1NP6A

Crystal structure of escherichia coli mobb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
170
structure length
158
Chain Sequence
b'MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Insight into the role of Escherichia coli MobB in Molybdenum cofactor biosynthesis based on the high resolution crystal structure
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 33
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1np6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1np6A01
4B43A 4Q7MB 2VL7A 2ZRAA 1GM5A 3AKCA 3EC1A 5JHGB 1E69A 1N6IA 3CLVA 3Q8XB 3I5YA 3QQ5A 1NN0A 2ZRJA 3NDBB 4QOSA 1XTQA 1YZUA 3BFXA 4PHFA 5FPKA 4YMUA 2IYLD 3CF6R 4KBFA 4JIMA 1OFHA 1WCV1 3I32A 1ZNYA 5EP4A 4KLZA 1XRJA 1S1MA 4XSHA 5B64A 4NH0A 2QAJA 4Q1DA 4B47A 2KWIA 2PMDA 2JDID 4CEHA 3B78A 1P2TA 1QHHB 2ZE6A 4EFMA 4O2RA 4L9WA 4FMDF 4V0OA 3ZVNA 4I1VA 2D2FA 1TEVA 2GJKA 2ZUDA 1EGAA 4DT1A 3QVVA 1NVWQ 4C0SA 4D4JA 3U3JA 1CP2A 4B3DA 421PA 4A8JC 3LA6A 4CEJB 3RC8A 5KNCA 2X77A 1GDDA 2A3RA 1BOFA 5E7MA 4MYHA 5DYGA 4CGZA 2LWIA 2ZROA 2GXUA 5CK4A 3U4QA 2VSFA 4GMXA 3MWLA 4B2IA 3KKPA 5CLQA 2UZIR 2EVWX 1CEEA 1IXRC 1DAIA 4HLUA 5EZ5A 1DEKA 3CF2A 4MRPA 4D0LB 2DWOA 1JR3A 3WHKA 4WVFA 1XTKA 1T6NA 3QXXA 4JVNA 5HZKA 4NYMR 1RRFA 1XTRA 1GL6A 1Z47A 2ZR0A 3B9QA 3PEVA 1ZM4A 1XMSA 1EFUA 1P9WA 2AK3A 2AKYA 5EP1A 5JSZB 1H65A 5FUYA 4QNRA 2GVZC 2A30A 4IKEA 3U3OA 4XTCS 1CXZA 2GRJA 1BYIA 1L4YA 3W8NA 2QE7A 2CNWD 5D3MA 3EIEA 2BBSA 2CVHA 4LPKA 2J46A 5LB4A 4EPWA 5DE3A 2XEXA 3QI2A 1Z22A 5FUWA 1W5SA 1Z8FA 3ND9A 2ZE7A 2V1XA 3OHMA 4KFSA 4HAVA 1N5LA 1EX6A 1U8AA 3UMFA 4L8GA 2IYZA 3F3YA 4Q4JB 3B1VA 4AURA 2R9VA 3L43A 2H16A 3CRMA 1E2NA 2ZUCA 2VA8A 2OBNA 4KAXA 3VKWA 4IJMA 4RD1A 1E2IA 4OI2A 1R5BA 4KFUA 1KGDA 4C0AC 1E9CA 2CDNA 3QVUA 1T5IA 1FUKA 1E32A 5DH9A 3Q5DA 1TMKA 4NP6A 5DN6A 2AK2A 2GCNA 2WTUA 2KSQA 1DAGA 3AB3A 1HE1C 2C2HA 1ZJ6A 4TL6A 3I8SA 1CKEA 4A36A 4NYIR 2J87A 1E0SA 4M4SA 2A5JA 4RY2A 4ARZB 4D4MA 2ZJ2A 3NTUA 4XVRA 2VQSA 1XU4A 2B8TA 4IEEA 2JEOA 3HJNA 4MH0R 4LBVA 4PZZA 2J7KA 3TAHA 3GLFE 1RKBA 2GJSA 4U00A 2IS4A 2KE5A 2QI9C 5AJYA 4DVGA 4OHVA 1ONBA 4HAXA 4XD7A 1C4OA 1E79D 1M2OB 2G88A 2RGXA 5EE9A 2CL7X 1IY1A 3RS4A 1E0AA 4WZBE 2ZQ5A 3DKVA 4TTRA 2AFIE 4IFEA 4ACBA 2NO1A 4EQ6B 4XD7D 2J0VA 4KYIB 1TQ2A 2CCGA 2RGGA 4DIDA 4JVSB 5DIFA 1M7BA 2WMOB 2N42A 3MRSA 2HLDA 4L16A 2MSDB 3ASZA 1W46A 4B75A 5K8LA 3T06B 4MYCA 2FPKA 2AN9A 3CWZA 4Q9IA 1TU4A 4AKHA 2ZSAA 3AUXA 4C9BA 4HYYA 4C2UA 3LW8A 3VQTA 1LV7A 4NKRA 1FQJA 1M1YE 2C9CA 2HLDD 5FUXA 3MAAC 4B34A 4I1UA 4DT1B 1PLKA 4URVR 1UDXA 4Q1BA 1XD9A 3R7WA 4TMKA 5G41A 1TL7C 2AWOA 4RD2A 3ICQB 3U44B 1H8EA 1W48A 4FCWA 4IOMA 3QEJA 4M1KA 3BH7A 4J0QA 5KDOA 3U7GA 2QT0A 3U4QB 3KXIA 2PZGA 2JIZA 1GITA 3RAPR 3L0SA 4BEJA 4NYJR 4AKGA 3K0CA 3VHLB 2VF7A 4HLDA 4LOAA 2KBFA 4B6EA 5SZKB 3P4YA 4M9XA 3G5UA 3B9PA 2ORIA 5P21A 3SN6A 1MH1A 1TQ6A 2QAGA 1VG8A 4OK5A 1KKLA 3DL0A 4NONA 1FW6A 3AKEA 3HYRA 1G6OA 1UFQA 2UZ3A 5B58C 4HB4A 2GF0A 4G5SA 4K46A 4LYAA 5FOUA 1AKEA 1KK1A 1AA9A 4ZDJA 4QHSA 1AS0A 1ZUNB 4P4UA 1U81A 4HDQB 2XNSA 5LPNA 3U60B 1XEWX 5D3MB 4PZLA 4UNRA 1HV8A 3C14C 3C41J 1OXXK 1J70A 2Q9AA 3RSOA 5CB8A 1VPLA 4TMZA 1AK2A 4BE7B 4C0HA 3WNCA 3AEZA 2QGNA 1QF9A 5IF9A 4PSVA 3CH5A 2A78A 1B0UA 2Q6TA 3KUCA 4TSFA 3EZ6A 1E1RD 3ZIAA 1DG3A 1CJVC 121PA 1NBME 4TYWA 1YZGA 1XD8A 3A1TA 1ZCAA 2F6RA 2FZLA 3QE0A 2NG1A 2YINC 2IHBA 4LYFA 3P26A 4Z1MA 4C0QC 2QSYA 4TSFD 3SQWA 4A2QA 3SEAA 1OH5A 1DG1G 2HJVA 3U3RA 2FGKA 3ZIAD 4PPQA 4E07A 4QNMA 2KI5A 3W3AA 3SJCA 1VTKA 3NIBA 2H5EA 2WPDD 2XOKA 4Q1FA 4LPSA 2BKUA 2JASA 5C2JB 3EIHA 2Z5FA 3QBVA 4U7DA 4Q47A 2XTZA 4WIAA 1Q1BA 1TU3A 4PC7A 3A36A 4CRWB 1TF2A 4YDSA 2CE7A 1XD2A 1HURA 3FDIA 4ERNA 2IYRA 4JT2A 2ZRCA 2J7PA 2R65A 5D3QA 3SBDA 5F98A 2IS6A 3L8ZA 1D5CA 1KI1A 2WWWA 2ZRFA 4G5QA 4UXJA 3SJZA 4IVRA 1US8A 1KO7A 2YWEA 1SXJA 2QL6A 3LVRE 2ZETA 1JXOA 2A5GA 3LLUA 1OFIA 1XPUA 2PEZA 3RS7A 4TLEA 3UXMA 4WAUA 4GI7A 3U61B 3JZAA 4BFXA 1P73A 2VHTA 5DISB 3PJRA 3R7WB 2D7DA 2OLKA 1KDTA 2AXNA 3A1WA 5FOWA 5IK2D 5JWRA 2XZOA 2WM9B 5FL7D 4M1OA 3GFPA 4WBSA 2WZQA 5AK0A 3ZZUA 2OXRA 3QKRA 1G19A 3ADBA 2K5UA 4FINA 3FKSD 2O8FB 3IBYA 2VSXA 3JVVA 3KL4A 4YLGA 1VCNA 3AH8A 2O5VA 4YXWA 3PXGA 2FX3A 2IF2A 2VTKA 2W2TA 2LCFA 1J8YF 3TMKA 3O47A 1VKJA 1PV4A 3WYGA 2CJWA 1OIWA 1W49A 2QAGB 1RYHA 1OHHA 4YXWD 5A5GA 3OESA 4TL9A 2QQ0A 3IPXA 3SHFA 1TQ4A 3NVAA 4UNSA 4LUCA 1KO1A 1A4RA 1KSHA 1G3RA 1Z29A 4MGKR 4Z54A 4Q9JA 2CXXA 2ZANA 3OE7D 3VR1A 2D7CA 4P4SA 2FN4A 2R2AA 3RANA 3ZGXA 1NNEA 4B73A 2W58A 2N1BA 1JAHA 1OHHD 3O8DA 4HATA 3P4XA 1JEEA 1CJTC 2QP3A 3QJYA 4NBSA 5FR2A 5DNYB 1GAJA 4V0ME 2WJHA 2ZRNA 2X2EA 4A1FA 3CPJB 2X19A 4KHZA 1E2MA 1OH7A 3Q5EA 3MD0A 4OI4A 4XTRA 5AUOB 2QP4A 1E1QD 2BC9A 1QHSA 3X1YA 2QPOA 1Z0FA 3QENA 4KODA 3A4MA 3GLIA 2ATXA 4FCVA 3UWKA 3IPYA 1HT2E 1F2UB 5DHFA 2GXQA 2W00A 3F0TA 1GRNA 1NMZA 3NWJA 1KDRA 4JKYA 3CH4B 3MWKA 1RRCA 5FOTA 3QF4A 1XFAA 4ASUD 2YOGA 1NJFA 3C16C 3I92A 4HAWA 4DCTA 2JA1A 1HT1E 2EWVA 4RD6A 4U02A 4F4JA 1KAGA 2Z4RA 2ZREA 5KSOA 4BFSA 4RFSA 3RRMA 4PPFA 4JYCA 1R0YA 1YR7A 1ZP6A 1Z3IX 3QY0A 4GOXA 1N0WA 1P9RA 