1NP6A

Crystal structure of escherichia coli mobb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
170
structure length
158
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the role of Escherichia coli MobB in Molybdenum cofactor biosynthesis based on the high resolution crystal structure
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
total genus 33
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1np6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1np6A01
1G64A 2HXYA 1S2MA 3LVQE 1NIPA 3U7FB 5E7MA 4PTLA 4DSUA 2X2FA 4XJXA 4IW3B 2CE7A 5GJWC 1US8B 5JJKA 1Q57A 2IYTA 2QPOA 2QRZA 2R8RA 2OEPA 1R8QA 1R5NA 3MFYA 1G7RA 4P4SA 4M53A 1LF5A 3SU8A 1HUQA 4OJKA 4PPGA 4Q02A 2EWVA 2IYVA 2EVWX 4PO9A 2OLKA 4PAMA 4QGHA 1E9SA 5CB8A 2ZPTX 3VKWA 1KO1A 1YZLA 1SKYB 1UM8A 2FWRA 1Z0DA 3RABA 3U44A 1T91A 1G6OA 1VCNA 2CDNA 3KQNA 2BBWA 2OLJA 1S3GA 4L9SA 5SZJA 4A8JB 1MKYA 1P60A 2HJGA 3ND9A 3Q9LA 2C9CA 4TZ0A 1X6VA 2GXUA 3FDIA 3SFZA 1DPFA 4DDVA 2XZOA 4PC6A 3EW9A 3SS8A 1OHHD 2XTZA 2WIBA 4PPFA 3MJRA 4Q1BA 1DELA 4L4UA 3SC3A 5JJIA 3PXGA 4YLGA 5ANRB 1OB2A 1PLLA 2IEYA 2FSHA 4I1UA 4AKEA 3IQWA 1G17A 1GL9B 3GJ7A 3SNHA 5EXXA 3VMFA 1OH5A 1LS6A 4O3MA 2ZSDA 1VG1A 5LPNA 3P4XA 3TSZA 4PHHA 1E98A 5JEDA 2HEIA 3RC8A 1ZD1A 4GRAA 4HUTA 2ZRAA 4QM7A 1ESMA 1YR9A 1W0JA 1ZINA 1GM5A 1R6BX 3PCRB 2ECKA 4BFUA 4A6XA 1PUJA 5EZ5A 1W5TA 4Y0AA 3ZZ0A 4QNRA 1TPZA 2FV8A 4Q9JA 5FH9A 5G3YA 1VECA 2H92A 4NYJQ 5HE9A 3T1VA 4ERNA 5TV2A 1VCIA 1OXVA 5DI9A 1X86B 1KKMA 3WMGA 3A6PC 1CJTC 4A2PA 1TAGA 2R62A 1W0KD 2CHGA 2PT5A 1CIPA 2D62A 2WTUA 3EWAA 2O52A 3LXXA 2W83A 2WV9A 1GRRA 4U00A 1G8HA 1T6NA 1IN4A 2REOA 1QG2A 1YZNA 4TLDA 4B75A 1RYFA 3ZZUA 4C0KA 3PUZA 4QG7A 5EE1A 1W7AA 5DIFA 1CJKC 2OBLA 4Q1EA 4IVPA 5GJBA 2AXPA 1RZ3A 4JVMA 3NBFA 5DI3A 5JMTA 4TYWA 3GLGE 2FSIA 4LHYA 1KMHA 2QE7A 2ZRMA 1VCOA 2JLSA 5AK0A 1Z6TA 1J8YF 1OXXK 1EFCA 4BGDA 4LJ8A 4PC3A 2VSFA 1HE8B 2IF2A 2YINC 5EE3A 1GIAA 3C8UA 1OH6A 1GVNB 4IDQA 1Z0KA 2JIZD 4A15A 2O8FB 4JLMA 1CEEA 4ACAA 1IJFA 2N46A 2JCSA 1MRNA 3ZYCA 4KLZA 4E09A 3RRNA 4KI0A 1DADA 1YZKA 1D2EA 1E79D 1LFDB 3C7KA 1V43A 1BYIA 1J90A 3WRYC 3OEHD 4G5GA 5B57C 5JSZB 2V6IA 1HQYE 2CHQA 1AS0A 2HYDA 1XNJA 1W4RA 2ZSBA 4AURA 4CVNA 1NG9A 4YQFA 2QTVB 3EPLA 3OEHA 1JR3A 3K9NA 4PSKA 2V54A 4Z1MA 3BB3A 4LBZA 4RJLA 2D2FA 1JECA 2RGEA 1K5GA 4NYJR 3IGFA 3LNCA 1K5DA 3PUYA 4RFVA 3RSLA 3AF1A 4DVGA 3NG1A 4BFTA 1XTIA 3EPKA 2OCPA 1AGPA 1IY2A 3KJHA 1W2GA 1LY1A 1UKYA 4ZKEA 3UMFA 4M4SA 2A3RA 1Z28A 2J59A 3Q72A 3ZGXA 2EFGA 3QKRB 2J0VA 2V3CC 5K8UA 5FBRB 2ORIA 1SVOA 2W0MA 4M9QA 4GDFA 2A78A 4TTQA 2VBCA 1ZUNB 3QXHA 3PITA 1WB9A 4EAQA 1U90A 3SZRA 2C99A 221PA 4LJ6A 2GWHA 2D4HA 4XTRA 3VHLB 4BQSA 2GF9A 2P5TB 4G5SA 5CIWA 3LBIA 1HTWA 1GL7A 2AN9A 4C0LA 3DZ8A 2ATVA 4O0MA 4C4PA 1E2QA 1XTJA 4JT4A 1DAKA 4TMVA 2ZITA 3EPHA 3W5IA 4DWJA 1OH8A 2GZDA 2IYQA 4FWIB 2IC5A 2ZIAA 2A30A 2V1UA 2BIFA 3CX7A 2W2TA 2D2EA 721PA 1LNZA 1DVRA 4BZQA 2ZYTX 3FMOB 2F1IA 3NVAA 4NCJA 4QKQA 1KK3A 3AB3A 4WOPA 1M74A 3VNUA 3LX8A 4TMZA 4HUQB 4OJQA 2R6CA 3T35A 4DCSA 2O8CB 3PR1A 1RJ9A 4HI0E 3I5XA 3B1VA 2NPFA 1ODFA 3UMSA 4JBWA 4IHQA 3AGQA 1ZD8A 1A4RA 1EGAA 4BEJA 4F4JA 3N2EA 2HJVA 1IXSB 5AUNB 1N0UA 3UANA 3IPYA 3MSXA 3CRVA 3DVLA 2ZI6A 1Z07A 1Y63A 2P3SA 3CLVA 1CRQA 3AKDA 2HT1A 4OK6A 5FPSA 3VR6A 3A37A 4OHXA 1KKLA 3DO6A 1F2UA 3B78A 2BV3A 4B76A 4TLCA 2RGNC 2WAXA 2Q3HA 1U9IA 2QQ0A 1E96A 2VP5A 3I3SR 4GZMA 1A1VA 3GCGA 3THYB 2Z43A 1X1RA 3KUDA 5IDVA 4XWKA 2OESA 4NL4H 1U0JA 3CR7A 4V02A 1E2PA 3MCAA 1C9KA 3FOZA 1C1YA 3LH5A 4NCKA 3U3MA 1EX6A 4KXFB 3SBDA 4DJTA 1TQDA 4NCIA 4P4TA 4Z51A 2BBSA 4I99A 1BKDR 5JSZA 1OJLA 1CXZA 3ZIAA 4EPRA 2ZU6A 2EWWA 1E4VA 2ORWA 3GEHA 5EXPA 3AH8A 1JNYA 1HYQA 1VYTA 1DS6A 1BOFA 1XTKA 4D4JA 4C7OB 3DOFA 4IEIA 2IL1A 1Z5ZA 1E69A 2GCPA 3ZS9A 2DY1A 1Z22A 3H4MA 4F93B 3VFDA 2YOGA 4TWZA 3DHWC 4MRRA 1E9AA 2GJKA 2AWNA 3A58B 1SVMA 1CR0A 1YR7A 3C14C 3LV8A 1GG2A 4PHGA 4LJ7A 4AY2A 2X19A 2WSMA 1SKQA 2KJQA 3QVUA 1XMVA 1ZM2A 2QAGB 5IHPA 3H0KA 2ZRJA 5CITA 2FX3A 3AVTA 4M8NE 2ZUBA 1TQ6A 1CTQA 1E2DA 1ZC4A 5FL7A 3ZJYA 4BFXA 3NC1C 4GMXA 4DSOA 2JJ2A 2GESA 2JLXA 2ZREA 3QEOA 1XEXA 2A5YB 3DKVA 4IJMA 5D3MB 1I4DD 1JAIA 1U81A 2OCAA 2G0TA 3E5HA 4KV9A 1N6PA 3TQFA 2IUTA 4C30A 4EFNA 1KI7A 4KYUA 4BECA 1XEFA 3IHWA 3IDQA 4D82A 2JLWA 4B3FX 2ZJOA 3T1QA 4KSBA 5EXTA 1XXHE 2EQBA 2X1VA 4X8HA 3SYKA 2GXAA 1NG1A 1E9FA 5SZHB 1OXTA 3WY9A 3B1ZA 4PPQA 3HWSA 4Q1FA 4WZ6A 4QM6A 4QHYA 1GKUB 2XOKA 1GRQA 3BGWA 3UKDA 1WCV1 2XNSA 4FINA 2WPDD 5FOSA 2CCJA 1OFIA 3ADKA 1XJ0A 3GJ4A 4Q7MB 1DAFA 3L82B 3W8NA 5JECA 4QJ4A 4Q1DA 3MUFA 1M7BA 2HF9A 3EG5A 4PO1A 3BS4A 2OCBA 1FMLA 4GOKA 2O8DA 1LVGA 3X1ZA 4DEXA 1GNQA 3GPLA 4NDZA 1ZCAA 2QT0A 4JSTA 1R0WA 3TUIC 4LYHA 1JQLB 4TYQA 4LJ4A 4CW7A 2DFNA 4D81A 1QBKC 4DT1B 3ADBA 1H8HA 3CX8A 4A9AA 3QQ5A 1JB1A 1R4AA 1IM2A 1P2UA 1R7RA 1N5JA 2XITA 5FTKA 2F9MA 3TNFA 1YRBA 1S1MA 4XVUA 1Q21A 3PV0A 4TN1A 1E9DA 1RKBA 1BIFA 5FOVA 1VYUA 4URVR 1P3JA 2FG5A 2HV8A 4MGKR 2ANBA 4NZYA 2H57A 1ZM3A 1KNQA 4M1SA 4XTCS 1OKKD 1SQ5A 1E2JA 4JMPA 4US1R 4LOAA 8OHMA 1NVUQ 5EE9A 5DYIA 4V0NA 121PA 1CU1A 1XPUA 