1NP6A

Crystal structure of escherichia coli mobb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
170
structure length
158
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Insight into the role of Escherichia coli MobB in Molybdenum cofactor biosynthesis based on the high resolution crystal structure
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1np6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1np6A01
3BFVA 5AWFC 4RY2A 2O8FA 3K9LA 3MSXA 2BWJA 3ETLA 5L3SB 1H65A 4IFBA 4GMXA 4QFMA 3REGA 1ZIOA 5FPHA 4CEHA 4RCYA 2PX3A 5A5GA 2O8BB 2R65A 5KHOC 2HYDA 1EESA 1EK0A 1YVDA 2ZSAA 4PR0A 1G4AE 4EPXA 4P0TA 4IDOA 5EQTA 3HU2A 1Q21A 5TARA 1KI4A 2Q9CA 3CH5A 4U00A 5SZHB 4DLSA 3KKOA 4C3ZA 1EX6A 1WBDA 2GVDC 1G4UR 1YZNA 1P9RA 2GXSA 4QJ5A 1XPRA 2DR3A 4OHWA 4ZI2A 2OXCA 3LO5A 3GCGA 2QEQA 4Q19A 1VPLA 4JLVA 3FOZA 3OIWA 4Q5IA 5AR1A 3NKVA 4JYBA 4MUBA 1NVVQ 3GQBA 3MWKA 5D3MA 1LV7A 4HAXA 1XMJA 3AKYA 3F0TA 3ND8A 4G5QA 1WQ1R 2UZIR 1QHHA 3L2OB 3EAQA 3K9HA 5P21A 4KSCA 3KQLA 4X8MA 1R8QA 4RCZA 3W3ZB 4XTCS 1CLUA 1QVAA 1G8FA 1R8SA 3I8SA 2FSFA 2YNMA 3TLXA 4E5UA 5GADl 2ZRMA 2DFLA 1QG2A 4N0DA 4PAMA 4IDQA 1FPMA 2CHGA 3P20A 4BE7B 1CP2A 3Q72A 5FUVA 1AS0A 2PMDA 1ZM4A 4M1OA 3EG5A 4QBGB 2DHRA 2QUZA 1Z6TA 2OO7A 2Z43A 3OEEA 5LDDC 4HYYA 2R6AA 2YOGA 2F55A 3SFZA 2BBWA 1CBUA 1UEIA 4PO1A 3P32A 2CCKA 2WJYA 2QAJA 3QKRB 2HUPA 1E69A 1HT1E 2AWOA 1YZKA 3AQ4A 1IAQA 5KSOA 3QKTA 1E2EA 3A4NA 3EWAA 2IYXA 1JI0A 1W49A 4U7DA 3GPLA 3A8TA 1KIMA 2QPOA 4M1TA 3PITA 2PX0A 4GMDA 2WIBA 5CM9C 4WVFA 4BRWA 1S3GA 4JLJA 1BS1A 2XOKA 2PZGA 3JVVA 3DOEA 3Q5EA 2RB4A 4YDHB 1BH2A 2QL6A 4OHVA 1V43A 2CCJA 2JATA 4OK6A 3CF2A 3DZ8A 4O2LA 5FOSA 4Z1MA 1RYFA 4QM7A 1I4DD 2J59A 2ZETA 2WMOB 1UDWA 2AN9A 2OCYC 1J90A 2W6JD 4IRUB 4ZDWA 3GMTA 2O8CB 2ZITA 2J9RA 1US8A 3K70C 3QE0A 2GVZC 3ZYCA 1G3MA 4RD6A 1NN1A 5KTYA 5TB5A 2UZ3A 3FFBA 1TNDA 3X1YA 2O8EA 4KYIB 1NLYA 3QOFA 4BQSA 3KQNA 1KO4A 2GA8A 4B33A 4QNMA 2V3CC 2G1KA 4POAA 3TK1A 5D3MB 2GEDA 1UFQA 4PQRA 4IKEA 2FX3A 1U94A 2BHRA 1IONA 3U3RA 1S1CA 3VAAA 3GLIA 2FNAA 2IYRA 1E9AA 1R10A 4QL3A 4CVNA 3B13B 1T8UA 3HU3A 2OV2A 1OXXK 3ZVRA 4MDFA 5EXXA 3CIOA 4Q9JA 2ZRJA 2CK3A 1Q1QA 4Z8XA 1NVUQ 3ADCA 5CK4A 3AVUA 2V8OA 1XBTA 1F6BA 2DBYA 4S35A 1A7JA 4JVLA 1RRGA 2J7KA 1SVMA 3K9GA 3CWQA 1W48A 1CS4C 3AV0B 4AIIA 3WYAA 1GG2A 3CF6R 1G17A 3I92A 1T3SA 4OQLA 2NG1A 3TW8B 2GETA 3IPXA 4RFSA 5KDLA 4KSBA 1NKTA 4RFVA 1R5OA 1U8ZA 4W9MC 3GJ5A 2B7BA 4IOKA 1XJCA 4NDZA 4YONB 5GJVC 5BYKA 4G5OA 2R9VA 1VMAA 1NSTA 2CCGA 1B0UA 2LKDA 1OH5A 1GKYA 3SHFA 3P4YA 3EZFA 1N5JA 3Q9LA 4LHYA 4MYUA 3NBYC 3FB4A 3B7GA 3QI2A 1UF9A 1AQYA 3M0EA 4CYMA 2ZREA 2Z5FA 2IYSA 5JHGB 2CL6X 3LV8A 2HJGA 1ZP6A 1K5DA 1XTRA 4Q9HA 4AY2A 3KQHA 3ZZ0A 2ZSFA 3PENA 4XD7D 1ZYUA 3QXJA 3GJ7A 4D81A 2JIZD 1P9NA 1N6NA 3OHMA 1T6NA 4QM6A 4ACAA 4XVUA 1ZM7A 3N70A 5HR5A 5IDVA 1XD8A 3BS4A 1XRJA 3GLGB 2EQBA 3UATA 1W0KA 4BZPA 2OAP1 4D4MA 1PV4A 1SXJA 3KQKA 4R71A 1MV5A 3VHLB 4ASUD 4JSYA 5J47A 2GZAA 4BFUA 3FGNA 3RHFA 2VIIA 2OG2A 2ZEJA 5DNYB 3FKQA 3MMPA 3PUYA 4MGZR 1ZCAA 1ZAKA 4LV6A 4Q47A 5EE0A 3SC3A 4Z54A 4Q21A 1CJTC 2WWYA 1N6HA 1OKKD 5JWHA 2VP9A 1E2PA 2A9KA 3L82B 2GBLC 3L8ZA 2QT0A 3ZS9A 1OJLA 3R9WA 2J0VA 4LCBA 3ZVMA 4MGYR 4DC9A 4BPBA 1JXOA 3NDPA 3QKUA 2D7DA 2ZR7A 1GIAA 3OAAA 5J4KA 3I32A 4GFDA 1KSGA 4HB4A 3VHXA 2ZS7A 2ZVPX 4A9AA 4Q7JB 1SQ5A 1TUIA 4JJKA 4G5SA 1QHXA 2DFTA 1EFRD 2QAGB 1E2QA 4MGIR 2C8VA 3QF4A 1NVVR 4X8OA 1WXQA 2B21A 4BGDA 1AIPA 4TLDA 2JJ8A 2HF9A 1KO5A 2OLKA 4Q02A 1JXMA 3THXB 3IHWA 3ZVLA 2NTYC 2PJZA 5FBLB 2ZAOA 4IEIA 4F92B 2WHXA 1IN8A 3HPQA 5B64A 4FCTA 4RFSB 3U3JA 2OFWA 4G01B 4Q9LA 1MABA 2CE2X 1N6IA 4LJ6A 1IOZA 5AJVB 1ZW6A 2MMCA 3QXXA 3A37A 1DE0A 1U0HC 4M1MA 4TMTA 4DLVA 3U61B 2FWRA 2R62A 3DEFA 3IQWA 3HDTA 4M9XA 1GILA 2RHMA 2ANBA 1HUQA 1A5TA 1G6OA 3A4LA 1Z0FA 3QG1A 4HAZA 4C0AC 5K8TA 4DCVA 1T0JB 4MGKR 1RJ9B 2JJ2D 1WA5A 2B8TA 4LJ5A 2IWHA 2P67A 1NNEA 3PVSA 2CBZA 5BN3A 5TV2A 4LPKA 2R6GA 3TR0A 1GL9B 4LJYA 4US2R 1R0WA 4BRUA 1FNNA 1KDTA 4C7OA 3THYB 2ZR0A 1XEWY 1FX0B 1E9RA 1AS3A 2WJIA 5FUXA 1II9A 4WZAE 2WV9A 1KDOA 3A1UA 4QJ3A 4DVGA 1COWA 3LW7A 4D0GA 3GLIE 4M0LA 4KVAA 1D2MA 1VCIA 1VECA 1SXJB 1NVWQ 4A15A 2DWOA 1OLOA 2JLQA 1F60A 1G9XA 3MG9A 4PPGA 4DEXA 3W90A 4JLNA 1PLLA 2WZQA 2JASA 4KFRA 2ZROA 3AVQA 3QXCA 4GP7A 2C9CA 1FUKA 2DWQA 3A58B 3RRNA 1Z8FA 1UKYA 4Q4JA 1EX7A 2FZ4A 4FCWA 2QE7D 2BMJA 2J41A 4HAWA 5AJWA 4F4IA 3MWLA 4NPHA 2IUSA 2WWXA 3EPKA 2P0EA 3ICEA 2BDTA 4P32A 1D8TA 1E79A 2LWIA 4G5RA 4OJKA 1G291 1KI1A 4GZLA 3UXMA 3A4MA 2ERXA 2VPPA 5FUWA 1JR3A 5FL7A 2ZVQX 1KDPA 4DRZA 1L4UA 3O8RA 2AWNA 3C14C 2FMXA 4NH0A 4ZKDA 3L0IB 4DLYA 4HLDA 5FR2A 5JBQA 4JBYA 1XFAA 3KJEA 1MKYA 4QBIA 5CYOA 5FBQB 1ZD9A 4JVNA 4TWZA 3VFDA 1UKVY 3W3AA 4LDJA 3WY9A 1M8PA 5UKDA 1IHUA 1U2RA 4PPNA 3CKLA 