2OFWA 2V55B 5HKKA 2ZM5A 3B1XA 1JPJA 3QKSB 5H1YA 2VPPA 3V4FA 4A6PA 4DSOA 1OB5A 3VNUA 1CU1A 4ESHA 4EUNA 3AVPA 3GPLA 4OKSA 4Q7KA 2IHYA 1BYUA 3LO5A 3R20A 4ZIRB 1P61B 1G21E 1RJ9A 1IQPA 3BFVA 4TMTA 4US1R 1KSGA 5EXTA 4Q4LA 5HKKD 1NVUQ 1SVIA 3HPRA 4QBHA 3CB4A 1Q0UA 2XX3A 2VP4A 5L3VA 1L7VC 1VYUA 1X86B 1Z6TA 2ZAMA 2YWFA 2HCJB 1XD2B 1G7SA 3REFA 2BHRA 3MFYA 1XXHA 2G77B 3PR1A 2ZI4A 4PO1A 2ZPTX 4BRUA 3VR3A 1EG7A 4LGMA 4URXR 2QRNA 2G0NA 1N2CE 2CLSA 5GJBA 1KK3A 2R6DA 2RKOA 3EIQA 4ESVA 1JEDA 4H1UA 5JI3E 2DBYA 4OHZA 4A6XA 2BDTA 1CS4C 3BBPA 3BFKA 3E70C 4GBMA 4IVPA 4BFUA 3QKUA 1XP8A 4B48A 2EYQA 2O8CA 4DLZA 4DDVA 3WHLA 1W0JD 2R6GA 2W6JD 4LJ6A 4AIIA 3MMPA 1UKYA 2ZTSA 2C9OA 4LY6A 1JPNA 5AJWA 3W3ZB 3CR7A 4C2TA 1CRPA 3B8HA 2X1VA 4LC1A 4BFYA 3QKRB 3HDTA 3KQHA 4TLAA 3Q7QA 1RE0A 2GNOA 4LX0A 4IEIA 1QHNA 3FFAA 4NCJA 3LXRA 4B74A 4DLWA 3RC3A 1GFIA 3BIFA 1P2VA 5F3WB 2IS2A 1DELA 4AC9A 3RWMB 3L0IB 1GSIA 1D2EA 1OXSC 5KOYA 2CJWB 1NRJB 2OSBA 4Q9LA 4KSBA 4ZDIA 3SU8A 3LWNA 3RVBA 2PLRA 2VHUA 3AGQA 2ZS8A 5FR1A 1SVOA 1VHTA 2I3BA 1E0JA 4LJ8A 1VDZA 1UF9A 3THYA 4DSNA 4WOPA 4NE2A 3GP8A 1R10A 4P4SB 2NO7A 4HI0E 2EQBA 1HE8B 4HLCA 2XNDA 4A0FA 4CW7A 1E2QA 3EC2A 3PQCA 3GLHE 1EFCA 4LDJA 1KMHA 4ZV4A 3FTQA 4MKHA 2P5TB 4AKIA 5GVSA 1PUIA 2FE4A 1N6PA 2NTYC 3DDCA 3NEJA 5JZVA 1GZSA 3MUFA 3GJ4A 1YVDA 3PUWA 3K0SA 4NL4H 1WBDA 5JBQA 3L8YA 1X6VA 2GZAA 1N0UA 2R6AA 2C96A 3FHTA 4Q03A 3UANA 3ZQ6A 3GLIB 3IIJA 3OZXA 2WAXA 1PZNA 2CCJA 3GFOA 2HYIC 1KHTA 1NVVQ 3TUIC 5K8TA 1N6KA 1O3YA 4Q18A 3FVQA 2QGZA 2ZSBA 3OFND 3AV0B 1W4AA 4XWOA 3QF4B 2ORWA 4C4PA 1HQYE 1TUEA 2V9PA 2O8DB 4V0NA 1IAQA 1E2GA 2B7CA 2XSZA 2J45A 4LBZA 3AGPA 4TL8A 3W5IA 2RMKA 1KZGB 1AN0A 2WWXA 2UKDA 3C8UA 4IDOA 4KJZA 2G0TA 2ZITA 1YU9A 2GBLA 1JALA 5IT5A 2WJVA 3BH0A 2QTVB 1S0UA 4RCZA 1NN1A 1CIPA 4HLUC 3U2QA 1UADA 4PR0A 2F43A 1IONA 5HE8A 4I4LA 1GKIA 2HF8A 2FEMA 2ZJAA 5FH9A 1IJFA 3K9NA 3VMFA 2A7QA 1RJ9B 2XB2A 1GKUB 3NHBA 4TQ9A 3HU1A 2W2XA 2HV8A 3WNDA 2E9SA 2CLDX 2YV5A 1G6HA 1E2EA 1R8SA 1QHHA 1BMFA 1ZMXA 2YJTD 5L3SA 3LBHA 3GLGA 2PZFA 4WA7A 4KVGA 3LQQA 3TE6A 4BFTA 2JLVA 1XXHB 2HF9A 4IOJA 2F1IA 2J0QA 2JCSA 4PXAA 5BQ5A 1OFUX 2CHGA 3DM9B 1DE0A 2WJJA 1BMFD 4U5XA 1RRPA 3NG1A 1XEFA 1ZCBA 4FMCB 3VX4A 5JJLA 3E5HA 2GTPA 5JWHA 4R2IA 2JGNA 3MJHA 3K70C 2FA9A 4D6PA 4DLTA 2FFQA 2I4IA 3SJBA 2B92A 4D0NA 2O8CB 4D81A 2WOJA 1RZ3A 2IWHA 2RAPA 2CMKA 1VYTA 2IX3A 5EE5B 4IDNA 5FFMA 3B1WA 1OXVA 1E9RA 1P2SA 5DO9A 3IDQA 3PEWA 4BFVA 2NZ8A 2JLWA 1VG9B 2ONKA 3QKTA 2N46A 5FTNA 1PJRA 1CTQA 3J81k 2F1JA 5JSZA 2QM7A 1GUAA 5HPYB 4GP6A 4NYMQ 1FP7A 2BVNA 1Q1QA 3SE0A 2QP9X 1T3SA 5KU1A 4PO8A 2GEDA 4M1WA 1N25A 4QGAA 1RRGA 4ZI3A 1Q1ZA 3U5ZB 4RKEA 4CEIA 2VHJA 3UMRA 4PHHA 4JMPA 4Y0AA 4PO9A 4LYHA 1A2KC 2Z6VA 4V0LA 3HR8A 4HZUA 4Q4JA 3M4YA 2DYKA 3CZPA 3RS2A 2RHMA 4JLMA 4ZKDA 1D2MA 2I1VB 1NVXQ 2RGAA 1V43A 1W7AA 1MRNA 1Y63A 3FOZA 5CDFA 3TR0A 1OH6A 4E22A 4BWYA 2IS1A 4A0HA 2OV2A 2HT6A 4B35A 3E1SA 3SS8A 3K9GA 5GADl 1NVVR 4JKIA 4G3XA 4Q02A 1U94A 4AD8A 1ZUHA 2PZEA 3OEEA 2J3EA 1OIVA 3WMFA 721PA 4PHGA 4Q4HA 4TN1A 2ZIAA 1OF1A 1S3SA 3KFVA 2OLJA 2R62A 1D9XA 1E2DA 5KHOC 4KITB 1G4UR 1SZPA 4ARZA 3PEYA 3GFTA 2VYFA 3OEED 3PIRA 4DCUA 3DZDA 2DR3A 2WJYA 1RPZA 4EJSB 1KY2A 4NYIQ 4QBIA 3B7GA 1C1YA 3RS5A 3RSLA 3UPUA 1G3UA 1EXMA 1G5PA 3K0CC 3V00A 1EESA 4IOLA 1V5WA 2JDIA 3SOPA 2F43B 3CNLA 2C03A 5SZJA 2Q21A 3TNFA 4ZCIA 2QAGC 4LYJA 4FMDB 3IO5A 3TBKA 4EQ6A 2B7BA 2J5XA 4A2PA 5GJWC 3WYFA 1S4QA 3CZQA 5JRJA 1OLOA 2IUSA 3K0AB 3QXJA 5L3SB 4TYNA 1EK0A 4LHXA 2ZI5A 5DLQC 3GLGB 1Z2CA 1KJYA 1II8B 1U99A 2OESA 3SFZA 2JJ8A 1JI0A 4D2IA 1WBBA 1C9KA 2MMCA 5JFGA 1MT0A 3LDAA 4F4IA 4A9AA 1GL7A 1N6HA 4CT5A 5FI1B 5FI0B 5C4MA 4W5WA 1Z83A 1E6CA 3BK7A 5E7JA 2ZJ5A 2JLSA 4N0DA 4UJ3A 3CBQA 3K9LA 5BYKA 2ZE8A 2XAUA 3IQXA 2ZRBA 4DWJA 4M53A 3U44A 3EZFA 4PC1A 3WBKA 2QEQA 2GCOA 3KJEA 4G5RA 1CR2A 1DAKA 1JAIA 1EFHA 2JLYA 2YNMA 4RVCA 2YYZA 4L4UA 2GK7A 2OAQ1 3RRZA 5H68A 1U9IA 221PA 2QMHA 3KQUA 4P3YA 4QC2A 3RWOA 1ZIPA 5K8IA 4TQAA 1ZC4A 2GZHA 3GJXC 1D9ZA 2HJGA 4MRNA 1DAHA 2QPAA 4NYJQ 4OQXA 4Q66C 5J4VA 3MSXA 1VECA 2J0UA 4OI0A 2C77A 4KV9A 2CNWA 1GNQA 4G1UC 4BLTA 3DM5A 1XDBA 4LBYA 2V7QA 3TKLA 3OIUA 1WRBA 2W83A 2JAQA 3KUDA 1M7HA 3H1TA 1J2JA 2ODEA 2DFTA 1JBKA 2DY1A 1W44A 1KO5A 1R4AA 1XTIA 1IJEA 1G18A 2GKSA 5EE1A 4OHWA 4CEIB 2C95A 3AM1A 2Z4SA 1D8TA 4DB4A 2V7QD 5H70A 1W36B 2QNRA 1BIFA 2P3SA 4HZUB 2HT1A 3QXSA 1RIFA 3SYKA 3EPHA 4IDHA 4KXFB 1P75A 1Z6YA 3IIMA 3KJHA 3OAAD 5EXPA 2QN6A 2OO7A 2D74A 3UIEA 3VR5A 1AS3A 1SXJC 3X1WA 2BWJA 3EWAA 3H4MA 1ZRHA 1XJ0A 3M0EA 1E99A 1OE0A 2IC5A 4R9UC 4GNKA 4MGYR 2AWNA 4QG7A 5DYIA 1KDPA 1T3HA 1F48A 1KNQA 4FD2A 3W5JA 4AG5A 3ZLJA 3PUXA 1ODFA 2I1QA 4DB2A 4Q4HB 3CX8A 4HB0A 2XJ9A 4TT3D 1ANKA 2PJZA 3ZZTA 3VNVA 5TARA 2WBLC 5HCIA 5C4GB 1E79A 2JLRA 1IN4A 4DRZA 4BZQA 2BM0A 3T34A 4D26A 4R2HA 3ADCA 1FZQA 5BW8A 2YVUA 2YC2C 2IYYA 5E95A 2O8BA 3QG1A 1UEIA 2ZYUX 5K8UA 2F3TA 2XITA 4BGDA 4D25A 1QDEA 3LX5A 1E96A 4URWR 1OIXA 5KSPA 4RZXA 1TX4B 3VHXA 5J47A 3CUEF 1XZPA 2G9NA 1LF0A 5JRZA 5FTKA 3LVQE 5G53C 4YMTA 2YOHA 5CJPA 4I99A 3FYHA 2F3RA 2QUZA 1Z6GA 