1AS3A 3QF7A 4RZUA 3K70D 2RCNA 5LD2C 2VHJA 4G5OA 3GEIA 4OBEA 3AUXA 3NBXX 1T8UA 2QA5A 4OL0A 4V0ME 1RRCA 1N5LA 5KYKA 3OEED 1RRPA 1OPXA 2Q3MA 1RJ9B 3MWKA 2WHXA 3GLHA 3DM5A 3O8DA 2YOFA 3FB4A 3PVSA 2HF8A 1IY0A 1KI9A 3HU1A 4A4DA 3K53A 3DOEA 1NN3A 1NBMD 5HCIA 2JJ8A 1IONA 2P6NA 2H17A 3ZH9B 2UZ3A 3K9GA 1CKEA 2W58A 5FTJA 3ZZTA 1EK0A 2ANCA 1AQUA 5CB6A 2D7CA 3ZVNA 2GETA 4CGZA 4IKEA 1J8MF 2XJ9A 1NMXA 1DO2A 1CF4A 1W1WA 2A5FA 3DDCA 1G8FA 1JJ7A 1QHGA 2VF7A 1G7TA 1T4GA 2B21A 3WNDA 1DBSA 5H68A 4C0BA 1N6RA 3TUJC 1GP2A 1JAHA 4LZZA 1NP6A 5JI3E 4ZIRB 2PEZA 1MABB 2WMOB 3I5YA 1W2HA 3M1IA 3RC3A 2C03A 1VDZA 2XZLA 1WDTA 2QMOA 3LQRA 2ZYWX 3GD7A 4MDFA 4DKXA 1XEXB 1HT1E 2VSOA 4UNNA 2BOVA 4HLCA 4M1WA 1ZM4A 2OO7A 2XNDD 4B6EA 1XTSA 3VHXA 2AKYA 3U3OA 3CRW1 5AUOB 1R0ZA 2NO6A 1T5LA 4F7WA 5KDOA 1UF9A 2ZI4A 1S4QA 2NG1A 4HLUA 4GBMA 5H1YA 2XEXA 3IKJA 4MRNA 1OB5A 2ZYVX 2QBYB 4GNKA 2IYYA 4B3BA 5K8TA 1JPNA 1N5KA 4MKHA 3TGPA 4MUAA 4NPHA 2CEAA 3UG6A 1VTKA 1KJYA 1W0JD 3VR4A 5CDFE 5LDDC 2BMEA 2IWRA 5AUPB 1UBGA 1E94E 1KYIA 2BM0A 5CYOA 1XMSA 2QAGC 5B30A 1OW3B 2YWHA 3AVUA 4FW9A 4EPYA 3E1SA 2IYUA 1R10A 1U98A 3B9QA 3X2SA 3AVXA 2ZRKA 2V55B 2HLDD 1R5OA 3EZFA 2WICA 1KJZA 5CJ2A 2A9KA 1Q0UA 2YYZA 3OHMA 3QKUA 2QP9X 5FI0B 1E1QD 1TNDA 2A5JA 2KB0A 4W7SA 5DHFA 3ZQ6A 5JEEA 1L2TA 2IXGA 4NU0A 3ZVRA 1M1YE 1AA9A 2QSYA 2P67A 2XX3A 1KI1A 4K81B 3DEFA 3B2EA 3Q85A 2YC4C 1E99A 2WAYA 4BLRA 4XSGA 4XIGS 1MT0A 3KQHA 2GHIA 3AVQA 1I4TD 3TIFA 4U02A 1KGDA 4QOSA 1GILA 2O8CA 5B58C 3RWOA 2W6JD 2ZROA 3ECCA 2FE4A 3ICQB 2GZAA 1XMJA 5FOTA 4KSCA 2OFXA 2ZUDA 4LYAA 4DCUA 1U2RA 5JJLA 4IOLA 3FMFA 4B3DA 1FP7A 1Z3IX 2BWJA 2ZI7A 2VHTA 4KFTA 4DLWA 2RGCA 1A7JA 4QC2A 1G21E 4ZV4A 3IILA 3EZ6A 2D7DA 1PUIA 4GZLA 2WSSA 2W2VA 1JR6A 3IIMA 1KDTA 2GJ9A 2HCJB 4JSYA 4YDSA 4C2TA 2C98A 5HTKA 4CEIA 4BZXA 421PA 4C0HA 2QT1A 3R8FA 2QROA 1E79A 4H1UA 5CM8B 3FVQA 5KDDA 1SXJB 3CM0A 1OYYA 3BB1A 1GWNA 2JDID 4AYWA 4EQ6B 1COWA 4TT3A 4MH0R 1SZPA 3BIFA 1E0KA 3U44B 1VKJA 5GADl 1NIJA 3WYFA 4NH0A 1HH4A 3EARA 3KX2A 3W90A 1II9A 5KNCA 1E1RD 5JBQA 3MWYW 4FMBB 2OILA 3LY5A 2MSDB 3WNCA 1JALA 2VLIA 3U2QA 3VX3A 3L0PA 5LBIA 4IXNA 3THWA 3SFVA 2I4IA 1JR3D 2YOHA 1D6JA 2F1HA 2XB4A 1ANKA 2FFHA 1ZM7A 2R6AA 3BB4A 2WM9B 1RYHA 4D0GA 3RRZA 3CF2A 4LV8B 5J4VA 4I81A 3CPHA 1G7CA 1FQJA 2KWIA 3VAAA 5FI1B 2P6RA 2PLFA 1D5CA 3WBJA 4QL3A 3THOA 1P9WA 5GVRA 1BH2A 4M9ZA 1KAOA 1J7KA 2WWFA 2XTNA 4M1YA 1GUAA 3T61A 2AR7A 5DH9A 3K0CA 3N5CA 4DIDA 3R20A 3MG9A 1JBKA 4N0DA 1W5SA 4D25A 2ZSEA 2WWIA 3A1UA 1E3MA 4N1AA 3B1YA 821PA 4CYMA 3W3AA 3VR2A 4E5UA 3VU9A 5BYKA 2J0UA 5C4GB 3IIKA 3K9HA 4Z8XA 1D8TA 4A1FA 3A36A 4HSEA 1PV4A 1YZUA 4UJ5A 4WZBE 1G3QA 5KHOC 2FSGA 4Q19A 4HATA 4R98A 4ARZA 5HZHA 2W00A 5FTLA 4DCVA 2IT1A 4E07A 4Q7KA 1I2MA 3PEUA 1FTSA 4CZ2A 1BMFA 3W8RA 3R8CA 2KSQA 1OFHA 2H18A 4PQYA 4V0OA 4B3CA 4BFSA 1FZQA 2ZRPA 4BPBA 4U7DA 4HDCA 4HAYA 3T5DA 2HCBA 2NIPA 2ODWA 1TADA 2J7PA 3DMNA 2W0SA 3MWLA 4QFMA 4ABYA 3V4RA 3M0EA 1S1CA 1TU3A 3QBTA 4KFUA 1GNRA 4RD1A 1PZNA 1Q1QA 4L16A 4NMMA 3SJBA 3VKHA 4TMXA 3D6TB 3X1DA 2QRNA 1F3OA 3K0FB 3RYTC 1TUEA 1XB2A 2JIZA 1NL3A 2IK8A 3UPUA 2V7QA 2DWQA 1D9ZA 4P31A 3REFA 4IVRA 2PZFA 3WP1B 4DXAA 4ARZB 1U94A 2ZJYA 3NHBA 2GJAA 1XD9A 2GEVA 3RAPR 4LCBA 1G6HA 4IOKA 5KO2A 3LWNA 3EIQA 1XBTA 2FPKA 2QORA 3TW4A 4LHXA 4OHZA 1S3SA 1QHNA 3I61A 5UKDA 4GL2A 2GK7A 3SBEA 2FGKA 1X3SA 2OUKA 2BMDA 4A36A 2ZRLA 1T3LA 1F2TB 5AWFC 1JEEA 2HT6A 4JL5A 4MA4A 5JWRA 3ETLA 4ZCLA 1YU9A 1FL9A 1R2QA 1FTNA 1MO4A 1G3RA 2QI9C 4FIDA 4M0LA 1VHLA 2GBLA 3RVBA 2QM8A 4URXR 1QRAA 1LTQA 4ESHA 3D7MA 3MGCA 4WA7A 2GEDA 3AKEA 5TARA 2C9OA 2GILA 4II7A 3TSWA 1G18A 2QNRA 4HEJA 3TQCA 4EPWA 4JVLA 3LX5A 3OESA 4F38A 1P2SA 4TTRA 1UBCA 3AV0B 4X8MA 3FMPB 1UPTA 2OT3B 3BD9A 1KO5A 1E9BA 3VNVA 1KO4A 5FPYA 5CDFA 3VU9B 1F48A 1TF7A 4RD0A 3BRWD 4DEYA 3SJCA 3PUWA 4R2IA 3SYLA 3WYGA 2ZE7A 2ZSAA 1SVIA 4QGGA 1E9CA 4HAXA 4BZPA 4YMUA 4US2R 3KKNA 4TQUS 1AZSC 2RGNA 5K8LA 4KBGA 1R8SA 2IWHA 1R5BA 2WJHA 4RCZA 3MJHA 2G0NA 2G83A 1HE1C 4D4MA 1UAAA 1DG3A 3KXKA 2IEZA 4BLOA 1XX6A 2IYSA 5DO9A 1M2OB 2WZQA 3NXSA 4FWTA 2IHYA 1YE8A 4YMVA 3O8CA 4GOJA 2OXCA 1XCMA 3LA6A 2QZ4A 3THXA 1KK1A 2NO9A 3LRPA 4M1OA 4HDQB 3FKSA 2YJTD 1KSFX 3OFND 2G1KA 3FHCB 1NLZA 4G3XA 2BBTA 3AVWA 1GKIA 4ZCIA 1F60A 4JYBA 4OHYA 1X8LA 1ZIPA 2BJVA 4GI7A 2RHDA 2G1JA 3BFKA 1GRNA 4ZO4A 1F2TA 2FU5C 4O25A 3AVPA 4RD2A 2WJGA 2MMCA 2ZVQX 2QGZA 4Q9IA 2GF0A 4GSYA 3VTKA 3KXLA 2LKDA 3B1XA 4DCNA 1JQJC 4M9SA 2IA5A 3LAWA 4B6FA 1SXJE 1XEWX 3FMIA 4XVQA 4LYJA 2CLDX 3S1AA 4OQLA 4B2PA 3OE7A 1E1QA 2O0KA 4WZAE 1EX7A 1KO8A 4TL8A 1UBFA 2NO7A 2WWGA 1BMFD 4US0R 1KSHA 2B92A 4LBYA 4NKRA 2IS2A 2YWGA 2ZRCA 3CR8A 4DT1A 4ITRC 1SVSA 2AL7A 3OZXA 4JKYA 2GBLC 1E32A 2JLZA 2ZE5A 4ACBA 3TH5A 2XSZD 3SQXA 3QENA 1YVDA 1TU4A 1II8A 2FSFA 3WNBA 1S9DA 4FD2A 2ZM5A 5JI2E 2I3BA 3F3YA 3RS7A 3GJ3A 4LWZA 5J5CA 4IFBA 3CNLA 4Q47A 1Z2CA 5EE0A 2J3EA 2R6DA 2VA8A 5JFGA 5F9HA 2ZYUX 2O8BA 4IVQA 3L8ZA 5C46F 1X8JA 1V5WA 3FHOA 2R65A 1ETUA 5LB4A 1QHXA 1N3BA 1S0UA 1Y3AA 3B13B 2HXSA 2BDTA 3BFVA 1ZYUA 4DRZA 1OF1A 1T0HB 3OIYA 1WE2A 2VTKA 4BLTA 2WKPA 4JLNA 