3SEAA 2V9PA 2Q3FA 1X1SA 1G20E 4H1VA 4TYWA 2AD5A 5L3QA 1UBGA 5L8VA 1KDRA 2Q6TA 1K8RA 1P73A 2FSIA 4A0RA 1MABB 3PUXA 3X1XA 5H8WA 4Q4LA 3FMOB 2R44A 4V0NA 1KMHA 2V55B 4B3BA 4F4JA 1KI6B 4L8GA 3EC2A 2CLCX 4A6XA 1W36B 1MH1A 4LJ9A 3KFVA 5EE5B 3GP8A 1C1YA 2HXYA 3MAAC 2NZJA 4H9GA 2I4IA 1O3YA 2O0KA 1RPZA 1SXJE 2ZJBA 2GCOB 4Q4AB 5DYIA 1NY5A 1S4QA 3U4QA 5C4GB 3KUDA 3UANA 1TQDA 2ZJAA 1ZD8A 1XDBA 4L4UA 5HKKA 1T5LA 3B2EA 1OIWA 2ZE8A 4FCVA 3QXSA 2C77A 4BWYA 4EIWA 1W4AA 2Q9BA 2C9OA 2GF0A 3DMDA 1YZGA 2NO9A 4TLEA 5FOUA 3REFA 3H86A 4Q1FA 3HP1A 4V0KA 3OESA 2ZM5A 5KYKA 4X8HA 2FPMA 2O0HA 1A1VA 1X8LA 5FI0B 1E9FA 5KSZA 2B7CA 4Q1DA 3IEVA 2LKCA 3SHWA 3UMRA 3G5UA 4EPWA 5FPKA 1YR9A 1JAHA 5IT5A 4M1SA 5FOVA 2P6RA 2Q9AA 2WPDD 3ZZUA 1NMYA 5LD2B 2ZE5A 5KUTA 4QKQA 1GZSA 1VDZA 4W5JA 1IXSB 1CJVC 1G5RA 2J87A 4PAOA 2ODEA 1XTSA 2ZRPA 4KBFA 2WICA 3K0FA 1Q1BA 2GESA 2IYYA 2AR7A 4MA4A 2X8AA 2VL7A 1G8GA 2H57A 2H8KA 2BMDA 4PC2A 3ZH9B 3LQRA 4Q03A 3BOSA 5GJWC 3QG5A 3OFNA 4LWZA 1Z5ZA 2JGNA 1P72A 3W8NA 3M4YA 1KI8A 2O8DB 4WIAA 4OK3A 1GDDA 3EASA 2F1IA 1YZTA 1E6CA 2ZSEA 3GJ8A 3FKSA 2QORA 3KKQA 1SZPA 4DDTA 4TZ0A 2WTUA 2YC4C 2WOJA 2Z4SA 5DLQC 3THWA 3CNNA 1SGWA 3OEHD 4AYWA 4FWTA 4PFSA 3ZJYA 3NBFA 2RGDA 4HUQB 4NL4H 5FL3A 2CMKA 3VQTA 1E2MA 2NZ8A 1D9XA 1AZTA 3LWNA 3QSYA 1JR6A 2FU5C 2IK8A 1E4YA 5DHFA 2CVFA 4MDEA 1KMHB 4OHXA 2WM9B 5GJCA 1X86B 2DB3A 3H1TA 1DADA 3RVBA 2JA1A 1MRNA 4LHZA 4URYR 1RW4A 2D2FA 2F9LA 3T12A 4Q4HA 3D6TB 2ZJYA 2GEVA 4O2RA 4LJ4A 3EPJA 3GEEA 2MMGA 2OM2A 1W4RA 3WXMA 4M8NE 3B9PA 5DGXA 1Z83A 4NCJA 3ZIAA 3KXKA 4IXNA 4JLDA 3SQWA 1TMKA 3HU1A 1QVRA 1Z2CA 4TQAA 4DDUA 2ZANA 1U9IA 5AUPB 2ZRHA 1NG1A 3AF4A 1XTIA 2EFCB 1NN0A 1S1MA 3FDIA 2OT3B 1JR3E 2EYQA 3TJZA 1F2TA 4ZKEA 1GUAA 1G5PA 1E2FA 2R8RA 2QU8A 1ANKA 5CLLA 1YKSA 3RNLA 3RWOA 4A0HA 4LPSA 4DLUA 5K8LA 2E9SA 1M7HA 4BLRA 3EIEA 4EJSA 1E9SA 1OXUA 2ERYA 5EZ6B 3WMFA 4ZO4A 2V6JA 2GDJA 2JDIA 2QGZA 1CXZA 1E1QD 4M22A 4PC1A 5DH9A 4NMMA 3LX8A 2WWFA 1VYTA 2AFHE 2C2HA 4IVPA 1ZUNB 4HB0A 1FFHA 3P27A 1A2BA 1IY1A 2QN6A 3ND9A 4DCNA 1GRNA 2NO1A 4QBHA 2YWEA 2FDCA 1W4CA 3KB1A 4RD0A 5J5CA 2ZR9A 3RRYA 3RRMA 3D3QA 4W5HA 4GP6A 1IY2A 4JBXA 3B1VA 3U3KA 3DPUA 1OYWA 2W6ID 3IIKA 3A36A 4QGFA 1JEEA 4A1FA 2JLSA 2EFHB 2WKPA 4EAQA 2IYQA 1NJFA 4D25A 4XOIA 4B48A 3U7EB 3FMFA 3VKGA 3LLMA 3AKCA 1EG7A 1IQPA 2WJGA 1U9IC 2WWGA 5KPDA 1X8KA 4PX9A 4II7A 5AUQA 2PEZA 1VG9B 4PZZA 2F7SA 2F6RA 2IYZA 2QI9C 2WIAA 2ZRAA 3AP3A 4KO8A 4QJ4A 1NSFA 2ZYWX 4CW7A 1IY0A 3ZQJA 2IS2A 1AK2A 2Q3HA 3C7KA 4P4SA 1GOTA 3CB4A 2MSCB 3TSZA 4O25A 3QNUA 5FR1A 1VG1A 1BO6A 1L7VC 1VCMA 2N1BA 2WKRA 4TTRA 4EJSC 4C0JA 2YKGA 3MUFA 2XNDA 4KCGA 3AF3A 2OCBA 4TYPA 1E98A 4MRPA 4MYHA 1JPJA 4UXHA 3EW9A 1KKMA 2C9YA 1KJWA 4L16A 1BYUA 2J45A 2A2ZA 3LBHA 2I3BA 2XAUA 3GJ4A 2GRJA 2GJAA 1A4RA 4M9ZA 4RD4A 2AXPA 2HLDA 2Z0MA 1GNRA 1G18A 1MO4A 1EWQA 2ZJ8A 3W6NA 5DI3A 2WSSA 1JEDA 4UXJA 1UADA 3FVQA 3I5XA 3OEED 1U8AA 4HEJA 1AN0A 1X6VA 4A2QA 1XCMA 2XTNA 3HR7A 3NG1A 2FFBA 1LF5A 3FFAA 1SVOA 1I2MA 1NVXQ 3DMNA 4HDOB 1Q0UA 2G83A 4WAUA 4Q7KA 2X77A 4HAVA 4E03A 4HZUA 5IHPA 3R9XA 1XNJA 2BBTA 4UQOA 4OHZA 3SS8A 4FN5A 1E2LA 2ATVA 3CWZA 2ZSBA 3AP2A 1P2TA 3O47A 2IEYA 1TX4B 3ASYA 3RYTC 1CIPA 4N3NA 3QKSA 2JLUA 5CK5A 2XOKD 3K9NA 4K46A 5DISB 1FNMA 4AKGA 1YZLA 3NH6A 1M7GA 1VG0B 5JJKA 1ZNYA 3Q85A 2IXEA 5M04A 3CNLA 3QEJA 3IPYA 1QHYA 4G1UC 1JAIA 4I81A 2IXFA 3CX8A 2W58A 4QRHA 3UMSA 3G82C 3ZDQA 4Z1MD 4WBSA 1W44A 4JT4A 4TMXA 2PLFA 5TY0A 2X2FA 3G0HA 2QNRA 3U2QA 2IYUA 2GZDA 1YZQA 2XTMA 4RZXA 1TQ4A 2V6IA 4LYAA 5HTKA 4Q7LA 5EUMA 1J8YF 2OBLA 1G8PA 1GL7A 3SBEA 5H1YA 4R9UC 3SNHA 3U60B 1HH4A 2C99A 4KJZA 4OI1A 1XD9A 5BN5A 3V4FA 4P4UA 3I5YA 4DT1A 1L2TA 1S2MA 3BH0A 4S2EA 4NU0A 2K5UA 4TYQA 2FGKA 1E9CA 1NBMA 1KZ7B 2GJ8A 4DJTA 4DBLC 2QTFA 3AF0A 2C5LA 2PEYA 4I1VA 2VF7A 2AHOA 1T3LA 4PC6A 4QHTA 5J40A 5DI9A 3T35A 3GLFA 2P6UA 3BE4A 3CUEF 3SOPA 1K5GA 4BFTA 2XB2A 1IJFA 2CK3D 3Q7QA 1Z0AA 1N0VC 5J4LA 2DWPA 3T1VA 1R5NA 2IX3A 2CNWA 4G5GA 3SR0A 4CEJB 3NHBA 2ZAMA 2WSMA 4RZUA 3QUSA 2AXNA 3AVOA 3BFKA 2PH1A 4DLRA 3V4RA 2JCSA 2YWHA 5KNBA 4A8JA 1D9ZA 5F2EA 2DYKA 2Q21A 4OQNA 3IO3A 2O8FB 1QHNA 4DCUA 3CZPA 5H70A 1ZD1A 4BEJA 2KWIA 3GJ0A 4AD8A 4CEHB 3X2SA 4WXRA 4ZCIA 3R20A 5B30A 3IIJA 3JZMA 1PJRA 1CULC 3QPUA 4RJLA 4PHHA 3F5FA 1KZGB 3FMPB 3T61A 5TVKA 4JL5A 4YXWD 3IHLA 4ZPXA 1VG8A 3QBVA 4KYUA 3KTAA 4IVRA 2G77B 4LHXA 5CDFA 4NBSA 5JCZA 3OIUA 1G3QA 2FFAA 4R2IA 4XWOA 3H84A 4KODA 1DVRA 3FPAA 3EIQA 3KDSE 3BXZA 1FP7A 4LBZA 2HCBA 4Q00A 3VX3A 1XPUA 4JLBA 3E70C 3LD9A 3GEHA 2G6BA 2FFHA 4JJZA 3P26A 4HDQB 4YMVA 3H0KA 3RS2A 2OXRA 3W6OA 1CR2A 1W0KD 2C78A 1O87A 1SXJD 2CHQA 1R4AA 1FP6A 4OL0A 2J7PA 5KSYA 1L4YA 1NMZA 2WWWA 1QHHB 3V00A 4DUGA 4M1WA 3ADDA 4PANA 1KK3A 1TQ2A 3NC0C 4MKHA 1SULA 4D0LB 5KU1A 3VR4A 2F3RA 1E2KA 