2LEXA

Complex of the c-terminal wrky domain of atwrky4 and a w-box dna
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Probable WRKY transcription factor 4
publication title Structural basis for sequence-spscific DNA recognition by an Arabidopsis WRKY transcription factor
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2lexA00
2LEXA 2AYDA 1WJ2A
chains in the Genus database with same CATH superfamily
3T4NB 2VUGA 3CCMZ 1K9M2 1M1K1 3GTPI 1I50I 1RO2A 2VUMI 3RZDI 4MD8A 4BXXI 1VQNZ 3NH5A 1VQOZ 2JIOA 3G4SZ 1VQ7Z 3I561 3HKZA 3PO3S 2P3YA 3CPWZ 3KIFA 1VQ9Z 3EEDA 1NP6A 2JMOA 1VQ41 3HOVI 1QF8A 4HGYA 3HOXI 1WCMI 2O53A 3CCR1 4S1TA 5FLXf 2OTJ1 2HF1A 2HU9A 3S14I 3G71Z 5D1OB 1VQP1 3MZLB 4AYBA 2YADA 3VB9A 1WJ2A 1KRLA 2JA8I 1QVFY 2QR1B 1YJNZ 3GTOI 4A3MI 3HOZI 2J6AA 1Q861 2QEX1 3HOYI 1VQM1 1N8R2 2OTL1 4QTTA 3JAMf 3CQZI 1X3ZA 1KD11 1YHQ1 1M901 4NBCA 4A3JI 3S15I 1YIJ1 1Q821 4NBAA 3I56Z 3G6EZ 3IF8A 3ESWA 2JR6A 1VQ5Z 1VQ4Z 3CCRZ 4BY7I 3CCL1 1Y8CA 1YJ91 2OTJZ 4RVGA 4A3KI 1NUIA 3IX0A 3S1NI 1KC82 4DK1A 2JUBA 3CC41 1ZB9A 1S721 2E7ZA 1TWHI 2W03A 3FQQA 3CCM1 3CMEZ 3J80b 4MONA 1LQLA 1YJWZ 5IP7I 4HGZA 5AN9F 1YHQZ 3OW2Z 1Y1VI 1VLAA 1YIJZ 1VQ91 4E32A 1W2BY 2OOYB 1RNIA 1K8A2 3GTLI 3CCE1 3CMA1 2I3CA 3RZOI 3FQMA 3CCLZ 3NDIA 3S1MI 2QRCB 3S17I 3F3FC 2B63I 3S16I 2GTHA 3GTGI 2VPZA 1Z01A 3NDJA 3CC4Z 3I4NI 1S72Z 5T6BA 2YU9I 1X3WA 2NVQI 2K3RA 3MZKB 2M48A 3I4MI 3HOWI 1QXFA 2V8JA 1NJI1 2QRDB 3G6E1 5D1OA 5A2Qf 2H85A 1VQK1 2QA41 1VQ51 1QVGZ 3GCFA 4EWCA 2VF1A 2K5RA 3CCEZ 3CMAZ 4BBRI 2P28A 1M1K2 3NH8A 4E2ZA 2JA5I 5C4XI 3CXCZ 2R92I 1Q7Y1 1KQSY 1DL6A 1K83I 3M4OI 1L1OC 5CM2M 4RV9A 2W04A 3CME1 4XX2A 4RVDA 4NB8A 1YJW1 2NVYI 3D9XA 4Y52I 1ZB8A 3TE5B 4NBHA 1VQ61 5IP9I 4NBDA 1Y1VS 2KI7B 2E2JI 2O4HA 1VQKZ 2DE6A 2QA4Z 2JNYA 3NFZA 3VMIA 3GTJI 1Q862 1VQL1 3I551 2V45A 4TNUA 1KD12 1P9NA 2DE5A 1M902 1TWFI 3TDHB 1Q822 3S2DI 5FLMI 3MONA 1AA6A 3CPWY 2RIQA 1RO4A 2OOXB 1WW9A 5C44I 2R6MA 2GU2A 1PFTA 2RBLA 1Q811 1I6HI 2JIRA 4A3FI 1Q16A 1YI21 1ML8A 3CCS1 5T67A 5FLXb 4CL1A 1VQ6Z 2JA6I 4A3LI 