1NP6A

Crystal structure of escherichia coli mobb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
170
structure length
158
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the role of Escherichia coli MobB in Molybdenum cofactor biosynthesis based on the high resolution crystal structure
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
total genus 33
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1np6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1np6A01
3AUYA 1G41A 5FUVA 1UKEA 3B8HA 3VU9A 1X86B 2NO9A 4MGZR 2IEYA 2H1LA 1E9FA 1XDBA 4A82A 1MKYA 3OIWA 4GZMA 3W6NA 1W49A 3FKSD 1J8MF 1ZMXA 3NWJA 1Z06A 1NLYA 4C30A 4PZZA 1Z8FA 1KMHB 3CNLA 2ZRDA 3ZIAA 3B1WA 2FZ4A 4K8OA 4URXR 1EFUA 3EWSA 3GLIE 2HF9A 1D6JA 4GSYA 3UIEA 1ZM9A 3OHMA 5FTKA 1E0KA 4JKYA 4P33A 5E7JA 3BORA 4WA7A 1G18A 3NC1C 1WA5A 3A58B 3TBKA 2CVHA 1QF9A 1ZNYA 4F38A 4K46A 2G3YA 4JT4A 1US8B 4CZ2A 1L4UA 4OQLA 4V0ME 3SN6A 3U7GA 2QPAA 2YZ2A 4Z1MD 1NLFA 2IXGA 3A8TA 1Z0DA 2WOJA 3VMFA 1ZJ6A 2PBRA 3OIVA 4GMDA 4K81B 5P21A 3TSOA 4GT1A 1ETUA 2V3CC 5CK5A 1KI4A 3T06B 1TL7C 4X8MA 4WZBE 3TR0A 5H8WA 3WMFA 4Q48A 3CNNA 3UG7A 5KSOA 1OB5A 3FE2A 1U2RA 2QMOA 1G8FA 4PSAA 3FYHA 1R8QA 2REOA 3NDPA 4MRVA 3RC3A 4FCTA 2JA1A 4RZUA 1YZGA 2PMKA 4G5RA 4M4SA 2WBLC 3WNCA 3U4QA 2IYSA 3DKPA 1DARA 4B32A 1S4QA 1XTRA 3ZIAD 3MWLA 5J4KA 1G5TA 2FN4A 2OCAA 4HZIA 3B9QA 4OQMA 5EXSA 5J4VA 4PO1A 4TMTA 3VR3A 1DBSA 4DWJA 2CDNA 2QGZA 4BZPA 1OFHA 4DLUA 4RSGA 4DCNA 1KI8A 1F6BA 1Q3TA 3HJNA 4HB0A 1HT2E 3GEEA 1T5IA 4Q66C 2JIZA 1GUAA 1M7GA 4C7OB 4ZDKA 2DB3A 3OFND 4TTRA 3R9IA 1MO6A 2IUSA 2ZROA 4A0RA 2VHCA 3Q9LA 3KL4A 1H8EA 2UZIR 3QI2A 2WSSA 4NCNA 2C9OA 2IYWA 5G40A 1UADA 4BLOA 1ZCBA 1FX0A 1SXJC 4POAA 3QF4A 1FTNA 3D8BA 4NMMA 4PPFA 2OLJA 2WJVA 4V03A 1N6PA 1OHHD 1D9ZA 4BWYA 4BPBA 1Q20A 5FOUA 2QQEA 4LZZA 2F9MA 2F1JA 4B35A 4KHZA 4OHXA 2PZFA 4Y0AA 2FF7A 2Q9BA 3EASA 3DMDA 2GBLA 3M6AA 4Q7LA 3WNBA 2RGAA 3H2YA 3K9NA 4YC7A 3EAQA 1KJYA 1ZD1A 4JIMA 2IXEA 4NL4H 5AK0A 3QBTA 1NP6A 5AJWA 3T1VA 4BZQA 1ZNXA 3OEED 4DB4A 2J9RA 1KDOA 3THYB 4PQRA 4C0BA 4A15A 1MT0A 1ZRHA 1W0KD 4US0R 3I5XA 1N6NA 3LBIA 3ADBA 3RVBA 4D0NA 2P2LA 5DLQC 3T1QA 2ERYA 3DL0A 4NKRA 2V54A 5CB8A 1RE0A 4XD7A 3MLEA 3NEYA 3MSXA 1CP2A 4Q19A 5GVRA 5F3WB 3THOA 2ZJ5A 2DHRA 4DSTA 2DWPA 3R8CA 3U6BA 4Q4HB 2H7VA 3RDPA 5JWHA 1BS1A 2QI9C 3GMTA 3UWKA 1KZGB 5JCZA 5SZKB 2BM0A 4BLSA 1IQPA 4ESVA 1OH7A 2X2EA 3DDCA 1GL7A 1P2TA 2QMUA 1SQ5A 3C7KA 2CK3A 3KB1A 4Z8YA 1N6KA 3GJ0A 1V43A 3GJ6A 3P1JA 1E4VA 1GILA 2R6AA 2WVJA 3EIEA 5AJXA 3ZGXA 4F4CA 3VKHA 2ZU6A 1SKQA 2W0MA 2E1RA 4MYCA 5F9HA 4RY2A 3AKYA 4PC7A 3RWMB 3CO5A 4RD3A 2WKQA 2FX3A 2AHOA 2FA9A 1PLLA 1TAGA 2O52A 2IT1A 1CRPA 1QBKC 1A4RA 4HLQB 3VKWA 4ERNA 1S9DA 2ERXA 3LVRE 4HB3A 3LXRA 4LYFA 1FP6A 1IHUA 1N6IA 2NPIA 2D7DA 5L3SB 3EPHA 2G6BA 1EFRD 1W2HA 2WIAA 3DPUA 4OJQA 1S2MA 2HJGA 2LKDA 3QJYA 4DLVA 1NKSA 4IW3B 1Z6AA 4JLNA 1F60A 4XSHA 2ODEA 2IS2A 1XTSA 3N70A 3PEUA 4HLCA 4KBFA 4OQFA 1NMYA 1YQTA 4LJYA 1GWNA 1ZM3A 3VR6A 3AQ4A 4E5UA 2FMXA 4TLBA 4LV8B 4B2LA 4Q7JB 2R65A 2X1VA 1CS4C 4RKEA 2R9VA 2ZSEA 3OEHD 5K8UA 2XB2A 1KDTA 1DAFA 2FGJA 1Q22A 2FJUA 4BFTA 3OFNA 1E2MA 4BFVA 1AJEA 3K0AB 3U5ZB 4KLZA 3QVUA 1LVGA 1FZQA 4UNQA 3L82B 2N46A 4NDZA 1PLKA 3BOSA 1U81A 2DFTA 4NYIQ 4NBSA 2QM8A 4ASUD 1U98A 3SQXA 3ZVLA 1NJFA 4CVNA 5FUXA 3THWB 1IM2A 4PXAA 4CEJA 4YMUA 3C5HA 1JXOA 4GP7A 2DWQA 3CPHA 2GAOA 2WWWA 2B6HA 1N5JA 1NL3A 4NYJR 1TU3A 1WRBA 4NPHA 3W5IA 4Q03A 2X19A 3AVXA 1OFUX 1C9KA 1HH4A 1RRFA 4HZUB 1KJZA 1XJQA 4KO8A 3U44B 2GNOA 1J90A 2J0SA 2GZAA 1QVRA 4XH9B 2I4IA 5AWFC 1OF1A 2IS4A 4RVCA 2VP2A 4AKGA 4M9ZA 3IQWA 5IRCD 1YE8A 4I1OA 3R7WA 3LAWA 3B1VA 1G8HA 4RD4A 3VNUA 2QENA 2IWRA 5FH9A 2JJ8A 3GJ4A 2GZDA 3D31A 2QTFA 3QKRA 2GXQA 4NZYA 521PA 3WRXC 4CEIA 3FHTA 2JLZA 5B58C 1DAHA 2RGCA 1P72A 4TLDA 4QJ4A 3U6KA 2UZ3A 2OESA 2GXSA 3IIKA 3F0TA 1CULC 1UBGA 4TN1A 3AP2A 1W4RA 3IO5A 3K0FA 1OXUA 2EVWX 2YWHA 2AR7A 5EZ5A 5CJ2A 5BN3A 4KYIB 1E1RD 4YMSA 2OXRA 2QBYA 1OXTA 2WJJA 1RJ9A 3KUDA 2FSFA 2GJ9A 2ODBA 2VTKA 3ZQJA 4TYWA 2MSEB 1ZUIA 5GJBA 2BCGY 2HDNB 3B6EA 2ZVQX 1DVRA 3CR8A 1E2HA 1GKYA 2WJGA 1IBRA 2WWXA 2KSQA 5GJCA 4D80A 4JVSB 4P4TA 2LWIA 5GJWC 2NO0A 3I5YA 5B64A 1XZQA 1G3IA 3T15A 2A7QA 1OYYA 2BEKA 1Z22A 4CEHB 2LKCA 2ZSBA 3L8YA 2OM2A 5EJEA 3EPKA 2IF2A 1IXSB 4DCUA 1DE0A 5L8VA 4ESHA 4P31A 4CDGA 2A9KA 1TF5A 3CUEF 1E9BA 4WOPA 5EUQB 2RGEA 1SXJB 1Z08A 4PC1A 1ANKA 2EQBA 1D5CA 1H8HD 4DJTA 3I4LA 1IN8A 3EIHA 2O8EA 1U8AA 2XAUA 1NMZA 1AK2A 2AFIE 3KTAB 1KTVA 3GLHE 2ZRPA 3IKJA 2D74A 3K0CC 3KJEA 1F3OA 3WXMA 2WZQA 3QE0A 3E1SA 1JR6A 2IC5A 1LNZA 2C04A 2J41A 4NONA 4Q1BA 4OHZA 3EXAA 1NMXA 3B1ZA 1Z0JA 1GNRA 1WCV1 2F7SA 5F2EA 2Q0HA 2ZSFA 4Z1MA 2FZLA 2O0HA 2ZRCA 3AB3A 1U8ZA 3QNUA 1S1MA 1TF2A 5JS8A 2GWHA 4DT1B 3WBKA 3KQNA 4PR0A 2YOFA 1NJGA 1OXSC 4A8JA 4DKXA 1OW3B 4RCYA 1SXJE 2GVZC 3TQCA 4WVFA 2GJKA 4U7DA 3TUIC 1BYUA 4RKFA 4DCVA 3PUZA 2OAP1 3C15C 2PL3A 1E0AA 1QHGA 3A1SA 4IOJA 4PC6A 5JECA 3CIOA 1FQKA 1WF3A 3L2OB 4IDPA 3SYKA 4AYTA 3I92A 1DO0A 1P60A 4AC9A 4ZKDA 3AP3A 4LPKA 4Q1CA 1KDPA 2NO1A 2JCSA 5FFMA 3P26A 2JGNA 