1KOFA 2ZU0C 2VP5A 2ZPTX 1ZINA 2ZRLA 4NYMR 2IYTA 4A8JC 1TUEA 5CLQA 4HB3A 1E96A 5JSZA 5A4JA 2QRZA 3NC1C 5EJEA 4YQFA 3VR1A 1U81A 3RDPA 3K70B 1SKQA 2OEPA 1JECA 3GJ3A 2QZ4A 1P2VA 3CLVA 3T1TA 2N42A 3IIMA 3WYGA 4E07A 1MRSA 3EPLA 5CIWA 4EPTA 1WP9A 4B3CA 3SQXA 3NVAA 5JFGA 3KKMA 4DEYA 2GBLA 4X8LA 1OPXA 2XSZA 3BC1A 2ZIAA 4TL6A 4KVGA 5FBWB 2WVJA 1IN5A 2BJWA 2FG5A 4IDHA 5HE9A 2ZE7A 2XTZA 1NLFA 5EE1A 2UVQA 1A82A 2ZYUX 1NN5A 1KK2A 2GCPA 2ZJOA 2I1QA 5EE9A 1M6NA 4TMZA 3KKNA 2RCNA 2KI5A 4NZYA 4FMBB 2GTPA 1X1RA 2BCGY 2AKYA 2GWHA 4QHSA 4TTPA 4C4PA 1PZNA 4PC7A 1YRBA 2JLXA 3I61A 3QPVA 2ZRBA 1UEJA 1W36D 3CR8A 1KNQA 4ZDKA 4KLZA 1E2HA 5KDDA 4R98A 5CB6A 1OHHA 3MRSA 4PO8A 1ZMXA 1E94E 3QQ5A 1P5ZB 1Q3TA 4LX0A 1Z22A 5TXGA 3KJHA 4AG5A 4ABYA 4EDHA 3TMKA 1HYQA 5JCPA 2OFOA 4RD3A 1CRPA 2QGNA 1RKBA 4I4LA 2VA8A 1Q1ZA 3DHWC 1US8B 4BLSA 3TNFA 1XPOA 4UNSA 1GITA 4M53A 3QF7A 4B34A 2VTKA 3CBQA 2O8EB 3BFXA 1F48A 2OFXA 4M21A 4FI3C 4WXPA 3RWMB 1NBME 4PQYA 1COWD 4BFXA 4NYIQ 2W2TA 3BK7A 2PT7A 4A82A 2P5SA 4LV8B 4BASA 1QHGA 3GLIB 3GLFE 2W00A 5DYGA 4XSGA 3QVUA 5EXTA 1P2UA 2VHUA 1MT0A 1YU9A 1W5TA 1E2GA 1XZQA 4PHFA 1DTSA 3M1IA 2ODNA 2VP4A 3W9YA 1XCGB 1R0YA 4CZ2A 1WB9A 1S0UA 2ODBA 2VP6A 2IWRA 4A2PA 4ARZA 3VNUA 4TSFA 5FBVB 2XX3A 5F9FA 1E3MA 2ZS8A 3Q3JB 4RZ2A 5JMTA 3OE7A 4Q1BA 1G7TA 2J0UA 2HEIA 2ZRGA 4GDFA 1R0XA 3ASZA 3FWYA 1E79D 4V03A 4KITB 4Z8YA 4Q7MB 3C16C 4JT2A 3LLUA 3Q5DA 3I72A 1WF3A 2QBYA 3NHAA 1JR3D 1YHNA 2VO1A 4RSGA 5FL7D 4I99A 1GFIA 3AP1A 4B6FA 2GJSA 4C0KA 3QY0A 4PAQA 3IGFA 1B23P 3GFPA 2QSYA 3LXXA 2DY1A 4DXAA 4LV5B 4C0BA 2IUUA 1JPNA 3RS5A 1II0A 1OYYA 3T06B 4EPVA 5JS8A 1VTKA 4PQFA 2TMKA 5CB8A 2ZRDA 2WMNB 1XMVA 1KAGA 3WMEA 2ZU6A 4ACBA 3C5CA 1GVNB 2ZSDA 3CO5A 3K8YA 2OLJA 5CDFE 4CT5A 3B60A 3WHKA 5AJZA 3MCAA 4B35A 2HT6A 3FHCB 4D4KA 4BFYA 1T0HB 3S1AA 3EWSA 2F1RA 4TLAA 2F1JA 4WZ6A 1D6JA 4UNPA 1H8HA 1XP8A 1N5KA 2KSQA 4BLTA 2PLRA 2ZRFA 4LGMA 2IHBA 3EPHA 3PIRA 1P6XA 4LK2A 3ZLJA 6Q21A 3MWYW 4B74A 1M34E 2FFQA 3NTUA 4DSUA 1LF0A 5C4MA 1DS6A 2ZE6A 4QOSA 4V02A 4EFNA 3F3YA 4GT1A 5HKKD 2VEDA 2NO0A 3LFUA 2G1JA 1EFUA 3CF0A 1K6MA 4YMSA 5E3HA 4F38A 3RS7A 3X1ZA 4A4DA 3A1VA 4B6EA 4TQUS 3EARA 1OKKA 2FEOA 1XJQA 1Q1EA 4JZKA 5KSPA 4ZDIA 5JJLA 2N46A 1BYIA 1FL9A 4G0NA 3L0PA 3TQFA 2EYUA 2CVHA 3BB4A 3CW2A 4GOKA 4V0MA 1CF4A 4TMWA 2X19A 1W7AA 1FTSA 1G7CA 4JLPA 3HR8A 2IT1A 3K0AA 4HZIA 4DLZA 4QG7A 5HCNA 2ORVA 1JJVA 1HY3A 3RRZA 4JMPA 2W83A 3T34A 4AKIA 2QP9X 3RLFA 1KI2A 1PLJA 2YVUA 3Q8XB 3ADKA 3SU8A 3NBZC 4EFLA 4ARZB 4YMWA 3QF4B 2BOVA 2E87A 3BB3A 1HV8A 1WBBA 2HCJB 3TQCA 5HZKA 4I1UA 2J0QA 2EWVA 1GL6A 1LVGA 2IYVA 3CRVA 1G6HA 2BBOA 4HAYA 1ZC4A 2ODWA 2G3YA 421PA 3KKPA 4QGHA 1JNYA 1DPFA 3PFIA 3LA6A 3OFND 4HAUA 2CL0X 2QBYB 2IS6A 2ATXA 4OQFA 5G53C 2JLVA 2NO6A 1AGRA 4IHQA 1U0JA 3GFTA 4DLXA 3BWDD 4OBEA 2NQ2C 4JKYA 1NN3A 1CU1A 3FYHA 5FTNA 4D6PA 3FKSD 2V7QA 1SHKA 2VHTA 4KBGA 1N0WA 2JJ1A 4LBVA 1C4OA 4ZCMA 4B71A 3RS3A 1GKIA 3E1SA 1M2OB 2O0JA 1IN4A 2ZYVX 1TADA 1Z3IX 2BCJQ 2H17A 1RZ3A 1FQJA 4L9WA 3OZXA 2GJKA 4C7OB 3RC8A 2OZEA 1EGAA 4AK9A 3B82A 4GL2A 1TEVA 3DM5A 3K0SA 2RKOA 4D2IA 1I2DA 4RZ3A 2YJTD 3VMFA 2AK3A 4Q18A 2GAOA 4ITRC 3SFVA 5JI3E 3CPJB 3C4JA 4Q01A 3DDCA 3ICQB 4Q9KA 1DAKA 2GJ9A 2CXXA 2QENA 3I3SR 1E99A 3CRRA 3V9PA 3ZZTA 1Z28A 3ZIAD 3CX6A 1GM5A 5JI2E 3PG5A 4TN1A 5JECA 5BN4A 2EFGA 5J4YA 2VP0A 1BMFA 1U98A 4Q1AA 1OH8A 1R6BX 3T5DA 3THOA 4URUR 1DO2A 1LS1A 4Q4JB 3VU9A 1DG1G 5LBIA 1KY3A 4IDNA 5E7IA 3WNBA 1T9HA 4URZR 2R6DA 2VYFA 1J2JA 1J70A 3K0AB 521PA 4C0LA 2WJVA 3I1FA 1Z6YA 2WAYA 2OUKA 5IRCD 1LW7A 5DIFA 3ECCA 1OFHA 2VBCA 3WP0A 4YC7A 4AKHA 1LTQA 3IQXA 2VSXA 2P5TB 1ETUA 1WMSA 2A5JA 2GKSA 3T1OA 1GTVA 4CF7A 4LSGA 2IS1A 3HPRA 1GP2A 1P61B 4FMCB 1RC8A 2JDID 2PJRA 5G3ZA 4EKDA 2AK2A 4NYIR 1E9EA 4NYJR 2B92A 3K0CA 5H68A 3AUXA 4TYYA 2EVWX 4AI6A 1KO7A 2ZJ5A 3MLEA 2BJVA 3BD9A 2RMKA 2BKUA 1AS2A 3B5JA 5L3QB 2IBMA 5SZJA 4F91B 5BQ5A 1W46A 2YHSA 1P7CA 2YV5A 1TF5A 1G8HA 1Y63A 1H8EA 2VF8A 1NRJB 4DB4A 4M2LA 1AJEA 2B6HA 1E2IA 4UJ5A 4LC1A 4JLKA 3U6BA 2GXQA 4M4SA 3CZQA 3VR5A 3L0OA 4BLOA 3T1QA 1UJ2A 1E4VA 4YMUA 2BVNA 5DN6A 2FJUA 3U4QB 4PTLA 1XU4A 3RS0A 4LBWA 2J5XA 2KBFA 2P3SA 3CONA 5F9HA 1YRAA 3VR2A 1FMLA 3CPEA 4A6PA 4R7ZA 2WKQA 1SKYB 2VSFA 1RRPA 1AZSC 3C15C 2PZEA 2RGNC 2ZJZA 2P65A 4C0SA 4KFSA 3RC3A 4V0ME 2VLIA 3IUYA 4OI0A 2QA5A 3TSWA 1KTVA 3CR7A 1YR7A 1GRQA 1II8A 3AVPA 2KBEA 5E4FA 1KNXA 5KPJA 4L5BA 1JBKA 4JVMA 5G41A 2XNDD 4AYTA 2F9MA 3CRQA 1Z2AA 2ASEA 3W5JA 5HCIA 4JLMA 3K0CC 2ZYTX 4I1OA 1XCPA 3DO6A 2NMVA 1QRAA 4R2HA 3OIVA 2H92A 4RKEA 1KYIA 4OJQA 2IC5A 5B2ZA 1F2UA 2CLSA 4URVR 2GNOA 1FW6A 1EXMA 3VU9B 3K0FB 3NBXX 3EXAA 4M1KA 3EZ6A 2FPKA 1NF3A 5AK0A 2HLDD 4TLBA 4Y0AA 5G3YA 3E2IA 2RGBA 3LVQE 2WSSD 4GI7A 2RAPA 1OB2A 3UG6A 4XWKA 1AQUA 2G9NA 5IK2A 4DCSA 2WWHA 1OXVA 