4BX3A 4DIUA 2FR1A 3BAFA 5FBRB 4K6OA 1M2HA 4DADA 3MLAA 1GN8A 5KS2A 1K4KA 1MQ8B 3KOZA 3OEED 4XTCS 1FSGA 1IQUA 3EIQA 5C3UA 1PJBA 1IUKA 1H4VB 2BT4A 2QG6A 4LNHA 2OZVA 4NNJA 1O0CA 2R0QC 4AX8A 4R8RA 3RJ5A 2QTCA 1IN1A 4XLZA 4W99A 3I6MA 1GNTA 4FT4A 2H52A 3PNPA 1XYYA 2QVBA 3CZPA 5SICE 3TXYA 4MAAA 4BAUA 1HKUA 1E0AA 3JQ7A 1IJKA 3ZH2A 1LA2A 4V1CI 5JZMA 5CCBA 4TL6A 4YFVA 2ZCUA 3IV6A 4YMLA 2BDUA 2JFYA 1CVRA 2GXAA 3L3BA 2WIFA 1QOZA 4FDLA 4HBZA 4OHMA 1Q862 3HJUA 1ZH6A 1XZNA 5IULC 2XQIA 3D7RA 4D25A 3PS9A 3D8HA 4QASA 2E49A 2GASA 4R2XA 2Y66A 4M86A 1YR8A 4CTNA 4CM6A 5H80A 4BBSI 3CNOA 4BO8A 4DA9A 1L5HB 5EG5A 3RNLA 2WSYB 1BXRB 2OY0A 5BN3A 1RZRD 1FFWA 5EZ6B 2WJHA 5LMNB 2V4ZA 4Q48A 1VYTA 4PS1A 2JW5A 2C0QA 3N7UA 4L5IA 4XLLA 3MINB 5KNBD 3G0HA 1QH0A 3L18A 1X86B 2BFWA 1BU5A 3N5KA 2F8TA 3AOGA 2X14A 5A4FS 2AXNA 1WZCA 1ESNA 5CNKA 2B20A 3OQ6A 1C9YA 4PNZA 9GPBA 4R1UA 2VWGA 4O2BB 1P6XA 4EMUA 2P1DA 3KELA 4ARZA 4MRRA 3P9ZA 4AN0A 2GXSA 3HK2A 3MXTA 3CQZI 1AQUA 1DJPA 1K8YB 2FQXA 2I62A 3M5WA 3RZOI 4A0GA 2BISA 2IPMA 2CY0A 2H2GA 3CLTD 4QUKA 5DHUA 3SC6A 4CL8A 4D2IA 4QBGB 4DIKA 2RGRA 1EWKA 5BOSA 2H5LA 3EFHA 1QX4A 4EX7A 3MQFA 1JEOA 5IJZA 1K68A 2JKVA 1U3TA 2FLWA 4XCVA 5F77A 4FZVA 3UYLA 5AM2A 4RANA 4DNOA 3CTMA 4PCUA 1MN6A 2FJPA 1DTSA 1Q83A 2JRLA 4IF4A 5CBPB 3K0AB 3RUHA 4JLUA 1S2OA 4L0CA 4BCBA 2C1XA 4IH9A 4PZPA 3TSOA 2IWRA 5I4IA 1BHJA 3ECCA 3H05A 1O6CA 3JD1A 4MMYB 5D7BA 3PTZA 1B6RA 1GCUA 4RKWA 4ZYZA 1YJQA 3DUWA 5JNLA 2VSOA 5I7OA 2B35A 2QW8A 5F12A 3WYCA 2F64A 1PP4A 2JVIA 4F85A 4YDHB 2B82A 4N01A 3OFVA 4O5AA 3FF1A 1YDWA 1UKEA 2GPNA 4D97A 1S72Z 3WQQA 4BGVA 1UADA 2PK3A 3D4OA 3G7UA 1NOJA 1Q7CA 2D1YA 3PCTA 3VTAA 4DNFA 4KNWA 4B6OA 1MA0A 1I32A 2VP9A 4H35A 3FBGA 4IQGA 5ERYA 2P67A 2QTGA 5TS3A 1YACA 2FR0A 4GFDA 1F06A 3RF7A 4B7AA 3NOXA 5EY5B 3PFGA 4D4HA 4ZAYA 3ROEA 4MITA 4BVFA 2ZSBA 3CXCY 1XLTA 3BJZA 3C85A 2NU9A 2KBFA 3ASVA 5I4CA 1MB9A 3F96A 2YUIA 3FTNA 4MLPA 2VWPA 2Y93A 1D7AA 2D3WA 1PF7E 4LJLA 5IKOA 1ZNYA 1SU7A 3TBKA 4BE4A 2VSYA 2ZSJA 3JQRA 1BXGA 4BFTA 4BC0A 3SFTA 5KQRA 4P36A 1YZLA 1MOZA 3G0GA 4A8JB 1S02A 4KX3A 1FTYA 4LZOA 3OW2Z 4ML3A 1RVDA 4D6YA 2C9BA 4XJTA 5DM4A 1XJWA 5L45A 4J1TC 2F4MA 1BJKA 1UPXA 4D80A 5T5QA 3T3PB 3IQHX 3TZEA 4E5DA 5JY6A 3DFMA 3OHPA 4GGPA 1E0KA 1PJAA 1U1EA 1IOWA 4KK4A 3B82A 4LXHA 1P3DA 1QK3A 3GXBA 3DDOA 2H4JA 5J58A 2DAPA 3TKYA 4PLTA 1G8SA 1BWQA 4ZO4A 5IRCD 2PAAA 1BXRA 2BHNA 3N75A 3FPBA 4N5IX 4CIAA 3IL2A 2ZSEA 4MLZA 2REQA 2VF5X 4WADA 3CXUA 1R6TA 1PUJA 4HJXA 4YN3A 3DTVD 3ZHXA 4BNKA 2OFWA 3GRCA 4YP6A 2XHEA 1SVU