2LEXA

Complex of the c-terminal wrky domain of atwrky4 and a w-box dna
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
b'LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable WRKY transcription factor 4
publication title Structural basis for sequence-spscific DNA recognition by an Arabidopsis WRKY transcription factor
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2lexA00
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH superfamily
2E2HI 3GTPI 2V8KA 3G6EZ 4MD7A 4QTUA 1VQOZ 2GTIA 2PMZA 3NH5A 2E9HA 3CCLZ 3D2LA 1YUAA 2JA8I 3CPWY 1VQ61 2RHBA 2VF1A 3KIHA 3QWUA 1VQN1 1YJWZ 4A3BI 3I4NI 1VLAA 3I55Z 3S1RI 1Y1VI 3I56Z 4NBCA 1SIWA 3G71Z 3PO3S 3CCE1 5FLXf 3CMEZ 3NH8A 1Z03A 4NOZA 3CD6Z 5FLMI 2OOXB 1Q861 4E2XA 1K9M1 2B63I 4A93I 1RLYA 1QF8A 2VUMI 2NVQI 4BY1I 1Z02A 1VQLZ 1S7MA 3T4NB 4NBGA 2QLVB 4A3DI 1USPB 3HOYI 1VQ41 4BBRI 2IV2X 3CCMZ 3GTGI 1QVGY 1Q812 3EEDA 4DQYB 5C44I 3CXCY 1P9NA 2W03A 4Y7NI 1VQKZ 1Q16A 3S2HI 5IP9I 4DK1A 3CC7Z 2R6MA 3G4S1 1I50I 1I3QI 3IFUA 2PM9A 2P3YA 4RS4A 4E33A 2F4MA 2JNYA 3F3PC 3GTMI 2E7ZA 2O4HA 5C4XI 4E32A 5T67A 1YHQ1 4A3FI 4E2YA 3VB9A 1VQ5Z 1NUIA 1YUKA 3I4MI 4QTTA 3P5JB 1TWAI 1VQ81 3RZOI 3CCR1 2JUBA 5C3EI 1YIJ1 2JS4A 2J6AA 1TWHI 3NFZA 3M4OI 2IZ3A 1YJNZ 1TFIA 4A3JI 3IX0A 2VPYA 5A2Qb 1RO0A 4Y52I 1ZB9A 3VTNA 5C4JI 2QKDA 1NJI1 3S16I 3JAMb 3S15I 1WCMI 3CC21 1RNIA 1VQ71 2R93I 3CQZI 2BJOA 2QA41 1N2FA 1WW9A 2Y0SA 3J81f 2OTJZ 4HGYA 1QVFY 2DE7A 2QRDB 1RO2A 2RIQA 3ESWA 2V3VA 4EWCA 3CCV1 4S1TA 1YI21 5LL6f 3CMA1 3S17I 4MONA 1Y1VS 1NP6A 2QEX1 2VPZA 1QXFA 1YHQZ 1JJ2Z 2RT9A 2F4OA 2WB1A 1LQLA 2M48A 5IT9f 4E30A 4MXUA 3CCS1 4CL1A 3CCRZ 1TWGI 2K3RA 2W04A 2QREB 1X3ZA 1VQMZ 2YU9I 3CCJ1 3GTQI 3OW2Y 3MZLB 3CCQZ 5FLXb 1S72Z 3GTJI 1YITZ 2VUGA 4AYBA 2OTLZ 2M6NA 1VQ7Z 4X6AI 2JIOA 4HGZA 3RZDI 1K8A1 1W2BZ 3GKQA 1Z01A 3IF8A 1R9TI 1TWCI 1VQP1 1VQ6Z 2P28A 2HU9A 2WAQA 5T64A 4A3MI 1USPA 3CCVZ 1WJ2A 1YJ91 1Q862 2V45A 1K9M2 3NH4A 1VQNZ 1KQSZ 3VMGA 4XX2A 4NH1C 2NAPA 4NFRA 3GTMS 2JA6I 1N8R1 3CCSZ 3S2DI 3HOXI 3CCEZ 1M901 4A3GI 2VPWA 1K731 