1R2QA 4JLAA 4O0MA 3PUWA 5SZKB 4PSAA 3SE0A 3U3OA 5L3SA 4US1R 2ZI3A 5G40A 2YOHA 2A7QA 4ILEA 5KNDA 1XJ0A 1W0JA 2BIFA 4ZIRA 4NYMQ 4FXPA 4GSYA 2O8BA 3THWB 1G21E 1WDTA 1J99A 2BMFA 3J81k 1QG4A 1WRBA 3M6AA 3OEHA 1UPTA 4GZMA 5LB4A 4KAXA 1CR4A 4UNNA 2YYZA 5EP4A 3U6KA 3BB1A 1OH7A 1OE0A 2QMUA 4D4JA 1KMQA 1W1WA 1SKYE 2R6CA 1S8FA 1Z6GA 4XH9B 3EIHA 5TMPA 1E1RA 4AG6A 2EU8A 2G88A 3NEJA 4C0QC 1W2GA 4PO9A 1RIFA 2DCUA 3IDQA 2ZTSA 3IBGA 3LRPA 2OE2A 3A1TA 3TVTA 4F4CA 2FGJA 2AD1A 3EA0A 2XZPA 3QJYA 1KSJA 2CDNA 3IEUA 4MH0R 2FH5B 4BFVA 5JHHB 4JYCA 1XD2A 1YQTA 1ZNWA 1ZU5A 4MYTA 4G3XA 1E2JA 4JL6A 4Q4HB 4D26A 2J46A 3TAUA 4NCNA 1SVLA 3AVXA 4KXFB 3SYKA 3SI7A 4TZ6A 4B2IA 1NKSA 1VHLA 3ZS8A 2IL1A 3B8HA 5GVSA 2QPTA 4A92A 1Z08A 1QHIA 2EW1A 3TKLA 3W34A 1OFUX 3HYTA 4LC0A 2ZUCA 1G3RA 1PUIA 2QG6A 1GAJA 1L8QA 3VR3A 1TU4A 2WJHA 3DKPA 4JSTA 1Z6AA 1KJZA 2PBRA 2QMHA 4W7SA 3U5ZB 4EFMA 3KQUA 1NI3A 2EFDB 2OILA 4NTZA 3K70D 1F2TB 2Z4RA 4LJ7A 1NBMD 5DSZA 2FV8A 3WHLA 3RS4A 2HXSA 3PEUA 4HLUA 2YC2C 2A5YB 4AYXA 1FZQA 1OXTA 2QM7A 3D7MA 4I1SA 3AH8A 3WRYC 5TDHA 4EJSB 3KL4A 3KFXA 3O8DA 1HT2E 4BEBA 1A2KC 1E1QA 2CL7X 1EFHA 3QKRA 1E0AA 5AJXA 4ESVA 1DAFA 5JRJA 5FTLA 1J7KA 2CNWD 1ZVQA 3L8YA 1XEXA 3AEZA 4Q48A 1LS6A 2W2XA 3LDAA 3O8CA 5K8UA 4KI0A 3U7GA 2VHQA 2VP2A 3BERA 1S9HA 3LX5A 4LY6A 1KY2A 1Z0KA 1BOFA 1QBKC 3LNCA 5FI1B 3QENA 4UKDA 2NO7A 3TSOA 4Y0VA 1ZJ6A 5HZHA 4UJ3A 2W6IA 1S3SA 4ERNA 2RGGA 4PZYA 2YOFA 3DKVA 3L0SA 3CNOA 4ZIRB 4EPRA 3VKHA 4B3XA 4QGGA 2GK6A 3TAHA 2HT1A 1CR1A 1G5TA 1WCV1 2REBA 3W8RA 4D0NA 2WBLC 3TBKA 1F5NA 4CRWB 1VCNA 2O8CA 1C9KA 1AKEA 2AL7A 3SZRA 4P31A 4P4SB 2Z6VA 1R5BA 2QMEA 1HE8B 4BZXA 5L3VA 5LPNA 1P75A 4D82A 3UPUA 1UBFA 2XB4A 3BGWA 1JQLB 3DM9B 4LHVA 4HLUC 1TF7A 2FZLA 3SJZA 4QBFA 4OI2A 3B85A 2DFKB 2F3TA 1XD2B 1FOEB 5FTMA 1CRQA 3NH9A 3N2EA 1SVIA 1ZNZA 3HYRA 4QHYA 1V5WA 2GEUA 2J7PD 4DUGD 2R2AA 1OFIA 1OF1A 4PHTA 3Q7PA 1T5IA 2RH5A 821PA 2FN4A 4TT3A 1PLKA 3UK6A 1AM4D 3LW8A 4F93B 5K8IA 4HLCA 3RSOA 3C5HA 1UM8A 3AVVA 4HI0E 2PL3A 4N0EA 2OBMA 2NGRA 1Q44A 5DE3A 1IBRA 4XSHA 1P62B 5AJYA 2PT5A 5DI3B 4TLCA 2VQSA 4FIDA 1XWIA 4ZDJA 3R9IA 2IXGA 2NIPA 1JQJC 4UNRA 5FOWA 5J4VA 1Q20A 1VYVA 2YWGA 4Q66C 4HSEA 3GD7A 5E7MA 2NPIA 2XSZD 4FMDF 5EXPA 4EQ6A 4L9SA 1Z6XA 4HATA 1ZNXA 2GCNA 2ZI9A 3GJ6A 3PR1A 4CEIA 3UWKA 4NCIA 1XEXB 3QXHA 1ZM2A 3A6PC 4TYNA 4BFZA 4HZUB 4XJXA 4CIDA 1CEEA 1P2SA 1E0SA 1SHZA 2WWIA 1UKZA 3PJRA 3FHOA 3R8CA 1Z0IA 3KUCA 3NDBB 2XNSA 3QKSB 2VH5R 4P4TA 4DIDA 1RYHA 2XZLA 1DAEA 3BRWD 2C04A 4NONA 1M7BA 1Z06A 4V0OA 1T91A 2MSEB 2JLWA 3R7WA 2REXB 4YMTA 2JLYA 1N2CE 2QQ0A 4KLNA 1HE1C 1XXHA 3GLGA 1NIPA 2H16A 1OHHD 3TE6A 1P60A 2CE7A 5FUYA 2ZS9A 3VTKA 4IXMA 1P4SA 5JWOA 1EFTA 1XMSA 2XZOA 4IOJA 4JVSB 2JAQA 1GWNA 1UBCA 2AKAB 2VRWA 3CPHA 5KO2A 4L15A 2A5GA 4FD2A 2R6FA 4LUCA 1LB1B 4M9QA 1Q57A 5CYPA 3KXLA 1KI3A 2DFNA 3TUZC 5CIQA 1N6LA 4Q1EA 3UMFA 4DT1B 1Q12A 1KO1A 1N5IA 2XEXA 3TW4A 1DO0A 2O5VA 2G0NA 2W0MA 3GFOA 2IHYA 3VKWA 1CR0A 2JLRA 3MJHA 3RSLA 4DDWA 3OAAD 3GLFB 2IF0A 4DLTA 3TGPA 3C41J 1U8YA 1NIJA 4ZI3A 3IO5A 4IFEA 2YINC 2QAGA 1XMIA 1TPZA 2XJ4A 3SN6A 2RGEA 3B1ZA 4TSFD 4KFTA 4LZZA 3THXA 2ZRIA 2GHIA 1HTWA 4XVQA 2IYWA 3OE7D 1IN7A 2D06A 1EWRA 2A5FA 5FPSA 2E1RA 4GBMA 4MKIA 4A8JB 1PUJA 8OHMA 1ELOA 2OAQ1 3DOFA 2QTHA 2O52A 4XVRA 4WZBE 1ESMA 4HDCA 1TU3A 4DLWA 5HPYB 1P3JA 3SJCA 2PZFA 4EQ6B 1GNQA 3DZDA 4XWAA 3K53A 2ZQ5A 5JZVA 4CEIB 2QY9A 3IILA 2XJ9A 4PSVA 2ECKA 2W2VA 1DG3A 1RJ9A 4A36A 1W5SA 1XTQA 2W0SA 1XEWX 4YXWA 5GJBA 4TQ9A 2AFIE 1AGPA 4B43A 2W6JA 4NP6A 4KV9A 1DOAA 1RVDA 1VKJA 1G8YA 2A5DA 3K1JA 3KTAB 5KNCA 3EX7C 1N25A 4UXIA 3THYA 1QHSA 4BECA 4IOLA 1MO3A 1FX0A 4RKFA 3X1DA 3TH5A 1MR3F 1WE2A 1H8HD 4LJ8A 5EE3A 4EPYA 3R7WB 4U5XA 4EUNA 1GNPA 1LFDB 1MOZA 1XXHB 2NPFA 1KHTA 4NCKA 5BXQC 2GXAA 5FTKA 2V1UA 2QAGC 5JLJA 4Z51A 4NYJQ 2Z83A 3WYFA 2PCJA 1JALA 4B76A 3BH6A 1DAGA 3GJXC 2BEJA 1U0LA 2WAXA 3CH4B 3PQCA 3X1WA 3FHTA 3MFYA 2H18A 1W2HA 1T8TA 4FW9A 1IN6A 2ORIA 4LRWA 4MRSA 1Q22A 1ZUIA 2J1LA 4TL8A 5JSZB 2ZI4A 1QZXA 4KFUA 5FH9A 2BEKA 3GEIA 3ADBA 5CJPA 4MITA 3A1SA 4F7WA 1XF9A 2C03A 1HURA 2QPAA 3W5IA 4PPFA 4AKEA 4YLGA 3A1WA 2WOOA 4MRNA 2H1LA 2C95A 1NMXA 1OB5A 2RGCA 2QT1A 4B32A 3TRFA 2XXAA 3UIEA 4LYHA 3SJAA 2ZI6A 1NY6A 4JLOA 3NWJA 4PZLA 2GXUA 3LY5A 2HYIC 1P9WA 3QIAA 4C2UA 1CJKC 2QROA 1CJUC 2I1VB 2KJQA 2X1VA 3JVUA 4OKSA 1OSNA 1Z29A 2X2EA 4QNRA 3BAFA 3EC1A 1QDEA 4C2TA 2XGJA 2PCLA 3KZ1E 3SDZA 5JS7A 1SXJC 1M74A 1ZUHA 4XD7A 2JIZA 1KI6A 4A2WA 1Y3AA 2ONKA 1XXHE 4GRAA 4LYFA 3GLGE 3AKDA 3PV0A 5FFMA 4N1AA 2V7QD 4Q4AA 2GCOA 1IXRC 1N6KA 1E32A 2FA9A 1Z0JA 2ZUBA 2FE4A 1ZU4A 2JJ1D 1N6PA 3QPWA 4IVQA 4MKFA 3WBKA 4ASUA 5C46F 3H4MA 1NP6A 3EZ7A 4OI4A 5IF9A 3HWSA 4W5WA 1UDXA 2A30A 2HDNB 3AM1A 1MO5A 2IUTA 3MD0A 1XTJA 1CJMA 1GKUB 4K81B 3ZVNA 2JLZA 3LH5A 