3AKYA 2IYXA 1AZTA 1RW4A 5E4FA 4HLQB 5HPYB 1W44A 2PCJA 3DKPA 3UK6A 5JZVA 2BEKA 2J0QA 2ZS8A 1GITA 1EFRA 2OAQ1 2VSXA 3CPEA 3L0IB 2V6JA 3QXXA 3TAUA 4GP6A 4WAUA 5HZKA 2ZR0A 2JEOA 4KBFA 1G9XA 1GFIA 4PZYA 5HR5A 4BRUA 4URWR 2FZLA 3EXAA 3QVVA 3WHKA 1DAEA 2JDIA 2VH5R 4ESVA 1WBBA 1A82A 4M1KA 4BLSA 1M6NA 1P2TA 3KKQA 3RRMA 3Q7PA 3NBYC 2WOJA 3ADDA 1M34E 1UKVY 1HURA 4BUJA 4MDEA 1UKZA 3GJ5A 2PX0A 1FX0A 1ZJ6A 3THYA 4I1SA 2J7KA 4DLZA 1MO5A 4AC9A 1CR4A 2YNMA 1D2MA 3EZ9A 2IF0A 4UXHA 2JLVA 4A0HA 3CWZA 1L4YA 4WIAA 2R44A 2Z5FA 4HDOB 4D26A 4AD8A 5GVSA 1KTVA 1DAMA 1XP8A 5B2ZA 4PAQA 5FUXA 3I4LA 5TMPA 1IQPA 1IY1A 2FEMA 3B8HA 4A92A 1YHNA 2AKAB 5KU1A 1KI4A 3GLHB 1QF9A 1WF3A 3IO3A 2YKGA 3EC1A 1ZIOA 4EFMA 2TMKA 4PPNA 2JGNA 3U3JA 1RVDA 2PJRA 2SHKA 1NSFA 3VR1A 3VR3A 1U0LA 2ZJ5A 2IBMA 3U3KA 4WXRA 1NJFA 3AF2A 4X8LA 1JXMA 5KNDA 1UEJA 4JKIA 4ZI3A 2EU8A 2JLYA 3B82A 2BVNA 4LI0A 4ZCMA 3OEEA 2WVJA 2ZUCA 2B7BA 1UKEA 2ZTSA 2QMUA 4RZXA 5FR2A 1Z08A 2G3YA 2GKSA 4A8JA 3HP1A 3GLFA 1ZM9A 2WBLC 4KITB 5E7JA 3NH6A 1E6CA 4TLBA 4KLNA 4OHVA 4RFSA 1KDOA 3AP1A 1NVXQ 1G4AE 4LHWA 5IK2D 3CX6A 4RD4A 4DLVA 3ZD7A 5FFMA 3G0HA 3NWJA 4GP7A 1MV5A 1KSGA 3QPWA 5TY0A 4EDHA 2GK6A 4DSNA 4KJZA 4HB2A 2IYLD 3CIOA 3MWJA 3X1WA 2PX3A 4PC7A 5KTYA 2F7SA 2C78A 1E9RA 4LGMA 1TMKA 2RHMA 3CNOA 1XTQA 2NZJA 5CLLA 4MKIA 2IS1A 4OQFA 3WHLA 3BERA 1KI2A 2UVQA 4MYCA 4DLUA 4MRPA 2J7PD 3ASZA 4EUNA 4IOJA 4AI6A 2AFHE 4X8OA 3HYTA 1Z47A 2X8AA 2G6BA 4BLPA 4AKHA 4D2IA 2A7QA 5EP2A 3SJAA 1ZD9A 4BE7B 4Q4LA 3IBGA 1AKEA 4FI3C 2GZHA 4IXMA 3W5JA 4OI1A 4DBLC 2MSEB 1G5TA 2P0EA 4PANA 5E95A 3NTUA 1DTSA 2BJWA 4G5RA 4NBSA 4MKGA 2RGBA 1G8GA 2AFIE 4AG5A 4IDHA 5J4YA 4OI2A 4B32A 2FPMA 2KBEA 4JLBA 2FFAA 5FOXA 2GXSA 3NDPA 1Q1BA 5EJEA 3ZVLA 4CEHB 4DDWA 3UMRA 4HUQA 2H7VA 1HT2E 3BC1A 1XWIA 3TMKA 4LHVA 4NCNA 4RD3A 3RS3A 3AVOA 1A2BA 2QPAA 3TJZA 4A82A 3I1FA 1EWQA 4Q4JB 4DB2A 2ZRFA 5TB5A 1U9IC 4YC7A 3B6EA 2CCGA 1M7GA 4W5JA 3IHLA 2ZRIA 3D31A 3Q5DA 1M7HA 4MGIR 1FPMA 4UJ3A 3WP0A 3N2IA 1NLYA 2ZJ8A 2F9LA 1E0AA 3QEJA 2AWOA 2ZRHA 1EFRD 1CS4C 3AP2A 2WKRA 2GVDC 2HLDA 4QHSA 4GPTA 2ZJ2A 3QBVA 1H8EA 1IXZA 4LHZA 4JJKA 3A1TA 3U5ZB 4F92B 2CK3D 5IF9A 3IO5A 3T5GA 4HB4A 3W6PA 4TZ6A 1PLJA 1CULC 3KJEA 3E70C 1RRGA 1Z0IA 2WJIA 3LBHA 1Z6XA 3U61B 2DR3A 1E2HA 2E87A 2OV2A 3QKRA 521PA 4E22A 1ZNYA 1NMZA 5JCPA 3G82C 1OHHA 4LC0A 5HKKD 3VR5A 5DE3A 1DAHA 5KSPA 3VKGA 2CVHA 5G40A 1NY6A 4S2EA 1E9EA 3CW2A 1GTVA 3KKPA 1UJ2A 2Z4SA 4PZZA 5FUYA 3LQQA 5AJVB 1J70A 5HKKA 3P26A 1CJVC 1KI8A 5C18A 4OQXA 3BOSA 3Q8XB 2XNDA 3EZ2A 4FN5A 4MRVA 3OFNA 1CBUA 1VG0B 2QM7A 1E2GA 2JLRA 3BH0A 3ICEA 4YXWA 1JJVA 1UFQA 3T1TA 1SKYE 3GLHE 3SI7A 2GNOA 4BFWA 5F3WB 1JEDA 4JYCA 4PX9A 4HZUB 1S8FA 1T3HA 4N0EA 4AK9A 3JVVA 4DUGA 3SEAA 1U99A 2REBA 1P75A 3LW8A 2RAPA 2JJ1A 4HAWA 3BE4A 4CEJA 1XFAA 1S9HA 2RB4A 3KKMA 4DLTA 3T34A 4C0AC 3ADCA 4CIDA 3GJ0A 1P72A 4QJ3A 4YMTA 4EPTA 5KPDA 3QPUA 1SVKA 4FMDF 4B43A 4DB4A 1BS1A 2GAAA 2ZE8A 1PLKA 4FCTA 1KDPA 1XXHA 5BN4A 1ZVQA 2ZRBA 4K8OA 1MO6A 3A1WA 3Q7QA 2XOKD 1AKYA 3QUSA 1VIYA 3MLEA 3NEYA 1R0XA 4RY2A 4EJSC 1FX0B 1WXQA 4Q4HA 2A5DA 2PLRA 1KI6A 4DDUA 2RGAA 3EAQA 1N0VC 4QXAA 3HJNA 2VP2A 3W3ZB 2AK2A 3KFVA 4TYYA 1FNMA 2AHOA 2C96A 2J46A 2NTYC 3U3RA 2N1BA 1Z6GA 4R9UC 2HUPA 1GDDA 5HE8A 4BFZA 4IEEA 2I1VB 5P21A 3IEVA 1NN5A 3UWKA 2RKOA 3QKSA 4QBIA 1E2KA 5A0FA 4UKDA 1G4UR 5FPHA 1ZAKA 4OK5A 1W0KA 4BFVA 5SZIA 2Z6VA 3PENA 4JLJA 3UATA 3K09A 1LF0A 2EFEB 3CZQA 4EIWA 1RFLA 4JL6A 3ZDQA 4YMWA 5CK5A 2O0JA 2FGJA 4MYUA 4LJ5A 2J1LA 2PMKA 4RKEA 2DFKB 1E2LA 3B5JA 1F6BA 1YR6A 3GEEA 5KPJA 4Q9KA 1Z0FA 3TSOA 3X1YA 4OI0A 1YQTA 5DNYB 3AVVA 3FYHA 4JLPA 3KKOA 2BCJQ 3FTQA 3OIUA 2CNWD 3RRYA 2MMGA 4DHEA 4EJSB 3D3QA 2FFBA 1FQKA 3P1JA 5BWMA 4Z1MD 5DN6D 5TDHA 2ODEA 4IDPA 1E1RA 2B7CA 1FOEB 4UXIA 4L9WA 1US8A 5CIQA 4EJSA 3P27A 1W36C 3U7HB 1X1SA 2J87A 5J4HA 2F1JA 4TSFD 4XWAA 2J0SA 1YZGA 1AIPA 1LS1A 2B6HA 3KTAB 4MGZR 3NC0C 4KU4A 3THXB 1KY3A 5AJYA 1C4OA 4G1UC 1OFUX 4L5BA 4W5HA 1CRPA 3L0OA 2RGXA 5C4MA 3K0SA 1JXOA 4LJYA 4TSFA 1G8PA 3GQBA 1XZPA 3C15C 2QP3A 3QY0A 5BN3A 4Z54A 3N70A 1SVLA 5FUVA 2CL6X 2IYRA 2ZJZA 4Q7LA 4DC9A 2QTFA 4LY6A 3X1XA 4NP6A 4BASA 1P6XA 2DFLA 3U60B 2GAOA 1XRJA 2V8OA 2OAP1 1LV7A 2VP6A 2F55A 3J81k 3OIVA 3GLGA 2CXXA 1WBDA 3EWSA 2AD5A 3SE0A 2WWYA 1OSNA 3HPRA 1YRAA 2BMFA 3H1TA 2NQ2C 3KXIA 2F3RA 1RC8A 3NHAA 3GP8A 3GLIE 4RFSB 2FPLA 3JVUA 5H8WA 2ZI5A 3EA5A 4LSGA 5BXQC 2ZRNA 3IUYA 4A0GA 1Q12A 4RD6A 1KIMA 3O47A 4U5XA 4Q9HA 4CEIB 1OFTA 1VG9B 2ZXUA 5L3RA 1A2KC 4TMKA 3A4NA 1AN0A 3AF4A 4C0JA 3I8SA 2IYWA 5DLQC 2CHVA 1ZUHA 1XZQA 1XXHB 1EWRA 5L8VA 1I2DA 2RMKA 4B3XA 5DISB 3BWDD 2AXNA 4OK3A 1ZNZA 2JAQA 5FL7D 4BWYA 4QBGB 2Q0HA 5BN5A 5KSYA 4MITA 4V03A 1XCGB 4B44A 2VF8A 2HDNB 2IS6A 1FNNA 3VX4A 2WWXA 3L43A 2ATXA 3A1VA 4RZ2A 5CM9C 1P7CA 5L3QB 2YVUA 1XEWY 3K9LA 1Z29A 4TLEA 1MR3F 2QG6A 1RPZA 1N2CE 3WXMA 4ILEA 2P65A 3MMPA 4M1TA 1Z83A 1LW7A 4IDNA 2C9YA 4PQRA 1F2UB 5FUWA 4JZKA 4NE2A 1AM4D 3ONWA 4MYTA 1P61B 1OH7A 3CH4B 1WMSA 3H2YA 1XPOA 1XPRA 4E03A 4PFSA 5L3SA 2ZSFA 2DBYA 4OQNA 4NYIQ 4QGFA 3WMFA 4CRWB 4D0LB 1T9HA 2YWFA 1G16A 1L7VC 5AUQA 