1K83I 3G6E1 4MH4A 3J80f 4NBAA 1VQO1 5D1OB 3U50C 4NB9A 3CCL1 3F3FC 2QR1B 1Q7Y1 1RO4A 2NVTI 1Q821 2E2II 2R92I 1M1K1 1VQ4Z 1YJW1 3MONA 3CPWZ 2Q51A 4NB8A 2GU2A 3HOUI 2I3CA 3D6WA 3HKZA 4RVGA 1QYPA 2JMOA 4RVDA 3I561 2RPRA 3CC41 1WIIA 4A3II 3GTLI 2AYDA 1KD12 3LUSA 3H3VJ 1KC82 5AN9F 3CME1 1SFOI 1YJ9Z 2LIYA 3G4SZ 3CD61 2H85A 1X3WA 2KI7B 2E2JI 1Y1WI 2JIPA 4DGLA 1ZB8A 2LFUA 2VPXA 4NBFA 4E2ZA 2YADA 5T6BA 3J81b 3S1NI 3GCFA 1VQ91 4A3LI 3S14I 3CCM1 1NJI2 2GTHA 1VQ8Z 3FQMA 1YIJZ 1VQK1 3HOWI 3VMIA 3FQQA 1QVGZ 5IT9b 2R7ZI 2DE6A 3CC71 4NBEA 3CCU1 4E31A 3CXCZ 2QRCB 4A3KI 2IZ4A 2ZAEB 3NDJA 3K7AI 2AKLA 2Q4ZA 2DE5A 2RBLA 4BBSI 3KIFA 4MD9A 3D9XA 1Q811 3CC4Z 3CC2Z 2V8IA 2JA5I 2QA4Z 3J7A4 3PO3I 5CM2M 3BG0B 1PFTA 4NBBA 2JR6A 1VQ51 3EERA 1JJ2Y 2HF1A 1YI2Z 3CMAZ 3S1QI 1TWFI 1YJN1 1VQ9Z 4RVFA 2QEXZ 3TE5B 2JIMA 2O53A 3GTOI 4HH4A 1X0TA 3S1MI 2LEXA 1I6HI 2K5RA 3Q87A 2JIRA 3M3YI 1K8A2 2JA7I 3CCJZ 2KPIA 2NVYI 3CCUZ 4NBHA 2OTJ1 2NVXI 1WZNA 1RQFA 2V8JA 1W2BY 5IP7I 4MRIA 3MZKB 3VMHA 4A3CI 3NDIA 1FDIA 3J80b 4A3EI 1Y8CA 2PK7A 1KRLA 1QVFZ 3H0GI 3HOVI 3GTKI 3TDHB 4E2WA 5D1OA 3FKII 1KD11 4BXXI 1KC81 1N8R2 4TNUA 3I551 2G2KA 2EGTA 4RVHA 2OOYB 1VQPZ 1M902 1KQSY 5A2Qf 2OZKA 3G711 1K732 1FDOA 3BG1B 3HOZI 3PO2I 1VQM1 3JAMf 2JIQA 4NBDA 1JWHC 4BY7I 4MD8A 1AA6A 3CCQ1 4RV9A 1Q7Y2 3I07A 1ML8A 1L1OC 1S721 1DL6A 1YIT1 1ZH1A 3IR7A 1Q822 3OW2Z 1M1K2 2OTL1 1VQL1 5D1PA
chains in the Genus database with same CATH topology
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYD A;  1WJ2 A;  2LEX A; 
#chains in the Genus database with same CATH topology
 2E2H I;  3GTP I;  2V8K A;  3G6E Z;  4MD7 A;  4QTU A;  1VQO Z;  2GTI A;  2PMZ A;  3NH5 A;  2E9H A;  3CCL Z;  3D2L A;  1YUA A;  2JA8 I;  3CPW Y;  1VQ6 1;  2RHB A;  2VF1 A;  3KIH A;  3QWU A;  1VQN 1;  1YJW Z;  4A3B I;  3I4N I;  1VLA A;  3I55 Z;  3S1R I;  1Y1V I;  3I56 Z;  4NBC A;  1SIW A;  3G71 Z;  3PO3 S;  3CCE 1;  5FLX f;  3CME Z;  3NH8 A;  1Z03 A;  4NOZ A;  3CD6 Z;  5FLM I;  2OOX B;  1Q86 1;  4E2X A;  1K9M 1;  2B63 I;  4A93 I;  1RLY A;  1QF8 A;  