1G7CA 2VF8A 3MG9A 3DOEA 1KSFX 1QHIA 1XCGB 1YR6A 2D62A 3KKMA 1F2TB 3VR6A 3V4RA 4DEYA 4RJLA 3GCGA 3TSZA 3N2IA 3AP1A 3GJ6A 1NIPA 4YDHB 3O8BA 4M9QA 2ZJOA 5DI9A 3RS3A 1A5TA 4Q7JB 4TYQA 1RW4A 3IQWA 4RKFA 3ZVRA 4V02A 3BC1A 4KCGA 1MV5A 3K9HA 4GOKA 4NCNA 2PT7A 3ZD6A 3AVWA 2QBYA 2V6IA 621PA 2P67A 2X8AA 2GCOB 4HUQA 3SYLA 1ELOA 2O8FA 1JJ7A 2AX4A 2ZR7A 1XPOA 4Q1EA 4Q9HA 3BB3A 4MDFA 1FNMA 4JT4A 1OH8A 3I4LA 5JS8A 3OIWA 1K8RA 2BMEA 2ERXA 4LHVA 4HAYA 2OXCA 1Q1EA 1ZD1A 3KQNA 2C9YA 2ATVA 1Z07A 5JCPA 3CRVA 2FJUA 2J0UB 2QM8A 3LNCA 5CK5A 1S9HA 5EE3A 1G8YA 4D4LA 4GZMA 3UKDA 3NBFA 4XVQA 2HEIA 5KNBA 1DO2A 4KFRA 3QPWA 1M8PA 1N6LA 1VIAA 1QBKC 3BH6A 1R6BX 4JLVA 4JLAA 1LTQA 4ON9A 4PTLA 3RHFA 1J90A 3EX7C 4M1TA 1Q3TA 1JB1A 1Z06A 4GRAA 1NKSA 1KTVA 2IYWA 1U0JA 1E1RA 1M34E 3QBTA 5FUVA 1VYVA 5BN3A 2OBLA 1F2UA 3FHOA 4US0R 1I4TD 4WZAE 1ZAKA 4M1YA 5EZ6B 4Q21A 1QHGA 1NLZA 3JVUA 4PQFA 4ILEA 5CJ2A 4YMWA 4DLXA 3L0PA 4QM6A 5BYJA 2ZRLA 2NOAA 5TB5A 2CEAA 1DAMA 1DPFA 4Z8YA 1KI4A 2WPDA 4BLSA 4TZ6A 1ETUA 6Q21A 2DWQA 2E1RA 2ODBA 2Z0MA 3QKSA 3IBGA 1COWD 3RRNA 1UBGA 2BV3A 2H1LA 1AQYA 1OKKD 4QGFA 1Z63A 4QFMA 3GJ7A 3L2OB 1QHYA 3CF0A 5IDVA 4W9MC 3U3KA 1GILA 3U7HB 4EAQA 2O8BB 2P6UA 3FMOB 2QMUA 5CM9C 4ZIRA 1YZNA 2NGRA 4ABYA 2R44A 4BUJA 5CYPA 2WKPA 2GXSA 4NCIA 1T0JB 3M6AA 4I1OA 4IHQA 5C46F 3H86A 4TMXA 4E09A 4URUR 2JATA 2YWHA 1MR3F 3IHWA 4MKIA 2MSEB 1ZNWA 2H8KA 4A0RA 3RLFA 1U2RA 5J4HA 4BEBA 3UWOA 2B6HA 1VG1A 1VIYA 2NZJA 2YOFA 2R6FA 1W0KD 3LQRA 3CRQA 4DZZA 4AYWA 1NIJA 1XWIA 1D6JA 4OI1A 2GVDC 1NG9A 5IK2A 2QSZA 1G3QA 5A0FA 5FL7A 4ZDWA 1E2JA 2PX3A 2A9KA 1R0XA 2OT3B 4MITA 1ZIOA 3I3SR 3W6NA 4F38A 4OQMA 1Z0DA 2IBMA 3FKSA 2WV9A 2FPLA 5B57C 3CRW1 3EPLA 3QF7A 2AXPA 1OYYA 4KU4A 3WYAA 1JECA 2QBYB 4CZ2A 2GWHA 1E0KA 1IHUA 4HUQB 4OHYA 3R9WA 4GFDA 2H92A 1YRBA 1ZM2A 5FBLB 5KUTA 3AVXA 2D3WA 4LV5B 3QIAA 3TR5A 1FUUA 1BH2A 3OE7A 3BAFA 4OK6A 1CBUA 3SC3A 4KVAA 4AG6A 4EFLA 3TUJC 1R5NA 2AL7A 2GBLC 1Q12A 2ZS9A 1BS1A 2R6CA 3HU3A 4XJXA 2OCAA 5L3QB 3HPQA 2G6BA 1NG1A 2C78A 2RHDA 2QG6A 3EAQA 2C98A 4NU0A 3RS0A 4ZPXA 4LRWA 1N6OA 2ZAOA 1SHZA 2NO9A 1UJ2A 3C5CA 1GRRA 3BRWD 3PUVA 4A2WA 5IHPA 1G8PA 1E1QA 1NBMA 1MO5A 4IDQA 3TVTA 1RFLA 1TQDA 821PA 3BJIC 4JLBA 5FPYA 1NJGA 3WY9A 4Y0VA 3C5HA 2CVFA 5L3RA 2YKGA 3K1JA 1T3LA 5JCZA 5FBRB 2RGCA 1NBMD 2O0JA 5JECA 2NPIA 1SKQA 3C7KA 3H2YA 4PC3A 1NI3A 3EZ9A 1HEIA 3GLFB 2BEKA 5F9FA 5TDHA 2G83A 4QXAA 2CCKA 5HZHA 1T0HB 2GEUA 1MOZA 3FHCB 3HP1A 3KKQA 1LS6A 2R8RA 1IBRA 5FBWB 1I4LD 3L82B 1J99A 1LS1A 4YMSA 3I1FA 3G82C 3ZJYA 2IWRA 3KKNA 1WXQA 2O8DA 1E2FA 4LBWA 1ZUIA 2Q0HA 4E03A 4FI3C 4DUGD 2ZS7A 1FOEB 2BEJA 4I1SA 2CK3A 5TXGA 4PSAA 3LW7A 4A8JB 1QHXA 3V9PA 3CRRA 3A1UA 3M1IA 1I2DA 2RGDA 1E2PA 1G4AE 2CK3D 4R7ZA 3TQFA 2FU5C 2J59A 4TYYA 2D4HA 1GG2A 2GEVA 2WVJA 4O0MA 2WKQA 5AUNB 1EWQA 3DPUA 1VCOA 1TNDA 2DFKB 2J41A 2FFBA 3CX7A 4JL5A 5CYOA 1CJKC 4W7SA 1DTSA 2RGNA 5CIWA 2LKCA 2BBOA 2WWHA 1W36C 3LRPA 3WMEA 1AQUA 4M21A 1W0JA 2W6JA 1TUIA 2OFXA 4II7A 5KPJA 5KPDA 5JS7A 3EZ7A 1N6RA 1F3OA 3B1ZA 2V54A 3D31A 4OJKA 4POAA 3K09A 4A15A 3O8RA 4MUBA 3KJGA 2OCBA 2D2EA 4JL6A 3AQ4A 1W1WA 1IN7A 4L15A 1YZTA 1F6BA 3TVDA 4ZKEA 5KTYA 2Q3HA 1G16A 3R9XA 3FWYA 2XJ4A 4C0BA 2FDCA 4V0MA 4XH9B 4TLCA 1IY2A 1NP6A 2HXSA 5JEEA 2B21A 5FTMA 3T1TA 4M2LA 3NXSA 3B6EA 1WA5A 1CR0A 4KYUA 1T91A 2FGJA 1KOFA 2FNAA 1MO3A 4IDPA 4DLRA 2IEZA 2QENA 4GPTA 1VG0B 3THOA 2ZRIA 3WP1B 4MKFA 1KYIA 4LK2A 1IN6A 4PFSA 2IXGA 5JEDA 1SVSA 1U8ZA 4DHEA 4JLJA 1OYWA 1YHNA 4CT4B 1N5JA 2G1JA 3KTAB 1DVRA 4QL3A 4Q1AA 2P65A 4M8NE 3OFNA 1KZ7B 1E98A 4DCVA 2IF0A 3I8XA 3IKJA 3EARA 4M1MA 2GCPA 3PEUA 5GJCA 1IOZA 2H57A 3TLXA 4DEXA 1A7JA 1I2MA 1P7CA 1CJMA 2GETA 1GL9B 3VR2A 3C4JA 3AKDA 3X1DA 3KFXA 1T8TA 2V4ZA 4RCYA 4OBEA 3HWSA 3KZ1E 1M6NA 1X8KA 2ZR9A 1GVNB 4QHYA 4EJSA 4JLOA 3FKQA 3EPJA 2ZSDA 4AY2A 1HY3A 5TY0A 1U9IC 4CVNA 1U8YA 4H9GA 4MKGA 1G1MA 4HUTA 2GESA 2GDJA 2A2ZA 1AGPA 4MGIR 4DLUA 3RNLA 1MABA 1FNNA 1ZVQA 1DADA 2EFHB 5BXQC 2ZYVX 1SVLA 4BPBA 3TJZA 3K8YA 3AVUA 1F5NA 3I62A 1GIAA 1GRQA 3K0AA 4TMWA 4QJ5A 5EXSA 5FPSA 1U98A 3BGWA 1S9DA 2RGBA 4BLQA 1II8A 2KB0A 4TTPA 2ANBA 2V8OA 4V03A 4PQRA 2FSFA 4KI0A 2FWRA 2ZI7A 2QY9A 3SHWA 1A1VA 5FOSA 2CL0X 3LV8A 4LHYA 1HQCA 4HB3A 4LZZA 1J7KA 2IXEA 4UNQA 4OK3A 4B76A 2WHXA 4ZDKA 1J8MF 3FB4A 3AF3A 4IVQA 4LSGA 3PUYA 1Y3AA 4CIDA 2GK6A 4P32A 3LLMA 1SHKA 3AVVA 4URYR 4RZ3A 3AVYA 3ONWA 1KNXA 4M0LA 1KK2A 2Q9BA 5ANRB 1N6NA 5DI3A 3B82A 1S2MA 1SVKA 1PUJA 4Q9KA 4KSCA 2ONJA 3AF0A 5C18A 1HUQA 4EPTA 2ZRGA 2OG2A 2WIBA 2QTHA 1LF5A 4F91B 3B1YA 3ZYCA 3CX6A 2P2LA 3S1AB 3NHAA 1OT3A 4CDGA 2IYUA 4K8OA 1KI6B 1FMLA 2CBZA 3TGPA 4RD0A 1AJEA 1N0VC 3PENA 1D2NA 2ERYA 4M9SA 1CR1A 1YJ5A 2JJ1A 4QJ3A 4JZKA 4G5GA 5EJEA 1TPZA 4JJKA 2REOA 4BZXA 3VKHA 2L0XA 3MCAA 4Z51A 4I81A 2JLUA 1EX7A 5DGXA 3EWSA 4EPRA 1Z0AA 4FIDA 5CB6A 1CULC 2XZPA 2JJ1D 2GAOA 4JYBA 3SNHA 2HUPA 2IYVA 3AVOA 3DVLA 3LH5A 5HTKA 2AD5A 3T35A 3WNBA 3MWJA 2XXAB 4H1VA 3A6PC 1G5RA 4MRRA 4PC2A 3AVQA 2QA5A 2D06A 2HDNB 3KX2A 2ORVA 3BD9A 4Q1CA 2OE2A 3CW2A 1JR3E 2VP5A 5JMTA 2PJRA 2WMNB 5KNDA 1K5DA 2F7SA 1XZQA 3T1QA 3MWYW 3T1OA 3FGNA 