4YDHB 5JWOA 2IUSA 2EFCB 3LO5A 4L8GA 4UNPA 4G0NA 1E2NA 3T1OA 2OFWA 5B64A 3RDPA 4NYMR 3AP3A 2WPDA 1XMIA 2GXQA 3THWB 1EFHA 3K0AA 2OCYC 4QNMA 4ZDJA 1SXJC 3U7GA 5AJZA 2PBRA 3KJGA 1D2NA 3Q5EA 5E7IA 2AD1A 3C4JA 1SULA 4TMTA 5JLJA 4C7OA 3I32A 2BC9A 2G77B 3ASYA 3BORA 3HPQA 4LC1A 2GTPA 2XJ4A 1HY3A 4XD7D 4F91B 4F4CA 2NO1A 1UDWA 1YKSA 3KJIA 2C2HA 4A2QA 3TK1A 2GVZC 3T06B 2C5LA 2Q3FA 3AGPA 2W6IA 2NO0A 3FFAA 3TE6A 5C2JB 5J40A 6Q21A 1T0JB 3R7WA 3JZMA 4Q9LA 3QF4A 2FH5B 4PXAA 3KZ1E 5KNBA 2WIAA 1KI3A 1VCMA 3MD0A 4ZI2A 2Q21A 1OIVA 1XDBA 1QDEA 3FKQA 3QG5A 3TBKA 4TYNA 4LPSA 4L15A 5K8IA 3HR8A 2LKCA 4B74A 4AKIA 5FR1A 1OYWA 2VP4A 2B8TA 1GAJA 1GKYA 3QE0A 4Q21A 3AKCA 4DSTA 3CO5A 2NPIA 3GJXC 1L8QA 3P32A 4B48A 2ZS9A 4HB3A 3EIEA 1AK2A 2CE2X 3RWMB 3TUZC 2GRJA 3CRQA 3RS0A 1KZ7B 1OT3A 1P2VA 1WRBA 1Z0AA 4HYYA 3UWOA 1NVVR 4LK2A 3AF0A 3BK7A 5EZ6B 4YXWD 4W9MC 1IAQA 5EQTA 1Z8FA 1SVWA 5EP1A 5BYJA 4JLOA 5FTNA 1E2IA 3B9PA 4JS0A 3LD9A 4Q7JB 1E2MA 1IOZA 4PO8A 4A8JC 5KSZA 4OKSA 2ASEA 2H1LA 1G3IA 1CJMA 1OXSC 2YHSA 2JLUA 2GEUA 2FJUA 4OHWA 2YC2C 1KOFA 3ZD6A 3LXRA 3QPVA 3AVYA 4TQ9A 5JRJA 2WMNB 2VHQA 4TL7A 4JJZA 2NOAA 3BBPA 4I1OA 2IXEA 3A4LA 2P2LA 2PEYA 1W4BA 3B1WA 1NBMA 2C04A 3F5FA 3G5UA 3PEYA 4Q48A 1MOZA 2ZETA 2CJWA 2OHFA 5J4LA 1XF9A 4QGAA 2BM1A 4TTPA 3QSYA 1HV8A 1X8KA 4MYHA 1IJEA 3K09C 2ONJA 4ASUA 4A0RA 3OF5A 1QZXA 2Y8EA 1XJQA 3KUCA 1KK2A 4XOIA 4D4KA 1N25A 4TYPA 2P6UA 4PSVA 2ERXA 1XD2B 4K46A 2VPPA 2O8EB 1OIXA 1T5IA 2PL3A 1FFHA 4URZR 1KI6B 3W34A 5CJPA 2WJVA 2PJZA 1XD8A 2V9PA 5H70A 4RCYA 3SYNA 4ZPXA 3MAAC 4Y0VA 4LBVA 4B2LA 1N6LA 5AR1A 1W47A 4IDOA 2Q9CA 1P9RA 1BYUA 3REGA 5BW8A 1MH1A 1YJ5A 2CMKA 5DHAA 3RS5A 3SJZA 1DEKA 3QKSB 4KHZA 4OI4A 1NJGA 5EP3A 4EPXA 1VMAA 4AYTA 3P20A 4JVNA 3KB1A 4IFEA 1CR2A 4R71A 4LX0A 3L8YA 3AEZA 3GLFE 1Q3HA 1ZUIA 2AX4A 4JLVA 3R7WB 2O0HA 3I8XA 5JRZA 1N0WA 3CZPA 1VG8A 1QHSA 1P5ZB 3VQTA 1Z6AA 1R0YA 1XU4A 3GFTA 3CF0A 3K0EA 4GFDA 5EXSA 5GJVC 3TVDA 3I62A 2OBMA 1SHZA 1PVOA 3IEUA 1CR1A 1NMYA 4PQFA 5IRCD 2E1RA 5BQ5A 4ZKDA 5IT5A 4O2RA 2KE5A 3TVTA 4HZUA 1ZW6A 2YV5A 4TMWA 5AJXA 5L3QA 1G19A 5D3MA 1G5RA 2VEDA 2ZU0C 2EFHB 4JLAA 4KCGA 2CL7X 2ZRDA 3K70B 2CCKA 5G41A 1W36B 1W46A 4HAVA 4F4IA 4AWXA 1OKKA 3F0TA 4KFSA 3GLGB 2ZRGA 4JL8A 1II0A 2VO1A 4MUBA 2OE2A 4OYHA 3RANA 2DWPA 2X77A 2WJYA 1Z06A 3QIAA 2DHRA 1COWD 4TT3D 1ESNA 2XXAB 1AGRA 1K6MA 4XVRA 4Q66C 4YONB 3C5CA 2Q6TA 3HDTA 2ZEJA 2QE7D 1TTTA 4LV5B 1G3UA 4JLKA 4QJ5A 2D74A 1GZSA 4R2HA 2Z4RA 1E2FA 1VYVA 4LDJA 4C0QC 2WOOA 2Q9BA 4PZLA 3LW7A 4DDTA 1NNEA 5F9FA 3RS4A 3GJ8A 3I92A 4J0QA 1HEIA 1NRJB 3DZDA 1IN7A 3QJYA 4YMSA 1W4AA 1U0HC 2BEJA 1JI0A 1XD2A 3CKLA 2PZEA 4TL9A 1T8TA 4ZDIA 2NZ8A 4V0LA 2FOLA 5FBVB 2EYQA 2LWIA 2DPXA 4TL6A 1VPLA 3A1SA 3B60A 4B2IA 4FMCF 1FP6A 2ZE6A 5DSZA 4AYXA 4XWOA 3GLFB 2WJJA 4B35A 4Q4AA 2GCNA 3AF3A 4DUGD 1KO7A 5A5GA 3QXCA 3PIRA 4XH9B 4M21A 4B33A 4FXPA 1G7SA 4HZIA 3GJ6A 3V00A 3FWYA 2IXFA 4P32A 1NVWQ 5CYPA 4KVGA 2VQSA 4D0NA 5CK4A 1IBRA 5JS8A 5KUTA 3NEJA 1ELOA 3U6KA 4B71A 4A2WA 4AIIA 1IN5A 1VHTA 4C9BA 1ZBDA 1CLUA 4Q03A 3AQ4A 1SHKA 1I4LD 3JZAA 3SHFA 3UIEA 5AJWA 621PA 2CJWB 3I72A 5TVKA 5EUQB 2ZJAA 3V9PA 2D06A 2ZANA 1D9XA 1N6IA 2QENA 3FGNA 3W9YA 4BLQA 4DZZA 2EFDB 1MABA 4Q18A 1EXMA 3HU3A 1IHUA 1NVVQ 2VIIA 2PH1A 4JVSB 2ZI9A 4LJ9A 2G9NA 4POAA 2PMDA 1J99A 1KSJA 4BFYA 2O8BB 2ZAMA 3SR0A 3PEVA 2C95A 3DMDA 4KYIB 3NDBB 3EX7C 1JPJA 2CLCX 2VYFA 4PC2A 5DGXA 2G88A 3UG7A 1Q1ZA 1K8RA 1FUKA 2GA8A 2VP9A 2OZEA 4EPVA 1KDRA 1G3MA 3E2IA 2H8KA 3TAHA 4P4SB 3F8TA 4WW0A 1NF3A 1IN6A 2WKQA 4MKFA 4PC1A 1IN8A 4HAZA 2ZAOA 5FBLB 3KL4A 3PFIA 4ASUD 1AJEA 4H9GA 1G20E 2EW1A 5JWHA 3BH6A 3LVRE 4DLXA 1Q22A 2O8DB 2YZ2A 2QUZA 2OSBA 3MRSA 3EASA 2CLSA 2O5VA 4JBXA 4XSHA 4Q4AB 3OAAA 2ZR7A 2E9SA 3RLFA 3TR5A 4QBFA 1EFUA 1A5TA 1P4SA 3QF4B 1KAGA 1TL7C 3T15A 4O2LA 1WQ1R 4BEBA 1OIWA 1NKTA 2FDCA 4FMDB 3ND8A 4C0SA 2AK3A 1RRFA 3TR0A 3QOFA 1M8PA 4KAXA 4RZ3A 3IBYA 3PUVA 4HB0A 3KQLA 3ZVMA 3TKLA 2WWWA 2ORVA 5FOUA 2OBNA 3W6OA 1SXJD 1ZNWA 3ZS8A 3PJRA 3CF6R 4WVFA 5FPTA 2HYIC 2YWEA 2DYKA 2BBOA 3A4MA 1XTRA 1Z0JA 3CBQA 4Q4HB 1G5PA 2QQEA 3TLXA 1ZMXA 1E4YA 3K0AB 2FMXA 1TX4B 4DLYA 1TF5A 4W5WA 4EKDA 3PQCA 1T3SA 1JR3E 4LBWA 4H1VA 4D4LA 2BHRA 4V0KA 3K0CC 5G53C 5FPKA 3R9XA 4Q1CA 3BAFA 4KODA 1ZNXA 4Q1AA 3A8TA 1Q1EA 2QP4A 1OE0A 4CT5A 1EG7A 3Q3JB 3C41J 3M6AA 2IUUA 3RNLA 1YR8A 3HR7A 2VHCA 5C1BA 3K70C 2JLQA 1OV4A 3KB2A 1ZC3A 1TQ4A 1EFTA 1TUIA 2D3WA 1EESA 1Z6YA 1LB1B 1S96A 2QL6A 2V1XA 2VL7A 2VP0A 2NMVA 1MRSA 3C5HA 4B34A 4ZIRA 2PT7A 4ZDWA 2RH5A 2DFTA 3DL0A 2Z0MA 2DWOA 1G291 2W2XA 1GNPA 3ZLJA 1DAIA 3KFXA 1N6NA 2ZS7A 1ONBA 3WBKA 1RIFA 2A2ZA 2JJ2D 3R9WA 3FPAA 1QHYA 3H86A 4MRSA 1KZGB 4LYFA 2OG2A 1E0JA 3DM9B 2ZQ5A 2J41A 3V4FA 3WYAA 3IIJA 4UQOA 3CPJB 4NHOA 2Q9AA 4G01B 4LPKA 5J4KA 3RS2A 2EYUA 2OFOA 3GFOA 3QG1A 2JA1A 4DLSA 3P4YA 4NCHA 1E2EA 3T12A 3S1AB 2FFQA 4HAUA 4WXPA 2I1QA 4QBHA 1KHTA 4DLRA 1Q3TA 3CRMA 5ELXA 4PSAA 4A0FA 1L4UA 1P9NA 2QTHA 3LLUA 2RGDA 4WBSA 2IS4A 1NN0A 3EPJA 3FKSD 2F3TA 1GSIA 2J0UB 2QU8A 4JLDA 1YZTA 1ZCBA 3EIHA 2ZVPX 1UBEA 2BKUA 3WRXC 4NONA 2QMHA 2XB2A 3AM1A 3EZ7A 1QVAA 3TW8B 