1J8YF 2JDIA 2IF0A 2WPDA 4TT3A 4D82A 3LQQA 1RIFA 1JB1A 2N42A 4DDUA 3TVDA 2H16A 2A78A 1ESNA 1Z83A 2IYRA 4RD0A 4JBYA 1IY0A 1RVDA 2EYQA 4HDQB 3AVWA 1XRJA 3EW9A 4Q1FA 1E3MA 5C1BA 1G7CA 1R0WA 3NEJA 4EPXA 3J81k 1X1SA 4URWR 5FBQB 2X77A 4U02A 2VP5A 5BN5A 3Q8XB 2K5UA 1NG9A 3MCAA 4HSEA 2QL6A 1PVOA 4LHYA 2JATA 2GJAA 1JR3E 4NP6A 3TJZA 1AS3A 4FMDB 4KITB 3F3YA 5J5CA 4B3CA 2XX3A 1RRPA 2ORVA 4LYAA 5IK2A 1ZC4A 2F55A 3W9YA 2QSZA 3PQCA 3TUJC 3FHOA 5BYJA 2C95A 2VP4A 4D0LB 2OCYC 1KIMA 1CR0A 3RWOA 4LV5B 3KTAA 1E2JA 3O47A 4AYWA 5JZVA 3BERA 2A5JA 2YINC 5CDFE 3A4MA 121PA 1Q57A 4PHGA 4TWZA 1JPNA 1JEEA 2QU8A 5EE3A 4PSVA 3DZ8A 1HV8A 1QVAA 5FBWB 3SHFA 1N6HA 4BUJA 1E1QA 4WXRA 4ON9A 3THXB 1LV7A 1NY6A 1LS1A 4M9XA 2QRNA 1TQ2A 2C99A 5KSPA 3AV0B 4MH0R 2JJ2D 5HCNA 3TSWA 3UG6A 4EPVA 3BK7A 4DDWA 3VU9B 1SZPA 4NCKA 3M0EA 2J7PD 1KDRA 2FSIA 4B75A 4B3FX 2BIFA 3WMGA 4MYUA 3EC1A 4JBWA 1GRNA 1GRRA 2J7PA 4IKEA 3HPRA 2IL1A 4BFYA 4DLYA 3X1YA 5FPKA 3FTQA 2H18A 4ZPXA 1Z5ZA 3PJRA 2H17A 1CJMA 1DO2A 1OKKD 2RHDA 2IYLD 2KE5A 2F3TA 4KI0A 4M1MA 2IS6A 3EA5A 3RHFA 2UKDA 4YLGA 3DVLA 1JQLB 1I2MA 1SVOA 1G3UA 3LW7A 2DFNA 2WV9A 3U7FB 1GTVA 2R2AA 3CRMA 1XCGB 1MO4A 3CX6A 3ADKA 2EFCB 4Q21A 2OFXA 4AKEA 1DAMA 2B7BA 3FMOB 3RS5A 4FIDA 3NBXX 4KYUA 3D3QA 2IS1A 4LHXA 4MGKR 2V6IA 2XOKA 3I3SR 1P9NA 4CW7A 4N1AA 4KSCA 2G83A 2NIPA 3I73A 1TEVA 5IT5A 1T3HA 3FMFA 2ZITA 3NKVA 1S3SA 4XSGA 2YV5A 2F6RA 2IYUA 3QIAA 2ZPTX 2HCJB 4RD6A 1IJFA 3WYAA 1VCIA 2REXB 1Z0AA 3CKLA 3DOEA 4V0LA 3KUCA 4BLTA 3CRW1 1JJ7A 4M1TA 2VSXA 4AKIA 4O0MA 1COWA 4MUAA 1W44A 1SVLA 4LV6A 5EQTA 3OIYA 5TDHA 1KI7A 4TQAA 2P5SA 1J99A 4IOMA 3B7GA 4M2LA 5FTJA 4WIAA 4HZUA 1WP9A 4HLDA 4TTPA 4EQ6A 3PEWA 4I81A 4M21A 5FPYA 2ZIAA 4HUTA 1DG1G 1C1YA 3PUYA 1BOFA 3TGPA 1NBMA 4NU0A 3HR8A 2VHQA 1R5OA 2GILA 1JEDA 2RCNA 1PV4A 3FOZA 3TLXA 3WP1B 1T0HB 4M8NE 1NN0A 2G77B 2QQ0A 5JSZA 1XMIA 1NN3A 2C9CA 5DH9A 1HE1C 3KB2A 2GCOB 3V9PA 5M04A 2YKGA 4BE7B 3IHLA 1HYQA 1E2QA 3CF0A 2DR3A 2ZSDA 2C5LA 1KKMA 1NSFA 3AVOA 3GFTA 5EE0A 5H68A 4R2HA 3NBZC 3AEZA 3ZZUA 4QBIA 5J4LA 1XD9A 4CF7A 1R0XA 4TMKA 4JZKA 1KO1A 3AVUA 4ZDWA 4ZDJA 1N0UA 1US8A 5BYKA 3CWQA 4P32A 3ICQB 1XMVA 3QXSA 4HB4A 4Q4JB 2CHQA 2R44A 1ZW6A 3EARA 3K1JA 1G3QA 4LWZA 5DO9A 4UXJA 1UAAA 1UM8A 2ZETA 1H8ED 1MO3A 3VFDA 2ZYUX 3PR1A 5KNBA 1A82A 1DAGA 5KUTA 4AY2A 3GLFA 1K6MA 2Z6VA 2YC2C 2XTMA 2ZXUA 1EFCA 3SU8A 4F92B 1XNJA 4DLWA 2YJTD 2BJWA 4KLNA 3CR7A 1CR2A 3QKTA 4Q4HA 3IILA 4QHSA 5EUMA 2FH5B 2VQSA 2BMFA 5LB2A 1E2DA 2QA5A 1XD2A 1F2TB 1G3RA 2HLDA 2QORA 2ZI9A 1CR4A 5G41A 1Z0KA 2BVNA 3LDAA 5DYGA 4W5HA 4D4JA 4H9GA 3QEJA 3G0HA 1AGPA 1P73A 5AJVB 3ZJYA 3NH9A 2OT3B 3NTUA 1CLUA 2B92A 4ARZA 1HT1E 4TMVA 3HU2A 5KDOA 4F4JA 3QXHA 3X1WA 2D7CA 3B85A 2G88A 2IUTA 4P3YA 4LJ9A 5JFGA 2QG6A 4LJ4A 4W9MC 1RZ3A 2ZJ2A 3IEVA 4PANA 2JLYA 3QVVA 2RAPA 3H86A 4FMCF 2GJ8A 4A9AA 3A1UA 4HDCA 1OB2A 3LX5A 3ECCA 3I32A 4B33A 3QG5A 5FBLB 1GRQA 3DO6A 3PFIA 1QZXA 2IBMA 3AKDA 1IOZA 1EX6A 2CNWA 2W2VA 2W00A 3KFVA 2IHBA 4HAXA 3ADDA 1ZNWA 1G21E 4QXAA 1UKVY 2O8FA 5C4MA 1L2TA 4JVLA 2ZUDA 3HYRA 1Z47A 2VIIA 3AGQA 1G9XA 4L16A 4GDFA 5JJLA 1ZUHA 1T6NA 2ZJAA 2GCOA 2CVFA 2XZPA 4ZDIA 2Z43A 1CU1A 4G01B 4DSOA 3IEUA 2O8CB 3SHWA 2DFKB 2IYYA 3N2EA 1AKYA 1OJLA 1VECA 1NI3A 4DCSA 3L43A 4DSUA 1II8B 1YZKA 1BYIA 3R20A 4R98A 1GG2A 3BS4A 4IXMA 2ZTSA 5TY0A 2OBMA 3BH0A 3MJHA 2JLXA 1SULA 3BE4A 3I8SA 3QBVA 1B23P 5CLQA 5JEEA 2EWWA 3EZ2A 3ADCA 1U0LA 2P6RA 4BECA 3GLIA 2EFDB 2BM1A 2OHFA 3VR4A 4FCVA 2JLSA 1QHIA 1W1WA 3U44A 3LH5A 4EUNA 3VNVA 5D3MA 2ZJ8A 3CX8A 1U99A 3EPJA 5CJPA 4YDHB 1OT3A 5KDDA 2Q3HA 4L4UA 4O3MA 4KXFB 2N1BA 1RJ9B 4A2WA 2VF7A 3SFZA 5J4YA 1VYTA 3QPWA 4L9WA 3PV0A 2XNDD 4DZZA 2ZYVX 2DYKA 1GOTA 2ZRFA 1N6RA 3KQLA 4MA4A 1W2GA 1VIAA 4HATA 1E79D 1T5LA 4IFBA 4LY6A 3SI7A 1TPZA 2ZE8A 3A1VA 1NKTA 4ZCIA 5L3QB 1HUQA 2QSYA 3B2EA 1WDTA 4AD8A 5HKKD 1DG3A 4GMXA 3R8FA 3OEEA 1XBTA 1ZINA 3L0SA 1G1MA 2YNMA 1CXZA 2AD1A 3CPJB 1CJTC 2RGBA 4PPQA 1DELA 4DXAA 2VP6A 1EGAA 3TH5A 3LLUA 3NIBA 1GNQA 1FOEB 4GOJA 4WW0A 3RRNA 3DZDA 1LTQA 2IYXA 1W7AA 1EWRA 2CBZA 4JLDA 4Q4AA 2FWRA 621PA 4D2IA 4DCTA 3I62A 2H5EA 2BBSA 5TARA 3RS7A 3IIMA 1ZYUA 4DC9A 4HLUC 2BEJA 1W5SA 1ZM2A 2RH5A 4QGFA 3TUZC 1II0A 2AL7A 3AF3A 4IOLA 3FKSA 4FCWA 2PMDA 4QC2A 2NQ2C 4LHVA 5KU1A 2JJ2A 4Q1EA 3WY9A 5DGXA 1MRNA 4MKGA 2C98A 4FD2A 5DSZA 2JAQA 2F1RA 1NIPA 4B43A 3BBPA 2HCBA 5JBQA 2ZS8A 4QOSA 1J7KA 1H65A 3Q5EA 4GL2A 2Q21A 2VO1A 1OIWA 5L3SA 4FI3C 4M1OA 2Y8EA 1Z6YA 3QXXA 2QP9X 3BH6A 2I3BA 3AF1A 4NH0A 2WKRA 3Q3JB 2AXPA 4PQYA 5G3ZA 3HU1A 2ONKA 3HR7A 3O8BA 2GZHA 3I8XA 3TQFA 3FFAA 1FNMA 4A0GA 2Z5FA 3SOPA 3UMFA 1TNDA 1FMLA 4OYHA 3KQHA 4BLPA 2QPTA 4OQXA 3B5JA 2QT1A 2HV8A 3RAPR 1JAIA 1W5TA 2D3WA 2FG5A 1OXXK 2GEDA 3BFVA 4V02A 3ZH9B 4MYHA 1VYVA 1XEXB 2WMNB 1FL9A 1JNYA 2YVUA 5AJZA 3REFA 2GDJA 4BGDA 3KQKA 2YOGA 1SGWA 3BIFA 1NN5A 3ZVNA 3LA6A 3OIUA 2W2TA 2R6DA 1KK2A 4PHFA 1G7TA 2XSZD 3K70D 5TV2A 1FTSA 2O8CA 2QN6A 2Z4SA 4TYQA 4QBHA 4DHEA 3RRYA 1E2LA 2KI5A 3MUFA 3HP1A 4C0JA 2FEOA 3THYA 2LCFA 5IHPA 4JT2A 1KO7A 2OILA 1JR3D 1OFIA 4B3GA 3LY5A 1XPRA 2JIZD 3QPUA 3B60A 1RC8A 1Z3IX 