4G0NA 1ZM9A 2OCYC 4HDOB 2BMFA 1WP9A 4DSUA 3ECCA 4IXNA 4M1SA 5FPHA 3SYNA 1QG4A 2P6NA 2ANCA 4KO8A 3A1SA 4A4DA 4M9ZA 4EPVA 1P3JA 3THXA 3ZDQA 3KDSE 2QQEA 1GNPA 5TVKA 3PCRB 2A5DA 5A4JA 2GXAA 3TH5A 4EIWA 1ZM3A 3CNOA 4JBXA 3F5FA 1MABB 3BORA 1NLFA 1WDTA 4BFWA 4F4CA 4QHTA 1UEJA 2C5LA 2EW1A 2QT1A 4DLVA 4YMVA 2NMVA 2IT1A 1F2TA 3P27A 2IUUA 2H17A 4B3GA 4F93B 3B13B 4DBLC 2FEOA 2QZ4A 4NTZA 3B2EA 3SBEA 5AUPB 2FSHA 1G5TA 4JBWA 1DAEA 3THWA 1XMIA 2AKAB 5GJVC 5JI2E 1P62B 2F1RA 3A37A 3SFVA 1U90A 4R98A 4NCKA 3QOFA 3FMPB 1XX6A 1YR8A 2EYUA 2EFCB 1QVRA 1NSFA 2GILA 4ASUA 3CPEA 2RGEA 1NL3A 3ASYA 5AR1A 1S96A 2ZU6A 3HR7A 4PAMA 4RSGA 3NH9A 3DO6A 3W9YA 1Q3HA 1N5KA 5J4YA 4EDHA 3X1ZA 4AKEA 1JQLB 4XOIA 4CF7A 1SGWA 3GLHB 2WWYA 4TQUS 3IO3A 3EZ2A 5DI3B 2VO1A 3TSWA 2IYSA 4NHOA 3IUYA 1XPRA 2ZYWX 1YZQA 4S35A 2IYXA 4PHTA 2VH5R 1DOAA 4PAOA 2ZVQX 4BRWA 2XTNA 3A58B 2C8VA 2DFNA 3ADKA 2WICA 2ZI9A 5KSYA 1L8QA 4OQFA 3UG7A 3CWQA 2OAP1 2ZI6A 5AWFC 3CIOA 2PCLA 1Z0KA 4D0GA 3QUSA 2NPFA 1Z28A 2PCJA 4BASA 4LWZA 4WXRA 3VFDA 3BS4A 1K6MA 1TF7A 4TLDA 1FTSA 3OAAA 4JVLA 2MSCB 1E2KA 1UKVY 3KJIA 3KXKA 1ZYUA 1U0LA 2WSSA 4G01B 4Q4AA 1XMVA 2O8EB 2ASEA 2OILA 1UKZA 4WZ6A 3X1XA 3EA5A 1LY1A 1W47A 2NQ2C 4B44A 1JR3D 1G64A 1U0HC 2YZ2A 4FXPA 1H8HA 1K5GA 3IEVA 4HAUA 2WSSD 4TT3A 1TAGA 4WW0A 3BERA 3GD7A 4C3ZA 1E9SA 4Q48A 2ZVPX 4NMMA 5EXXA 1ZD9A 2VP2A 4JSTA 4FWIB 1H8HD 4DKXA 1XCMA 2REBA 3C15C 4X8LA 2QE7D 2FFHA 3N2EA 1KI8A 5CM8B 3U7EB 5AJVB 4YONB 2BMJA 1KO8A 2XTMA 2VRWA 4A92A 1HYQA 1Z08A 2A5FA 3HU2A 3Q72A 3BOSA 4DLYA 4GMDA 2ZRDA 3QEOA 1GTVA 1Z0IA 1FX0B 1P5ZB 2O52A 1E9BA 1XTSA 4Q5IA 5G3ZA 3WMGA 4ACAA 3K70D 4PPNA 1YZKA 521PA 2OFOA 3P20A 3BXZA 1XEXB 1IY0A 1W4BA 3THXB 2H7VA 4HB2A 4A0GA 4N3NA 1N3BA 4FMBB 1E9AA 1GWNA 4FCTA 4C0LA 1VCIA 5F9HA 3VX3A 2BKEA 2GAAA 5C1BA 2HCBA 1ZC3A 4OQNA 2QTFA 1SKYE 1NN3A 3AKYA 5DN6D 3GQBA 3GJ8A 3K0FA 4TMVA 5KO2A 1G9XA 3PVSA 5KDDA 3VU9A 2QRZA 2XZLA 5JJKA 3T5DA 1G3IA 1UM8A 1E4VA 1O87A 3DOFA 3GEEA 4ZCLA 3B85A 2FH5B 3NC0C 4NCHA 1JXMA 2V6JA 3D8BA 3N70A 3RABA 2PL3A 3QG5A 1AIPA 1ZM7A 4ZO4A 3THWB 4W5JA 4HLQB 1QZXA 2J1LA 2OCPA 2UVQA 3AVTA 2ZRMA 3LBIA 4N0EA 4X8MA 1VCMA 1KAOA 1LFDB 5F2EA 2PLFA 3ZD7A 4CEHB 1X8LA 2WOOA 3LX8A 1GOTA 2QPTA 5AUQA 5JJIA 3FMIA 4MGZR 4BLRA 4C0KA 1E2LA 1X1RA 2F9LA 3OIVA 4JS0A 1UKEA 1WF3A 3NBZC 3GMTA 1Z0JA 1PVOA 3W34A 1IM2A 1TEXA 1FL9A 3ZVMA 1S1CA 1OW3B 1XCPA 5JHHB 1MO4A 2DWPA 4QRHA 2EU8A 4PANA 3T1VA 1KJZA 4QM7A 2W6IA 1VMAA 3FMFA 3AF1A 4DCNA 1GP2A 2VIIA 2ECKA 5L3QA 2QROA 1S8FA 1GKYA 4PQYA 4AYTA 4US2R 3PUZA 4BLOA 2H18A 2W6ID 1MKYA 4TL7A 1SXJE 2ZRPA 4GDFA 1YQTA 2G3YA 1SVWA 2ODWA 1H8ED 5KDLA 4XVUA 1ESNA 1EFRA 1W5TA 3NH6A 1IN5A 2ZEJA 2PMKA 4GOJA 1DARA 3HYTA 2FPMA 2JIZD 3TQCA 1ZW6A 4LJ4A 3P32A 4B32A 4Q4AB 4DIEA 2YWGA 3W90A 1PLLA 2ZJ8A 4RZUA 1ZBDA 3G0HA 1G41A 2BJWA 2TMKA 4GZLA 3E2IA 4XWKA 5LD2B 2RGNC 5AJZA 1UPTA 3GEHA 1NMXA 4MQBA 3WRYC 4B33A 1EFRD 3GLFA 5TV2A 1GNRA 1QVAA 4JVMA 2IXFA 1JJVA 3QXCA 1KIMA 2VHQA 3QPVA 4B3CA 4ITRC 3EG5A 3WRXC 4YQFA 3U7FB 4MYTA 1COWA 1AZTA 1OKKA 2IW3A 3K09C 1LNZA 4GSYA 1AGRA 3K0EA 1WE2A 4TYPA 2ZJYA 3D6TB 5FL3A 2GA8A 4RZ2A 4A8JA 4X8HA 3K70B 5CLLA 1ZINA 2DFLA 3REGA 2Q3FA 3TSOA 2BOVA 3CNNA 1DBSA 1UBEA 2OZEA 1G8HA 1XB2A 4QGHA 2JLXA 3DEFA 2O0KA 5EQTA 4P31A 3FPAA 5LDDC 2RB4A 3DMNA 4XWAA 2GF9A 1W0KA 2IK8A 3ZZ0A 3A4LA 3I61A 1KI3A 1W4RA 2IL1A 4HDCA 4IW3B 5EUQB 4M22A 2V3CC 1R5OA 4B3BA 3ZQJA 1Z2AA 1FMJA 1ZU4A 1XMJA 4OQLA 1G8GA 1NKTA 3QSYA 2FF7A 3K0FB 2ODNA 5JWOA 3LBNA 3MJRA 4G5OA 3UATA 3VU9B 3W8RA 3GLIE 1E94E 4GP7A 3UMSA 3BE4A 4Z1MD 2WJIA 4DSTA 3LY5A 3BB1A 1BO6A 4JLNA 1JR6A 3KKOA 1KK0A 4OHXA 2YHSA 1DO0A 2ZRKA 4DDWA 4LJAA 4F7WA 2REXB 2PX0A 4URZR 5FOXA 2EWWA 1IXSB 3TW4A 1E9EA 3AP2A 1JNYA 1R0WA 1G291 4QJ4A 2F1HA 2XOKD 3NC1C 1EFTA 3P1JA 1KI2A 3R8CA 3A8TA 1L2TA 2NIPA 2NO0A 4NZYA 3W6PA 5BWMA 2ZRHA 4BECA 1Q21A 4CYMA 2XGJA 2FG5A 4B6FA 1G3MA 1NY5A 4Q19A 1NLYA 2J7PD 4DCSA 1XF9A 5IRCD 2QMOA 4HZIA 3CONA 5JLJA 2AR7A 2GHIA 2WWGA 2Q9CA 1SXJD 4UNNA 4EJSC 4NDZA 3QPUA 3ZS9A 5BN5A 3I5XA 2QMEA 5B30A 2VBCA 4B2LA 4EKDA 4BZPA 3O8CA 3GJ0A 2VEDA 4DLSA 1XXHE 5L8VA 1ZU5A 4JL8A 5BN4A 4AK9A 1EWRA 1KSJA 3BWDD 2ZYTX 4QBFA 1OXTA 2NO6A 3NKVA 3MGCA 1A82A 4OL0A 4D82A 4EPYA 1BKDR 1IN8A 5H8WA 1KKMA 2OM2A 3MLEA 3H84A 3KTAA 4JBYA 1CRQA 3T61A 3TK1A 4UXIA 1WB9A 2O0HA 4UXHA 5B2ZA 5CITA 2IYTA 2ZUBA 2ZXUA 2JLZA 1P72A 3TRFA 3K53A 4N1AA 2J9RA 4Q01A 1R0ZA 2BIFA 3KB1A 4MA4A 1HH4A 2OEPA 4DJTA 3WP0A 4DUGA 4DDTA 4P33A 2FZ4A 4IFBA 1Z6XA 2KBEA 1NY6A 4E5UA 1RYFA 4ZI2A 2Q3MA 1OV4A 2JLQA 1LVGA 1XBTA 4BFZA 5SZHB 1SKYB 4D80A 3T15A 3F8TA 2YC4C 1B23P 3D3QA 3ZVLA 2VP9A 1E9DA 2AFHE 3VR4A 4B3XA 4OJQA 4DDUA 4JLPA 3JZMA 3SZRA 1NF3A 4EPXA 4MYUA 4ZCMA 1X8JA 4QGGA 5LBIA 5FBQB 5FTLA 2B8WA 5FOVA 2FOLA 2BCGY 3I73A 4BQSA 2XB4A 2P0EA 2P5SA 2W0MA 2DPXA 3ADDA 4IOKA 3D7MA 3GJ5A 1HTWA 4PC6A 2ZSFA 1E3MA 1R2QA 1NN5A 1CR4A 2C04A 3NBYC 2HXYA 1ZNZA 5LB2A 3LFUA 1QRAA 1OSNA 1AZSC 3AF2A 1OPXA 2DB3A 2OUKA 2CE2X 3LD9A 2WSMA 3EW9A 1YKSA 5KYKA 2JJ2A 3KB2A 1UDWA 2FFAA 1ZD8A 4FN5A 5EP2A 2X2FA 4AYXA 1UBFA 4PSKA 3NDPA 5SZIA 1OXUA 4PX9A 1KO4A 3A4NA 