1USPA 4A3EI 2PM9A 1JWHC 3CC2Z 2ZAEB 1SIWA 4NB9A 1RLYA 2BJOA 3GTMI 1WZNA 5T64A 2G2KA 3HOUI 1VQLZ 1K731 3NH4A 3IFUA 4QTUA 4E2XA 3I55Z 2V8IA 2JIMA 2E2II 2RHBA 3I07A 2QREB 2NAPA 2WB1A 3JAMb 2PMZA 2JIQA 1QVFZ 4A3BI 4MXUA 1FDOA 1JJ2Y 4MH4A 1K9M1 4NOZA 2VPWA 2RT9A 1YI2Z 4MD7A 4NFRA 2V8KA 3QWUA 3CCJ1 2Q4ZA 1VQ81 3CCU1 3CCSZ 1I3QI 1RQFA 4BY1I 2GTIA 1N2FA 3P5JB 4E2WA 3U50C 3LUSA 5D1PA 5C3EI 2F4OA 3H0GI 2QKDA 3D6WA 1RO0A 4NBBA 3OW2Y 2AKLA 4MRIA 1NJI2 3FKII 3J81b 2E9HA 3F3PC 3J80f 3KIHA 4A3II 1TWAI 2V3VA 2KPIA 2QLVB 4NH1C 5C4JI 3H3VJ 2PK7A 1N8R1 1R9TI 1YUKA 2DE7A 4NBEA 2M6NA 5IT9b 3CCJZ 3EERA 1VQ8Z 1Q7Y2 3CCUZ 3GTKI 3GTQI 3CCV1 1W2BZ 1YIT1 3J7A4 3BG1B 4DQYB 3CC21 4X6AI 1ZH1A 2VPYA 3S1QI 2AYDA 4E2YA 4NBGA 2VPXA 4A3CI 2E2HI 2JIPA 4RVHA 1Z02A 2IZ4A 2LEXA 4E33A 3CD61 3GTMS 3IR7A 2R93I 2NVTI 3PO3I 1KC81 4A3GI 1S7MA 4RS4A 4BBSI 3CCQ1 1FDIA 2EGTA 1QVGY 1YUAA 1JJ2Z 4A93I 5A2Qb 3CXCY 1VQPZ 4NBFA 3CC71 3GKQA 4DGLA 3S1RI 4A3DI 2JA7I 2R7ZI 4E30A 3CCVZ 1YITZ 1K8A1 3VMHA 1WIIA 2IV2X 1Q812 2QEXZ 1VQMZ 1TWCI 2Q51A 3J81f 3CD6Z 2OTLZ 1VQN1 1VQO1 1Z03A 2LFUA 3G4S1 2NVXI 1VQ71 4MD9A 1KQSZ 1TWGI 2Y0SA 3S2HI 1Y1WI 2LIYA 1X0TA 3CCQZ 3K7AI 3Q87A 2OZKA 4HH4A 2JS4A 5IT9f 1SFOI 3BG0B 3VMGA 3G711 1USPB 1YJ9Z 1K732 4Y7NI 3PO2I 3D2LA 2WAQA 2RPRA 3VTNA 3M3YI 4RVFA 1TFIA 4E31A 3CC7Z 5LL6f 1YJN1 1QYPA 2F4MA 2IZ3A
chains in the Genus database with same CATH topology
2LEXA 2AYDA 1WJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEX A;  2AYD A;  1WJ2 A; 
#chains in the Genus database with same CATH topology
 3T4N B;  2VUG A;  3CCM Z;  1K9M 2;  1M1K 1;  3GTP I;  1I50 I;  1RO2 A;  2VUM I;  3RZD I;  4MD8 A;  4BXX I;  1VQN Z;  3NH5 A;  1VQO Z;  2JIO A;  3G4S Z;  1VQ7 Z;  3I56 1;  3HKZ A;  3PO3 S;  2P3Y A;  3CPW Z;  3KIF A;  1VQ9 Z;  3EED A;  1NP6 A;  2JMO A;  1VQ4 1;  3HOV I;  1QF8 A;  4HGY A;  3HOX I;  1WCM I;  2O53 A;  3CCR 1;  4S1T A;  5FLX f;  2OTJ 1;  2HF1 A;  2HU9 A;  3S14 I;  3G71 Z;  5D1O B;  1VQP 1;  3MZL B;  4AYB A;  2YAD A;  3VB9 A;  1WJ2 A;  1KRL A;  2JA8 I;  