4QM7A 1E1QD 2CL7X 4I1SA 2ATVA 3LRPA 4RJLA 3KKNA 1Z29A 221PA 4DUGD 2ODWA 3AUXA 1P9WA 4FWIB 1VIYA 5CM9C 2JJ1A 2O0JA 1KYIA 3TW8B 4V0MA 5K8IA 4B71A 4KCGA 5KDLA 2W6ID 5GADl 4QJ5A 4KFTA 4QGGA 4XIGS 5JHHB 2GK7A 3QY0A 4PPGA 4G5SA 5FPTA 5JWRA 2FEMA 1D8TA 4NCIA 5G3YA 3L8ZA 2OEPA 3RLFA 4C0KA 3ZLJA 2VHJA 5KPDA 2A5YB 3SDZA 1KK3A 3DHWC 5AR1A 5FUYA 1B0UA 2A5DA 1Q1ZA 1UEJA 3KFXA 2IHYA 2IYTA 1F2UA 1YRAA 3QF7A 3IUYA 1WXQA 3QEOA 1JALA 3LV8A 5FBVB 3A4NA 2IK8A 3EA0A 1SVSA 3KJGA 4JJKA 1N5IA 4G5GA 1Z2AA 1W0JA 4PQFA 3RSLA 3GLHB 2QGNA 4JYBA 3W8NA 2NO6A 3LLMA 4R2IA 1G16A 1M6NA 4LBVA 4OHYA 1E98A 2WM9B 3K0EA 2XNSA 1QHHA 4HDOB 3TSZA 1W36B 1XMSA 2IYQA 2QE7D 4O2LA 5CYOA 5FTMA 5FPHA 1DAKA 2WPDD 3C4JA 1TU4A 3PIRA 3RYTC 3CRRA 2GF0A 2O8DA 2ZE6A 2ZS9A 2FPLA 4XD7D 1GFIA 2NZ8A 5EXPA 3GLHA 4LCBA 2IEZA 3AVTA 1Z6XA 4QM6A 4QGHA 3UKDA 4D4MA 3MMPA 4H1VA 2EWVA 2C03A 4B73A 5LBIA 2ZRJA 4JLAA 1KI6A 3W3AA 5AUQA 3U3OA 1CJKC 4IEEA 2ZRMA 3ZZTA 5K8LA 1DOAA 2FSHA 4I1UA 3UWOA 3CH4B 4C0AC 3ZS9A 1FFHA 2ZYTX 4Q9LA 2QNRA 2BMEA 6Q21A 5IK2D 1U8YA 1KSFX 4GRAA 2VHTA 1EESA 2ZRGA 3PEYA 5KPJA 2J0QA 3BJIC 1NVVR 2GETA 2RHMA 4Q02A 1W0JD 1FUKA 2VA8A 2YWFA 2ZSAA 3EZ9A 3PG5A 4MKFA 3EC2A 2YC4C 3O8DA 4DT1A 4Z51A 2VH5R 4FMDF 4UNSA 4MRRA 4LPSA 1XFAA 2AKAB 4KODA 2J0UA 1VCNA 1RPZA 3SNHA 2VF8A 1YKSA 2F9LA 4D0GA 1UJ2A 4GFDA 5BW8A 3PITA 3K0CA 5H70A 4WXPA 5KOYA 4IFEA 3REGA 1T8TA 3RS4A 2FSGA 2NZJA 4OJKA 5D3QA 1PUJA 2OFOA 1P62B 2RGGA 5J4HA 4U00A 3LO5A 1X6VA 3T61A 4CGZA 2BOVA 2HYDA 2G9NA 3A6PC 2J59A 1YR7A 1AQUA 4BFSA 3KKPA 4KV9A 3LNCA 4Q4JA 4AK9A 1VCMA 3WBJA 5TMPA 2QP4A 1ZVQA 3KDSE 3ZDQA 4US2R 2V8OA 4GOKA 4P4SA 5J40A 2A5GA 1TMKA 1ZP6A 1P2SA 2V55B 1TX4B 2ODNA 3V00A 4P0TA 3EZ7A 2R62A 4URYR 3ZVMA 2J3EA 2BV3A 1YR8A 4OQNA 1XTKA 2VEDA 4C2TA 3R9WA 3I1FA 3O8CA 1MO5A 4GPTA 4DIDA 2QPOA 5SZJA 4LHWA 4UXHA 1ZIOA 3GFOA 1NLZA 1N6LA 3GLGA 1F48A 1E69A 1R6BX 2QAGC 1NSTA 1I4TD 2OAQ1 4TL7A 2FOLA 3KKOA 4JVNA 1KO4A 1GDDA 1RYHA 1SKYB 4JYCA 2GVDC 4LX0A 1FP7A 1P6XA 3U7EB 1YZUA 2FU5C 1MR3F 3T5GA 3T1TA 3A4LA 3IIJA 4OKSA 2XZLA 4L9SA 4TYPA 3UATA 2DWOA 3RSOA 1A1VA 2HXYA 4ZI3A 3CPEA 3KKQA 4HEJA 4ITRC 1HY3A 3V4FA 1WMSA 2OO7A 2PT5A 2OUKA 4DSNA 3IBGA 4R71A 4B2PA 1TUIA 2V1XA 4Q7KA 3RNLA 1E9RA 4ZV4A 4EPRA 1NNEA 2WWIA 3X1ZA 2PLFA 4LHZA 2A5FA 3HDTA 4QGAA 5FI0B 3B13B 2W0SA 1AS0A 4LBYA 1IN5A 2NOAA 4OK5A 1G5RA 4JLVA 2IWHA 1KI1A 1E2NA 3LD9A 5AJYA 4C3ZA 1QDEA 1Q1QA 5JLJA 1ZNZA 5B30A 1FQJA 2JJ1D 2ZR7A 3LVQE 4WBSA 2F43A 3IGFA 2OV2A 3QKSB 4B3XA 1AN0A 3E5HA 4OK3A 3X2SA 2RGDA 2R6CA 1IJEA 1E2PA 2B8TA 2JLQA 2NTYC 2BJVA 3JZAA 3T12A 1T8UA 2ZU0C 2ZJBA 4B2IA 5FOSA 4M22A 3WMEA 2ZREA 1GP2A 3CONA 5A4JA 1G20E 1T3SA 2ZJOA 2OLKA 2FFHA 2ZVPX 3KXIA 1UPTA 4G5OA 2DY1A 4BEJA 2QM7A 3M1IA 2ZI4A 1VKJA 4ZIRA 1F2TA 3TMKA 3TW4A 5KTYA 1IN6A 3GJ8A 3ASZA 3W90A 1UKYA 3KXLA 1RRGA 1CJUC 1X8JA 2ZRKA 4YDSA 1R10A 5EE1A 3DKVA 4PSKA 1TEXA 3NH6A 4B3DA 4TLEA 4B48A 1D2MA 2OBNA 3NBFA 1KOFA 1PUIA 1KY3A 4EFLA 1X3SA 2Z83A 1VG9B 5ANRB 4XJXA 2BBOA 4QNMA 1WB9A 1XCMA 5JRZA 1IY1A 1YZQA 3TRFA 1VPLA 3T35A 3VKGA 1LF0A 2ZR0A 3MGCA 4DDTA 1GVNB 3RRMA 1Z28A 4BFWA 2FV8A 1OIVA 3W6PA 3SEAA 2P6NA 3TR5A 3BC1A 2W6IA 1Q3HA 2CL0X 4FN5A 3OESA 1M1YE 2OE2A 4G1UC 3UMRA 4A6XA 4A6PA 1G4AE 2ZRIA 3UK6A 5EP2A 1HURA 1G17A 3TVTA 4ARZB 3CRVA 4TSFD 3SJZA 3QUSA 3K9GA 3BAFA 1P4SA 1W4CA 4LDJA 5CIQA 1II8A 1R5BA 3GJ7A 1J2JA 4KVAA 4ASUA 4DEYA 3AM1A 2QZ4A 3UMSA 4O2RA 2WKPA 3OEHA 1P61B 2ZJYA 3AKEA 3SE0A 1JJVA 4QHTA 5BXQC 2XXAA 1LY1A 2QAGB 4XVRA 2CE7A 1KSHA 2XITA 5K8TA 4OBEA 1TQ6A 2ZI5A 2Q9CA 3H1TA 2R6GA 1S96A 1XF9A 4B34A 2ZYWX 4EPWA 2EFEB 3TK1A 2Q9AA 5SZHB 1V5WA 3WYGA 2G1KA 1ZUNB 4MKHA 3G5UA 1D2EA 1K5GA 4URUR 2C8VA 3X1XA 2CJWA 5E7MA 4D26A 1XZPA 5TXGA 1PZNA 4TQ9A 4V0OA 2P65A 3GLGB 2CCJA 2W2XA 2CLSA 4OHVA 4EFMA 2ZRLA 5JEDA 1G7RA 4M1YA 2AWOA 3H4MA 1N2CE 2JEOA 4NE2A 3NDBB 3TKLA 1KI9A 5J47A 4IXNA 1E32A 2VL7A 4Z8XA 1MABA 1RFLA 2GF9A 1YJ5A 4B47A 1OHHA 3SQWA 3NC0C 4OL0A 1JPJA 2QP3A 3L0PA 3IBYA 5BWMA 2WOOA 1M8PA 2CK3D 2QY9A 4G3XA 1T9HA 2ZUBA 4PPNA 1P75A 3KJIA 2B21A 2HT6A 4B6FA 4CRWB 3UANA 4LYHA 4JJZA 1T91A 2GHIA 2Q3FA 3UPUA 2WWHA 1BH2A 3K0SA 3E2IA 2F1HA 3GLIB 1AZSC 1FNNA 5E3HA 1Z2CA 4Q9HA 4TYNA 1GKUB 4CT5A 4TSFA 4DEXA 5EE5B 5C2JB 2OCBA 4IDQA 2HF8A 4M53A 2ZEJA 1W0KA 4WAUA 1HEIA 4B76A 2KJQA 3GPLA 2OFWA 4LSGA 4A36A 5DI3B 1X8LA 4DIEA 2BMJA 1LS6A 4OI2A 4ZKEA 3W34A 4A4DA 4U5XA 2W6JA 4A8JC 4YXWD 1LF5A 4HAZA 3QXJA 2BHRA 1JAHA 5JI2E 4PC3A 2EYUA 1GITA 3ND8A 2OBLA 2V6JA 4F7WA 1M2OB 2ORWA 1G5PA 3T1OA 3ZD6A 1DEKA 4S2EA 4I1VA 3MJRA 1VG1A 3DEFA 4XOIA 4DBLC 4FXPA 2XTZA 2BC9A 2QTHA 1ZBDA 4TMXA 1XXHA 1UBFA 1Y63A 1ZU4A 2IYZA 2CEAA 5DHAA 3AVYA 4TL6A 4V0KA 5AUOB 4Q4AB 4II7A 1G8GA 2Z0MA 2H8KA 2ZRNA 3WP0A 4LJ6A 3U60B 2VHUA 4N3NA 3N2IA 3ZQ6A 4IDOA 1OFTA 1W46A 3MD0A 4JS0A 4YMWA 4URZR 3NHBA 5GJVC 1OSNA 1R4AA 4HAYA 3ZS8A 3RC8A 4JL5A 2F1IA 4A0FA 2VSFA 3ZD7A 4S35A 1BIFA 3AF2A 2A2ZA 3VR5A 4ILEA 4DLXA 3GLGE 4PAOA 4TZ6A 1CIPA 1XPUA 2YHSA 1KI3A 3GFPA 2VBCA 1P2VA 1SVWA 2X8AA 1NIJA 4E09A 1GKIA 1IAQA 4Q18A 2OCPA 3P32A 4WZAE 3GEHA 3SFVA 2FPKA 1O3YA 2C2HA 3LX8A 1F5NA 2AK3A 