4LJ7A 4C7OA 1W2GA 2PT5A 2JJ2D 1US8B 2OBMA 4FWTA 3R9IA 1KY3A 1SXJB 3L0OA 4K81B 4XIGS 2VHCA 2FSIA 2V1UA 1P9NA 5J4LA 4C0JA 4PPGA 5TMPA 2Y8EA 2RH5A 2BBWA 1LB1B 1SVMA 2KJQA 4A82A 5J4KA 2G1KA 4LHWA 4O25A 3ZH9B 1T8UA 1KJWA 3DKPA 4LJ5A 3AP3A 1G8FA 3PFIA 3GLGE 4X8OA 3S1AA 2VSOA 4UNPA 1X1SA 1SQ5A 4O3MA 2ZU0C 4W5HA 3WBJA 1KI6A 2AHOA 4MRVA 3B5JA 2IEYA 1G17A 3WXMA 1WMSA 3IHLA 8OHMA 4AI6A 2W0SA 3U3MA 5AJXA 2Z83A 3T5GA 5E4FA 4MUAA 4RD3A 3BB4A 4B3FX 4KLNA 5HCNA 5FPTA 1DS6A 3GJ3A 1P60A 4F92B 3R8FA 4YC7A 2QU8A 4DXAA 1X3SA 3EPKA 1TTTA 1ZNXA 4LJ9A 2XXAA 2GJ9A 4Q7LA 3T12A 1FQKA 1FFHA 2GJAA 2SHKA 2WWFA 3N5CA 1CJUC 2DCUA 5G40A 1G20E 3TW8B 3TUZC 1S3GA 1E9FA 1G7TA 3PV0A 1WQ1R 3W6OA 1KI9A 3CR8A 2XNDD 3SQXA 2GJ8A 2FV8A 3IIKA 1FTNA 2J0SA 2F55A 2HYDA 4UQOA 3DHWC 3GEIA 4TLBA 5KSZA 1M7GA 5EE0A 3PITA 4Q00A 4LHZA 3VKGA 1Q57A 3KQLA 1NMYA 4HAZA 4PAQA 1Q20A 1ESMA 1OFTA 2EFDB 2CL6X 1AS2A 4LI0A 4Z8XA 1XJCA 3NBXX 2ZE5A 1KI7A 4LCBA 4L5BA 4WXPA 1P4SA 1A2BA 5EP3A 1KMQA 4RFVA 5UKDA 3SI7A 3SR0A 2BCJQ 2CLCX 4RFSB 2IYQA 3Q3JB 3IILA 3KXLA 3IGFA 5CDFE 4DC9A 4TZ0A 1R8QA 1T4GA 4UKDA 4V0KA 3RRYA 2XSZD 2BM1A 2GZDA 1T5LA 3Q9LA 3KQKA 3AF4A 3ZS8A 4LC0A 4LJYA 4MDEA 4GT1A 4EFNA 3OEHA 2ZSEA 4QBGB 4BLPA 4FW9A 1QG2A 3DZ8A 4S2EA 4P0TA 3RYTC 1CLUA 3CO5A 5LD2C 4XSGA 2BMDA 4IXMA 2ZJBA 1FPMA 3PG5A 3SJAA 2E87A 4RD4A 5M04A 1LW7A 2PBRA 1P2UA 2MMGA 3FFBA 4OYHA 3OEHD 1DAFA 1OJLA 4IRUB 1TF5A 4B2PA 2FSGA 2OHFA 4C7OB 1T9HA 3GLHA 4KFTA 4L9SA 1E2HA 1XNJA 1AKYA 3OF5A 1TADA 3ETLA 1XJQA 2PH1A 4LV6A 3RDPA 2WIAA 1YR9A 4CEJA 1YZLA 4NPHA 1MO6A 3Q7PA 3Q85A 3EXAA 4B71A 4JJZA 1OB2A 1Z6AA 3EA0A 2BBTA 2ZI3A 4QKQA 2IA5A 2A5YB 2WJGA 2VP6A 4FMCF 1UAAA 1VHLA 2EFEB 1KDOA 5ELXA 1Q22A 1HA3A 3EASA 4GL2A 1CF4A 3A1VA 3I72A 3OIYA 1II0A 4C30A 3SDZA 1RVDA 3QNUA 4KBGA 3VAAA 4D4KA 2CHVA 4HEJA 2EFGA 2AD1A 1M74A 4P4TA 5J40A 4HSEA 1E4YA 2O8EA 1YRAA 4PZYA 3LXXA 3ND8A 4TWZA 1RC8A 4TTQA 1L4UA 2W2VA 2FMXA 4JLDA 2C99A 2ZJZA 1XEWY 3CM0A 3TAUA 4O2LA 4MRSA 3VTKA 2QORA 4UJ5A 2WWIA 3THYB 3U6BA 1YE8A 1N5IA 2P6RA 1XTJA 1NSTA 4R71A 1FP6A 2IUTA 5EUMA 3X2SA 3ICEA 5FBVB 5E3HA 4AWXA 1W2HA 1KMHB 1PLJA 2Z43A 2F9MA 5DHAA 3QXHA 1R7RA 1Z5ZA 3IEUA 2CHQA 2WAYA 4JLKA 1W36D 1JQJC 1G7RA 2VLIA 1W4CA 3FE2A 5CIQA 1Q44A 3H0KA 5J5CA 1FX0A 5G3YA 1IXZA 1P6XA 2RCNA 1MRSA 1SULA 5DSZA 2WKRA 1UBCA 3UG6A 1XEXA 1I4DD 3CKLA 3LAWA 3CPHA 3UK6A 3AUYA 2LKDA 3DMDA 1II9A 1F60A 3U6KA 1AM4D 3NEYA 5HR5A 5GVRA 5E7IA 2PEYA 3B60A 5FTJA 2VP0A 4LV8B 5HE9A 2BJVA 4JSYA 3TIFA 2DHRA
chains in the Genus database with same CATH superfamily
1J0AA 1N8R2 2EX1A 2ZRAA 1XZEA 3B8EA 4R41A 1Z2NX 1E69A 4KX3A 5JTTA 1AUOA 1Y6JA 2GD6A 3PGJA 2JHPA 2PZAA 4QAJA 4QOSA 3BFXA 4YMUA 4GR9A 1CJCA 2VI5A 5FQOA 3ZDFA 3RO7A 5JD6A 4OLBA 3RS8A 3WV5A 1E3EA 5K05A 1ECFA 1F8GA 4FHFA 4G07A 3QVJA 5BYBA 1AA6A 4HH1A 1DC4A 3ADPA 4WCFC 4HK4A 3OZFA 4WUTA 4R84A 1ES9A 4EG1A 2UYHA 4BNTA 2E4AA 1HORA 4RVNA 4L08A 4CETA 1ML4A 5WRFA 5G1NA 4O2RA 4L9WA 4NDNE 2F62A 4F8JA 3AHFA 4RPKA 2Z2IA 1KJIA 5LL6f 1I32A 5H7XA 5SV2A 1XZNA 3NGMA 3G89A 2F1OA 5C0OE 2ZT8A 1JQKA 2HLHA 3LT2A 1NVWQ 4D4JA 4KWTA 4RTJA 3IIIA 3U3JA 2QE6A 3TLYA 1P5JA 1VQ7Z 3GLKA 5DCLA 1GV1A 3LA6A 3JTEA 5DBGA 3RC8A 3IP5A 2Q5JA 4MWGA 1BOFA 1ZRMA 5CDYA 5B1SA 5E7MA 4BEVA 3OPYA 4CGZA 1M8KA 5DYGA 5H3LA 3KIPA 2ZROA 5DEOA 2WPNA 4BPRA 1NOIA 5COBA 1ULHA 2DR0A 3KHTA 4B2IA 4WEOA 2HX1A 4FYIA 1WKBA 4G1VA 4QJBA 3F3KA 3GGDA 1EFVA 3PLNA 4LYGA 1IXRC 1T2AA 3EVCA 3LT0A 1DAPA 4MRPA 4XYBA 3E9NA 1Z16A 3WHKA 5JY1A 4KG7A 3PC6A 5KWEA 1CDZA 4WVFA 3C48A 3K1AA 1JILA 1GZDA 5EINA 4NYMR 4F11A 5ICSA 1RRFA 1XTRA 1Z26A 4MVJA 3ZGVA 1JRLA 1ZM4A 2AK3A 4Y6QA 5EP1A 1EK2A 2NPOA 4Z2AA 5JSZB 3F9CA 3TEMA 2H7XA 2EFYA 2RT9A 1XTVA 1EBBA 5K0FA 1NP7A 4XTCS 3V2UA 3M9LA 1CXZA 3FPBA 4DE5A 5JYBA 2JC3A 3UB4A 4H0CA 4JU8A 4X7RA 2QE7A 3P94A 3P0HA 5F5NA 5LMZA 4LPKA 3CVVA 4HTFB 4EPWA 2WYWA 2XUAA 4J4HA 5DE3A 3UT5A 2BFOA 4HH4A 1SVNA 3R44A 4KFSA 5HZGA 5KJFA 4QTUB 5L4NA 5IVHA 1WOYA 2O3SA 1OA1A 3F3YA 4E31A 4RENA 3B1VA 1Y7LA 3CEHA 3L6CA 4A3EI 4AURA 4BO9A 5BMVF 4M98A 3SLRA 4MW9A 3DG9A 3UV6A 1Y3HA 2OBNA 5BNIA 1VMIA 4IJMA 1QE3A 4RD1A 2BISA 4TKVB 4Y2VA 4EGSA 1A9TA 4FFLA 1W29A 1KGDA 2XTAA 3PC8A 1Z4JA 1E9CA 2CDNA 4P53A 1T5IA 2C0PA 1CZNA 2QTMA 2VRBA 3KDAA 4J4BA 1ADCA 4Y7DA 3TL6A 1QRSA 1FFDA 2V9ZA 2IDZA 2WNSA 1TMKA 2Z9CA 3JSAA 1ZLYA 2CV1A 2ZBEA 3CPWY 3H3VJ 3FNBA 5DN6A 1GKKA 4CMHA 4QICA 2PK3A 1UANA 3NOVA 3PBKA 4X63A 2GSWA 3SYRA 5B3LA 4GKAA 4UAJA 1I1HA 3HVIA 3O4VA 1ZJ6A 1TYEB 1GYRA 2ZBRA 4WDQA 5DVZA 1CKEA 2Y1XA 1K88A 5B6IA 3EIUA 4LNAA 4NYIR 4ARZB 4RY2A 2ZJ2A 3PZRA 4UBNA 2VQSA 1XU4A 2RHCA 4IEEA 2JEOA 4DJJA 3GUCA 5HFAA 1LDBA 4C4TA 4EGJA 2XHZA 4MJXA 4TXHA 2CN1A 2PUFA 4JELA 4HNRA 2GJSA 4F60A 1HE5A 1NI4A 2JFNA 5A4DA 3O93A 3F2VA 1C4OA 5E2AA 1BVHA 5REQB 2A1TR 3J80b 1QYVA 1M2KA 1P5RA 4A3DI 2Q1YA 1GT6A 2D1RA 3DKVA 5EG5A 5LJIA 1VRCA 1CY4A 2AFIE 3RVPA 3ABSB 2AGVA 1N36B 3CZMA 2YZMA 2V4MA 2P3QA 1D1TA 2ATEA 3EJ6A 4UU1A 2HQBA 1M73E 3R9KA 1T9GS 4KYIB 4Y52I 2JLCA 3DFFA 3T3PB 2WUVA 2VS1A 4XCXA 4JVSB 4GLJA 3KWMA 1T35A 5LKAA 2P5UA 2QIOA 2C2YA 2YH2A 2HLDA 3D3NA 3MTGA 