4KU4A 1SVWA 4B3DA 4DCTA 2RGXA 3AUYA 3W6PA 3LAWA 4WOPA 2B8WA 2VHCA 1R0ZA 2BV3A 5FOTA 4IW3B 4NE2A 3KJIA 2GF9A 1TQ6A 3NIBA 3AF1A 1RRFA 3GLHA 2P2LA 2XITA 1ZIPA 1TL7C 4DSOA 3CM0A 4B3GA 3PEYA 2H7VA 2BBSA 1DARA 4ESHA 2OHFA 4DZZA 4MQBA 1EFRA 2J0SA 2A3RA 4RD2A 2DPXA 1BMFD 3O8BA 4ZV4A 1XTKA 2F43A 4XTRA 4B3FX 2LCFA 4M9SA 4NKRA 5EP1A 3SBDA 1VHTA 3TVDA 3WRXC 5KDOA 1ODFA 2V54A 2AX4A 4V0LA 3SYLA 4DIEA 1ZRHA 2FSGA 2J0UB 2QM8A 1W36C 2KB0A 1FTNA 4B2PA 3U7HB 3NEYA 2FSHA 1FQKA 3I4LA 2FOLA 4DSNA 2ZUDA 1YZUA 5FTJA 3TR5A 4RD1A 1ZM9A 2QTVB 3B1XA 2O8DA 4D4LA 1G7SA 1SVKA 4GOJA 2SHKA 5F3WB 3FTQA 3KB2A 1LY1A 1NJGA 2L0XA 3P4XA 5DHAA 2UKDA 3AVTA 2XXAB 1DAHA 1X3SA 5BYJA 4O3MA 1Z47A 3ZGXA 1BKDR 3MJRA 2H5EA 3BJIC 3T15A 1DAIA 5E95A 5C18A 4CDGA 1OIVA 2JJ2A 4MRRA 1E9BA 1YJ5A 1T4GA 3WP1B 3VR6A 5JEEA 2G0TA 4HUQA 1HA3A 2ZI7A 3SJBA 2CJWA 2BMEA 1I4TD 5EP3A 1DAMA 3BBPA 4TTQA 5EUQB 3LXRA 1G3UA 3PEVA 4LOAA 3PXGA 3ONWA 121PA 2OBNA 2IF2A 3EZ9A 4E22A 3SYNA 1H8ED 3S1AB 4A0GA 4PSKA 1N6OA 2ANCA 5LD2C 1E2NA 3PCRB 1T3HA 3UWOA 3T5GA 1MO6A 1AKYA 2ONJA 2ZJ2A 5E7JA 1KK1A 2YWFA 5CITA 5DN6D 3AKEA 5JWRA 1I4LD 1UAAA 3B9QA 3B6EA 4YDSA 1ZBDA 3CRMA 3CRW1 1Z07A 1M1YE 5B57C 3EA5A 1X8JA 3H2YA 2ORWA 2IYLD 1OT3A 2CHVA 2GAAA 4JL8A 4UNQA 1IXZA 2QE7A 4OK5A 4JIMA 1U99A 1D2EA 3DL0A 1KI7A 5CJ2A 2P6NA 1JJ7A 3AGQA 3IKJA 4HB2A 1DELA 2REOA 1N0UA 3GLHB 4P33A 2RGNA 2V1XA 1G1MA 1OFTA 5BWMA 4E09A 4LYJA 1CTQA 1G19A 2EFEB 1LNZA 1VIAA 1KGDA 4JKIA 4MKGA 3MGCA 3KX2A 4AWXA 3LBNA 3N5CA 2FPLA 3I8XA 4BLPA 4H1UA 2NOAA 3ZQ6A 3TUIC 4QGAA 1W4BA 2F43B 1G41A 2C98A 4D80A 3WBJA 4M1YA 4B47A 4ZCLA 1XX6A 2CEAA 3OF5A 3L43A 4B44A 5JRZA 2QP3A 3U7FB 5F98A 2QRNA 3LQQA 2JEOA 4Q9IA 5EZ5A 3FE2A 2OCPA 3ZD7A 5AUOB 3KJGA 4DSTA 3EZ2A 3AB3A 4TMKA 5IK2D 1SVSA 1YR8A 4U02A 2F1HA 1N5LA 5LB2A 4DKXA 2OCAA 1YE8A 4OQXA 2GK7A 1PVOA 3DVLA 1E0KA 2CLDX 1CKEA 4IOMA 1IJEA 4OYHA 5B58C 3D8BA 2VHJA 1W0JD 3B1WA 4C0HA 2D4HA 1UKEA 3NXSA 5JJIA 4IEEA 3PUZA 2Q3MA 4LHWA 4BFWA 4LBYA 2EWWA 5CM8B 1UBEA 5FPTA 2CJWB 2IEZA 4NHOA 3U3MA 1E1RD 1S9DA 4K8OA 1TF2A 4XIGS 3HJNA 1ZCBA 4B75A 4CGZA 3B78A 1KI9A 5SZIA 5D3QA 2ZRCA 1Z0DA 2V4ZA 1BIFA 4GNKA 4QXAA 1ZM3A 5L3RA 4QC2A 3AVYA 1FMJA 1VCOA 2PMKA 2RGAA 4AURA 5C2JB 1IM2A 3GLHE 5ELXA 3VX4A 3WNDA 2IS4A 3I62A 3FMIA 5BW8A 2WPDA 4RVCA 1KK0A 1N3BA 1W47A 4DB2A 3BIFA 4HLQB 1E9DA 1ESNA 1KSFX 1N6RA 1RE0A 1KKLA 3U44A 3K0EA 1OXSC 3N2IA 3LVRE 1J8MF 2OSBA 4BLQA 1U90A 2GILA 4A0FA 5J4HA 3E5HA 4PC3A 4JS0A 2QP4A 1G64A 2QSZA 2BM1A 3LBIA 3P1JA 2QMOA 4TL7A 3B1YA 3VNVA 1D2NA 4DWJA 4IDPA 1E2DA 4KHZA 4GPTA 3OIYA 4HUTA 1KJYA 2VSOA 1FUUA 3C8UA 5FOXA 2RHDA 2FEMA 4LI0A 3TIFA 2WJJA 3RANA 3PEWA 3AF2A 3TUJC 4JBWA 4URWR 1G3IA 2ZI5A 1OW3B 2YZ2A 2Y8EA 2ZXUA 5ANRB 3I73A 3KXIA 4DDVA 1R7RA 5HE8A 2D62A 3K09A 5EP2A 2HV8A 4C9BA 3MWJA 4WA7A 1TTTA 3PUVA 5GVRA 4C30A 3UG7A 1ONBA 4FINA 4FWIB 4NCHA 2GZHA 1VYUA 2HJVA 5AUNB 2FF7A 4OHYA 1HEIA 3QVVA 1G7RA 4OQMA 621PA 2J3EA 1NL3A 4DHEA 2D74A 1Q3HA 4IJMA 2D2EA 3QBTA 1KSHA 1RFLA 2Q0HA 1KAOA 4BZQA 1RRCA 1S96A 1DBSA 5FBRB 5EXSA 3R8FA 4LJAA 3ZD6A 3RAPR 4P3YA 4BUJA 1G16A 4CT4B 4J0QA 2BM0A 3JZAA 2MSDB 2BC9A 1TAGA 5KOYA 4MRVA 4FMDB 1E0JA 1D5CA 1F3OA 3RABA 3WMGA 1NG9A 3D31A 1OV4A 1OIXA 4MYCA 1OH6A 1ZC3A 4B2LA 4PPQA 2ZRNA 1KO8A 1XEFA 2HF8A 4MUAA 4AC9A 4ON9A 3BORA 1NLZA 1XB2A 4URXR 1Z63A 2KE5A 5FPYA 5A0FA 1II8B 1TEXA 4BFSA 5JEDA 721PA 4GOXA 1DEKA 3AVWA 4FMCF 1YR6A 1HQCA 3CX7A 3K09C 2C96A 1QF9A 3F8TA 4PHGA 4Q1CA 3U44B 2QQEA 1HQYE 1XZPA 1AA9A 2ZRKA 2IA5A 4TL9A 1EFCA 3IBYA 2D3WA 4WW0A 1F2UB 4TT3D 1JB1A 3QEOA 2BKEA 5DO9A 4CEJA 1GRRA 3BH7A 1VIYA 2D7CA 2IW3A 4US0R 3UKDA 1GSIA 2OESA 5C1BA 4PXAA 4TMVA 2A78A 3WNCA 4B73A 221PA 3AGPA
chains in the Genus database with same CATH superfamily
3BFVA 4XDZA 1Y7LA 2BWJA 5L3SB 1IMJA 1H65A 3M3HA 4IFBA 5K0BA 2BAGA 4UCWA 4RACA 1I2CA 4FW8A 4PLWA 4RCYA 2J4DA 1WDLA 4E88A 2XIJA 3I52A 4GO1A 1GO2A 2R6JA 3RTCA 2R65A 1Q19A 2AJLI 3QA9A 5HJ7A 1PSDA 1YVDA 2ZSAA 4PR0A 4EPXA 3PX3A 1YJAA 5GMOA 3HU2A 1Q21A 5TARA 2BFBB 3VRHA 2CFSA 4ZC8A 1QV9A 2Q9CA 5HZMA 3C5WP 2C0CA 5A7HA 5SZHB 1XQYA 3RCBA 4U2EA 3AB8A 4O5AA 5GAJA 3E61A 1WBDA 1WG8A 1VQNZ 3M81A 3OX3A 3MJSA 2H9IA 4ZALA 2DR3A 1YA6A 4OHWA 3EG9A 4DXHA 2NYVA 4ES6A 2QEQA 3C7TA 4NPAA 1VPLA 4LMBA 2WG0A 4XQ9A 3OIWA 4D46A 2XRFA 1E5VA 2X0IA 4HGPA 3BRQA 1WW8A 4GWLA 5AR1A 1H2AS 3ILXA 3DUFA 3GQBA 2WI8A 3MWKA 5D3MA 4MWOA 5E3IA 2Z2YA 3ZGLA 3D5EA 3P9KA 4HAXA 4YR9A 1X80A 2X23A 2ZJ0A 3N0WA 1A95A 1QHHA 1DDGA 1VPVA 3L2OB 2PUHA 4MJ7A 4FWBA 3G3EA 4XTCS 1ISRA 3OIFA 3TGLA 2QRPA 1ISFA 3R5KA 1IY8A 2HA6A 1R8SA 1ZD4A 5K0NA 2YNMA 2Y1DA 3ZV7A 5GADl 2ZRMA 2DFLA 1X9HA 3RHSA 3M6IA 4N0DA 2X3YA 3H5OA 2CDCA 3IB3A 1AS0A 3AJAA 3QWUA 3ZY3A 4CV1A 3N39C 2PMDA 4QBGB 3GVIA 1Y1PA 2X7HA 6REQA 3PX7A 1Z6TA 2OO7A 1TRKA 2Z43A 3I45A 