4Q5IA 3ZVRA 3P20A 5KNCA 1JECA 3T34A 4LJAA 4HAUA 2IA5A 3C16C 1KMQA 5DE3A 4XWKA 1NVXQ 1KY2A 2VPPA 2D06A 3QQ5A 2P67A 2BCJQ 1VHTA 4OI4A 2ORIA 3ETLA 4MGYR 1XEFA 2HYIC 2FFQA 2YOHA 4L8GA 5DN6D 2WWGA 3BWDD 4M1WA 1R8SA 1VMAA 1XMJA 2ZANA 1TADA 2JASA 2P3SA 3LXXA 3SS8A 2NO7A 3PUXA 3CF2A 2A30A 2ZAMA 2ZI6A 3AVVA 3THWA 2PX0A 1UDXA 4HUQA 4JSTA 4KJZA 5F98A 4TZ0A 5H1YA 2P5TB 2ZRHA 4MKIA 2HEIA 2CLDX 4EPTA 1OXVA 2J46A 2PCJA 3X1DA 1G7SA 3QPVA 2IW3A 4UJ3A 1Q21A 2WHXA 1G291 1S0UA 5DNYB 2ZUCA 3LQRA 4QFMA 1P2UA 1KO8A 3FVQA 3PCRB 3D6TB 4RFSB 2C78A 2KWIA 4C0QC 5E95A 4HUQB 4ABYA 2J87A 3U7HB 1BMFD 1KZ7B 1N0VC 3LFUA 4M9QA 4I99A 4FMCB 5CLLA 1SHKA 2G0NA 3Q7PA 4UKDA 5DISB 4H1UA 4NYMQ 3K70B 3MWJA 3TE6A 5JJIA 2ANCA 1N25A 1NG1A 5BN4A 3W8RA 1N5KA 1LW7A 4W5WA 5LDDC 5DIFA 1XEXA 4EJSA 2W58A 2PX3A 1QHHB 5UKDA 2RGNC 4HYYA 4OI1A 2JLUA 2FPMA 2EW1A 1NVWQ 3MWKA 1QHYA 1BKDR 4FMBB 5CIWA 1II9A 1BO6A 1U0JA 4AKHA 3DMNA 1YR6A 3AGPA 5EXTA 3M4YA 3P4XA 1ZIPA 5CYPA 3K09C 4QNRA 2GEVA 1G8YA 4Z54A 4DB2A 1ELOA 3RS2A 4QHYA 4IDHA 3SBEA 4A92A 1E9DA 2GXAA 1OLOA 2RMKA 1NVVQ 2D4HA 3FMIA 3K9LA 2FNAA 4J0QA 4URVR 1UKZA 1XTQA 2PJZA 3KQUA 2ZE7A 3G82C 3PEVA 4Q9KA 2VYFA 2IYVA 1S1CA 2QAJA 4B6EA 4EIWA 2EFHB 2XOKD 421PA 4YONB 4EKDA 2QMEA 1E2FA 1KGDA 3FMPB 5JHGB 2ZI3A 1KI2A 3GLFB 4QBGB 4JKIA 1J70A 1KJWA 3GEIA 3U3RA 3CW2A 3Q7QA 4W5JA 2XJ9A 1TF7A 1YZTA 4LJ5A 1XXHE 2CCGA 5EP3A 3N5CA 3EZ6A 1T0JB 1Z0FA 2CE2X 3OZXA 4RD2A 4UQOA 4D4LA 3NHAA 4BFUA 4TLCA 3B9PA 5KNDA 2XEXA 1XJCA 2ZR9A 3LWNA 1FW6A 4XWOA 2WAXA 4NCJA 3B82A 4KAXA 3ONWA 1YU9A 721PA 3GD7A 2H57A 2WAYA 5EXXA 3FHCB 1E94E 2BDTA 1S8FA 1HQYE 2H92A 2JDID 4TT3D 3K70C 2HLDD 2ASEA 3CZPA 4G0NA 4NCHA 4DRZA 1D9XA 1KSJA 1JI0A 1NF3A 1R0ZA 4LYJA 3HWSA 1VDZA 2QE7A 2ECKA 2MSDB 2D62A 4N0DA 1GSIA 4E03A 1RKBA 1E1RA 4JSYA 3QXCA 4KFSA 3SJBA 1Z6TA 4AI6A 3FKQA 4FW9A 1Q44A 2CXXA 1KAOA 5BQ5A 2ZJZA 4LC0A 4CIDA 5AUNB 4PO9A 3WHLA 4MGIR 3PUWA 4LGMA 1XPOA 4EJSB 4A1FA 4C0LA 2KBFA 3K8YA 3PVSA 1U90A 2DCUA 1R7RA 3W3ZB 4GZLA 5JWOA 4FWTA 2PT7A 1L4YA 2J5XA 4XWAA 4ZIRB 3NG1A 2RGXA 2SHKA 1U9IA 1GL9B 2XTNA 2AK2A 2GJSA 4YMTA 1EWQA 1SXJD 4LUCA 1SVKA 3SJCA 4I4LA 4JL6A 4RZXA 1MV5A 1W36D 4Q7MB 1R2QA 1QG2A 1N0WA 4L5BA 3SC3A 2HJVA 2ZQ5A 3KJHA 1FX0B 4A8JB 2XB4A 3MRSA 4TTQA 2JLVA 1IXRC 5FR2A 4DUGA 2R6FA 2OZEA 2FFBA 4MITA 1MH1A 1RW4A 3SBDA 1E96A 3WNDA 2F3RA 4BFXA 2WIBA 4HI0E 1OH6A 3IHWA 4YQFA 3EPLA 3GJ5A 2JLWA 1PLJA 1TQDA 2D2FA 3QOFA 2PJRA 5TVKA 4OK6A 1NN1A 4Y0VA 3OE7A 2IX3A 5LB4A 2WMOB 3B1YA 3GCGA 3VX4A 3A1TA 4OI0A 4HB2A 1MOZA 1NY5A 4BFZA 5B57C 4D25A 5EE9A 8OHMA 4NYJQ 4PO8A 3U61B 1TTTA 1ZAKA 1UF9A 1T4GA 3RS0A 1TQ4A 1UBCA 2B7CA 4Q1AA 1A7JA 3MAAC 4RCZA 4RZ2A 2BKEA 1XXHB 5KSYA 2EU8A 2WTUA 2C9YA 1R5NA 2J0UB 3PENA 4LRWA 4QBFA 3BFXA 2V9PA 1OH8A 2PLRA 3OAAA 2ZM5A 1DPFA 3K53A 1AGRA 2AX4A 2VP0A 2YYZA 2FGKA 1VYUA 4TLAA 1FMJA 3SYLA 5HCIA 4ACBA 4Q9JA 3FDIA 2ZRAA 2G1JA 4IEIA 5E4FA 1ONBA 4GBMA 4M1SA 1E4YA 2NPFA 1E2GA 5KYKA 5ELXA 5FL3A 5KHOC 3E70C 4D6PA 3FFBA 3A37A 2W83A 1YZNA 4CT4B 4RFVA 5HZHA 3EZFA 4JBXA 3U3JA 1NBME 3AKCA 2AXNA 3JVVA 3Q5DA 1JXMA 4LOAA 4P4SB 2GKSA 4F93B 2TMKA 1XD2B 1K5DA 1DADA 1EG7A 2O5VA 4QKQA 1ZD8A 4LJ8A 2QMHA 4YMVA 2GXUA 2NG1A 4AWXA 2CL6X 1I4LD 5EP4A 1E0JA 4PZYA 3CF6R 4RD1A 1KSGA 4B44A 5C18A 2ZI7A 2HUPA 3BB4A 3LW8A 4PTLA 4C7OA 1N3BA 3MFYA 2GCNA 1AM4D 4PHTA 3GQBA 4F4IA 5FL7D 3AP1A 2RGNA 3VR1A 4G5QA 3KKMA 2UVQA 2VRWA 3LBHA 4JLKA 2ZRBA 5HE8A 1ZCAA 4GOXA 1VTKA 1HTWA 1OYWA 1OE0A 2J7KA 3CRQA 3WHKA 4ZCLA 3QSYA 5A0FA 5FPSA 3QG1A 2XXAB 5EP1A 4DLRA 4AIIA 4IHQA 2O8BB 3DM5A 2GESA 2REBA 1E0SA 4E07A 3JZMA 1UDWA 4Q1DA 1XCPA 1XWIA 1VG0B 1TUEA 4E22A 4EPYA 1S3GA 1IXZA 4M0LA 1G19A 1KI6B 3PUVA 3H0KA 1E9SA 2MMCA 3D7MA 1EX7A 4DLTA 5LPNA 2PCLA 5KO2A 1ZM4A 1XD8A 2GK6A 4PHHA 2C96A 1WBDA 4GP6A 1E79A 1EFRA 5CK4A 2O8BA 1FPMA 1D2NA 4KFUA 2P6UA 4FINA 1FUUA 1R0YA 4HAWA 1H8HA 5DHFA 4KSBA 2QTVB 1NVUQ 2CLCX 4NYMR 4AG6A 3B1XA 1VG8A 3FB4A 3S1AB 2CCKA 3U2QA 2VLIA 2AN9A 3K09A 4JLOA 2J45A 2D2EA 1Q1EA 2AWNA 5DYIA 1WE2A 1C4OA 1EFHA 1EXMA 4BEBA 2I1QA 2W6JD 2P0EA 2L0XA 3RANA 3U3KA 3GJ3A 3MWYW 1XB2A 2FDCA 1ZD9A 3RABA 1Z0IA 1E2IA 2B8WA 3QF4B 1AQYA 1NBMD 4XVQA 5FL7A 4LC1A 5L3QA 5JSZB 4Q01A 1JR3A 4KU4A 4MRNA 1KK1A 2CMKA 4IVQA 4PZLA 3TAHA 4D4KA 1LB1B 1AA9A 3ASYA 1AKEA 4QL3A 1ODFA 2PEZA 5DI9A 2IUUA 4HLUA 3CM0A 3GLFE 5G53C 4AG5A 4TQUS 4TYYA 1JQJC 1A2BA 2X2FA 3B78A 1CBUA 2I1VB 4MDEA 5IDVA 3CB4A 1Q1BA 2ZAOA 1KMHA 2GA8A 3A36A 5A5GA 2KBEA 1YRBA 4M1KA 3F5FA 4BASA 1P9RA 4EDHA 4TL9A 1W36C 3CNOA 4Q47A 4IVPA 4US1R 4R7ZA 3CH5A 2PZEA 4MDFA 1I2DA 1IY2A 3HU3A 1E2EA 2MSCB 2O0KA 2BKUA 3I61A 2CJWB 4JL8A 1Q0UA 1XTIA 1KAGA 5CITA 3GP8A 2DFLA 3R9XA 2DBYA 2J0VA 3R7WB 1SXJA 4Q4LA 2GCPA 2OG2A 4A0HA 5FTLA 1OV4A 5FOTA 3KXKA 4PC2A 2Q3MA 2BBTA 4LJ7A 1QG4A 3OAAD 4IOKA 4UJ5A 1YVDA 2ATXA 2V7QA 3F8TA 2QAGA 1G4UR 1QHNA 2DPXA 1IN7A 1T3LA 1W47A 1QHSA 2ZS7A 4LBWA 4LK2A 4M9SA 4QG7A 5JCPA 5KSZA 2O8FB 1NRJB 1IONA 1MRSA 4UNRA 4MRSA 4V0NA 1CRQA 2OSBA 2HXSA 1WBBA 4L15A 4C2UA 5DI3A 2HT1A 2E9SA 5CM8B 3SR0A 3EWAA 5B2ZA 4AURA 4LBZA 3BXZA 2QBYB 3U4QB 2AD5A 3AVPA 2QROA 2CHVA 3OE7D 5IF9A 