1P62B 1GL6A 1H8ED 1XJCA 2V4ZA 4RKFA 4LUCA 2J5XA 1WA5A 4Q4JA 5FBWB 5M04A 1OXUA 3BXZA 4M22A 4V0MA 3KTAA 5HCNA 4AKGA 1UEIA 3HU2A 3CNNA 1H8HD 4ON9A 2H16A 2QGNA 3OE7D 3LDAA 4ZDKA 5A4JA 2QSZA 2X2EA 5F2EA 3OAAD 1KK0A 5FTMA 2F6RA 4CT4B 1DO0A 1QG4A 1DG1G 3U4QB 1QHHA 4JT2A 4XD7A 2A5GA 4DCTA 4PHFA 3PUXA 4M1MA 4UXJA 4CEHA 1ZP6A 1OLOA 3H84A 1DARA 3SOPA 4D6PA 1ZU4A 3KQKA 2FNAA 3DPUA 2CK3A 2VRWA 5TXGA 3SHWA 2FZ4A 2QAGA 4C3ZA 1U8ZA 1B23P 1DAGA 5J47A 1CP2A 4IOMA 3ZIAD 2W6JA 3LFUA 3SQWA 2H5EA 1ZU5A 2UZIR 3NBZC 5G3ZA 5JHHB 1SGWA 3SN6A 2DB3A 1TQ2A 3BH7A 3ZQJA 1E0SA 4KO8A 3PG5A 2XTMA 1HA3A 2ZJBA 2GJ8A 3CUEF 5EE5B 4GOXA 1B0UA 4HLUC 5D3QA 2ERYA 2QN6A 1IXRC 4P4UA 3BJIC 2WSSD 2XZPA 4FMCB 5JCZA 1W36D 1N5IA 2KBFA 1NY5A 5KDLA 4D80A 4P3YA 4URUR 5E3HA 1QHHB 4IRUB 4LRWA 3RHFA 2CNWA 1PJRA 2R9VA 2FA9A 3QI2A 4M2LA 3KQUA 2F1RA 2QY9A 3LBNA 5DN6A 4B3GA 1KY2A 3NH9A 4GT1A 2XAUA 2Z83A 3OIWA 3QXJA 5DYGA 3GFPA 2FF7A 4Q00A 2BMJA 4I1VA 1RE0A 1G41A 1NBME 2GCOA 3GLIB 4DIEA 3CH5A 3FHTA 1NLFA 4NYIR 4S35A 2FEOA 1N6KA 1F5NA 2NGRA 2ONKA 3TRFA 4LJAA 4PR0A 4OQMA 5FBQB 2XXAA 3EC2A 1Q44A 3NIBA 1BO6A 2B8WA 1FUUA 2ZR9A 1WP9A 2O8FA 2F43B 2GDJA 4N3NA 4GMDA 4KFRA 1NI3A 3M4YA 2QPTA 1W49A 1U8YA 1KNXA 2JJ1D 2XSZA 3KDSE 2C77A 2ODBA 2J45A 3QNUA 4P33A 4UNSA 1VIAA 2F43A 3B85A 2JATA 2IHBA 3IPXA 5KSOA 1CJUC 2L0XA 4B73A 3I73A 3L2OB 1NSTA 1NKSA 4FCVA 4RVCA 2QMEA 1Q20A 1AS2A 3FE2A 2VHUA 2CL0X 1UADA 2JASA 5LD2B 2ZI3A 5IK2A 2J9RA 2GCOB 1U8AA 2IX3A 3GLIA 1GOTA 1KJWA 3K8YA 5SZKB 1Z2AA 4BRWA 3L0SA 2CBZA 3O8BA 4M9XA 2O8EA 1DE0A 3HYRA 4Q01A 4HLDA 3UXMA 5L3SB 5CLQA 5FOWA 2OXRA 2QBYA 1AQYA 3U6BA 4Q5IA 1W48A 1XCPA 3NKVA 3U7EB 2XGJA 3B7GA 4PHTA 2UKDA 4CF7A 2REXB 2V7QD 2RGGA 4I4LA 4MGYR 4QHTA 5FL3A 4A6PA 3FFBA 1G1MA 3CONA 3CRRA 1QHIA 5DI3B 2CVFA 4KVAA 4TQAA 3AUYA 3R9IA 2IW3A 4EFLA 2FN4A 1O3YA 4Z8YA 1TF2A 1KMHB 2W6ID 2QEQA 3O8RA 1P73A 3LLMA 3QXSA 5LB2A 1DOAA 3K0FA 3WMEA 2IYZA 2P5SA 3C16C 4PAOA 1N6HA 1QVRA 2BKEA 2DCUA 5JHGB 4NYMQ 3QKTA 4RSGA 4C2UA 1ZRHA 2LCFA 3K1JA 4JBYA 4TLAA 5GJCA 1SXJA 2ODNA 5EUMA 4UNQA 1KMQA 3SDZA 2BCGY 3GMTA 4MQBA 3PEWA 1Z63A 2K5UA 4NTZA 1II8B 3BFXA 2GJSA 1N6OA 5KOYA 4JIMA 5F98A 2R6GA 2PCLA 4URYR 5EP4A 2MSCB 2R2AA 4CEJB 2R6FA 4P0TA 2C8VA 3CWQA 2OM2A 2QAJA 3EA0A 3U4QA 1W4CA 3CB4A 1TEXA 3W6NA 4B47A 4G5QA 4AG6A 3IQXA 4UNRA 3D8BA 1FW6A 2PZGA 1NN1A 1FMJA 1J2JA 1H65A 1TEVA 2N42A 4LV6A 4R7ZA 4FCWA 3RSOA 4CDGA 5L3VA 1G8YA 2WWHA 4QRHA 1YZQA 1HQCA 1UDXA 5JS7A 1O87A 4EQ6A 1MO3A 2KI5A
chains in the Genus database with same CATH superfamily
2C3MA 2ONZA 3DEZA 1C5KA 1SZCA 2WTEA 4IGEA 1NIPA 4MVCA 3DCNA 4UHFA 4LA4A 4YCCA 2JIMA 3W5AA 4W5NA 4IW3B 1U2QA 3Q98A 1V7CA 2CE7A 4QQKA 1US8B 4ZOLB 5GJWC 3OZBA 2QRZA 1V47A 3IXLA 3OJFA 5J43A 1EWVA 1Y7TA 3E53A 3T38A 3JYOA 3MFYA 1TRHA 4HVCA 3KQMA 3WA6A 1HUQA 5AIBA 5ALNA 3WGHA 1UZAA 2PUDA 4X92A 3W2EA 1ZK0A 1P0IA 4Q02A 2HM7A 3H6GA 3AEUB 3GT0A 1DKUA 2NTJA 2EVWX 5FLYA 3TRJA 2IE8A 5KJ6A 1ETHA 5CB8A 3D8HA 2ZPTX 4OEHA 3P45A 5TRTA 1KO1A 2Q4RA 1Z8HA 2G4LA 1HE3A 3D5TA 3O26A 2FWRA 4FHDA 1PJAA 4KOAA 4MB2A 4N0QA 3TECE 4CDNA 2X41A 5K0FA 3GG2A 4EH1A 1YRLA 1T8SA 3K2BA 2Y27A 4A8JB 2LE0A 3BMOA 2WFLA 1VXOA 4C0XA 1P4GA 2C9CA 2JFQA 3FDIA 3SFZA 1IU9A 2WYUA 1YQ9A 2G70A 1AUQA 1WNFA 1BMQA 2R47A 4RV9A 2FW1A 2WIBA 2YXBA 3G2IA 4IHAA 1O95D 1R0KA 2NO5A 3QFRA 3PXGA 2GK3A 4B87A 4IO1A 5ANRB 3QUTA 4REOA 2FSHA 1G17A 3SNHA 3VMFA 4F2GA 2BW0A 4INZA 5L4SA 4QLAA 1LS6A 2A4KA 2IY9A 3H18A 1QV6A 4RIFA 5FJIA 2FSSA 2VNIA 1JYSA 1NDHA 3GJRA 5IH3A 3TSZA 2YS6A 1E98A 2AR0A 3CN9A 4EL5A 3RC8A 3HXLA 2Q07A 3WYEA 2G07A 2W2PA 3WKCA 3ABRB 3A1CA 1CQPA 4CETA 1K2VN 5EJ9A 1B3RA 4WD3A 4WDQA 3HA3A 2ECKA 3GGGA 4N76A 3L7CA 3UA3A 4IJWA 2H3HA 2WA2A 3ZZ0A 4LF7B 4Q9JA 5FH9A 4NX2A 5CHEA 2H92A 4NYJQ 1JWLA 5CHYA 3T1VA 1ITZA 2AOUB 2B36A 2MHCA 4PIVA 1O6FA 1OZAA 3A7DA 5B36A 1NXOA 3BHJA 5GV7A 2A9VA 1G6KA 2R96A 3GJZA 5DI9A 1X86B 2FAXA 3TQSA 1NR7A 4KXWA 5I51A 3O95A 1P33A 1TAGA 2VAPA 2ZT5A 3C3BA 2JLCA 2R62A 1FFXB 3O7WA 3ZHCA 3DDHA 4CG3A 1H5UA 1DHTA 5IJ9B 2WTUA 1L4MA 3SSOA 2XUKA 2W83A 3FRHA 3ZEIA 2JANA 3O9ZA 4JY7A 1BKSB 1GRRA 1I10A 2WV9A 2YW2A 4KYVA 2YIJA 1T2VA 4U00A 3AUUA 4H1WA 1RQGA 1T4CB 1WX1A 2ISSD 1P5FA 1UWKA 4MUEA 4TLDA 4B75A 4O2AB 1RYFA 3FVWA 3U4AA 3KWLA 2W70A 3EGCA 5DX0A 2VT6A 3GO4A 1RJEA 2YN0A 4IVPA 3DWGA 4TUYF 1GTJ1 1C9NA 2LR0A 2BLNA 3A2LA 3RYHB 1RZ3A 3IBFA 2DPLA 1ARZA 4FOTA 1Y1WI 4KE9A 5K3EA 4CJXA 4LHYA 5KYVA 1KMHA 3V9AA 5KAPA 4DYDA 3RH0A 4LQDA 2HA4A 2R93I 4J0HA 5AK0A 1Z6TA 1J8YF 2M6RA 4M54A 4N3GA 1EFCA 2R8OA 4LJ8A 2XUQA 2NU8B 3DEYX 2NYVA 2VSFA 2E2HI 2IF2A 4IRXA 4KUHA 3MMNA 1WR8A 5ESXA 1GIAA 3OCVA 4PYJA 3VHRA 1C3VA 4IDQA 1Z0KA 4O3FA 3RS9A 3VSCA 1SU6A 3KR2A 1M2WA 2ZQZA 3D5EA 3W7AA 1V5GA 4HGZA 4GXRA 3ZWOA 16PKA 4GRDA 5AD1A 3UVEA 3ZYCA 9ABPA 2HMSA 3NUZA 1Y0BA 5EEGA 3AL3A 3HCRA 4D3YA 3L5KA 5LM3A 1IK6A 2G40A 5BPFA 2V45A 1USGA 4NARA 2OP0A 1D2EA 1E79D 1LFDB 3IVXA 3ONVA 4QQNA 5BSMA 4JXXA 3O8QA 2VT2A 4ZEXA 3WK6A 1TWAI 1YB2A 3ZUGA 3K73O 4EGJA 1IB6A 2CT8A 1LLFA 1MRZA 1NUQA 2YIVX 3E7PA 3L4JA 1P19A 4K7JA 2X4DA 5DX1A 4QSHA 2HYDA 1KU6A 4H17A 1SZDA 