4HMQA 5BSHA 5LDDC 3ZTWA 3V80A 4L5IA 4MQEA 5IYZF 5ES4B 4MUNA 2Z56A 3G0DA 3Q8WA 2BBWA 3DT9A 1TO6A 2C07A 3WK8A 2PA3A 2CF6A 3FNQA 1V9CA 3EIUA 4HXEB 3ZBPA 3ETEA 4MRIA 3HXTA 3B9RA 3R41A 2Y68A 3Q2OA 5ED4A 4WOCA 4OYYA 1EVYA 2OFFA 4OGFA 5C1PA 1IAQA 5KSOA 4AIRA 3QKTA 3SM9A 3WL5A 5JY1A 3GRRA 1TT5B 1LPPA 4U0KA 1PRYA 3TPFA 2DE6A 1NJI1 1Y82A 3H5VA 4PZDA 1C8KA 2BEUB 2WR8A 2QPOA 1E6LA 1MNAA 3L0BA 3PITA 1O6CA 1QE0A 4GMDA 3KWMA 2P1DA 4TZTA 4FGLA 4JLJA 3BL5A 3JVVA 3K9CA 1Z3CA 5I5GA 1L6RA 3IYLW 4MVJI 4ONEA 3W5HA 5CVEA 4BNKA 1BH2A 2J3QA 3S5JA 4AZWA 1IM5A 2QN9A 5AICA 2FWNA 4K3VA 4Z7QB 3CF2A 2WTXA 4IYRA 1C80A 1FLNA 2P69A 1V3VA 4O2LA 5FOSA 4Z1MA 1RO4A 1UWVA 3GYGA 5FV7A 3E2PA 2LFUA 1ORWA 1USWA 1I4DD 4WRRA 2YNMC 5G1PA 1ZWLA 4LISA 1VQLZ 1CR6A 2R1VA 1J90A 1I24A 4C20A 4QUAA 3I6YA 3LXUX 4QD3A 4ZDWA 2HA4A 2PMWB 2R11A 2D1YA 3K70C 2YDYA 3SNKA 5WRFA 4RD6A 4AKSA 4XDGA 1M76A 5DM60 4MV8A 4FILA 5TB5A 2UZ3A 2O3JA 3ESBA 2O8EA 3O3OB 4MW4A 4BQSA 4LOKA 3A3OA 1UBLS 2P9FA 4JUIA 4BN0A 2XDQA 4QNMA 2V3CC 5HF6A 1Z62A 3EB9A 4WZAA 4NOKA 4CMIA 3BSYA 2SECE 5KYYB 1ODTC 1RIIA 1IONA 1RPTA 1S1CA 1U4NA 3FNBA 3GLIA 3AR7A 1QCYA 1U0FA 1EQUA 2HO5A 2J4FA 3B13B 3F98A 4NE7A 1T8UA 4P4GA 2OV2A 5AOAA 4HJRA 4EAAA 1OXXK 1ZQ9A 3L3BA 5EXXA 1Q822 3JQEA 4MCAA 1YS2X 1B76A 2IZ5A 4WJZA 4IUBS 2KMLA 3B6JA 3L7MA 5CB0A 1M2VB 1W1UA 2FN8A 4H31A 2CN1A 4UBIA 2Q5HA 4K9PA 1ULUA 1LWOA 1IEWA 3CZRA 3LF2A 4UBOA 5MHTA 3AV0B 4AIIA 4EELA 3MLAA 3CF6R 2VJBA 5DEOA 3EDMA 4D02A 3B7WA 3FFTA 3SC2A 3P0HA 1A5BB 1H2EA 2ZTMA 3AIIA 1ZGBA 3GJ5A 3KYCB 2RHOA 4BQEA 3UA4A 1XJCA 4YONB 5GJVC 4G5OA 1H1DA 2O59A 5AW6A 2CCGA 1MFPA 1L4MA 1OH5A 3P94A 3HUEA 1NI4B 1IZ7A 1QVZA 2YXNA 3B53X 1CE8B 3P4YA 3QLJA 5ENZA 4C5AA 4D96A 4BQNA 1TAUA 2A92A 3LUFA 2ESRA 1U65A 4GLLA 4IQ0A 4WK2B 1UF9A 4KPYA 1H22A 1XZAA 2IYSA 4ZGWA 1PDWA 2CL6X 4CI9A 4CLEA 1FB5A 3L6EA 4P82A 1GG5A 1MAHA 4MD8A 1XTRA 4Q9HA 3ROFA 5KSYA 4AY2A 3OW2Y 1EVEA 3PENA 1ZYUA 3EIOA 2VPZA 3QXJA 5AVWA 3E48A 3PF8A 1P9NA 3H9EO 1T6NA 1YGPA 1WCWA 1N1DA 1XWFA 3ASVA 1IDOA 2XIQA 3N2LA 4HFMA 5CM9C 4YAGA 2UYHA 4YRIA 3RT7A 2GEKA 1XD8A 1M8FA 3BS4A 2I6XA 1QIHA 3D02A 1N2EA 4IVNA 4WE3A 1PFWA 1W0KA 4NDNE 5IEJA 4LDPA 2X9GA 3ENWA 1C14A 3NDIA 1SXJA 2A88A 1AKNA 4EUEA 3KQKA 1HNXB 4ASUD 2B5WA 5E7QA 4F5WA 5LZ8A 3L1VA 1HR0B 4GPIB 2PSFA 2RI1A 3RHFA 1L8AA 2VIIA 5LQUA 2ZEJA 3MJ4A 3M3YI 3MMPA 4EHLA 4MGZR 1KEPA 4QLBA 3W5AA 1NUUA 1Q0RA 4Q47A 2VJAA 4Z54A 4K9NA 4W5OA 2ZVDA 1UQTA 3E9EA 1W34A 1M3SA 1WNFA 2YN2A 2VP9A 1B14A 3CD6Z 3S1SA 3D4BA 1MVLA 2EIXA 1DRJA 5H5JA 4DSAA 3KJFA 2J0VA 3O1HB 1G8SA 4OAOA 2CNLA 2XMQA 4LMAA 4BPBA 1RLMA 1JXOA 2FWPA 4OHFA 3RSFA 2IUEA 4PCAA 4JGGA 4AZ3A 1QPZA 1KMCA 3OAAA 1F0NA 4L7QA 5J4KA 3FW1A 3I32A 4M83A 4ZHQB 5TS2A 1KSGA 3WSWA 3UGJA 4A9AA 1ZH4A 1SQ5A 4JJKA 4LSMA 5J1SB 2F3PA 3IPRA 3KR2A 3DDNA 1YS4A 2QAGB 1Z68A 2Q49A 3L92A 4MGIR 4PRYA 4IGFA 3NH8A 1WXQA 3VNQA 3AXSA 5MGNA 4Z0HO 2JJMA 2OLKA 1KO5A 3U19A 2I78A 4QA9A 1ODKA 1JHVA 3IHWA 5AVSA 4K03A 1JSRA 2G08A 1DDIA 2WHPA 1BEZA 1Q3KA 3AY6A 3SJUA 4F92B 5IVKA 2WHXA 3GTOI 1IN8A 4BYGA 3C48A 3LSTA 3O9ZA 3WSVA 4RFSB 4Y9DA 1HQKA 1CDEA 2WF7A 2YV3A 3NDRA 5BT8A 1LPSA 3FIJA 2OTL1 1ZW6A 5FYDA 3A37A 4TMTA 3U61B 1F9AA 1JKXA 2FWRA 2PY6A 1XK6A 2LW7A 3SEQA 4G1FA 1GILA 4ARVA 2RHMA 3ZWQA 2X5XA 1J2EA 1G6OA 4Y2YA 1Z39A 3U9SA 4C0AC 1ZIDA 1I0IA 3LC2O 4IIYA 1QCDA 5LLTA 1ULZA 1NPYA 3TFQA 5ES3A 4ZZ1A 3AI2A 3H65A 3DF9A 4FGUA 1M2OA 4XEHA 2AJTA 2RIRA 4ZO7A 3JD4A 4TKUA 5HJ5A 1GL9B 3IA2A 3S1RI 1OI3A 2J33A 4QE3A 1GG8A 2BGGA 1NONA 3THYB 4UVHA 2EBFX 2ZR0A 3DQZA 5F2KA 2Z5VA 1A0OA 2WJIA 1JSLA 4KK4A 2QIPA 4DY6A 4JI7B 3EVEA 3PO2I 5JISA 3OY7A 2G28A 4WZAE 5KSWB 1Z17A 3U1BA 3JAMf 3S5UA 1VE3A 2F1OA 1SC3A 3I01M 4C7XA 3GLIE 1BXGA 5H3CA 2R0QC 3K9WA 3ZZNA 5EJ4A 4BVLA 1D2MA 1VCIA 1SKUA 2HCRA 3JQ9A 1E3LA 3VUEA 3BXHA 1HRDA 1Z4LA 4K28A 5DW3A 3T95A 1F60A 5CPFA 1G9XA 3MG9A 2PGIA 1PCXA 2JZCA 1IG0A 4JLNA 1TZJA 3RYCB 1Q17A 3PDWA 4KFRA 4KR2A 3QXCA 8GPBA 4FUQA 5B7GA 4D74A 5EFOA 3EQ6A 3PSHA 3RRNA 4RELA 1OZ0A 4N3BA 4FSHA 1FFGA 3EXIB 2VYND 2BKXA 1EX7A 2BUCA 3NWPA 4KQMA 3V97A 4FCWA 4V3CA 1VJGA 4B17A 1ID8A 3OTWA 3ICEA 3DDUA 5AJWA 3MWLA 3VU1A 5SY6A 4D6XA 2P0EA 4EGAA 3ZE9A 2QTLA 1Q0TA 3KVYA 5DJ5A 2W6MA 5T6MA 2LWIA 3DBLB 4OY3A 1A4UA 5EKTA 1MB0A 2OCKA 4B4UA 2V58A 1KR2A 5FUWA 5AK4A 5LZ2A 5LMNB 1A9ZA 2F4VB 4J0JA 3QWAA 4HGZA 2XUIA 2FSUA 3O8RA 3PTAA 2VSQA 2XWJI 2WM8A 4NH0A 2PM9A 3CCBA 3HMQA 4DLYA 5FR2A 4JBYA 3EIWA 1MKYA 4JB2A 4X45A 4UATA 4IDAA 1ZD9A 4UE2A 3LYAA 3EYAA 1V11B 2CF5A 2ET6A 3L4BA 3W3AA 4QASA 1GA4A 2IZ1A 3R75A 1XPJA 1U2PA 3AY0A 4EYEA 3CKLA 3SEAA 3KSRA 4BNXA 2AD5A 1Q7GA 2AVNA 1S6YA 2HV9A 3HLYA 3RIXA 3KKEA 1BRMA 1DRKA 3FDJA 1P73A 4KRYA 1KVRA 2E85A 3X1XA 1JYFA 3N0RA 2O3UA 2NTNA 2QW8A 2Z3ZA 4J07A 1NW3A 3L41A 4V0NA 4LTNA 3WI7A 4B3BA 1F51E 