2WWYA 1W48A 1E99A 3KX2A 4NYIR 3ZYCA 4IRUB 1HE8B 2Z4RA 2YWGA 4IJMA 3NXSA 3BB3A 3DOFA 4HAVA 3L0IB 4KFRA 3IPYA 1XP8A 4NTZA 1GAJA 1MABB 1G3MA 4UNPA 2WJYA 4R9UC 4BQSA 4ZI2A 1K8RA 1KNQA 1SVMA 4O25A 4DLZA 2WJHA 5L3VA 1E9CA 1CF4A 1W4BA 4B3BA 4JVMA 1Z63A 2BBWA 1Y3AA 1HQCA 4X8HA 1L7VC 4EAQA 4PAQA 1KHTA 5C46F 4RFSA 5LD2C 1WQ1R 1A2KC 2Q6TA 2YWEA 1RYFA 3TIFA 5TB5A 1Q12A 3C41J 3FPAA 1L8QA 1M34E 2NGRA 1XEWX 2V4ZA 2ANBA 1Z6GA 2O8DB 3EIQA 1I4DD 5HE9A 3SZRA 3CLVA 3K0AA 4DVGA 2GRJA 5LD2B 3IQXA 2BWJA 2NMVA 1ZC3A 2GAAA 4BLRA 1W4AA 4YXWA 4C9BA 4NHOA 4WZ6A 1U94A 4KBGA 4JMPA 3GJXC 1PJRA 3TAUA 1UFQA 4RZ3A 4JLJA 2J1LA 2GEUA 5FTNA 1E9EA 4UNNA 1SKYE 4CEJB 821PA 2ZE5A 5FOXA 1DAEA 1GM5A 5JRJA 4A2PA 2R8RA 1E2KA 4OHWA 2PEYA 4MRPA 1DS6A 1VCOA 1CEEA 3ND9A 5D3MB 4F91B 1RRCA 2WSSD 2CHGA 2MMGA 4LI0A 2BMDA 3W6OA 3BB1A 3QKUA 1YHNA 5HR5A 3AVQA 4GNKA 1AS2A 3CBQA 4BRWA 3BRWD 3W5JA 3VX3A 3C8UA 3VR2A 1HA3A 1SHZA 2XZOA 1G6HA 3P4YA 4Q9IA 1GIAA 3RRZA 5CDFA 2KB0A 5FOWA 4PAMA 1COWD 3V4RA 5E7IA 4JLMA 2O8EB 2VSOA 3QKRB 4CEIB 2WWFA 4C4PA 1XJ0A 1GZSA 3WRYC 1E9AA 1F2UB 3P27A 1SVIA 5AUPB 3BH7A 1DAIA 1DTSA 4IVRA 1XU4A 4TL8A 5FBRB 3LBNA 3BD9A 4B74A 1XX6A 1M7HA 1X8KA 2RB4A 4CEHA 1A5TA 2V1UA 1CR1A 3AF0A 3K0FB 3MG9A 3PXGA 2RKOA 3JVUA 5JI3E 1OIXA 2G0TA 1AIPA 1Z07A 3BFKA 3WYFA 4JLBA 4P4UA 2IXFA 2WSMA 5FUWA 4DLSA 4MYTA 1KNXA 2GTPA 3QENA 3VHLB 1GL6A 2F43B 4W7SA 3HYTA 3FWYA 1EFTA 3KZ1E 1N5LA 1ZM7A 3H84A 2ONJA 2AFHE 2PZGA 2FE4A 1OKKA 3Q85A 2CNWD 3C5CA 3CX7A 3TNFA 3A1WA 5FI1B 3THXA 1U0HC 3EG5A 1CKEA 5HTKA 4PX9A 1KO5A 1ESMA 1M7BA 4PFSA 1JBKA 1XEWY 4C0SA 1P3JA 3VTKA 3Q72A 4QJ3A 2XGJA 2QT0A 2E87A 4A2QA 2VP9A 5FR1A 4BRUA 4CYMA 3FGNA 2OXCA 3IO3A 4ZO4A 4N0EA 5C4GB 4ACAA 2WJIA 3OF5A 4MUBA 1QHXA 4IDNA 4TMWA 3QKSA 3L0OA 3DM9B 4UXIA 4QRHA 3C14C 2WICA 3K9HA 3CZQA 5SZIA 2XSZA 4BLQA 4EJSC 1YR9A 3IDQA 4DDVA 3RS3A 2QRZA 3BGWA 1E6CA 5HPYB 3I72A 4GI7A 4KVGA 1KK0A 1P5ZB 3CWZA 3IPXA 1N6OA 2C77A 1XTJA 4D81A 1UBEA 5HZKA 1AZTA 3T5DA 3U3MA 1VHLA 1ZU5A 1BMFA 4Q00A 2V7QD 2A3RA 3HPQA 2XJ4A 5JS7A 3O8RA 3NBYC 1GNPA 1EK0A 1CTQA 4X8LA 5GVSA 4EQ6B 3VQTA 5JMTA 4TMZA 3UXMA 4XTRA 1G64A 4BZXA 5L3RA 1P7CA 1KKLA 3ICEA 1YZLA 5EZ6B 4C0HA 2AKYA 3S1AA 3AH8A 3VHXA 2GBLC 3VAAA 2QEQA 4EFNA 3ZZ0A 1S9HA 4MQBA 1U9IC 4X8OA 3SJAA 1G6OA 2PH1A 5JJKA 4ZCMA 2QUZA 5HKKA 2EFGA 1CJVC 5CB6A 2FFAA 1QRAA 4XTCS 1G8PA 3EX7C 1O87A 4AYXA 1OPXA 1LFDB 2JLRA 3SYNA 5DN6A 3AF4A 3NVAA 2XNDA 1M74A 4JLPA 1X1RA 1OH5A 4XVUA 1IN4A 5F9FA 5FOVA 1UEIA
chains in the Genus database with same CATH superfamily
3AUYA 2D54A 3B8HA 1J56A 3IEPA 3PQ6A 3LZ6A 4OX9Y 4MGZR 3ZHCA 1J6UA 4ENWA 1EE9A 1SUBA 3MUNA 2QRLA 1XDBA 4A82A 3EXEA 5F7ZA 3GY0A 1R9MA 2GERA 1ECCA 4DCGA 5KZMB 2GN2A 5REQB 3LX6A 1S01A 1ZMXA 1VLAA 1GZ4A 3DBRA 3H6HA 2QRVA 4L95C 5D87A 2QEX1 5HKOA 2CY0A 2PGXA 2X2OA 1Z8FA 1KMHB 3GEGA 2WJ6A 4BVBA 3BQMB 1ZD3A 4URXR 1XTBA 3AR7A 4MUIA 4X5OA 2EC5A 2HF9A 1I6MA 1EQ2A 2I99A 2FTKE 1C2YA 4RH0A 3FH0A 3UBMA 1AK1A 4P33A 4JEHA 5DXJA 4WA7A 5EVCA 1WA5A 4Z4QA 4OQ4A 1JT9A 3GTKI 2CVHA 3FWKA 3UJCA 4HRXA 3WGVA 2G3YA 1OLUB 3KDAA 2J6IA 4ZCRA 1XTPA 4I0WB 2Z6AA 1PZEA 1US8B 1JUDA 1L4UA 1QONA 4B6GA 3DFFA 1OILA 2YZ2A 4Z1MD 4PZCA 4H7HA 3RKUA 3CSDA 5IJ9B 2ZOSA 3LG2A 3U5TA 2C29D 4FOOA 2XMGA 3COWA 5ECYA 5P21A 2AN1A 2D6FA 4GT1A 2W4MA 1YHQ1 4U7FA 4C6TA 4RVSA 3R6WA 1TL7C 1GG8A 3TR0A 1P1CA 4YRQA 4LG1A 3WMFA 4Q48A 1WW9A 1K7FB 2I7DA 5KSOA 1W35A 3FE2A 4UVIA 1OB5A 3LYAA 3VO2A 2VDPB 4PSAA 1M8JA 3OPNA 3FYHA 1YJCA 4MRVA 4KR9A 5GZ3A 3PL1A 1QKIA 1YZGA 2PMKA 4FHGA 4IYJA 2VDKB 1S4MA 2EIXA 1Q0QA 2WBLC 1AB6A 1NW6A 2G25A 4RA9B 3DKPA 4IZ6A 5F4BA 4Z99A 1C4XA 2QTCA 4ZP1A 4A8PA 1ZEMA 2Y1WA 4B32A 3HP7A 5H82A 2YV1A 5J4KA 4LTMA 1PDOA 1UQUA 1EZ4A 2OHIA 4WY8A 2NV2B 1RXVA 2F2TA 5TIIA 2P90A 4PO1A 1OI2A 4ZTUB 5D1OA 4UU1A 5EIBC 4DCOA 2CDRA 4C4YA 3VR3A 4D98A 4CMEA 4E5SA 4NBBA 2BM8A 2VUHB 2PWYA 5BPHA 3F7NA 1I24A 4LYDA 1MFPA 1Q3TA 1HT2E 2NU8A 4MB0A 1KH1A 1PL7A 4K88A 2VT6A 4ZDKA 5JALA 2JZOA 4TTRA 5LYYA 5BWNA 4RQUA 1MO6A 3R0IA 3T1HB 4A0RA 3EEIA 1EFDN 4Z86A 2VHCA 3Q9LA 2CBGA 3VR6H 2QUJA 2UZIR 1E7SA 1LNQA 1XWWA 3VVLA 1M8KA 2XGMA 4NCNA 3WV4A 1YXMA 4F4FA 1LD3A 5HTOA 3L7NA 3TLEA 1RIIA 2P8JA 5CFRA 4WGGA 1Q821 1U7DA 3CGWA 1G8MA 4JP5A 1FUYB 3QF4A 2Q28A 4YS6A 3HG7A 5BNIA 2LCIA 1E6KA 2JD2A 4BWYA 4CLRB 3T9FA 3JASB 4JFAA 7YASA 3MWDA 5KINB 2F1JA 1EIZA 2FW9A 5KX5B 5KVSA 1LPOA 5H16A 1DCMA 4AJ4A 2O7RA 3SVLA 2YNMC 3DMDA 1PKXA 4Q7LA 4I55B 3FVVA 1B41A 2DX7A 3N6XA 5ES4B 3EAQA 4ZHSA 3B36A 2XKAA 3ZE0B 3QBTA 1NP6A 5AJWA 3T1VA 1F2VA 2JFOA 2J3LA 3SM3A 2FZKA 4F86A 3DD5A 3FFTA 3PSAA 4L6CA 1KDOA 3C5VA 1LVHA 2D2XA 3THYB 1R50A 3QQPA 3GPBA 4C0BA 2WFZA 5BSMA 1ADGA 1BQEA 1SOUA 4CM9D 4QYSA 1Z0SA 4HWKA 1AT1A 1Q0HA 2R93I 3ZDZB 1Y6QA 3ADBA 4TVSA 2HDHA 3VAYA 1PWHA 4X41A 3V4PB 3P9ZA 3C3MA 2VSQA 2WHPB 4CKWB 1YACA 3DC7A 3RK1A 3HDYA 1UBHS 1QH1A 1VJDA 4BIIA 1PYGA 4BCCA 2BW0A 2DHRA 3VO9A 2JGAA 3C3PA 1FYFA 1CEYA 1NFQA 3R3XA 3RDPA 1SXHA 2QI9C 4BY9E 5JCZA 2BM0A 4BLSA 4BKPA 3E35A 4YJFB 5E1DA 4FFVA 4G1CA 5DEOA 4BCDA 1OH7A 3DDCA 3F8WA 2O3JA 4H0CA 3QKWA 4RPKA 1P2TA 2WU8A 1SQ5A 1VPTA 