2VUM I;  2NVQ I;  4BY1 I;  1Z02 A;  1VQL Z;  1S7M A;  3T4N B;  4NBG A;  2QLV B;  4A3D I;  1USP B;  3HOY I;  1VQ4 1;  4BBR I;  2IV2 X;  3CCM Z;  3GTG I;  1QVG Y;  1Q81 2;  3EED A;  4DQY B;  5C44 I;  3CXC Y;  1P9N A;  2W03 A;  4Y7N I;  1VQK Z;  1Q16 A;  3S2H I;  5IP9 I;  4DK1 A;  3CC7 Z;  2R6M A;  3G4S 1;  1I50 I;  1I3Q I;  3IFU A;  2PM9 A;  2P3Y A;  4RS4 A;  4E33 A;  2F4M A;  2JNY A;  3F3P C;  3GTM I;  2E7Z A;  2O4H A;  5C4X I;  4E32 A;  5T67 A;  1YHQ 1;  4A3F I;  4E2Y A;  3VB9 A;  1VQ5 Z;  1NUI A;  1YUK A;  3I4M I;  4QTT A;  3P5J B;  1TWA I;  1VQ8 1;  3RZO I;  3CCR 1;  2JUB A;  5C3E I;  1YIJ 1;  2JS4 A;  2J6A A;  1TWH I;  3NFZ A;  3M4O I;  2IZ3 A;  1YJN Z;  1TFI A;  4A3J I;  3IX0 A;  2VPY A;  5A2Q b;  1RO0 A;  4Y52 I;  1ZB9 A;  3VTN A;  5C4J I;  2QKD A;  1NJI 1;  3S16 I;  3JAM b;  3S15 I;  1WCM I;  3CC2 1;  1RNI A;  1VQ7 1;  2R93 I;  3CQZ I;  2BJO A;  2QA4 1;  1N2F A;  1WW9 A;  2Y0S A;  3J81 f;  2OTJ Z;  4HGY A;  1QVF Y;  2DE7 A;  2QRD B;  1RO2 A;  2RIQ A;  3ESW A;  2V3V A;  4EWC A;  3CCV 1;  4S1T A;  1YI2 1;  5LL6 f;  3CMA 1;  3S17 I;  4MON A;  1Y1V S;  1NP6 A;  2QEX 1;  2VPZ A;  1QXF A;  1YHQ Z;  1JJ2 Z;  2RT9 A;  2F4O A;  2WB1 A;  1LQL A;  2M48 A;  5IT9 f;  4E30 A;  4MXU A;  3CCS 1;  4CL1 A;  3CCR Z;  1TWG I;  2K3R A;  2W04 A;  2QRE B;  1X3Z A;  1VQM Z;  2YU9 I;  3CCJ 1;  3GTQ I;  3OW2 Y;  3MZL B;  3CCQ Z;  5FLX b;  1S72 Z;  3GTJ I;  1YIT Z;  2VUG A;  4AYB A;  2OTL Z;  2M6N A;  1VQ7 Z;  4X6A I;  2JIO A;  4HGZ A;  3RZD I;  1K8A 1;  1W2B Z;  3GKQ A;  1Z01 A;  3IF8 A;  1R9T I;  1TWC I;  1VQP 1;  1VQ6 Z;  2P28 A;  2HU9 A;  2WAQ A;  5T64 A;  4A3M I;  1USP A;  3CCV Z;  1WJ2 A;  1YJ9 1;  1Q86 2;  2V45 A;  1K9M 2;  3NH4 A;  1VQN Z;  1KQS Z;  3VMG A;  4XX2 A;  4NH1 C;  2NAP A;  4NFR A;  3GTM S;  2JA6 I;  1N8R 1;  3CCS Z;  3S2D I;  3HOX I;  3CCE Z;  1M90 1;  4A3G I;  2VPW A;  1K73 1;  1K83 I;  3G6E 1;  4MH4 A;  3J80 f;  4NBA A;  1VQO 1;  5D1O B;  3U50 C;  4NB9 A;  3CCL 1;  3F3F C;  2QR1 B;  1Q7Y 1;  1RO4 A;  2NVT I;  1Q82 1;  2E2I I;  2R92 I;  