1QVF Y;  2QR1 B;  1YJN Z;  3GTO I;  4A3M I;  3HOZ I;  2J6A A;  1Q86 1;  2QEX 1;  3HOY I;  1VQM 1;  1N8R 2;  2OTL 1;  4QTT A;  3JAM f;  3CQZ I;  1X3Z A;  1KD1 1;  1YHQ 1;  1M90 1;  4NBC A;  4A3J I;  3S15 I;  1YIJ 1;  1Q82 1;  4NBA A;  3I56 Z;  3G6E Z;  3IF8 A;  3ESW A;  2JR6 A;  1VQ5 Z;  1VQ4 Z;  3CCR Z;  4BY7 I;  3CCL 1;  1Y8C A;  1YJ9 1;  2OTJ Z;  4RVG A;  4A3K I;  1NUI A;  3IX0 A;  3S1N I;  1KC8 2;  4DK1 A;  2JUB A;  3CC4 1;  1ZB9 A;  1S72 1;  2E7Z A;  1TWH I;  2W03 A;  3FQQ A;  3CCM 1;  3CME Z;  3J80 b;  4MON A;  1LQL A;  1YJW Z;  5IP7 I;  4HGZ A;  5AN9 F;  1YHQ Z;  3OW2 Z;  1Y1V I;  1VLA A;  1YIJ Z;  1VQ9 1;  4E32 A;  1W2B Y;  2OOY B;  1RNI A;  1K8A 2;  3GTL I;  3CCE 1;  3CMA 1;  2I3C A;  3RZO I;  3FQM A;  3CCL Z;  3NDI A;  3S1M I;  2QRC B;  3S17 I;  3F3F C;  2B63 I;  3S16 I;  2GTH A;  3GTG I;  2VPZ A;  1Z01 A;  3NDJ A;  3CC4 Z;  3I4N I;  1S72 Z;  5T6B A;  2YU9 I;  1X3W A;  2NVQ I;  2K3R A;  3MZK B;  2M48 A;  3I4M I;  3HOW I;  1QXF A;  2V8J A;  1NJI 1;  2QRD B;  3G6E 1;  5D1O A;  5A2Q f;  2H85 A;  1VQK 1;  2QA4 1;  1VQ5 1;  1QVG Z;  3GCF A;  4EWC A;  2VF1 A;  2K5R A;  3CCE Z;  3CMA Z;  4BBR I;  2P28 A;  1M1K 2;  3NH8 A;  4E2Z A;  2JA5 I;  5C4X I;  3CXC Z;  2R92 I;  1Q7Y 1;  1KQS Y;  1DL6 A;  1K83 I;  3M4O I;  1L1O C;  5CM2 M;  4RV9 A;  2W04 A;  3CME 1;  4XX2 A;  4RVD A;  4NB8 A;  1YJW 1;  2NVY I;  3D9X A;  4Y52 I;  1ZB8 A;  3TE5 B;  4NBH A;  1VQ6 1;  5IP9 I;  4NBD A;  1Y1V S;  2KI7 B;  2E2J I;  2O4H A;  1VQK Z;  2DE6 A;  2QA4 Z;  2JNY A;  3NFZ A;  3VMI A;  3GTJ I;  1Q86 2;  1VQL 1;  3I55 1;  2V45 A;  4TNU A;  1KD1 2;  1P9N A;  2DE5 A;  1M90 2;  1TWF I;  3TDH B;  1Q82 2;  3S2D I;  5FLM I;  3MON A;  1AA6 A;  3CPW Y;  2RIQ A;  1RO4 A;  2OOX B;  1WW9 A;  5C44 I;  2R6M A;  2GU2 A;  1PFT A;  2RBL A;  1Q81 1;  1I6H I;  2JIR A;  4A3F I;  1Q16 A;  1YI2 1;  1ML8 A;  3CCS 1;  5T67 A;  5FLX b;  4CL1 A;  1VQ6 Z;  2JA6 I;  4A3L I;  1USP A;  4A3E I;  2PM9 A;  1JWH C;  3CC2 Z;  2ZAE B;  1SIW A;  4NB9 A;  1RLY A;  2BJO A;  3GTM I;  1WZN A;  