2P41A 2CK3A 4IQGA 4W1RA 1N6KA 2XRYA 4Z8YA 3E7DA 3OE4A 5FP0A 1L5LA 1VM6A 3GJ6A 1FXWA 1TCAA 3UJAA 4AYWA 3I0MA 4XX0B 1BEEA 5EIAA 4N65A 2ZU6A 5TPZD 2DBRA 4L0CA 2W0MA 2E1RA 2XT6A 3L1IA 3LY8A 4HF7A 4QTTB 1HDRA 5F9HA 3AKYA 2JAXA 5E0OA 2FQQA 2FX3A 2FA9A 3GRCA 1Y1RA 2JKYA 3R77A 4FXOA 4JLWA 2IT1A 1TA4A 1FRVA 4HLQB 2CW5A 2G1UA 2EZ8A 3IXMA 2C7VA 4JGBA 3K05A 3FD8A 3LXRA 1N6IA 3OQHA 4KG7A 4ZALA 1A9TA 1JSXA 2BKXA 3FUCA 3LY7A 1B8PA 4XGQA 1V9SA 3DEKA 1EFRD 1VPVA 3JYLA 1XLWA 4H7PA 1R4ZA 4I5FA 5DSTA 4BNDA 3QY9A 3N2KA 2LKDA 3O83A 3RTAA 4JLNA 1F60A 3WYBA 2VRBA 5LU8A 4RVHA 1NURA 4FBMA 3M4XA 3OCCA 1P7ZA 3N70A 4ZRMA 3W2GA 1A50B 1J07A 4KQ6A 3SCZA 4ER6A 4AM8A 1YS2X 3KS9A 4KBFA 1ZM3A 1A4IA 3AQ4A 3NNNA 4WSOA 1JDZA 4IIFA 4WQMA 2J6AA 2X8JB 1RQXA 3EDMA 1V8ZA 2X1VA 3WAGA 1CS4C 4RKEA 3I6YA 2ZSEA 5K8UA 4I36A 1KDTA 1R15A 1WKBA 2P4UA 2FGJA 2QN9A 1Q22A 3N9IA 1DX9A 3OFNA 2H2WA 1QGYA 3K0AB 4GM4A 3RVOA 3TPZA 3FWHA 1L1OC 1C3EA 1NR7A 1XQXA 2CJFA 3QVUA 3BWBA 5HKLA 1TMGE 2CLMB 4G25A 4K3VA 4CPDA 2ZK7A 1D5WA 2QM8A 2BSAA 4IDBA 3EISA 4A3CI 1UH5A 4HX9A 1B4DA 4NOZA 4ASUD 5EQJB 2BZ1A 4CVNA 2EJUA 5CFNA 2ZAGA 4PXAA 5K3FA 5EKSA 3J7AC 4ZAYA 3FNEA 4MK4A 1YDEA 2DWQA 1SQ6A 4D79A 2GAOA 2QTTA 1V2HE 5K0CA 2X1HA 3V8PA 1QOPB 4JC0A 1OFUX 4CBVA 4KO8A 1PNQA 2PSJA 4MVJM 1WXHA 2GNOA 2VHYA 1J90A 4HWOA 4Q7EA 4ZZIA 1PVOA 5A3QA 2B0CA 2CXNA 2V7PA 4PS1A 1L5QA 4ZCQA 3ZCRA 4JYMA 3TLMA 4RVCA 4EZBA 3JARA 2VRCD 1TM5E 5LJLA 2GN0A 3BZWA 1YE8A 4M0KA 1X87A 2J31A 3OZWA 3R7WA 3LAWA 3B1VA 5KOJB 3NONA 2IWRA 2JJ8A 1D2CA 2OHHA 4ZJYA 1KZHA 3N8KA 3RUDA 4F2DA 5ITZB 4NZYA 2GXQA 4PXYA 4PLVA 2WABA 3I76A 5CBKA 4KUHA 1DAHA 2JLZA 1P72A 2AR0A 3LFTA 3HLTA 3L77A 3SC6A 2OESA 2GXSA 2PVPA 3IIKA 3F0TA 4KE6A 4JXZA 1UBGA 1MB3A 3PD1A 1Q862 4NOLA 5DM2A 4C1NA 1RHKA 2B4YA 4TS9A 2QVYX 2Q2OA 4GBED 1OXUA 4X1YA 5G1NA 3CMMA 3C7TA 4ROSA 4TNUA 4WUVA 1QV7A 2TMDA 4RCVA 5CJ2A 5EZ5A 5TS3A 5BORA 1VJ0A 3EGXB 3I2KA 4IICA 4I9NA 3CH6A 4NICA 1JKFA 2VDMB 5TQ0B 1OXTA 2WJJA 1RJ9A 3JWJA 2GJ9A 2VTKA 4L5JA 4RIFA 3BWVA 5IXJA 4TYWA 2BCGY 4WESB 4TKLA 3DTVD 2F4NA 3IJRA 3IT3A 2ZVQX 1DVRA 4B4WA 4YY3B 2QUKA 2IDMA 1GKYA 4MUXA 1OI4A 1WSBA 2WJGA 3PKIA 4R8LA 13PKA 1N5OX 4RXMA 4DNFA 4GZ5A 3PZBA 4L4SA 2FDRA 4D80A 3GQVA 4JVSB 2FJPA 2O23A 3IVCA 4GYYA 2XGGA 4P4TA 4PGHA 3R5KA 2NO0A 5FEMA 4YP5A 4CMKA 1G3IA 1JQEA 3T15A 1NJI1 1KYQA 1Z22A 2VZ9A 1MENA 3M83A 4CHTA 4EARA 3L8YA 2OM2A 1IXSB 4DCUA 2KX7A 4BQFA 5BVGA 5MN6A 4ESHA 4P31A 2IXAA 1MTZA 1WMEA 2PHZA 3TL6A 2HX1A 4CDGA 4L8VA 1TF5A 3A9CA 3CUEF 4EWCA 4DJTA 5JAUA 1ANKA 2EQBA 3VC3A 4BZZA 1E7WA 4CM5A 3GGJA 3R3ZA 1IN8A 1C1XA 4A3FI 3EIHA 3F3FC 2BGLA 4H16A 4YDQA 2CSUA 4CU2A 4B3TB 3F3PC 1NMZA 5EIFA 5CW2A 2XT0A 3UMJA 1ZJJA 1I3OA 1OFUA 3HBFA 4HOYA 4L3VA 4K6MA 4OGLA 3ROEA 3QE0A 5CT9A 3N5KA 3VDXA 2G5CA 4GSKA 3H2GA 2C04A 2J41A 4G89A 1XIVA 1BA2A 4JR0A 5EMHA 1Z9BA 5EKTA 4EKYA 4UM7A 1G6Q1 4G26A 1P7VA 2ZKIA 4I5EA 4QO7A 1Y9DA 1NATA 1Z0JA 1W29A 1WCV1 1T3TA 2Y2VA 3OQBA 3KKEA 2Q0HA 2VAWA 5DJ5A 3WK6A 4D9NA 2YWXA 4GX1A 2FZLA 1MAWA 4UPDA 3KHUA 1PQWA 2GNPA 4HDRB 4WK0B 3S68A 4W6QA 1SHJA 4HEQA 1Q1NA 1MC1A 4AS1A 4DT1B 3WBKA 2L69A 3PNSA 1E1NA 1MJGA 2QUHA 2DH5A 4MQUA 1CFZA 4RCYA 2IEGA 1SXJE 2X23A 4ML3A 3U7QA 3WX0A 3WYNA 4D4IA 5JASA 3E3OA 5JSFA 1P5JA 3HJGA 3U0VA 3TUIC 3NDJA 1B14A 2GCGA 4DCVA 1Q0LA 2JA8I 2GZMA 2Q8NA 4HQNA 3E1KA 4J7AA 2PH7A 4NZZA 2DH6A 2IV3A 2L42A 5JECA 3CIOA 2HCRA 1FQKA 1WF3A 4COKA 2CLOB 2HI0A 2O0MA 2PDAA 4A16A 3V2UA 2ASVA 2EL7A 4ZKDA 3AMVA 1QGOA 4LPKA 4NMHA 4I50B 2JCSA 1RPAA 1WX1A 3MJVA 2NTJA 2XOEA 3BFJA 3R1IA 3R0ZA 4Q12A 4BKMA 5B6JA 1RMTA 3PD0A 1QG0A 1JDSA 1A9YA 3CNEA 4MPRA 5E2IA 4CKCB 4RENA 3CCE1 1RIFA 1JB1A 1ECPA 2BFEB 2CLEB 3LT1A 4RH1A 1MO2A 5AFSA 2YWCA 2J4CA 4RD0A 4JBYA 1K97A 4FYPA 3H6GA 1SEPA 5C1BA 1W52X 4G9BA 1G7CA 4Q3BA 4EPXA 1WNFA 3J81k 3T7EA 2B1IA 3I34X 4OA8A 3TTYA 3Q2IA 1XA4A 1FYWA 3AX6A 3FMVA 4PG6A 4RTQA 3BHMA 1G42A 4MUHA 3GRVA 1J0AA 1E5XA 2GK4A 3Q8XB 4IGEA 2O1EA 4ALMA 2QL6A 1QB8A 3TJZA 4B3CA 3MXOA 4GKAA 2VUSA 3T99A 1HDYA 1NUPA 5IK2A 4MW2A 3DXXA 3WLFA 1IBMB 1W8DA 5AT1A 3FHOA 5ISMA 3W5UA 4H6PA 4QZVA 4GMHA 4D0LB 3EMBA 3CEMA 1PYDA 1ZHOA 5CBPA 3PNOA 2XAAA 3NV7A 4DN6A 2OXIA 2WJ4A 3H2KA 3I561 1XZFA 1OX4A 4JN6B 3UMYA 4UVEA 5F1OA 5HJEA 2A5JA 2OL4A 5CDFE 1FBTA 121PA 1JHZA 1KYYA 4PGAA 3BRSA 1FLAA 1JEEA 3NAMA 1ISFA 1Y4UA 4GHWA 2CLHB 5L7TA 5EWJA 4ON9A 2JNYA 2IZOA 1HYGA 2QYTA 1LS1A 2W2MA 2WILA 3IJ5A 1TQ2A 4IWXA 3AV0B 4OUKX 5ILGA 2JJ2D 5HCNA 3UG6A 4EPVA 1E9VA 2XWPA 3BK7A 4DDWA 5EPOA 2W93A 1SZPA 2HFKA 4NCKA 3VU9B 4E14A 3H2SA 4JWTA 2O57A 4B3FX 2BIFA 4MWZA 5E6RB 1XT6A 2Q6LA 4ED9A 3Q7IA 2VNSA 4JBWA 1GRNA 2J7PA 2LE0A 3NJ8A 1L5HB 2WZCA 3R75A 2EX1A 3B2QA 5JAQA 3NBMA 3DBRB 5FPKA 5DXFA 3WLPA 2WUDA 4EL5A 1Z56C 3CLUC 2H18A 2X0EA 4X7MA 4A1OA 3RF6A 1OKKD 1VSTA 2R3SA 2QVZX 2KE5A 1BJRE 3VMMA 5L9AA 2X9GA 3FLMA 4YLGA 4C5CA 5DHSA 1NR5A 4Y2UA 3O9MA 2HPHA 4JD5A 1JQLB 4KMSA 2W6OA 2GAJA 3UUWA 2HW8A 2XH8A 3L02A 1Z2DA 1Z73A 2HIAA 3KLNA 1XWFA 5HRUA 3U4DA 4DR2B 5CDUA 3U7FB 2JCYA 3CX6A 2M48A 1TM2A 4Q21A 3SKXA 1ML4A 3S2YA 3RS5A 3BK1A 4KYUA 5E1OA 3D3QA 5J2TF 3C85A 