4B75A 2AOUB 2FXIA 3ER6A 4X92A 2C3MA 3T06B 5AVQA 4TUYA 1QE0A 3EHDA 3HFSA 1LJLA 4K2AA 1UFVA 4FFRA 4GL4A 1YBFA 3LW8A 3S40A 2CT8A 4GVXA 4JR0A 1G60A 3K32A 3LX4A 3VQTA 3JARA 1NQXA 4NKRA 4CKWB 4ZZ2A 1FQJA 2C9CA 1ZNQO 4IF4A 4NRDA 1OX4A 4HEA6 3C97A 5CCEA 2Q6IA 2Q41A 3F4LA 2JFPA 4FOTA 5K4AA 3SKYA 1VL0A 1EM6A 3N0TA 4ZAZA 3ZH2A 4ZJYA 1TL7C 4G23A 4GM4A 2AWOA 4KMSA 3U44B 1ZPDA 1H8EA 1DUVG 1V9SA 3INNA 3PEEA 1JDSA 3O7MA 3T3DA 1WSBA 4MR7B 3QEJA 4BNJA 1CY0A 3WL4A 3U3DA 1I3KA 3H9UA 1UBLS 3V4LA 2PZGA 3HVJA 1GITA 3C3MA 3RAPR 4C01A 3IR6A 4NYJR 4F9TA 1Z7WA 3K0CA 4H4DA 2VF7A 2JLAA 4LOAA 3VHLB 2A9FA 5TE9A 4B6EA 2DSTA 3I1JA 4KWCA 3V48A 4BYMA 3DC7A 4M9XA 1QH1B 1O5IA 3G5UA 4YRRA 4EGAA 3DUFA 3K05A 3R6TA 4S1PA 5F12A 1TJ4A 3ZDCA 2WFAA 3OCXA 3BZWA 2VEOA 4NONA 2FWAA 1DT5A 4TTIA 5JD3A 3FYUB 4EUKA 1DRKA 1UQTA 5FWYA 4NBAA 2BUBA 2BELA 2CMFA 3UMGA 1G6OA 2UZ3A 4IJUA 5FRDA 1PS0A 4K46A 1Q7BA 2QB5A 1GRCA 3O03A 1AKEA 5C8YA 4H3HB 4DF3A 2OM6A 3ZBUA 2PMWB 4OY3A 4HDQB 1TKRA 4ZV9A 3ZBTA 3ACDA 4A5SA 4YTEA 1Z5PA 3J81f 1A50B 4PZLA 5CVCA 2QV0A 5D3MB 4EO4A 1SXHA 3C14C 3AIOA 1OXXK 2TS1A 3C41J 4Q3LA 4X71A 5KTPA 5EJ5A 1SHJA 2ZB8A 4V1CB 2JFHA 4OLJA 1DWUA 3F4KA 3MAGA 3TTSA 5CB8A 1EP9A 1C9MA 2HPAA 4UATA 5E6SA 4E5YA 1X77A 3CF4A 4K05A 4TVBA 4HBGA 1XTPA 4ALKA 4MQEB 4MHOA 4PGAA 1JHQA 2QGNA 1QF9A 3C6KA 3L7LA 1PR1A 3ZK8A 5DM1A 4KEAA 1GUBA 2AMYA 1BWQA 1P74A 5IDXA 1W96A 2CVQA 3JWHA 3IOEA 2WF6A 2WZDA 3J7AC 1E1RD 4I4TB 4Y2JA 1CJVC 1Z2PX 5CDGA 1BVRA 2NZYA 4TYWA 1YZGA 1XD8A 1KP3A 2HUNA 5AJUA 4BNGA 2ZIFA 1I7NA 1JMVA 3QE0A 2EZTA 4LYFA 5ECDA 4C0QC 5JAMA 4DGQA 4A2QA 4D3ZA 3SEAA 3GKQA 1FDIA 3K92A 1JFFA 2HJVA 3L02A 3PNPA 3U3RA 1OH5A 1KRWA 2O59A 5AICA 1MAAA 3DV2A 4QOJA 2KI5A 4AQ7A 3OX3A 1ZITA 2EIXA 5GV7A 1KAHA 3PQ4A 4P6VF 2QTTA 4OA8A 3TN7A 4X64B 2HMVA 3BTSA 1FIUA 3MRXA 4X45A 2Q4ZA 1LNSA 2B4YA 3AILA 4MW4A 3S14I 3TLEA 4EHAA 1D6SA 1UMCA 3H99A 5LIRA 3EIHA 3SQLA 5FLMI 4Q47A 5JNLA 2XTZA 3KT0A 1GAQA 3TLJA 5B3KA 2ZAGA 1V8PA 5EIBD 3KAJA 1TF2A 3GTMS 4IZ6A 1WW8A 3IUJA 4WK2B 3JQAA 3OF2A 3K6SA 1SCQA 3CZRA 3SDBA 1IAVA 1QVWA 2R65A 3Q0IA 5D3QA 3SBDA 4E7OA 2WQ6A 1OC4A 1T1RA 2UUPA 4UHHA 3GZNA 2IHZA 3IR7A 5F2OA 2XUDA 1V7CA 2H59A 3R3WA 2NACA 3TDMA 5HTOA 3LVRE 4Y2UA 2UYGA 1E1NA 1E66A 2XNCA 2ZETA 1NV8A 4ZMRA 1E2BA 2A5GA 1OFIA 1I5EA 1O97C 3WDKA 4BQEA 1AKNA 1KBZA 4WFIA 4LE1A 2Y05A 1MD9A 3RKRA 5EMKA 2OGZA 4BRZA 4GI7A 5JVDA 1FZTA 1HFJA 1KIFA 3NWEA 4O0LA 2Q07A 5CW1A 2BR5A 5JAZA 3HJFA 3PJRA 2RHRA 1XZDA 5IK2D 1LK0A 3H2JA 3R23A 5JW6A 2D00A 1RJGA 1Z38A 4WBSA 3GDHA 5AK0A 5KZMB 1IBKB 1NAHA 3K5HA 3ADBA 1S2LA 1NJ8A 1O9HA 1LJ8A 1N9ZA 1PDOA 2XT0A 4PGGA 2VSXA 4ZJZA 5JNVA 2XVXA 3F9IA 2V7EA 3AH8A 4NIMA 1NJI2 4F84A 2FKNA 2JVIA 1EA5A 2YVKA 1A0OA 2IF2A 2VTKA 8AT1A 1D1QA 3OQ1A 3MTDA 1VKJA 4L6AA 3AL3A 1WY7A 1EDBA 1X7ZA 1DV2A 2CUZA 2QYSA 1OIWA 3DF9A 3HZZA 3SJ7A 3VDMA 3IDSA 5ALWA 1LSSA 5A5GA 4J1NA 4YXWD 3M3YI 1YGYA 5JMWA 3SHFA 2Z58A 2CZGA 2QLTA 4LUCA 5DEIA 2D5AA 1C0PA 5SY9A 3NI2A 4Z54A 1KMMA 1KD12 2CXXA 1LPOA 2JEZA 3EUAA 3OE7D 4KXNA 4Q9JA 2FCRA 2FN4A 1ISJA 3SDSA 3O75A 3WGLA 1DKLA 4RY9A 3NTXA 5LMUB 1GQ2A 7ADHA 2X58A 3NUGA 5JNSA 4UAUA 3U17A 3HM9A 1VQ1A 4CL3A 4LDAA 4BMDA 4MZDA 1PX0A 4BY9E 5B37A 1M6WA 2X19A 1QHFA 4BGEA 4KHZA 4ES6A 4EB0A 1CQJA 2GHRA 3MD0A 3NHUA 4OI4A 1X7HA 3WKAA 1ECJA 2QP4A 1IYZA 1E1QD 2BC9A 4RADA 1E6WA 5ALOA 2UXBB 1HWYA 1R0KA 1XZMA 1YKGA 4DFDA 2NVWA 4YPVA 4R1LA 5TIIA 5HQTA 1V16B 2R1VB 3G23A 3HO8A 3IBFA 2W4QA 2YIMA 2QVCA 3OTWA 1GRNA 4JKYA 4OATA 3GNSA 2HMSA 4BQIA 2E21A 4FU0A 2LNDA 4MCAA 3ET5A 3MWKA 4P2BA 4E3ZA 3C8HA 3VU3A 4NBCA 1KC81 2C4NA 3KETA 1D5WA 3S29A 5B6JA 4EUEA 5F23A 1SPXA 3EVZA 3C16C 3DMHA 4MJ7A 4P58A 5DLDA 1SIBE 3MJFA 4J0CA 1BFUA 1Z5GA 4GD3Q 3HKZA 1FFEA 1T4CB 2JFUA 4ZO8A 4DA9A 4GWKA 1Z15A 4PPFA 3KLPX 4QU5A 1C1DA 1ZP6A 4IV5A 3B1JA 1ZSNA 2Y99A 5KYUA 1JLKA 1E62A 2XBLA 2CLEB 2X6RA 3ORSA 3RE1A 4JHLA 4ZVKA 2QTVA 4ZT7A 3V4FA 4RTPA 2DPLA 3G2OA 2WKWA 2D5IA 1ACMA 2MYTA 1CZRA 4O2AB 3SHOA 2IHYA 4TZKA 2HWUA 3G1UA 3R20A 4MD7A 3L3BA 1P61B 5F64A 4TMTA 4ZIRB 3BFVA 4US1R 1RLUA 4RUKA 1KSGA 2XXBA 2D6FA 3HPRA 3HEBA 2IH4A 2CZCA 5FDFA 3HCFA 2OCLA 4QXQA 1X86B 3CUYA 4XKJA 1BRMA 2YWFA 2O6HA 2QUKA 3PPYA 4J0KA 4K9SA 4ENTA 4W7HA 5LQCA 1U1EA 2BW0A 2R8BA 3REFA 5CA1F 4P22A 5J2UF 5B53A 3PR1A 3FNIA 4MONA 3HEAA 4QU0A 4A0SA 1JWLA 3NUZA 3VYSB 4L5JA 2B5WA 4LGMA 4N18A 4DIOA 2G0NA 1N2CE 4GXQA 4WERA 5DNWA 1KK3A 4R54A 3NDRA 5DF1A 2RKOA 2V97A 2XYVA 2ZUSA 3RB8A 4AXBA 2VHXA 4ESVA 1V3UA 3R3XA 4AWBA 3AEUB 2FX5A 3JQBC 1CS4C 4IQ8A 4IVPA 4F3NA 3PKJA 2FEAA 4WJLA 5BSHA 2QUBA 3TNDA 3KDPA 4PYRA 2A33A 4ER3A 1GFZA 4B48A 3HCBA 3WLHA 3FJOA 2FN9A 3CX4A 2XUJA 3IPAA 2R6GA 3N58A 4MARA 2XYGA 1IBMB 4WKOA 4AIIA 2PG3A 4CQNA 4ZARA 3W3ZB 2ET6A 3LU1A 1JPNA 5ALVA 2ISQA 4BO5A 4U3JB 4MTCA 3CQ9A 1N92A 2RC6A 5HRUA 1RP1A 2PM8A 3HKCA 2GNOA 2B98A 3IQFA 4QFCA 1XNGA 4TLAA 3TTVA 4A5OA 2JAHA 4ZMBA 5HKBA 2GLUA 2GUGA 4OF4A 1IE3A 3FFAA 4QQFA 3P8ZA 3PJFA 5JH7A 3RC3A 3HBFA 4MB2A 1N4AA 4CM9D 1ND5A 1DL6A 1DELA 3ZOZA 3GXOA 5A0TA 3L0IB 4BNXA 1BS2A 3KYDA 3QLUC 5KOYA 2OSBA 2R8EA 4E2XA 1UAGA 1Y6QA 2M6LA 3WKBA 1LBQA 