1W4RA 4CVNA 4BDSA 3ZNPA 2QHXA 4FKBA 3H9QA 1NG9A 3EOBI 1ABFA 1TXGA 2B6NA 2ZBDA 4KMMA 1W6UA 1JKJA 3K9NA 4HAOA 4PSKA 2V54A 4RZQA 2VBFA 2QXUA 5KNDD 3FUTA 5DNYB 1CW2B 1O0CA 4LBZA 2D2FA 1KPGA 2JGIA 2Q5OA 3U62A 3QEMA 3O4JA 4DQDA 1K5GA 4XJTA 1H4SA 4Z0TA 3IGFA 3S1QI 3V32A 4YUZA 1T5HX 3HB1A 5TS2A 3PUYA 1K8QA 1IBCA 5I48A 3W4KA 1R6UA 5EKDA 3AF1A 1NJ5A 3E1KA 5EWLB 3RSLA 5C1OA 5KYGA 3VO2A 4LE2A 1AGPA 4LXHA 3KJHA 3RGGA 3VDNB 3ZOKA 4U6SA 2IIBA 1KIFA 3UMFA 3RKUA 2J59A 3Q72A 3CEHA 2V3CC 2FPOA 2J0VA 4Q39A 5K8UA 1FNBA 4EHAA 2I7VA 4L22A 2Q2OA 2W0MA 3I9LA 3PUJA 1WSDA 4JR0A 4NBUA 3T0FA 4GDFA 2WYIA 4GGOA 3C3AA 3QVGA 5DT2A 3UC9A 1QGZA 5HHTA 5JSYA 3U56A 1IN1A 3QXHA 2D5CA 3PITA 4RSRA 4CF4A 4K6OA 4EAQA 5GM2A 3I6MA 3OZEA 2D4HA 4W63A 3TYXA 4EHLA 3LT1A 1WL8A 3N87A 2P5TB 1Z26A 2XYRA 3V1UA 5TGTA 4A2CA 1U2TA 5CIWA 3SQLA 1HTWA 3GRKA 1CRLA 1IPHA 4C0LA 1VKZA 1EXDA 1J0BA 5HJ5A 4C4PA 4ZOLA 1DAKA 3L7MA 1XTZA 3MUEA 1BX1A 1EA5A 1P4JA 1TLTA 2IYOA 2V1UA 2G6TA 1PSWA 4JNKA 4EPVA 1GKLA 2FCAA 3CX7A 1DQRA 4FNAA 3IP1A 3VZPA 721PA 5LQNA 3FWPA 3JAWA 1H5QA 1DVRA 2PD4A 2NZVG 2VNKA 2ZYTX 3EBOA 3Q6NA 4NCJA 2ROQA 4QKQA 1YJ91 1KK3A 2UUAB 1M74A 3O9MA 1IXKA 4PZAA 4XYMA 1OX5A 4M98A 1KJQA 4TMZA 2E7ZA 1E4EA 3JASB 3DBHA 4OMCA 2FPIA 2F9FA 2WHYA 2PA3A 2I76A 1RJ9A 2RHGB 4A93I 1O08A 1ODFA 5K4GA 5LA6B 2X23A 4IHQA 3PWKA 3JYPA 4IQ8A 2H65A 4J49A 1KQNA 3N7AA 3ZGLA 2GBCA 1ZD8A 4DR6B 4BEJA 4ZOAA 1Y8AA 4EJFA 1XRPA 1U0TA 5AUNB 3SVZA 5KYNA 2J4CA 3AY3A 2JFWA 4NU5A 2YH2A 2H4YA 3G23A 5GQSA 3DVLA 3PC3A 2OTLZ 2ZI6A 3L79A 4ZXPA 3TOVA 5A9RA 1Y6FA 2P3SA 2ZJ0A 3CLVA 3ZBTA 4OH1A 3AKDA 4QG3A 5C81A 4OATA 3GAMA 2VDRB 3TCNA 2FETA 3U39A 1WD5A 1E8NA 3DO6A 3PPIA 1F2UA 3D0KA 4E5YA 5I7VA 2F8SA 1C0IA 4B76A 4PLGA 4BQRA 2WAXA 1GAXA 1A1VA 4WDRA 1J0CA 3FCOA 1F7VA 2D5AA 3A25A 4R2WA 3EVAA 3TDHB 3HUDA 2NSDA 4E3WA 1X1RA 3KUDA 5CM2M 1U0JA 3B36A 3IAM1 1KE1A 5JALA 1J9GA 1V1RA 2X3FA 3FOZA 4O29A 1HDCA 3LH5A 2FSUA 5HYVA 5JJ5A 4J9VA 1XCBA 1A72A 4E4RA 2M6KA 2P91A 1GARA 3Q2IA 2BMWA 4NCIA 1YDFA 2AI1A 4I99A 5G4LA 1BKDR 3VYRB 3L9XA 3CXCZ 1OJLA 3SZOA 1IQUA 2EAUA 2JFBA 4JQSA 3KNZA 3RAJA 3NHJA 3ZIAA 4H31A 2WE8A 2ORWA 4WKBA 2BFDB 2VRNA 2WLTA 1W5EA 2DM6A 3H9BA 1DS6A 4RYLA 3WQBA 1BOFA 3N6VA 3DOFA 4IEIA 3MBOA 2IL1A 4LY0A 4X1YB 1OZGA 3ZCRA 1WLYA 3OQMA 2XCTB 3KCNA 5T41A 2WAOA 1ISHA 1E9AA 2Q2QA 1XTBA 3DZHA 3QSGA 3H5TA 1MXFA 4M49A 4RL4A 2BFDA 2FF5A 5EN4A 5BQPA 5AQ1A 4BTEA 1YR7A 5T67A 1O89A 3UMVA 5JSKA 2X2OA 3T9DA 5EWMA 1PVVA 3ZW9A 2EHJA 3E05A 1GRCA 1WCIA 1A50B 1KP3A 2WJWA 3PX7A 4PRYA 3QVUA 2KJQA 1RKUA 1ZM2A 2GOYA 3H0KA 1EM8B 3L1UA 3LUJA 1HBJA 5CITA 4WKOA 5JQGF 5KTOA 4EGFA 3L06A 4UOEA 4BFXA 2GPNA 1WV1A 1ZGGA 3NC1C 4PR3A 4WNIA 5AM0A 2BGWA 4NG4A 5ALUA 3NKFA 4XLLA 3G2OA 2BI7A 5HK9A 3GLTA 2PSHA 3K2QA 4IJMA 5D3MB 1EVQA 4URFA 1JAIA 1JDTA 4CMBA 2OCAA 1RXVA 5AJUA 3VAZA 3PNSA 4MLPA 4YO7A 3SPXA 3VKFA 3II6X 4MEBA 1JHRA 1X94A 4LS3A 3V4OA 3JWEA 3V3KA 1KI7A 2C42A 5EWLA 4BECA 3IDQA 4ZYVA 4L73A 4D82A 3GU3A 2NXWA 1VL2A 2WUWE 2OTL1 1EU1A 3S6JA 4B6PA 4OGLA 4B3FX 4TVSA 4LE0A 4NBFA 1LKZA 2EQBA 1CUIA 2NWQA 3H2JA 5K3FB 4YDQA 4HYEA 3JD2A 2J33A 3DTVA 4EG3A 1E9FA 5SZHB 4CFZA 5TQVA 1OXTA 2FMIA 3ZW8A 4Q1FA 5GV8A 1Y1KE 4ZQIA 2FEXA 3WDMA 4ENUA 2XOKA 2CC2A 2P9GA 1T43A 1TZKA 2O4HA 2ID8A 2ONCA 1JKFA 5K3OA 2I4LA 3MZLB 1X80A 4DLLA 1M2GA 1VGQA 2EZUA 2B0JA 4ZT2A 1FW8A 4MWGA 1L4LA 4R8KA 1NYLA 4HBGA 3LT4A 2JFGA 5JECA 4QJ4A 3JQAB 2GNAA 3VR2D 4BLWA 1G1AA 4RE5A 2BT4A 3KQYA 1KR2A 3ET5A 1YJ9Z 4ZOEA 4CF6A 3EXHC 3T9CA 4AMYA 2CFCA 4O1IA 3RUCA 2O8DA 1LVGA 1CUFA 3HBAA 3EVBA 1VQLZ 2F4OA 1DOZA 1GPBA 3OZRA 4R5MA 4V3CA 4P22A 2VUHB 4X64B 1F8XA 4D74A 3HN2A 5GMOA 4IS3A 5F2KA 4N9QA 1S7CA 2P4EA 4LXGA 2QT0A 3C1OA 3H13A 4JSTA 3CVVA 2XUIA 1FC0A 3GIWA 3I30X 1EK2A 1OA1A 4BCDA 4MVJA 4UNIA 1PUXA 2Z3ZA 4LJ4A 4NR0A 2DFNA 3U5ZB 1QBKC 2Z3VA 4R68A 4DT1B 2Q0SA 2Q3DA 4EF6A 1B15A 4A3LI 1O97D 3ID6C 3OTOB 3QQ5A 4F72A 3GFBA 4RESA 4B45A 5F7XA 4GYKA 4H27A 5CA1B 4ODIA 1P2UA 4I3FA 4PXYA 2F9MA 3TNFA 1YRBA 3ZE1B 1WZ2A 1GSOA 3Q7SA 1S1MA 2GUGA 3B3FA 4XVUA 1Q21A 2JBHA 5E1BA 1P31A 3PPWA 3ZY4A 3EGDA 3TEJA 3WWCA 4ER0A 4ZOLF 4X7BA 5FOVA 4G5FA 4GYJA 1P3JA 1VQK1 2FG5A 2IDKA 3KXDA 4L9AA 4NFHA 3SSMA 1YFKA 2V7XA 4FZ5A 4MP3A 2K87A 4QYTA 2KX7A 6GPBA 4NCBA 3M6IA 2BP7A 5JSQA 2WJ6A 1E3QA 4M0UA 2QXTA 5EE9A 2CUKA 1QKJA 4QT0A 3CCE1 1P45A 4V0NA 5BWLA 4S3MA 1SKMA 4G9BA 1XPUA 3K70D 2RCNA 5BMVA 2WVGA 4GX2A 5CX1A 4D0SA 2OXEA 1ACLA 1OPRA 3Q7EA 1GUZA 1T8UA 1X7ZA 2PX6A 4ZJYA 4FGJA 1Z9BA 2C4UA 5U4XA 5KYKA 3MQFA 1JVNA 3N7UA 2GPJA 4NMHA 1AGXA 3JZDA 4CU5A 2C8KA 2X9LA 4AQDA 5BN1A 1RJ9B 3KTFA 3N75A 3MWKA 2OOSA 1ADGA 3JYLA 5BXYA 2ZYRA 1T9KA 2PUBA 1LK7A 3EDMA 4IIBA 3I9V1 2E1PA 4ZRDA 5K3DA 3KUUA 3E3MA 3PVSA 3T5PA 3W5CA 3TBHA 3X1MA 3LTNC 4A4DA 3K53A 1Z25A 1NN3A 4EGCB 1MFPA 2DERA 3AB7A 1D04A 2JJ8A 5EYPA 2H17A 2XNJA 3OCCA 3ACDA 4GC5A 4UD2A 3UHOA 3FNEA 3A1EA 3I4MI 1ML8A 1A9SA 1VL1A 2XHZA 3EEBA 3N07A 3NRCA 4KRGA 1AQUA 5JR3A 4M0EA 3V7WA 4YPOA 1DTWA 1LX6A 3HS3A 3ZDRA 4AS2A 2XJ9A 1UFKA 4DOMA 4XQGA 4MONA 1P2BA 1GPKA 2H1FA 5BSTA 1JJ7A 2VF7A 4BVEA 4OXXA 3BSFA 1Z38A 3DD5A 