2R4UA 2V6IA 3O8OB 3JQ9C 4NQRA 5EFOA 4CW7A 4EQZA 3BVPA 1IBKB 1TEVA 1ODSA 1U7PA 3ABZA 3HCEA 3FMFA 1ZI6A 1NJ5A 3NKVA 1KFEB 3PHBE 1ORRA 4J7CA 2C42A 3L3BA 4YEDA 2YV5A 3LA8A 3QIAA 5AW5A 4DDHA 2ZPTX 4IWNA 2XUPA 4FFNA 4LYGA 2HCJB 4RD6A 5KJCA 4DR3B 1V35A 3H9GA 3KJFA 1JEJA 5J2TA 3CKLA 3KUCA 3G8CA 4DLAA 3A6EA 4NBLA 2EFYA 4EO4A 2PVSA 4AKIA 3SY8A 2CUKA 4QYWA 5ELMA 1J1IA 1CSEE 1COWA 2GARA 1W44A 1CQIB 1DRJA 5EQTA 5FJIA 3FNGA 1O5IA 2BONA 3OIYA 4IOMA 1GPAA 3OD5A 3OZAA 5FPPA 3LKDA 2QVLA 3L04A 2FR1A 4HZUA 4HLDA 4TTPA 4O4JB 3RBAA 1FQOA 2E49A 2WMYA 4HUTA 3P94A 1MB0A 2PA0A 3ENQA 4DADA 2FWMX 3HR8A 2XYRA 5TPWA 3A2LA 1KC1A 5DCLA 4IH4A 4C4AA 2YASA 2AYZA 1JEDA 2RCNA 5TMEA 4M98A 1K7YA 1XDWA 2MR6A 4P6VF 5T4HA 2C82A 3TLXA 3ETDA 4BVFA 1L7MA 3WLEA 1SELA 4MS4A 3AL2A 4NXNB 4IMIB 5FA6A 2O5EA 1E1YA 3FCYA 2C9CA 3AG6A 1LBEA 3V9PA 3KB2A 2FPPB 4DVJA 1WCIA 1V1JA 3R44A 5B6PA 5JDCA 3IHLA 2WB4A 2YKGA 2OLEA 1E2QA 2YXEA 4M0FA 3BMOB 2DR3A 4RMHA 4WI1A 3CR3C 1M5UA 3EODA 5H68A 1VPWA 1WPRA 1YVUA 3ZZUA 2A9PA 3D9XA 1BD4A 3IULA 1CC1S 1M6VB 4MYSA 4CF7A 3PUIA 2D2VA 1PEDA 2E3JA 1KO1A 2I3DA 2DGDA 1DRVA 2IPAB 2FUG1 1HFEL 2WUWE 3CWQA 4R68A 4P32A 2YV2A 4RPCA 1I6KA 3NANA 3T3DA 4CM6A 4Q4JB 5AVVA 2CHQA 1PV4A 5IYZA 3CZ4A 1VFPA 3ENKA 2W8BB 1XL0A 3AV3A 3GRZA 3LUPA 4I4TF 1PGOA 1UODA 2VDLB 4HG2A 5B7GA 1M0SA 4WCFC 2ZETA 3ZG6A 1H8ED 2E6KA 3PR1A 1VI6A 2RGWA 3JR3A 1BDHA 4AY2A 3T7AA 1EJ6A 3NBKA 1Y4DE 1ZK2A 3ULKA 3GFBA 3GLFA 3O1IC 1ZXLA 4NI5A 2JGIA 2R1VB 2YC2C 1KU0A 2XTMA 2FR0A 1XNJA 3ZDEA 2P79A 4KN5A 1EE2A 2BJWA 1JMVA 3CCMZ 1CR2A 3KUKA 4GRDA 4DLWA 2XECA 3BEDA 3PO3S 2FMHA 5TEVA 3L7JA 3S28A 1NXWA 3LX4A 2BMFA 3UUEA 1QFJA 4D8YA 3O94A 2DQKA 1RQPA 1JIXA 3L0BA 4R84A 2HLDA 3QE4A 4PSCA 2GK3A 4KAJA 3LKVA 3GAMA 2BVNA 2ST1A 1F1JA 1AXEA 1K06A 4W5HA 4D4JA 1XZBA 3QEJA 2VUGA 5AJVB 2PBFA 3CIFA 3NH9A 3NTUA 5F5NA 3I0ZA 1AQIA 3H18A 2CHUA 4FK8A 4WZAA 1EJBA 4ARZA 5JAIA 4MW7A 1ILEA 4ZOLB 3HU2A 3IS3A 5KDOA 2XBLA 5C4IA 2D7CA 1O03A 4PYRA 4YV0A 4P3YA 5E3IA 4LJ9A 4MV0A 4UMVA 2QG6A 5JFGA 4W9MC 4NFRA 1USVA 1YS7A 4FYXA 1CQIA 2EGUA 2PWBA 5DW3A 3C39A 2RAPA 4BX2A 1I7QB 1NT2A 4OQDA 4PIVA 3D5QA 2ZUEA 3OPVA 2FRDC 2MYTA 1TT5B 1IZYA 2V0GA 4K05A 2RI6A 3DE0X 3LX5A 4D9IA 3UTDA 3O8LA 4N6GA 2QDXA 3I32A 4L4YA 5BVHB 3HRHA 3QG5A 5JMWA 2AC4A 3HZRA 4RHYA 3OF3A 4QT4A 3VTAA 1MPTA 4EY7A 2W2VA 2W00A 4C4RA 1HG0A 4XW2A 4ZYWA 5JO9A 1G21E 1Z4MA 1KJ8A 4P3XA 4LNAA 2Y1KA 3J80b 5C4MA 3T38A 2JGDB 4LF6B 3PCTA 1QRUA 1L2TA 2EKLA 2LGJA 2ZUDA 3IRVA 1Z47A 2VIIA 4DQUA 2LD4A 4WOCA 2AYYA 3Q3HA 2A14A 5DYWA 4J4TA 4ALJA 2XQGA 4ZU6X 2HRCA 1QDLB 1CG6A 3WJ2A 1U7OA 4F4UA 4E51A 5CCEA 3M4OI 2O14A 5JCJA 2DFKB 4Q39A 5HFJA 2XD9A 3R76A 3RSGA 1OJLA 1VECA 2P75A 3LCVB 1GGHA 2CZQA 2Y0EA 3LQ1A 4J0KA 4KACA 3GLQA 4CDRA 2Q9UA 4IGKA 4DSUA 4TWBA 4Z5XA 1GG2A 1ODKA 4NB9A 3CCQ1 4LRXA 4LHSA 4CTOA 4IXMA 3ZE8A 4F0JA 2QX9A 2A88A 2C3UA 5C53B 4GR5A 2OBMA 4QJBA 3BH0A 1TYCA 4D9JA 1YQWA 1O94C 5IMSA 1KMIY 1WHSB 2HK9A 5K3FB 3C24A 4B7CA 4R01A 4MR8A 4UDYX 3IQDB 1URPA 3UWPA 5CLQA 3EZ2A 3L41A 1U0LA 2QXYA 4DMMA 3BHNA 4XWTA 4ETMA 2P6RA 4GPEA 2XWJI 5JE8A 3M9XA 3N05A 4HDNA 3VR4A 5CD9A 4KQ1A 1E1LA 5BT8A 1W1WA 5DMXA 3V1UA 3URKA 4F9EA 3VNVA 3N6VA 5H81A 4IUDS 3WOHA 3WGUA 2JW5A 3MJ4A 4CFSA 1RAHA 4F3KA 2EQAA 4HS4A 2NZXA 3C6KA 3RB8A 4RBNA 3DD1A 2H4JA 2VF7A 3ZUGA 1VYTA 5LOVA 1X7ZA 1W30A 2BKLA 3MS7A 1VHDA 2F8TA 1GOTA 1U04A 4HATA 4LY6A 4QXPA 5L3QB 1TPZA 3A1VA 3HE3A 1RZVA 1PJLA 4ARUA 3KFLA 4AD8A 1SO8A 3RV3A 3HC7A 4GMXA 1Q0TA 3OEEA 1N8KA 5LC1A 1UP6A 4PCUA 1GUBA 1TMYA 2P11A 3TW6A 2GDZA 5ARBA 2Q4EA 5HRCA 5DKFA 2P9BA 4PPQA 4DQXA 1ZMRA 2HA2A 3P9PA 4IP0A 2VP6A 3MPUA 4U1RA 3UN1A 3O93A 4DXAA 10MHA 2WSYB 2WSIA 3LLUA 3NIBA 2UZ1B 1GNQA 4GECA 1FOEB 4ANFA 1DZIA 1W5AA 1FVOA 3DZDA 3IAM1 5ESXA 1HRKA 1YI1A 4QBTA 2IYXA 3QUAA 4C6SA 2RHBA 1JU9A 2C4MA 1PR6A 4C5BA 3DONA 3IVMA 4AF7A 4J03A 4NBCA 1F8YA 4DCTA 4MVJE 4E1VA 2BBSA 1P19A 3NU1A 1LDGA 5TARA 2F1OA 5KTSA 3IIMA 1ZYUA 1J23A 3JAMb 1JR4A 1NLUA 3FPSA 4XX2A 1ZM2A 2RH5A 3LPAA 3WMXA 2B8EA 2QN3A 3O38A 2AL7A 3BWEA 3E4DA 2EOAA 2PMDA 2NQ2C 3EIWA 3ZKAA 2BMAA 1QZTA 2QSUA 1R88A 1U7UA 4K3UA 3HNPA 5DGXA 1B0PA 1HTBA 1PL6A 1EYZA 2C98A 5DSZA 2DHCA 4JUCA 1UR5A 2FPIB 3LMKA 1GCUA 1ZFNA 1NIPA 4NJOA 3BBPA 5JBIA 1OWMA 2FR8A 1L9KA 1BX0A 2WWTA 3AY7A 2EBUA 1L6IA 3ORQA 3F5DA 3ESAA 3C6BA 4QOSA 4XR4A 2NUTA 4GL2A 4C78A 3LY9A 4EFDA 5KKAA 2OK7A 4FI3C 2DE6A 3V4OA 1BXGA 1Y6JA 5JATA 1GPNA 5JZ9A 5KBYA 4YMIA 1Z6YA 3MGBA 3QXXA 2CJYA 5CT8A 3BCSA 1F7VA 2JIDA 5JARA 5C35A 4L8WB 1LPSA 3ZHYA 4RESA 5LIRA 2JNWA 3G2OA 2B9VA 3HR7A 3O8BA 3V1MA 4YT2A 1EUCB 3TQFA 3HXTA 5A02A 2EW8A 4LYYA 3MWFA 4EO7A 1UL1X 3FNQA 4GC9A 4HWSA 4IS2A 2R68A 2RHLA 3EVEA 4N8SA 3RYIA 3TN7A 3UC9A 3G2HA 4Z53A 2Q46A 3GROA 4OYHA 2H7CA 3KQHA 1TUBB 2O4UX 4KRGA 4H18A 5WRFA 5LLTA 2HLPA 1VQ51 1XVAA 4RJJA 2OZLA 3OT5A 4DZTA 2RC5A 1GAWA 2I6QA 3QPBA 4QAQA 3BFVA 5K3DA 3ZDAA 5B1HA 1XCJA 4J0EA 3TQHA 5JMOA 1ADYA 2YVUA 3REFA 2VLBA 3RYHA 3TEMA 2E85A 2QRHA 4IHJF 4WJKB 1HNXB 3TSAA 2H1IA 3JQ6A 2GASA 1EGMB 1K7SN 4J9UE 4JLUA 1P81A 1G7TA 2Q51A 2XSZD 1F51E 1KAHA 1U5AA 2Y1OA 1FTSA 1DTEA 