4CDRA 1FDVA 5AO9A 3TSCA 2X0RA 2X1LA 5KYYB 4BNIA 4CLEA 2I3BA 1A8PA 1E0JA 2J9XB 4LJ8A 3THYA 4WOPA 1Y1RA 3NTVA 4NE2A 3GP8A 4H7IA 5BW6B 4P4SB 4PSDA 4HI0E 2Y1FA 3I23A 2XNDA 3EC2A 1Y1KE 3HU5A 5F5XA 1KMHA 1UPFA 3LO8A 4UPEA 4N6GA 4I55F 3I5MA 2P5TB 4MS3B 4HGRA 5TLSA 2ENWA 1XQYA 2FE4A 2PJDA 3KJFA 4CI0B 5I01A 2OHXA 4M99A 5GM1A 1WETA 3VYVA 1OVMA 4HNQA 2CJPA 4Z99A 5BR4A 3P5BA 3DBIA 3I3OA 3N8GA 4W5NA 5KTSA 3ZKWB 1YVDA 4BNLA 4ZC8A 3K0SA 4NL4H 5E9QA 2R6AA 1N0UA 5DBEX 3FHTA 3NJ4A 1QR6A 3UANA 5LQMA 2WYVA 3GBSA 1JJ2Y 3IIJA 5HK9A 4LYDA 5JAUA 2DTXA 3R6LA 4RL6A 5DHRA 1IQRA 4RACA 1YU6A 3TUIC 4F72A 5K8TA 2ZTLA 1T9CA 4RS3A 2OQVA 2VJLA 4RK4A 3FTCA 4BN0A 5GONF 1QQTA 3W5VA 1P4RA 3ZWPA 4Z5XA 1MJ5A 2IE8A 4C4PA 4CDNA 2YJ3A 3ANMA 3ETNA 3A9SA 1NVAA 1CUDA 2B7CA 2WA1A 2XSZA 1W4ZA 3PQ8A 3W5IA 2RMKA 2Y0PA 4IWYA 4HQFA 2G0TA 2V65A 1EXVA 4ZODA 3O38A 5AKKA 4RKQA 3LA8A 4GEGA 4QYSA 1QTRA 3LY9A 3MS4A 4J7UA 2HHHB 2ZWVA 1THZA 1S0UA 1MFPA 1EUZA 4IEFB 3EY4A 4PR0A 5HIKA 2BTEA 1IONA 4BQRA 2E49A 3MOGA 3Q11A 2FEMA 2JA8I 5GQSA 1IJFA 2HNBA 4RABA 1RJ9B 3EOZA 4OQ4A 1GKUB 2XB2A 1X8XA 2OCIA 3IPRA 1DI0A 3WNDA 2HV8A 5LQAA 2DOKA 1ORWA 4BP8A 2HMYB 1NTOA 2CLDX 1BGVA 3FPEA 3AO0B 2YJTD 2XQVA 2DWUA 1QE5A 2GHQA 5G4KB 5IN5A 3IC5A 3UXYA 3TE6A 1RHRA 5IYZB 4R7TA 1XXHB 2HF9A 3QMMA 1XKLA 4ZOBA 1FQWA 3A14A 4PXAA 4XFKA 1NXSA 4IKPA 1FYWA 1V2GA 3AFIA 3BJRA 5BQ5A 1Y9JA 3NAQA 1VHQA 3RFCA 1RACA 1RLOA 3O9VA 1RBYA 1JU3A 3TX6A 1G2PA 3ROFA 4DCOA 2YY6A 3VX4A 5KX5F 2IPXA 5JWHA 2GTPA 2I87A 3KYCA 1J9EA 2JGNA 2OAGA 4TROA 4BLVA 2G36A 4YCCA 2YQZA 3I8OA 4J90A 2B94A 4I46A 4FS8A 1DHRA 3E3NA 4WHMA 3V80A 2O8CB 3ZWVA 4D81A 4HDMA 3IDZA 1LPBB 2V45A 2IWHA 1LDNA 3DTVD 1VP3A 2CFSA 2CMKA 4MO2A 4F46A 4WQMA 1N9KA 2WHPA 5F1KA 1IZYA 1W85A 4IDNA 5AKEA 5AKXA 5FFMA 3NZEA 4I14A 3QUAA 4F4FA 3E9RA 3JY6A 2DMRA 4YY3B 1E9RA 2J3LA 4BNFA 5T7BA 4RLQA 1FSGA 4YV1A 1EJ0A 4LNUB 2NZ8A 4HJRA 3D6UA 3HXTA 1VG9B 2ONKA 1YACA 3UQYS 2N46A 3A3NA 2GEJA 4K7JA 1ZEMA 5FTNA 4G2NA 4KRYA 4D6XA 1BU5A 2F1JA 4R2LA 1Z5OA 2QJWA 3LF2A 1QFMA 2Y1WA 1ZVKA 4TLLB 2V5VA 2QM7A 5C8VA 2NX2A 4XLTA 3GA0A 5IC6A 2RI6A 3UH0A 5HPYB 2BVNA 1OAOA 4KXMA 1XCBA 1Q7GA 2I03A 4Q82A 4M1WA 1N25A 4EF5A 4L7VA 2X4IA 4TKUA 2XQGA 2J3MA 4HL6A 2M9MA 2MOKA 4PHHA 1TIBA 3TINA 4TV8F 2Z6VA 2W03A 3ANSA 4UEJA 4BMCA 3HR8A 4HZUA 1BX0A 4KLAA 3M4YA 3ND5A 1ZH6A 4LXXA 2C9ZA 4ZOLF 3TPZA 1DOHA 5KWJA 1HEYA 3HR4A 3HUDA 3L07A 1VKNA 2O4UX 3G6WA 4G41A 5KS2A 1WW9A 4R2KA 1MRNA 3FOZA 4ZHQF 1OH6A 1PCXA 1GGHA 2AJCA 4BWYA 3AUAA 4KIJA 2F8LA 1UMBB 2OV2A 3CJQA 3N8IA 1XMOB 2W2LA 3SE7A 2PUTA 2OSVA 2AHRA 2WE8A 1R0BA 3CME1 3VI4B 2PZEA 2WUWE 3LBFA 4C7BA 4AKHA 3ZNOA 1OBVA 4PHGA 4I6EA 2NTJA 4EKEA 1OF1A 3RVOA 4H17A 3ESWA 3CPSA 2BYTA 3WYBA 2X22A 1FP1D 1RYNA 3ZWXA 1DXHA 5KHOC 4E88A 1G4UR 3PEYA 3T9AA 2Z8ZA 3GT0A 3OEED 1DTEA 3HH8A 3LDFA 2I91A 2DR3A 2WJYA 3G7SA 3NLLA 4Y9TA 4QBIA 3B7GA 1C1YA 2ES4A 2G8NA 2HV9A 4B40A 5JXJA 5KTNA 3ZE9A 3DA8A 1G5PA 1Y8RA 3CZ5A 3UHAA 4AJHA 3UJ3X 1IMJA 4JI1B 1M2OA 2A84A 4BLUA 1HSZA 1R6AA 1U3GA 4MQUA 2JDIA 1RWMA 3S2HI 3SOPA 3W2GA 1KZYC 5SZJA 2LIPA 2Q21A 1BEEA 4B8YA 4Y3UA 2QAGC 3P9XA 1NWHA 3UJAA 4J0EA 1WABA 3DJFA 3DAHA 4BBJA 2I4RA 3DMPA 1RYBA 1PRYA 1BA3A 2Q8NA 3KPWA 5EFZA 2HPHA 4FDUA 3DE1X 3W04A 3WYFA 1S4QA 3GVHA 4M7RA 1OLOA 2LIVA 4OREX 4RVHA 4ZQCB 3TFOA 4BZWA 3GW8A 2BGTA 1ULUA 5L3SB 3JWGA 2HBZA 3GLGB 4AZWA 4O4JA 2ZI5A 5DLQC 2AN1A 1M67A 1II8B 1U99A 2OESA 3SFZA 4AJJA 4D2IA 5C4IA 5LOVA 2MMCA 3ILXA 3R3VA 4ZCTA 4A9AA 3K70D 3U9SA 3COSA 3CGGA 5K0JA 4TS4A 4W5WA 1PR4A 4LZOA 1RAHA 3RUIA 2JLSA 1T0PA 3DTVB 4N0DA 2EJTA 3GTOI 3BKXA 5LLTA 3IQXA 3AHJA 3RKUA 4L9AA 1K2VN 3RT7A 2VTEA 3L7DA 3STUA 2QEQA 2GCOA 2V3VA 3DR3A 2A35A 1CR2A 3LYAA 4YJGB 2V5UA 1JAIA 5EWJB 4MMZB 4EF4A 3H05A 1CUCA 1OTXA 2GK7A 3C7TA 2OAQ1 3PP8A 2AOTB 3VYRB 3RRZA 1DC8A 3M8KA 3FB1A 3OOJA 4R68A 2GPBA 3AFOA 2GN1A 1RRVA 5K8IA 4TQAA 2FMTA 3NHWA 3W6PA 4ASUD 1R9TI 1D9ZA 3Q7IA 5LXTB 2PUAA 1D0VA 2YNMD 3L0BA 3L4SO 5K0CA 3I9LA 3VPHA 1DMSA 2AMFA 2C83A 2DUWA 2OP0A 1L5KA 4X6AI 1VL2A 2C77A 2EBHX 3DLBA 3PPWA 5HGXA 4I5IA 3L9WA 3ENKA 4EATA 2DGDA 5CVDA 4DG5A 3V7NA 1N3YA 1SIUA 1GPDG 2V7QA 4Z3OA 1XROA 1QAOA 2YW9A 5J2TF 1J2JA 2ODEA 3U7IA 2DY1A 5BMVB 1IG3A 2PXHA 2GKSA 1APBA 5EE1A 3HG7A 4CEIB 3QM1A 1NQAO 1IBCA 1JWAB 3AR2A 3IF8A 2VZ9A 4G0MA 2DETA 3AM1A 4DB4A 1YS7A 1XHEA 5ER6A 4LFCB 5KYWA 5H70A 3WSTA 2Y0BA 3K8ZA 3QUTA 1NVMB 4IICA 2HF2A 1RIFA 3IPCA 4HZGA 3B3QA 3EPHA 4B81A 4KXFB 3GTMI 1P75A 2A88A 4ESOA 1TT7A 1Z6YA 4BMZA 4QUIA 3ETHA 4U63A 3KWLA 2Q29A 1E4OA 4DG9A 2VJMA 1L5FA 5J5AA 2DJIA 3ELWA 3F1LA 2BWJA 3HJHA 3EWAA 4GKBA 4B4WA 4RK1A 1ZRHA 1XJ0A 1U5BB 1E99A 2QR2A 1OE0A 4GNKA 3CLUD 2BE9A 2IPOA 3N2KB 4LTMA 2AWNA 4MGYR 2JKZA 3DHYA 2YZ7A 3SC2B 1I7PA 1SR8A 4HCJA 4KXVA 4MLPA 3VR5D 3W5JA 4Q4HB 4DMFA 3ZLJA 1XQ9A 4GAEA 4W5RA 2GBGA 2HY7A 2HBYA 4EBFA 4PLZA 4MUNA 1KORA 2BP7B 1SVUA 2C84A 2WVAA 3ELUA 3DVAB 4M1QA 5KJEA 2V0GA 2JLRA 3EAGA 2YN0A 2BM0A 3T34A 2YQ5A 2BZGA 3L7CA 3EIFA 4R2HA 4IR7A 3LT4A 5TC4A 3GJZA 3ZHZA 2IYYA 3CMMA 5LN1A 2O3RA 5BPFA 4GM0A 5LU9A 3HB7A 2FUG1 3CC71 2P4QA 4QDZA 4D25A 3PQ2A 1ZRSA 