4L8GA 3DYIA 2A0FA 5A3JA 1W36B 5IAEA 4IO1A 4KE8A 1C1YA 2LV8A 3GP8A 1HMPA 4X7MA 4ZT4A 4H9GA 1FBNA 1GPH1 1WLSA 5GOTA 1K1EA 1SXJE 2FEAA 4RETA 1OFGA 2IBTA 1OPRA 2YW2A 1PGOA 3E9CA 3DNFA 1OR8A 3WAGA 1JIIA 4YRAA 1ZD8A 3BILA 4NY1A 1BWQA 1BWSA 1QX4A 4XYLA 1V16A 2NZXA 1QYCA 5BN3B 4FCVA 1LJLA 1TK2A 1KQPA 3LCUA 1W2BY 1LU9A 2C9OA 3EISA 2RPRA 5K0LA 1XKQA 2ODQA 2NO9A 2YXDA 1C3OB 4HWRA 2CXRA 5G4KB 4HMOA 3REFA 1HE5A 1L3IA 4GR5A 4V0KA 3OESA 1OFVA 4K87A 5AVUA 2OB1A 3WWEA 1A1VA 1X8LA 1T4DA 4BMOB 1DNPA 5FI0B 2NNLD 1PZGA 1GQSA 4FB4A 4Q1DA 3IEVA 1KEWA 1Y7HA 4IIGA 4NZZA 4E14A 1DAOA 3UMRA 1U1IA 3L4BC 1UPAA 4M1SA 2P6RA 2RKWA 2Q5OA 2WPDD 3CCR1 1E7QA 3I3OA 1NMYA 4L5CA 3WDLA 3ZGVA 4ETMA 1RM5A 4L8FA 4NNPA 3AONB 4RK4A 2PFSA 2ODEA 2WFLB 3OX4A 4LXIA 3NM4A 4WBXC 4FFVA 3K4PA 2JIDA 4ZYUA 2ZRPA 4G1CA 4OSPA 2OP0A 2HL6A 4M7RA 2AR7A 3ZLUA 1A69A 3GARA 4MA4A 3TIIA 2VL7A 4BNWA 1G8GA 3BZUA 4WN3A 1DTEA 2H8KA 3AM5A 2CXPA 2QYHA 5ALOA 1F5SA 1JYSA 1K5PA 4DWWA 4ZOQI 4B2YA 3Q3VA 3HKDA 5GJWC 3VHRA 1GCUA 2O9JA 1E1MA 2JGNA 2XMZA 1ZN8A 3ENQA 3PDIA 1CT9A 1F12A 1H6CA 4R54A 5EFZA 3W8NA 3FPKA 1T34A 3WYNA 4OK3A 1E8MA 1FCJA 2PG3A 2JJYA 4OB7A 1EP2B 2IDKA 3MTIA 3X0DA 1FDUA 3OCJA 6PFKA 5HGXA 2IU0A 4O08A 2JAXA 4ZAZA 1H4SA 5L9AA 3CPWZ 3K5IA 4IIHA 4TZ0A 5DLQC 2K2WA 2Y1EA 1NNLA 4H08A 5BQPA 3WIBA 5AFSA 1L7XA 4RA6B 2PGXA 4PFSA 4RE5A 3NBFA 4HNQA 5KTSA 4HUQB 1FS6A 2HAEA 4OD0A 2H6EA 5IVIA 1E2MA 3QMVA 1WQ3A 1FDRA 1LLQA 5EAIA 4Z4HA 1PIWA 4RKYA 4A6EA 4Z9BA 2FPRA 1ZKDA 4PYQA 4UUQA 5DHFA 4MDEA 3K94A 4YJ3A 5D5QA 2X3FA 5GJCA 3AT1A 3SLKA 3N0XA 3WB1A 3B52X 4KR7A 3WA6A 5AM2A 1IPHA 1OJ7A 1AHHA 3NIWA 4WKNA 4PNPA 1QM5A 2D2FA 3GPDG 2YWXA 4OP2A 4XX1A 2J0EA 5IWCA 1Q0SA 2GEVA 4FZ5A 5I7HA 5LL6P 2EBUA 1J23A 2G9VA 4IJ5A 2VPQA 3DB2A 2VUSA 2VOJA 3QW4B 4IILA 3SBOA 3NGMA 2FCAA 3C2QA 4GQAA 2PS3A 1DKQA 1WL8A 4XPIB 4IXNA 5C32A 2X3UA 1BCSA 1K2WA 1QJ4A 2H63A 4UTXA 4NFHA 3HXQA 2Q4DA 1VC2A 3UGKA 1EVQA 4WCDA 2GN8A 4QXRA 4HH3C 4DDUA 1HX7A 1DI0A 4XWGA 1NJ1A 3CMA1 3FGPA 4UULA 1TM3E 3DR5A 2BHTA 1T8SA 1W9MA 3N6VA 1HDEA 1NN0A 1C3LA 3CN9A 2JC3A 5JH7F 1U8XX 3LQKA 2EYQA 4DM4A 4IKOA 3F2VA 2JF0A 1F2TA 3OOSA 4P7JA 3SG0A 3E84A 2C5GA 4JY7A 3UV7A 3V1NA 3FZEA 1ANKA 1I5OA 3QBJA 3W6ZA 1Z0UA 3MBIA 3HDQA 4TV9B 3JQRA 1L4FA 4B4WA 1VQ8Z 4D99A 2H8GA 1VBMA 2E9SA 4LZLA 3UOWA 3UPDA 4EJSA 1DXOA 4GXRA 1VQ51 1E9SA 3KQOA 4F45A 1XOIA 2YL2A 1FFXB 3ESYA 4ZO4A 3SZUA 5DBIA 5MFZA 1QFMA 2GDJA 1QRDA 1AUOA 3MJDA 1DTWB 4X95A 5EIHA 3W2IA 3LYUA 5DH9A 1YUMA 4BNYA 3M6MD 2OBFA 1U11A 1VYTA 3NJRA 1K732 4P7FA 4LQ4A 4F8EA 1ZUNB 1L5ZA 5KWVA 3BCUA 1IY1A 1I80A 2HJ9A 4DQXA 3ND9A 3GTMI 1I6LA 2OYRA 1EXDA 4JI3B 1D6SA 2PYDA 2F8LA 3LQ2A 2ZR9A 4BUCA 2VXYA 4W5HA 2H9AA 5F52A 4JBXA 3PNLA 3U3KA 2Z8ZA 2W6ID 3IIKA 1W4LA 3A36A 1XZ8A 3M6LA 1XHFA 4ROSA 3OTGA 2PUVA 4WEOA 3WISA 3WMRA 1NJFA 1VXRA 1VKRA 2Q4ZA 4B48A 5DHUA 3U7EB 1TQ8A 5AW4A 3VKGA 2HSDA 3VUFA 3IFSA 3C3EA 2GO1A 3N6XA 1IQPA 4F71A 1D7OA 5AKXA 1GU1A 3FSJX 1LI5A 3O2NA 1RQ7A 2QV0A 4FHCA 1X14A 2L82A 1ZK0A 2F6RA 2F7SA 2ZRAA 4M6WB 4YAUA 1YDEA 2HHHB 1Q74A 2IXTA 2GCGA 3OQBA 1O8CA 2RGYA 4IGEA 3TXYA 3CB4A 3LZCA 3ZHSA 3GVHA 1RWXA 2AN4A 3TL3A 3CLTD 4MQ4A 4O25A 3QNUA 3SZLA 4MRAA 1VG1A 4UCQA 4DIKA 3BQNB 1L7VC 3GEDA 5G0UA 1BCRB 4X90A 4EJSC 3HXKA 1WVGA 3VNRA 1Y8QB 3U3XA 2YKGA 2Y4OA 5D87A 4N5MA 4IIDA 3RBXA 3T3PB 4W8GA 1JPJA 4ZI7B 5FAKA 2C9YA 1RYNA 2JI9A 3ED1A 3SHOA 5LP6B 3SYTA 1M0WA 1QGAA 2FUKA 2QTBA 3IAUA 5J5VA 4Q16A 2EX0A 3PE3A 5I8WA 1E5DA 5G1NA 2A2ZA 1O03A 3K6RA 2XAUA 2QRMA 2GRJA 3GJ4A 1TQHA 3IESA 4UC0A 5TQVA 1JH9A 4PR3A 1A4RA 3JD0A 1P0MA 1POXA 2FR8A 1N9ZA 1YUBA 1G18A 5HIJA 1QOPB 4TXLA 4AJLA 5FOQA 3W6NA 3M9WA 2XBLA 2DUUA 5DTMA 2WSSA 4UXJA 1OXKB 3K0BA 4P3OA 1B3BA 1GD1O 3KEOA 3OEED 4HEJA 2VT3A 1S89A 1M0EA 1AQNA 4XA8A 1MBZA 5BR4A 1L5OA 5EG5A 3WNVA 3H5WA 1UKBA 5AK6A 3FFAA 1SVOA 2Q1YA 4KUEA 2CEKA 4OXKA 1L9KA 1NVXQ 4U5QA 3CC7Z 4YRSA 2EKBA 5HP4A 1QC5A 5K20A 1KTIA 2YTZA 4P83A 1SFOI 1ATZA 1BHQ1 2PMEA 1FJHA 2YJ4A 3L8DA 4I4TA 1D2CA 3GLSA 5LWQA 3RPEA 1JPVA 1UDAA 2BGNA 3PC6A 4HZUA 4YP7A 2OXTA 2XQVA 5IHPA 4UQOA 4OMFG 3P45A 3G59A 1U3UA 3DFZA 1TUBA 1SCBA 3LYLA 3AIMA 1P2TA 4ZVTA 4ZTUB 1MVOA 4H7PA 1Y4SA 3ASYA 3M4ZA 3SHQA 5B4VA 3AR3A 3QPCA 2JLUA 2R4QA 2XOKD 3NGXA 2NU7A 5EGNA 1CEXA 4KR0A 4F7DA 4AKGA 1QV6A 1YZLA 1IEQA 1M7GA 2P75A 3NH6A 4BLWA 3TDMA 1ZNYA 2Q1TA 4LNAA 2JCXA 2G63A 3QU2A 3QEJA 4HS9A 3IPYA 4MS4B 4UAGA 2V6FA 2C7RA 3DMHA 4Y2TA 3H3XA 2O1SA 3HJFA 4QRHA 3G82C 3ZDQA 1JDJA 1TCUA 1B3RA 2ZBEA 5IARA 1W44A 2B6NA 2O4CA 2PLFA 2VJMB 3F71A 3FNGA 3A7EA 4TMXA 5D3KA 5E1DA 1GGEA 5TY0A 2QNRA 5F3DA 1Y1RA 2FR8C 2XADA 4BC1A 2RG7A 1YZQA 2XTMA 3A14A 3FJOA 2HGSA 2V8KA 2NV0A 4K6GA 5CA1A 1TQ4A 4LYAA 3R7SA 1K6JA 5EUMA 2D1FA 3K32A 4IV0A 1G8PA 1SBCA 1W5FA 4RA9A 4R9UC 4W63A 3HKZA 1L5HA 4UHBA 3SBEA 