1M1K 1;  1VQ4 Z;  1YJW 1;  3MON A;  3CPW Z;  2Q51 A;  4NB8 A;  2GU2 A;  3HOU I;  2I3C A;  3D6W A;  3HKZ A;  4RVG A;  1QYP A;  2JMO A;  4RVD A;  3I56 1;  2RPR A;  3CC4 1;  1WII A;  4A3I I;  3GTL I;  2AYD A;  1KD1 2;  3LUS A;  3H3V J;  1KC8 2;  5AN9 F;  3CME 1;  1SFO I;  1YJ9 Z;  2LIY A;  3G4S Z;  3CD6 1;  2H85 A;  1X3W A;  2KI7 B;  2E2J I;  1Y1W I;  2JIP A;  4DGL A;  1ZB8 A;  2LFU A;  2VPX A;  4NBF A;  4E2Z A;  2YAD A;  5T6B A;  3J81 b;  3S1N I;  3GCF A;  1VQ9 1;  4A3L I;  3S14 I;  3CCM 1;  1NJI 2;  2GTH A;  1VQ8 Z;  3FQM A;  1YIJ Z;  1VQK 1;  3HOW I;  3VMI A;  3FQQ A;  1QVG Z;  5IT9 b;  2R7Z I;  2DE6 A;  3CC7 1;  4NBE A;  3CCU 1;  4E31 A;  3CXC Z;  2QRC B;  4A3K I;  2IZ4 A;  2ZAE B;  3NDJ A;  3K7A I;  2AKL A;  2Q4Z A;  2DE5 A;  2RBL A;  4BBS I;  3KIF A;  4MD9 A;  3D9X A;  1Q81 1;  3CC4 Z;  3CC2 Z;  2V8I A;  2JA5 I;  2QA4 Z;  3J7A 4;  3PO3 I;  5CM2 M;  3BG0 B;  1PFT A;  4NBB A;  2JR6 A;  1VQ5 1;  3EER A;  1JJ2 Y;  2HF1 A;  1YI2 Z;  3CMA Z;  3S1Q I;  1TWF I;  1YJN 1;  1VQ9 Z;  4RVF A;  2QEX Z;  3TE5 B;  2JIM A;  2O53 A;  3GTO I;  4HH4 A;  1X0T A;  3S1M I;  2LEX A;  1I6H I;  2K5R A;  3Q87 A;  2JIR A;  3M3Y I;  1K8A 2;  2JA7 I;  3CCJ Z;  2KPI A;  2NVY I;  3CCU Z;  4NBH A;  2OTJ 1;  2NVX I;  1WZN A;  1RQF A;  2V8J A;  1W2B Y;  5IP7 I;  4MRI A;  3MZK B;  3VMH A;  4A3C I;  3NDI A;  1FDI A;  3J80 b;  4A3E I;  1Y8C A;  2PK7 A;  1KRL A;  1QVF Z;  3H0G I;  3HOV I;  3GTK I;  3TDH B;  4E2W A;  5D1O A;  3FKI I;  1KD1 1;  4BXX I;  1KC8 1;  1N8R 2;  4TNU A;  3I55 1;  2G2K A;  2EGT A;  4RVH A;  2OOY B;  1VQP Z;  1M90 2;  1KQS Y;  5A2Q f;  2OZK A;  3G71 1;  1K73 2;  1FDO A;  3BG1 B;  3HOZ I;  3PO2 I;  1VQM 1;  3JAM f;  2JIQ A;  4NBD A;  1JWH C;  4BY7 I;  4MD8 A;  1AA6 A;  3CCQ 1;  4RV9 A;  1Q7Y 2;  3I07 A;  1ML8 A;  1L1O C;  1S72 1;  1DL6 A;  1YIT 1;  1ZH1 A;  3IR7 A;  1Q82 2;  3OW2 Z;  1M1K 2;  2OTL 1;  1VQL 1;  5D1P A; 
#chains in the Genus database with same CATH homology
 2AYD A;  1WJ2 A;  2LEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...