1VM6A 4BGDA 4L6IA 3J81b 2ZATA 4L22A 3SIWA 2YIVX 2SKCA 2O06A 1VQ5Z 4UEQA 5KSPA 4CMIB 2PV7A 5J47A 3NNDA 5CAEB 1XZPA 1L4KA 1THGA 2QXTA 4CCAA 2HC9A 2QYOA 1WWKA 3L5OA 2PFKA 3U40A 3UA3A 4LEIA 2WU0A 3FYHA 5IAEA 1Z6GA 3CFYA 2R8YA 1KSFX 1QHIA 1WKCA 2PTGA 3F6BX 2C94A 2IJGX 3PNLA 3T38A 3ZWDA 4ENQA 4ENPA 4DR7B 3DHEA 3BCRA 4Z3KA 3V4RA 1BW9B 4YCLA 3BCHA 1AT1A 5JCJD 4RJLA 2Z30A 3PLAE 3TSZA 5ADWA 3AP1A 4D4HA 3H2ZA 3GIDA 2OTLZ 3L8CA 5YASA 2H54A 5A3RA 4YYZA 4JT9A 5IANA 3NIWA 1TZMA 1KQ3A 2QL9A 2RAFA 3VR6D 1MV5A 5LDGA 1XKTA 1Y3BE 3M4OI 3OA0A 4NCNA 2PT7A 5E6UB 5A3QA 4BGIA 2ZFUA 4U6NA 2P67A 3G79A 5G1OA 5AFSA 5IC4A 2XRMA 2O8FA 2AMVA 2F1KA 3ETCA 1ENOA 1EK5A 1OX6A 3A9RA 3BB3A 3DBHA 3NAZA 1YDEA 1DIBA 3PR3A 4Q1EA 3ABIA 3GFGA 4JT4A 4ZQHA 1R1DA 3UCFA 4ADSG 1OH8A 1X7WA 3RYFB 3OIWA 5JS8A 2A1TS 1TI7A 1TJNA 2ERXA 5JDCC 2RK6A 4LHVA 3KE9A 3WKCA 3S2DI 2R47A 4BYGA 3D7LA 2QN2A 2C9YA 4Y2QA 4E94A 4BTLA 4F12A 1T9ZA 2AN5A 1UBHS 2BGNA 3DBLA 3LNCA 4GF5A 2XEDA 4L4RA 4B6QA 2X76A 4BQOA 2P3YA 2CVPA 2VBIA 3EGOA 5EKXA 2W8ZA 3JD0A 4XVQA 5AESA 4EX7A 4UM8B 4HQRA 2WP8J 1XG5A 3CVOA 3QPWA 1M8PA 1IULA 1QX3A 2D5BA 1R6BX 1QBGA 2G82A 1JLLB 3AR8A 4XVHA 1IUOA 1X42A 1POWA 2P40A 1SUFA 5KMGB 3SLGA 2NXWA 2GMWA 4ZQIA 1Y6GA 3BL8A 5DYTA 2BT4A 1REQB 5GV8A 1JB1A 4LXHA 3E35A 2Q5OA 3IURA 2WUGA 3WK8A 1U0JA 1VSQA 1J0DA 5FUVA 3G2QA 1P6QA 4DYDA 2ODQA 1OLSB 4DOMA 4R40A 1YVUA 1F2UA 2C1XA 2YASA 4O2BA 2EBFX 1R66A 1BCSB 1SIWA 1LI4A 5EZ6B 1N2IA 1C0IA 1NLZA 3G2MA 2XMZA 4RWEA 1MEJA 3S28A 1QP4A 1QK4A 3T3MB 3GRZA 4DNXA 3ESBA 4YMWA 4DLXA 4A8TA 3L0PA 2ZRLA 4ER5A 3USCS 2AFIA 4LRQA 3QE3A 2KPIA 4QOHA 1IHOA 3JQEA 1RO0A 1SMKA 3DPIA 4DJFC 5KKNB 1E5LA 4URHA 3V4OA 4YX9A 2B25A 4MEBA 4YJ3B 3VU0A 4LF7B 4X1IA 1WW3A 1ARZA 2JZCA 1ZRNA 2ZUEA 2Z0MA 3IVAA 3IBGA 1COWD 3CKMA 1FSZA 2NUTA 1AQYA 3N5KA 4QGFA 2P4UA 4E1BA 4Y98A 5IDVA 1QHYA 2B8EA 5LBUA 2I33A 4XCVA 1K66A 3U3KA 2QMUA 1RJEA 1KEWA 3PRKE 2IYAA 4XUDA 2Y0DA 1XRRA 1YZNA 2NGRA 1NA5A 3FPSA 4INJA 3UWPA 4FDMA 3T1YB 3X1KA 2OAEA 4C0WA 4I1OA 1C9NA 3H5AA 2ZZKA 4IHQA 2JATA 1YQDA 4LRTB 2M48A 1BMQA 2YWHA 4K87A 2K87A 4MKIA 3ZI4A 5M7EA 4HNAA 1GZ6A 3RLFA 1FP4A 1U2RA 3D8HA 4RNDB 1EZZA 3GAAA 4G37A 1MG5A 3ZCRA 4C4AA 5BUSA 3E8MA 2AQKA 2SBTA 2YOFA 2R6FA 3LQRA 4A7PA 1D6NA 4B3IA 1X7DA 4JR1A 1C30A 3ND6A 4HADA 3IEIA 2GVDC 5C4XI 4MW1A 3SAJA 2QSZA 1G3QA 1YC5A 3A9WA 5BSKA 1WPRA 4WBNF 2UUAB 1E2JA 2PX3A 3SX2A 3DAOA 3DZHA 4MITA 3I3SR 2XA2A 2EHDA 2HSZA 3IEKA 4ZPJA 1MH9A 1QYWA 5E4YA 3ASUA 3CRW1 3ASVA 3RW9A 4L4ZA 4RDIA 3IMFA 3TTXA 5DNYB 2CXHA 2HHJA 1CIVA 3LUHA 4I8DA 4BKPA 3LQYA 1BJKA 2YJ4A 1JECA 1LC0A 1VE9A 2FSSA 1QVGY 4FE4A 1D2CA 2NT4A 5I8WA 3GC6A 3LHKA 1VIVA 1VQ8Z 2H92A 4JEMA 3ILHA 1ZM2A 1XV5A 3BGSA 1RM0A 2QZ9A 1OY1A 5LM3A 2X41A 1QVZA 3DDNA 4EFLA 1LDGA 3C5WP 4KVAA 4PONA 4KOEC 1SZJG 1WAMA 4U0JA 5EHXA 1D07A 3D5TA 4RHXA 3RARA 5L40A 2I4MA 5BOSB 1HC7A 3WSVA 2J6HA 4JWTA 4XPZA 2GBLC 1Q12A 3RK0A 1BS1A 3W05A 3HU3A 5K4HA 4XJXA 2OCAA 2BI7A 4M60A 3DWEX 2UZ1A 2Q5IA 4QELA 5IULC 2QG6A 3H8JA 2C98A 3HKDA 4GLLA 4ZPXA 3Q3HA 3IV9A 2ZAOA 3DZJA 1SHZA 2ZXEA 5IHPA 1UJ2A 3C5CA 3BRWD 1OXKB 5FHRA 1YUNA 2IXBA 4KDRA 3W5UA 1NF8A 1K7SN 6PFKA 2W71A 2OFFA 2RAVA 1JMYA 1MO5A 3ZE6A 2C57A 4K9LA 4ETMA 5MDHA 2DHCA 1RFLA 3DF7A 2RBEA 3JQCA 3TIVA 4LQ4A 2PNFA 2QVYX 4MCHA 4OB8A 4Y0NA 5CYFA 3WJAA 4F0JA 7REQB 2Z2KA 2FXVA 3K35A 2H5JA 3DDOA 3GELA 3OPMA 1X19A 1G38A 1L6IA 5JCZA 3IUEA 1HG1A 1NBMD 3S1QI 2O0JA 3CISA 2NPIA 3BAZA 2DECA 3PQ7A 4Q4DA 5AP9A 4BTEA 4PC3A 5F9FA 4HO1X 3NJRA 4K40A 5HZHA 1T0HB 2GEUA 2F9FA 3V9AA 2P4SA 5KVCA 3IAUA 2PKCA 2R8RA 4EO9A 2CFTA 3GVIA 1D2GA 3OUTA 2BDEA 3NP7A 3KKNA 2W6CX 4K9DA 2IWRA 2JA7I 3QTLA 3ZJYA 4MUYA 4BNDA 4CUZA 2XE6A 4INPA 2ZS7A 1FOEB 3R8XA 1PT5A 3RGWS 1R8YA 5J3JA 4KXQA 3OLQA 4MYRA 3ORRA 3LW7A 4A8JB 2PGDA 2PMEA 4UDOA 4RH0A 1MDBA 3NQ41 4HMOA 4UFOA 3URMA 3QOXA 3V9PA 3VNSA 4V1CI 3A1UA 4NMWA 5HZMA 3OCVA 1T2FA 2D0OB 3FHJA 4I5EA 4ABTA 1MJHA 4H0NA 3H0EA 2NZWA 2UUBB 5FBKA 3T7IA 5CA1B 4RA9A 2M2IA 5BQ3A 3HKEB 3I2GA 4N0MA 1W581 1NYQA 3RC1A 3WL3A 1O94C 4TYYA 4KO3S 4D8XA 4LOHA 3DP7A 3FJYA 3OG9A 4QRDA 5F7XA 1QKKA 3RSHA 4FC7A 3G9QA 3DPUA 5CPFA 4G4IA 4KWIA 2AF4C 2E48A 4CKZA 4DR1B 1YUBA 2FFBA 1CEXA 1WPGA 3ED1A 4BKOA 2PTHA 3AF5A 2XWQA 3HWX1 1G8AA 2ON6A 5JBNA 2AG8A 1IZ0A 2HIHA 2WWHA 1C9DB 4EA8A 1W36C 3LRPA 4PRLA 1VQ9Z 1QRRA 2NVQI 1T8SA 3VISA 4NU6A 2XQJA 1PYOA 1OMOA 3PFNA 3M5PA 3WB0A 3H5VA 1BVUA 4IH1A 2OZPA 5FQNA 3CSUA 5JS7A 3WRXA 1GGKA 4FK8A 5AOVA 1L4MA 4PVDA 1ZCZA 2KX7A 3KAKA 4ZGBA 4FP9A 1P3DA 2YIJA 1K4KA 4UTOA 4B84A 2D2EA 2ZVDA 1PJAA 1F9EA 1IN7A 3SX4A 4XYLA 4KAAA 3VC7A 1YZTA 3HOWI 4AJ4A 5E6RA 1W5FA 2XUHA 3BQNB 3TLMA 5JAOA 1G16A 1OLUA 3IB6A 1MIOA 4A93I 4PLGA 4F8EA 2IDKA 2TSYB 3FWYA 1DT3A 3OZTA 4O6VA 5IAKA 4C0BA 1SCKA 3HP7A 1QGUA 2B7LA 1ZJ5A 2SECE 2H29A 1QRDA 5DGHA 1T1JA 2EP8A 3O0TA 5K3FB 1SU7A 1T5DX 5KJ6A 3HFRA 4G6ZA 3V4ZA 4M2LA 4JP5A 4JQSA 3B6EA 5ALHA 1WA5A 1Q0ZA 1QUEA 2BHTA 3GG2A 3EQ2A 1TA4A 4ZU3A 4RA6A 3PX7A 2J32A 4I55B 1LDYA 5E1OA 3DVQX 2FNAA 1N2JA 4XIJA 4YRFA 2AN3A 4PAGA 3RJZA 3G0GA 3HSSA 4M8LA 5LKRA 1U7WA 3KTOA 2FK8A 2Q5LA 4GGMX 5BN4B