4ZQCB 3MNFA 2GLXA 5H68A 2NU8A 3SM9A 2HSZA 2XDQB 5BSWA 4LDPA 1V9SA 3JQCA 4TRRA 4PVDA 4CMJA 4L95C 2JI9A 2PEZA 1MABB 5L9AA 5J23A 4JD5A 4QYIA 3QPAA 1ZIXA 3SZGA 2DC1A 2A1UB 5D85A 5F5LA 1IUOA 1Z5WA 3BGIA 3I3OA 3UW3A 3GD7A 3UT6A 5LUAA 4DKXA 4OHPA 3CCM1 1XEXB 5DVZA 1H1LA 3OM9A 3CF4A 3KSRA 5K05A 2QM0A 4CG0A 4GAEA 1YZ3A 4XUCA 3UV6A 2PGAA 4LJKA 2NVTI 4D6YA 1K08A 2AKYA 1M8KA 3CRW1 5AM5A 2BZ1A 1QVGY 1JTEA 2R60A 4F7WA 3GUHA 1QVFY 3ILHA 5ES3A 3RVOA 1WXWA 2ZI4A 2C5SA 5GGYA 3EVCA 5H1YA 1AQNA 4P8RA 2D1SA 2ZYVX 1TFIA 3BDIA 3O8OA 1ORRA 1V6SA 3ESYA 3DZBA 1QC5B 4GNKA 4ONEA 4ZGBA 4MKHA 3I0ZA 4KNVA 4A3FI 4C3OB 1LRLA 1ZGAA 4H4CA 5CB4B 4MWBA 1VTKA 2O8VA 1TQHA 4NS4A 5CDFE 5LDDC 2BMEA 3GRFA 4KKXB 5E2AA 4LY9A 2QL9A 2Z5LA 4CGYA 1KYIA 3PNBA 4UBIA 1ZSVA 4P36A 5HM8A 3ORSA 5B30A 5BT9A 3AVUA 3E1SA 2IYUA 1R10A 1X77A 2Q7OE 3ZWWA 2V55B 4O4HA 3EZFA 1R5OA 4I9FA 1GNLA 5SY6A 4BO2A 1JYEA 5ARDA 2HTFA 3EVFA 3H5VA 2YYZA 3OHMA 3QKUA 5DM0A 4PS0A 3NYRA 2ZYSA 2VRBA 2B3DA 2BGMA 4NEGA 1L7XA 2EGHA 4YIKA 2A5JA 3P9SA 1L2TA 3DXYA 5KWSA 1A9YA 2WF7A 1EQAA 1GTL1 1M1YE 2JFZA 2QSYA 3M5PA 4L4XA 4MUKA 4CODB 2XX3A 1TEHA 4HNVA 1C7ZA 2B0CA 3CVOA 3DEFA 3L1VA 4K81B 5JCXA 1DOHA 4DE5A 1NFRA 3B1FA 2PN1A 4GSKA 1M1YA 5SYAA 3ZBPA 2I7TA 4L27A 4WKNA 5BORA 1OGIA 4W1PA 3PGKA 2DQ4A 2GHIA 3AVQA 3PXCX 3KVRA 3UAGA 2IEIA 4LHEA 5IVPA 4QOSA 4P7BA 3J7A4 1GILA 3ZIUA 5B58C 1SXIA 2IBSA 2O8CA 1HPLA 3ECCA 1NQVA 1XHEA 3OF2A 3FWZA 1P0QA 2GZAA 3X43A 1PG0A 3H11A 1OD6A 3U4GA 2RBLA 4C7BA 4RVDA 2AH5A 1PQWA 3ZWCA 3DO8A 3L4SO 1H93A 1IIRA 1EK6A 3LFTA 1N8R1 2GZ1A 2PZBA 4EKNB 5C9ZA 1KZ6A 1Z3IX 2RGCA 4OA5A 4QC2A 3A04A 4B7CA 2P2CA 3BL8A 1BCRB 2NVYI 1BN6A 4A10A 2BHLA 4DMGA 1PT5A 4OAPA 5LBTA 2X8BA 5FUQA 4JSYA 2FQ1A 2HCJB 4RA9A 3F90A 2X3UA 1FBTA 2C98A 3UQZA 5HTKA 2CF5A 421PA 4BZXA 2QT1A 1INLA 3CCR1 8LDHA 1EFAA 1UXKA 4ML3A 1VQ9Z 2OGZA 4MV1A 1KDYA 3MTDA 2JAPA 3FLAA 2QY6A 5CM8B 4AX4A 5KTNA 2ZYHA 5IUJC 2GNPA 2RE8A 2IEDA 5JH7A 5KX5B 4S0ZA 2I67A 2PZAA 2ONYA 5AW8A 2JDID 4FYKA 1PW5A 2WLSA 3HCFA 4U7GA 3W1VA 3F5MA 4N5DA 3EE6A 2GEFA 4MH0R 4YRZA 4ENVA 1IULA 5GADl 2O54A 1HH4A 3KX2A 4MR8B 3UMGA 1E1RD 2N0SA 3IYLW 1K7CA 1P1KA 4ZTUB 4FMBB 5AW0A 4QGBA 5TPZD 3WNCA 5LQDA 3QX9A 2DX7A 2VLIA 3K72B 3RAGA 3VX3A 3L0PA 2CGEA 4C5CA 3SFVA 3TSYA 5LA6A 1D6JA 5BUZA 1WCMI 1KEEA 2QRDB 1RD4A 1ZKMA 2Z8YM 4BBSI 1T2DA 4KOEC 3WZMA 1PZEA 2HOQA 1BAPA 1P2FA 3RRZA 1VQM1 1TA0A 2JZOA 3MT0A 2WD9A 3GBPA 1EB8A 2AI3A 1RU3A 3GRAA 3TLBA 3VAAA 5I7OA 1D4FA 2Q6KA 5ITZB 4G0VA 3RT7A 2ENUA 4G67A 3OOSA 1T8YA 3KFLA 1RWOA 5IC4A 2JCYA 3BZUA 3SQOA 5HCUA 4J0GA 1RXIA 1PTJA 3R20A 2F64A 3MG9A 1Z37A 1KFEB 1THMA 3DBOB 5ALQA 1W5SA 4Y98A 1F0NA 1G63A 3RBAA 3OTHA 2SKCA 5LQCA 3OJWA 3W3AA 4JUFA 4J76A 3QWIA 3CNHA 3CCQ1 3JQ9C 4ICIA 2AMLA 1LGYA 1TKAA 1EKXA 1UL1X 1XDUA 2J0UA 5C4GB 1K68A 3RVJA 2MIIA 3MBKA 3AX6A 1F2VA 2VHZA 1MD9A 3EPRA 1YZUA 4JUDX 1A4XA 1QF6A 3BK1A 3I52A 4QDOA 5KHOC 2XUJA 4FFDA 3LLSA 2FSGA 4DIFA 1EWKA 2C4HA 4R98A 4CM4B 1WXHA 2VZ8A 4TUYA 5EMJA 3GGSA 3QVLA 1DMRA 3WADA 4FKZA 1M33A 1PEYA 3TIVA 4CIBA 3CW8X 3A27A 2FJPA 3AO0B 2ZDHA 3L6CA 2KHZA 3RYHA 1OFHA 4RACA 1UJ6A 1CERA 4L7VA 1OV6A 4KGZA 2UYGA 2Y2UA 3D6UA 3IKMB 3PO3I 3CPSA 5DRTA 4B3CA 4U7JA 3K2IA 5KCZA 2Q4OA 4GMHA 1XL0A 2QPLA 4NBRA 1EB9A 4HDCA 3KT3A 3R6WA 4KXNA 2IYEA 3TLYA 3V4RA 3V8RA 2R4UA 3QE9Y 3Q8LA 1YI0A 5DEIA 4YCMA 1QQ7A 1MJGA 3GROA 3MZKB 1HYHA 1OFUA 1R0SA 2FMUA 3IHTA 4L16A 2QZ9A 4NMMA 2C7GA 5D84A 5DEOA 3SJBA 2ZZMA 1YR3A 3GP3A 4C5BA 3KB8A 3D6TB 3KHTA 3W9UA 2QRNA 3X1DA 1OAAA 3OCUA 3SKXA 1WWKA 1XB2A 1Y80A 2O2GA 3TLGB 1NL3A 2IK8A 1OI3A 1UFRA 2QRKA 2COEA 3K4PA 4IVRA 4N5LA 4F5DA 4AUEA 2V7WA 4CQNA 2VHEA 1NVAA 3S16I 1D7AA 2EIXA 2V74B 3R0JA 2IX9A 1CPYA 1LPSA 2IH4A 2Y1LA 2OMKA 1VQO1 4LCBA 1N1EA 1G6HA 1V6AA 1ZBQA 3JS5A 3S4YA 1XBTA 3DEKA 2FPKA 1H69A 5JNRA 1N2ZA 1U9YA 3KWMA 4KP7A 4W7IA 1K8ZB 3CUSA 4F4HA 1GUFA 3T5CA 2OUKA 1WU7A 2BMDA 2EBWA 3CV3A 4JI6B 1UAYA 3E8MA 2FEKA 3EBPA 3TNDA 4EEKA 2UXCB 1JEEA 4YRIA 2HT6A 4BQFA 3V33A 1QVGZ 1R2QA 1ZG3A 2RBEA 5DMHA 5ECYA 4JBNA 4IY1A 1ZJJA 2HWKA 3KQOA 1MO4A 4QYIB 1BDHA 3FR8A 5CAEB 3RVBA 3AY7A 4MR9A 5DHQA 4Y2HA 2HB6A 4URXR 1LTQA 3F6RA 3KIPA 3FTDA 1EVIA 3MGCA 4ESHA 4YAOA 2GEDA 4K3UA 5DGTA 3DC2A 1T36A 4C14A 1TMYA 3NXKA 1VE9A 2C59A 2GILA 3ED1A 5JBIA 1ORVA 5ADUS 2QNRA 4HEJA 1D1TA 2VJNA 3ECSA 3W79A 4EPWA 1VQPZ 3QP9A 1LDNA 1MX3A 1P2SA 5AM2A 1Y1SA 5KNDH 4LNUA 3EGDB 4WLNA 1QQAA 1KC82 3FMPB 1UPTA 1WO8A 3TLEA 5KOJA 3PZBA 4KKVA 5FPYA 3V2UA 2IRWA 4K1XA 3OD5A 1J5PA 3EF3A 4K9PA 4HT3B 5HXAA 2PWAA 4ND5A 2NXEA 3CLUD 3WYGA 4Z0NA 2ZE7A 2A9JA 3ZWMA 2FQWA 3I53A 3FLEA 1E9CA 4XW2A 1A9OA 4YUYA 5LQKA 3CC7Z 4TQUS 1KZHA 2VDUE 3P2KA 4BNDB 1AZSC 5B1SA 5K8LA 1U4OA 3LY9A 1R8SA 1BFDA 5L40A 2C58A 3O6VA 3P9KA 4GPEA 4KR2A 2WJHA 2Y68A 3GCDA 4DGQA 5JSUA 1W9HA 2G83A 3A6GA 1HE1C 1VHDA 3BD7A 3MMSA 1LPNA 4QYWA 4D4MA 4DG5A 2UXBB 1PS9A 3KXKA 2IEZA 4IIFA 4BLOA 1XX6A 5DO9A 3T9FA 1M2OB 4DQYB 3HCOA 4K9SA 1SBZA 2IHYA 1XEAA 4JSRA 4WMLA 2XLCA 1ZRMA 1XCMA 3LA6A 2W48A 3LRPA 3X3HA 3WIDA 3HN7A 4HDQB 3L4BC 5IZCC 3UICA 3OFND 4UDXX 3WWYA 4D97A 2EW2A 3AVWA 1N2GA 2O8NA 