5T64 A;  2G2K A;  3HOU I;  1VQL Z;  1K73 1;  3NH4 A;  3IFU A;  4QTU A;  4E2X A;  3I55 Z;  2V8I A;  2JIM A;  2E2I I;  2RHB A;  3I07 A;  2QRE B;  2NAP A;  2WB1 A;  3JAM b;  2PMZ A;  2JIQ A;  1QVF Z;  4A3B I;  4MXU A;  1FDO A;  1JJ2 Y;  4MH4 A;  1K9M 1;  4NOZ A;  2VPW A;  2RT9 A;  1YI2 Z;  4MD7 A;  4NFR A;  2V8K A;  3QWU A;  3CCJ 1;  2Q4Z A;  1VQ8 1;  3CCU 1;  3CCS Z;  1I3Q I;  1RQF A;  4BY1 I;  2GTI A;  1N2F A;  3P5J B;  4E2W A;  3U50 C;  3LUS A;  5D1P A;  5C3E I;  2F4O A;  3H0G I;  2QKD A;  3D6W A;  1RO0 A;  4NBB A;  3OW2 Y;  2AKL A;  4MRI A;  1NJI 2;  3FKI I;  3J81 b;  2E9H A;  3F3P C;  3J80 f;  3KIH A;  4A3I I;  1TWA I;  2V3V A;  2KPI A;  2QLV B;  4NH1 C;  5C4J I;  3H3V J;  2PK7 A;  1N8R 1;  1R9T I;  1YUK A;  2DE7 A;  4NBE A;  2M6N A;  5IT9 b;  3CCJ Z;  3EER A;  1VQ8 Z;  1Q7Y 2;  3CCU Z;  3GTK I;  3GTQ I;  3CCV 1;  1W2B Z;  1YIT 1;  3J7A 4;  3BG1 B;  4DQY B;  3CC2 1;  4X6A I;  1ZH1 A;  2VPY A;  3S1Q I;  2AYD A;  4E2Y A;  4NBG A;  2VPX A;  4A3C I;  2E2H I;  2JIP A;  4RVH A;  1Z02 A;  2IZ4 A;  2LEX A;  4E33 A;  3CD6 1;  3GTM S;  3IR7 A;  2R93 I;  2NVT I;  3PO3 I;  1KC8 1;  4A3G I;  1S7M A;  4RS4 A;  4BBS I;  3CCQ 1;  1FDI A;  2EGT A;  1QVG Y;  1YUA A;  1JJ2 Z;  4A93 I;  5A2Q b;  3CXC Y;  1VQP Z;  4NBF A;  3CC7 1;  3GKQ A;  4DGL A;  3S1R I;  4A3D I;  2JA7 I;  2R7Z I;  4E30 A;  3CCV Z;  1YIT Z;  1K8A 1;  3VMH A;  1WII A;  2IV2 X;  1Q81 2;  2QEX Z;  1VQM Z;  1TWC I;  2Q51 A;  3J81 f;  3CD6 Z;  2OTL Z;  1VQN 1;  1VQO 1;  1Z03 A;  2LFU A;  3G4S 1;  2NVX I;  1VQ7 1;  4MD9 A;  1KQS Z;  1TWG I;  2Y0S A;  3S2H I;  1Y1W I;  2LIY A;  1X0T A;  3CCQ Z;  3K7A I;  3Q87 A;  2OZK A;  4HH4 A;  2JS4 A;  5IT9 f;  1SFO I;  3BG0 B;  3VMG A;  3G71 1;  1USP B;  1YJ9 Z;  1K73 2;  4Y7N I;  3PO2 I;  3D2L A;  2WAQ A;  2RPR A;  3VTN A;  3M3Y I;  4RVF A;  1TFI A;  4E31 A;  3CC7 Z;  5LL6 f;  1YJN 1;  1QYP A;  2F4M A;  2IZ3 A; 
#chains in the Genus database with same CATH homology
 2LEX A;  2AYD A;  1WJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...