3F74A 1IBLB 1TKAA 2R8EA 3TIXB 4QBHA 2FP3A 4GYWA 3ZHQA 1Y7PA 1E2LA 4DHEA 2AW5A 1MQSA 1S3FA 1SBTA 2G5TA 3MUFA 4UMEA 2LCFA 1BXRA 4P38A 4MV6A 2X58A 1JR3D 5FNZA 5DV9A 3LY5A 1XPRA 3O2NA 2JIZD 2O4HA 2WJAA 1C1DB 1WB6A 4R2WA 3HBLA 3IR5A 2CL7X 3CVVA 3RC7A 3UAZA 3S14I 2QTWB 1KDZA 3DHYA 6CHYA 4KQHA 1K732 2ZWOA 4RJLA 4UHKA 5C8YF 1SCJA 3OFSA 4DUGD 3AUXA 5CM9C 3TW8B 2C2MA 2O0JA 1TM1E 4NCXA 4V0MA 4EG0A 3V48A 1I32A 1YV9A 3V2GA 1DKPA 5CLGA 5JNRA 5KDLA 5AESA 5EG5A 4DR7B 4FD3A 1FTWA 1RYEA 5BSEA 2WWRA 1PL8A 4RANA 4XCQA 3MCUA 3P71T 5G3YA 4WLNA 3JRNA 1QNLA 4XFDA 4LDRA 5IT9f 2OEPA 3GMIA 5E8RA 4AJNA 4B87A 3OOJA 4CR8A 4EYGA 2A5YB 3SDZA 4ZYXA 5AR1A 3OIGA 4XRRA 1UEJA 1NP7A 5IP7I 2I8CA 1X8XA 2IHYA 3H65A 5DBHX 2LR0A 5G0UA 2IYTA 2HNBA 3RWBA 2WUEA 2B5OA 1QE5A 1WXQA 3HY4A 3OZTA 1JALA 4KK4A 3A4NA 3JR7A 1HC7A 3VU0A 1UAYA 1XP5A 1N5IA 4L3WA 2GX6A 1HL3A 1Z2AA 1THZA 1W0JA 3E1GA 2BFWA 4PQFA 1Z38A 3SZOA 4LMPA 1LEHA 4MICA 4QVIA 1G16A 1M6NA 1W85A 2VF4X 4AF8A 4OHYA 3EVAA 4R3WA 4CQJA 3E8XA 1YFLA 1QHHA 5DM70 3RTGA 3O2JA 1LPAB 2ENWA 5KMGB 1JH8A 3LQYA 3IAHA 3I9JA 4DM7A 4JJFA 1DAKA 2CYBA 3PIRA 3X44A 1NQUA 1VQ4Z 3CRRA 3F49S 2N3ZA 1G8SA 4HN4B 2O8DA 3IFUA 4LKOA 3UMGA 2OCGA 3Q9SA 2FPLA 4EUSA 3UFXB 5BNZA 1GFIA 2NZ8A 1C3JA 1GTRA 4YP0A 4LCBA 2IEZA 4CGZA 1A5AB 3A0UA 4EB8A 2NX2A 1T0PA 2GPYA 2I7VA 3MT0A 3CVXA 3OHSX 4B73A 2ZRJA 1IQUA 5AUQA 1V7ZA 1RI4A 2IFTA 3FPFA 3WLSA 1OBFO 2ZRMA 3MTBA 1DFGA 1QC5A 1WIWA 2J5KA 2X0NA 4TKVA 4HJXA 1V39A 4NBUA 1BFKA 1SN7A 1T0BA 2AX3A 3MUOA 5DLDA 5G1PA 1KDYA 1FFHA 1J00A 3C8ZA 1SQSA 2QNRA 2Z3WA 2ACWA 2VN8A 1EWYA 3G9XA 2FUCA 3GA5A 1M33A 1N33B 2K7FA 2WLTA 3AEUB 3YASA 3O26A 1U8XX 3DE1X 1SBQA 2ZT5A 1YQGA 2VHTA 4GRAA 3USZA 2F9FA 2ZRGA 3P2EA 4LDNA 1LNSA 3UGQA 3WQRA 2ZBQA 4MONA 2ALJA 1NVVR 1Y8QB 4I3GA 2E89A 4A3LI 3QHPA 4MKFA 5I7AA 4N5MA 16PKA 4F60A 3SNKA 1W2BY 4DT1A 2FWIA 4UREA 5J43A 3HA7A 1U80A 2DMRA 3OZ7A 2J0UA 4FYHA 4UNIA 1JPUA 3ABRB 3MGGA 1DAPA 1DEXA 1FSGA 2BH9A 2VF8A 3SXUB 3D1JA 4RMGA 4ZMBA 4KREA 3CS3A 3QYAA 1WVMA 5L4NA 2XUHA 1MPXA 3IUBA 2H4XA 3ZUPA 4GQBA 2FSGA 2NZJA 1N8NA 1N2BA 4G23A 4ER3A 2CV1A 4U5QA 5JXGA 3HXOA 2CXRA 1I14A 1ECFA 2PKRA 3ZCQA 2V8BA 3GFQA 4U00A 3TI7A 3EC7A 3ZPXA 3NXKA 2BOVA 3H0EA 2HYDA 4RVUA 4ZVNA 1HTTA 5C7IO 1YR7A 4BFSA 4AK9A 4KV9A 5HRAA 1I2BA 2VWHA 3ND6A 4DA0A 2YADA 4UCWA 1P4JA 3P5SA 1ZAYA 1TMKA 4N3BA 3I6BA 3LK6A 3SHVA 4XSVA 4N5HX 2LW7A 4CQMA 5I01A 2ATEA 2RCYA 1PO7A 2RGYA 1TX4B 2FEPA 1FNSA 2WSLA 3R5TA 2CEKA 3AM5A 4XYMA 2W2KB 3ZVMA 2I3ZA 4TV8F 3VZSA 2J3EA 4LWOA 2YJ6A 3ZTWA 5AVSA 5K0BA 1YR8A 3WZ2A 4OQNA 1XTKA 2B4AA 2VEDA 3HCFA 3I1FA 4EYEA 1MO5A 2GH1A 2ZCUA 3HKBA 3S2HI 2QPOA 1MT3A 3S2IA 1L7RA 2QEXZ 2Z56A 3V34A 4UXHA 1ZIOA 4ZT3A 5CEFA 1TJYA 4IH9A 3GLGA 4K9QA 1N34B 3WLOA 4MLCA 1E69A 3AM3A 3L7CA 1YQDA 1R6BX 4DPKA 1NSTA 1VLHA 2OAQ1 2DHDA 1OBCA 1DMSA 2EGHA 2VOEA 4M8LA 1AG9A 2BI8A 1GDDA 2VT3A 4PG5A 1UC8A 4YI3A 2XTAA 3VYRB 4C22A 1ML8A 3DT6A 3R3UA 1DSSG 2C20A 3DMYA 1OZGA 2FU5C 2WKWA 3QH4A 3RNOA 5AW4A 4EGFA 2OC4A 2Z2ZA 1TKRA 2QD5A 3EY4A 3LS2A 3FLEA 4K8RB 1T5DX 2QZJA 4OKSA 1XROA 3SE7A 3U62A 3CY6A 3JPYA 2P5YA 1NI5A 2WVHA 4ZI3A 1NJSA 4FFMA 2QM3A 4JI0B 1HY3A 1WMSA 1YA8A 4BN5A 4R71A 5I8ZA 1NXXA 4B2PA 4N0QA 4TVKA 1R0KA 4N8DA 5HGXA 3NUQA 4KVZA 3X1ZA 5AYVA 4QGAA 5FI0B 3ESBA 3LLCA 3B13B 2AW3A 4FGJA 5CTJA 3FPEA 3VDRA 3H4TA 5TSDA 3AOEA 3G0CA 4LBYA 5H4GA 2HBRA 5CP8A 5EC8A 1C4KA 4Y3UA 2K2QB 2XMRA 1Y5NA 2Z3ZA 4DOMA 3ZZ1A 2PUCA 4YJ2F 5JO0A 2P4SA 4OXNA 1JIVA 2D1YA 5FLYA 1H6CA 3JAKA 4RIGA 2VYND 5DNAA 4AL4A 1E2PA 5ESWA 4C0WA 5CH8A 3VAZA 2C58A 3C8MA 3MJEA 5EHQA 3PIIA 1TT7A 1R64A 5FWDA 2ZJBA 4C3VA 5FOSA 3HR4A 4Q3AA 1N57A 2EWMA 3EW7A 2HNKA 1OXMA 1TAHA 2ZJOA 2VCEA 3MT7A 2FFHA 2QAIA 2ZVPX 4ND5A 3UJDA 4G5OA 4M36A 3PLAE 1PV1A 3C3AA 4BAUA 5C7OO 2PXXA 4GOOD 5T8KC 3R9KA 4JC5A 1O96A 3V1KA 1SBIA 1KRWA 3C1UA 2OORA 5KTYA 1IN6A 1EH5A 1X7DA 2Q99A 4R2MA 5EWLB 1CIJA 3A6LA 2CXHA 3LSTA 1I7DA 5IAKA 2EDAA 1RRGA 1CJUC 1X8JA 3MWGA 4CHGA 1PKEA 4U39A 3AL3A 1T1RA 1JEYB 5AI0A 1XQVA 3RAJA 2QV0A 4PSKA 3LZCA 3OO0A 4N6OA 1W0CA 4AKSA 1KMCA 4EA8A 1GQOA 2Q2VA 4V24A 2X0RA 1UBTS 4NAHA 3NH6A 3E58A 3HJRA 4OAPA 2IZ5A 2QL9A 2VZ8A 3P2YA 3NHMA 4B48A 4G97A 3P9QA 4GZ3A 1X3SA 2Z83A 3U39A 2R00C 4EFLA 2H52A 3V8QA 1LQTA 5EJMA 5ANRB 3LSYA 4HP8A 2FP4B 4W5TA 2X0KA 4U2CA 5GWXA 3SIPA 3ST7A 4R1UA 3O2SB 4C06A 5HM6A 3AUJB 5K6AC 1YZQA 1HORA 4JR1A 3TRFA 3N8HA 3ODGA 3VH1A 1TYEB 3RTEA 4BCBA 3CXCZ 3T35A 3A2KA 4TS4A 4MQFA 3MGCA 5A1JA 3RRMA 1GFZA 3P19A 1DEOA 3M2PA 5H4HA 3CXRA 2O6HA 5K5EA 3IDAA 3NBQA 4QWMA 4AZVA 2KI7B 4RQBA 2W6IA 2C8KA 2CL0X 4XDYA 1DCKA 3E15A 1H4TA 2WHRA 5IG2A 2QX6A 1C3OB 1M1YE 3CJQA 1MP0A 2OE2A 3TIGA 4PF1A 2REQA 3UMRA 5J23A 1SCAA 4YT4A 2H6EA 3D3JA 1PD1A 1UJ5A 1HURA 1K731 4FFSA 2PMWB 3GEDA 4D3YA 3I23A 5IDXA 3MWEB 3BX1A 3CRVA 3RODA 3ZHBA 3V7WA 4TSFD 3RU9A 5AVYA 1W4CA 4LDJA 3PPWA 5CIQA 2XMBA 2H3EA 3UTCA 4KVAA 4DM4A 1JU3A 3UW1A 5KWJA 4IWYA 5LM3A 3AESA 3AM1A 2DP4E 3EBLA 2WKPA 1Q16A 4BBJA 3C45A 2IHNA 3MOSA 1R4NA 2XXAA 1LY1A 3MONA 1T2DA 4BP8A 1N5MA 5T64A 4F11A 4UQLA 4BFLA 1H9BA 4FDUA 2CE7A 1FSPA 2HF2A 4G8DA 1AGYA 5JNWA