3U37A 2PX8A 5DSTA 1GKIA 4ZCIA 2HNKA 3D6NB 3IVGA 1Z6ZA 2QTTA 3UMYA 2M1ZA 1B00A 2RHDA 3TDNA 3ZGVA 1QTRA 4M38A 3MT8A 2FDXA 4ZO4A 1FRQA 2QRVB 5ALYA 1Q19A 4L1KA 1GLVA 2CHFA 3LL7A 1LBTA 1B7GO 3N86A 2O53A 2C2MA 2R84A 2PBZA 4H0FA 4QECA 3ZNQA 4A8HA 1ZVVA 1QZZA 4DCNA 1KYVA 1IWPB 2IA5A 2QJWA 4DM4A 4F3CA 5BSFA 1EM6A 3C6ZA 3JD3A 3LP8A 1XDWA 4MVYA 5HJEA 3R41A 2HMYB 3DVRX 4LYJA 2OL4A 3QX8A 4IIJF 2I2BA 2EFJA 3MUNA 4H2DA 4FBLA 1W25A 1FVFA 2O0KA 2D8MA 3NIGB 2EW8A 4TL8A 2GPYA 3LQKA 3NVKI 1FSPA 2C1ZA 4J4BA 4ZZ1A 1EUCA 4LBYA 3SP1A 5REQA 2IS2A 2GFHA 1OVGA 1RJFA 4R2KA 3DNMA 2AL7A 2E2II 1KFCB 2YDXA 4TZKA 3SQXA 5T7BA 3AEXA 2J0QA 1IDOA 3CT4A 2LUOA 3T4XA 1TU4A 1UBKS 3CG0A 5EKXA 1GGEA 4FD2A 4RJKA 5JI2E 2I3BA 3G2LA 2ZT6A 4XX0A 7REQA 4LWZA 5J5CA 2H4FA 2PZMA 5JFGA 2J3EA 5G1PA 1XUOA 3RJ9A 4YRFA 1YZFA 4JXKA 1GPYA 2C82A 3I9JA 3ETJA 4AL4A 4IVQA 5EMMA 1QGAA 1X8JA 4QYSA 4A0SA 4BC1A 4Z9YA 1DP4A 3V55A 1ETUA 1P5HA 2XYGA 1QHXA 2KS6A 1Y3AA 3GTGI 1NDQA 3HBMA 3HU5A 3OLQA 4PTZA 1ZYUA 2VS1A 3V4VB 3EEIA 3PTAA 1LDYA 1C0LA 2HRBA 3WTBA 3ESWA 3CISA 2PGOA 3AKYA 4DIKA 5A3VA 4HLQB 4RM3A 5JZVA 2F62A 4K0KB 3KJFA 1LLCA 4N9WA 4NENA 3L18A 4W6QA 2VSXA 3B6ZA 3CPEA 3FPBA 3W8FA 4KWIA 2QRQA 4WAUA 4F1WA 1I7DA 4MWTA 2JEOA 4CIAA 1NOJA 5HR5A 2X9GA 1E1YA 3EXAA 2IVFA 3K92A 2VH5R 2D54A 4BLSA 1Q14A 1P2TA 1GJRA 2CFSA 4EBFA 5CIYA 2WOJA 1A9TA 1T2UA 3PC6A 4D9EA 1UKVY 1HURA 4LXQA 4RUKA 2O23A 1XZJA 2I6FA 1UKZA 4AY4A 2VF2A 1COZA 5J1TB 1PW7A 4QOGA 3GJ5A 4MDEA 3D1LA 4HRVA 2JG3A 1C8KA 2J7KA 1LQUA 1VPVA 2YR0A 3N5KA 1CR4A 1D2MA 4RPIA 4JUBA 4LMPA 1L7PA 4BKRA 3CCLZ 2JA8I 2R44A 4TWRA 4HDOB 5GWXA 2NUTA 1KTVA 1D2HA 1ZLXA 3D9XA 2X0EA 4X1IA 4GQIA 4A92A 4JP1A 1KJ8A 2YL2A 4KEAA 4R2JA 5DLYA 3U4CA 4D96A 2AKAB 5TF0A 1GPUA 1KI4A 3D8TA 3LT5A 4E2WA 5LZ4A 4ZODA 1QF9A 3WGJA 3H4VA 3K15A 2DPMA 2I54A 1NONA 3WJ7A 4BGIA 4WBNB 4EFMA 1PJZA 1Q1GA 4EBBA 4O4IB 2V4UA 4GM4A 1MJFA 3VR1A 3TL6A 3E15A 3G89A 3SC4A 1NUPA 1V39A 5B2FA 2IBMA 4NJOA 3LX4A 2GAIA 1Z6QA 2EU8A 4AW9A 2JLYA 2Y93A 4X90A 4R1LA 4RVFA 5EKTA 1GZDA 2ZUCA 4HEHA 3ROQA 2QTNA 1ADFA 3NYIA 4N7RA 3FPGA 5E7JA 3IA7A 3QEKA 3ROEA 2WKSA 1R9JA 1X2EA 1RNIA 4KLNA 2ZPUA 1KDOA 1XK7A 4BP3A 1CK4A 5IK2D 4QLBA 3OKPA 3U26A 1T4DA 5FFMA 4DLVA 3SF8B 5A3QA 4XD2A 5JAZA 1IHDA 3CNQS 5TY0A 4PM4A 4I50F 4G8BA 4BV3A 5BV2P 3CIOA 5CURA 5BY2A 1QRSA 3TKYA 3Q87A 1JFRA 1E9RA 1ZX1A 1TMKA 2RHMA 3DMTA 3WOHA 4NABA 2QJOA 2RDMA 1G98A 5A04A 1XTQA 2NZJA 4C29A 4BAGA 5CLLA 4MKIA 1NQOA 3OPVA 1U1IA 1DRKA 3LA8A 6YASA 4MYCA 2GZ3A 4CBVA 1ATZA 2WP8J 1UDCA 2J7PD 4EUNA 1T2FA 2OQVA 1RKQA 5B12A 1OAKA 1F6DA 5JQGA 3UJNA 1HNWB 2R92I 4AI6A 3TTXA 1L5ZA 1LSUA 1JRLA 1MQ8B 2G6BA 2X8AA 1YJN1 2HDOA 1HTBA 4RL6A 2A7QA 3H1AA 4WT7A 1UT6A 5EP2A 4D2IA 2FR8C 4R8LA 4OI1A 4BO4A 2MSEB 5JY1A 3G8DA 1G5TA 1A04A 2AG6A 1VYHA 2P0EA 4E14A 4Z2AA 1V95A 2Q49A 2HA6A 3NTUA 3ADOA 4TTIA 2BJWA 1HKUA 4BLVA 4KLCA 1MJHA 3RV3A 2AFIE 2IOHA 4Y30A 2M9MA 4IDHA 3OH8A 2P9ZA 1CDZA 3ETCA 5J4YA 4OI2A 2PGLA 4B32A 1BMDA 4A3DI 2KBEA 3TW0A 4JLBA 1I6WA 1BGWA 1W9MA 1P2GA 3NHSA 4WFKA 3ZVLA 2QNBA 4K9RA 4P58A 4RMNA 4CEHB 1GEEA 1JG6A 1E4EB 1T5SA 3JASA 2R7ZI 1IC6A 3NYQA 5F78A 3BC1A 3KOOA 2LRHA 1WXDA 2CMFA 3NLLA 2R8XA 3NWOA 4GPIB 4HMOA 4IX9A 2EERA 3EQ2A 1A5BB 2XA2A 1JLSA 1T9ZA 4RD3A 3UWSA 2QPAA 1VQKZ 1N36B 3DAPA 1EWQA 2I6SA 3I1FA 3M83A 1A76A 3A2KA 4I1PA 2ZRFA 4DB2A 2NNLD 4J16C 3A9RA 5TB5A 4KN9S 3PD7A 5M2QA 5LLSA 4LAFA 3SGLA 2IU0A 5KVVA 1LPOA 4C04A 2OV1A 4CV2A 1P74A 2ZRIA 1GGHA 3D31A 3GN2A 3Q5DA 5F5NA 4MGIR 1FPMA 2YWJA 2O7RA 3N2IA 3QYFA 3V1KA 5JS2A 1PJCA 3M5DA 3SY8A 3TJRA 1E0AA 2ZRHA 1NNLA 2XYVA 5JXHA 2WKRA 1L4FA 1R74A 2I2XB 1X2BA 4GPTA 1PNTA 4KMSA 2ZJ2A 4LHZA 1H8EA 5FA5A 4JJKA 1VJDA 2ZRQA 3W5SA 4ESEA 3CN7A 3PT5A 5FYDA 3F9IA 4HB4A 2IIPA 2VJMA 4LXYA 3ZTTA 1PLJA 1CULC 4EYGA 4NJEB 3MMXA 5JBNA 4EO9A 3EXHB 3HKDA 3LYAA 1VQL1 3GWZA 2WJIA 3LBHA 1Z6XA 3N05A 3U61B 3G0BA 4JH0A 2E87A 3MVEA 3PGMA 1ZNYA 1XMPA 3ZHOA 4E22A 2WNIA 2PR2A 4KACA 5IS2A 1IDN1 3G82C 3HRIA 1QIMA 1M901 1YCGA 5WRFA 3TLZA 4J8PA 3WO1A 1NUSA 2CVHA 2D1YA 2ZAYA 3A05A 3MXOA 5D6OA 5G40A 3O3CA 1E9EA 3HCEA 3W6UA 2H00A 2Q5JA 2YJZA 2Z4SA 3J80f 4QOJA 9LDBA 1ODLA 4TXMA 3BRQA 5AOVA 1YR1A 4PZZA 1DKOA 3LQQA 5ESDA 3V46A 4F6LA 3DTVB 1RRMA 1TOAA 4QUKA 5K0NA 3TRDA 2OZKA 1KI8A 1OWNA 2GD1O 3TR6A 2AMJA 3BOSA 4Z9AA 4MRVA 3IKTA 3LUHA 1FFXA 2A57A 5EMLA 1CQWA 3LHDA 5FQOA 3V34A 4GP9A 3ICEA 4YXWA 3TM4A 1LLQA 3DR3A 1X7WA 2GNOA 4F97A 5F3WB 2FK7A 3F3PC 3JQ7A 4XR4A 3ZU5A 4KDFA 4M86A 3F9CA 4GG1A 4FT4A 4HZUB 1DFIA 1RO4A 2LCIA 2YRWA 5CVEA 3UTCA 1CP3A 2QW8A 2Q27A 3AESA 2PZ8A 1N0HA 4I8IA 4YJKA 5GONF 3SEAA 1JX6A 1OROA 3LW8A 4HAWA 3VH3A 3MBIA 2GCEA 4RIHA 2VDKB 3HKBA 2W2OA 2JZCA 3JQAD 3A3PA 1RYEA 3T34A 4CMEC 4CIDA 4DV7B 3QI7A 5JZMA 1P72A 3BYZA 3N8IA 4NULA 1VI2A 1LVHA 2FFRA 1LK5A 4QJ3A 1NF9A 2XD9A 4KE6A 4FMDF 3OM0A 4B43A 2AVNA 3LUPA 1J0EA 5DF1A 2VCHA 5DYYA 5C34B 5IASA 1VQN1 1UPAA 4NH1C 2A58A 4PLCA 5EAIA 1XZDA 3KALA 2MSLA 1PFTA 3I9KA 1JMKC 2C7BA 2X4GA 4QZVA 4LNUB 2IPLA 1QLJA 2JHCA 2R8YA 2WI8A 4PSCA 1ISJA 1A8QA 1WMAA 4BX0A 5AMXA 1RPAA 4K8OA 5JDCC 1AKYA 2IHZA 3KQPA 4NH4A 1E1DA