3WGZA 4B6RA 4CMJA 2C59A 4YHHB 4FDMA 4KJZA 4A3LI 4YT8A 1AHPA 3I5YA 2IU3A 1CY0A 3MF4A 1NC3A 1RQGA 2ZZKA 3L7DA 3UWSA 1PWHA 2YQ5A 3G711 1YQEA 2V7GA 3BMOA 2C54A 3FBGA 4PZAA 5EIWA 1QR6A 5DYNA 1NWCA 2PL9A 2FGKA 3A1NA 4TYQA 5E6SA 1H3EA 1ZKMA 4N6GA 4ZVOA 3S1LA 2B8JA 2C5LA 4BNDB 3MK31 3LUJA 3G1UA 3T35A 3CHYA 1DWQA 1M2JA 3GLVA 4U2CA 5A4KA 3OQMA 1Y1VI 3CUEF 5F23A 1YVEI 2XB2A 1PBNA 3P7MA 4PBRA 1Z0AA 1N0VC 1XZGA 2HK9A 3HV0A 4MI6A 1E7RA 3U1VA 4AMBA 1V2HE 2DWPA 5H16A 3QP9A 4CCAA 4FZVA 5EJAA 2X7JA 3SR0A 5JCXA 4H4EA 4R1QA 3TSYA 4PSDA 3FPFA 3UH0A 4YJ3F 4NH1C 4KEAA 5HQJA 4F3YA 1KXZA 3KT3A 1SR8A 2GASA 5EJ9A 2P2GA 3BFKA 4M89A 2PH1A 4DLRA 5IUNC 2YWHA 1P74A 3WS7A 2C57A 3NAMA 1JQAA 2Q21A 3GAAA 4IX1A 3FCOA 4OV6B 5IT4A 3IO3A 1QRUA 1QHNA 3L8FA 4DCUA 1ZISA 3CZPA 3E4DA 2JGEA 4MUFA 2Q07A 5E6RA 4YRNA 2EBWA 4CEHB 1GPJA 3L7YA 1KJNA 5DM70 1NV9A 4H6PA 1U8CB 3OMLA 3ZWDA 1FQOA 4RJLA 2JZOA 2UV8A 2V74B 3BWCA 4WH0A 4ZXFA 4YJHA 2ZB3A 1R1DA 3KTAA 4DADA 1IOLA 1C3JA 2PD6A 3M5PA 4HQ0A 4BO2A 4IQ4A 2X40A 5CDFA 3TTXA 4D79A 1WCMI 3UK0A 3ESAA 2GPYA 2Z08A 1SM4A 5AI5A 1PR1A 1R50A 3KDSE 4LBZA 4MVJA 2WWVD 1SRRA 2WU1A 2Q2QA 3LD9A 4RTOA 4YPOA 5IT9A 2J32A 3P26A 4Y1FA 3CCJ1 4YMVA 3RAJA 3RS2A 2NUAB 2NXNA 1RJEA 4X94A 2PBFA 3HG7A 4K9DA 4PYRA 4TVBA 1GQYA 1AE1A 5IKEA 2CHQA 3FLAA 1KOLA 1HYGA 2J7PA 4Z86A 1L4YA 3DB1A 2WWWA 3TTUA 5F4BA 4M1WA 4EYKA 4CFZA 1TQ2A 2VAVA 1XJWA 2JFPA 4ZU3A 1FIUA 4E08A 2HHLA 4D0LB 4RSMA 3DEAA 3VH2A 1Y4AE 3FJYA 1HZZA 1N9GA 4N0PA 2ZU0C 2YADA 1BD3A 3W5DA 1I7QB 1OA1A 3JALA 4R3NA 5K4HA 3PYLA 4OP1A 4AJJA 2XUQA 5KYVA 5JSZA 4R51A 4XIYA 1CEYA 1HYEA 4MOWA 1VGRA 4YWJA 3MHPA 1FPQA 1HKHA 3DJYA 3HH8A 3RDPA 4YT4A 3NORA 1QVGZ 1NMEA 3RSHA 3FR8A 3PJEA 1C1XA 3WGJA 3GJ3A 4DJ5X 3TXXA 2YFYA 3HRKA 3EPLA 5GWXA 2ZT5A 1E9VA 2KI7B 2P62A 2VHEA 2HPVA 1OXBB 1XHLA 2O1XA 1ISPA 1ND6A 3AWDA 1KH3A 3IUSA 3NVAA 2PJUA 1VL6A 2GBLA 4K7JA 5CDGA 3GVXA 4HPWA 4CDRA 5JMOA 2H08A 3TIVA 4ZICA 2BTQB 5E9QA 4BX0A 3PEEA 1K3TA 4RPLA 1TMGE 2R4UA 1R15A 5IABA 2Y0CA 2XMSA 3WWCA 2HNBA 1T8PA 1KBOA 4IDHA 5HE9A 1BGXT 3PGLA 4EK9A 4JU9A 2ZWAA 3WICA 2CXNA 1A82A 3RREA 1PD0A 3L4JA 1SN7A 4EGSA 1NN5A 4JI6B 3P2EA 3CCQ1 1TGYA 2APJA 3ZK9A 4DYDA 1T9CA 5C4IA 3DCYA 4IP0A 3WR5A 5TJ9A 1IRIA 3JYNA 4TMYA 5JNTA 1FNSA 2WE7A 1QH1A 3A3YA 4NZYA 2GPWA 4X1KA 1D3AA 4YALA 4QHSA 3G8DA 1PZNA 3Q10A 1YRBA 4RLSA 2C4NA 3NWEA 4I8XA 3F5QA 3SXPA 1P81A 3QPVA 1TT7A 1YZYA 4P3XA 5ALWA 4F2HA 2ZUEA 1UWKA 1VKHA 1XCOA 4OQ4A 2BR5A 4QXMA 1BFUA 1C0LA 4F11A 1HZZC 1TCVA 3IAAA 1ZMXA 4PO8A 3NVKI 1E94E 2I7VA 5EPOA 2OYCA 1Z22A 1NW7A 3GAFA 2JGFA 2CUZA 4L0MA 4ANFA 4UTRA 4J29A 2XCRB 2OFOA 1O96B 3BAZA 4CTOA 1CRPA 1QIEA 4I4LA 4GKJB 4XEUA 2Q9UA 4QICA 3JRWA 3DHWC 3UK1A 3HJCA 2B78A 2CBXA 5EWJB 4J0CA 1GITA 2IYEA 3BHIA 1EBBA 2ZXFA 3C24A 3HFGA 3QF7A 4M1EA 4M53A 4B34A 2KPIA 1JRLA 3RFXA 2Y4NA 1AUPA 4LWOA 3FGOA 5FNVB 3U0VA 3U37A 4DQDA 5K03A 4DRYA 3EAGA 1U2EA 4TXMA 1U0OC 3C3YA 3RWMB 3IT3A 4PQYA 4BNNA 2C00A 2G36A 1N2GA 4BFXA 1C7EA 1V2GA 3CNHA 3OJWA 3OA0A 3EIFA 4Q0MA 5I7EA 4GYWA 1K98A 3PO3S 1V8ZA 2WU4A 3C8MA 1VFNA 4BMCA 5SYAA 1OD6A 3GTJI 1C9NA 1E1CB 1M1ZA 5K3FB 1G38A 2OR3A 4G5FA 4ALLA 1MT0A 1GZ4A 4I4TF 1KFJB 1EEXB 1W5TA 1CHNA 2IIBA 2WJ4A 4J9UE 3IVRA 2ZK7A 1TWHI 3D2CA 2VP6A 4O4HA 1SUWA 2NXWA 3PNBA 2DT5A 2IWRA 5KYXA 1RQ2A 5L7WA 4ARZA 3VNUA 5IMSA 2QR3A 2DFPA 4KI7A 5F9FA 1K08A 4IWYA 3Q3JB 2P9TA 2QRDB 1BJRE 1Y7TA 2ZRGA 4MV7A 3R7BA 4AJ9A 3ASZA 4V03A 2JIBA 2QDKA 3N2KA 4DV0B 3G85A 2FZ5A 3G89A 4I9HA 1W88B 4Q7MB 2QBYA 2VQ6A 1NYRA 3LUHA 1U9CA 1JR3D 2P27A 1LSOA 1Y3CE 1M6HA 2EC5A 3KHSA 2CVOA 3HCWA 4CF6A 5FQOA 4JR1A 4HTFA 1NI5A 4MR9B 4B6FA 5JDIA 1YMQA 4PAQA 1OBOA 3LXXA 4HC4A 3GPBA 3VTFA 4IIEA 1M72A 2WD9A 1JPNA 4MMZB 4KIGA 3T06B 4BQRA 1KEKA 3RSCA 3EPPA 4YJGB 3I2KA 4G0OA 4HGOA 1KAGA 2I9PA 2VJDA 3FPBA 4I5IA 1KRXA 1ST3A 4Q15A 4XE5A 1E18A 4GPD1 2DUMA 2NZ2A 2JFZA 4D9GA 3VR6D 3B3QA 2OLJA 5CDFE 1GXSB 1IUPA 1YD7A 2JHPA 1YBMA 4V0QA 1CUGA 4ZZ2A 4BB6A 1G20B 2FW9A 1WMDA 3EDQA 3SHVA 4BVFA 4MWZA 3FHCB 1C81A 4D4KA 2RI0A 4MVJE 5JCOA 1N2XA 4QTZA 2GMWA 3EWSA 4TLAA 2F1JA 3W8FA 1LD3A 3F3PC 2X2OA 1K9M2 2X8JB 2AZDA 4IRXA 3SR3A 3V4LA 3KL2A 1D8AA 4A91A 4WNYA 3DDWA 4NBRA 3PIRA 3E7WA 3SVZA 1ENZA 1LSSA 2BGJA 5BMVA 5HRUA 1PU2A 4BJ3A 2NUBA 1J9EA 4QOSA 3FB1A 3KOYA 1KVUA 2IE8A 3ABQB 3KXPA 5ALUA 2N1MA 4F4HA 4GT1A 4K0KB 4YRRA 3V1KA 1JSXA 2VEDA 4H7HA 4G0VA 4W9RA 3CF0A 4UFNA 3G6KA 4JOQA 3B3FA 1TWAI 4CCYB 4PYOA 1K6MA 2Y0PA 1V8OA 3K4HA 4IUCS 4KX5A 4YMSA 4F38A 2BEVA 3A1VA 4EVIA 4B6EA 1I33A 1OKKA 2FEOA 1XJQA 1DC4A 2QAIA 4JZKA 3RS8A 3RVPA 4ZDIA 1N7JA 2NM0A 2VRCA 1EJ6A 1JP7A 3O03A 3L0PA 1SMKA 4TNUA 4JC8A 4W7HA 1JFTA 2Q4EA 3BB4A 4W6QA 1CG6A 1T5DX 3GWZA 2LUOA 4V0MA 5JDIC 3LUSA 3B9BA 1NF2A 4PYJA 4RF5A 5KNBH 3F3MA 5CLIA 1ZL0A 1G7CA 4YGXB 3LKVA 1NVMB 3RLIA 3FPCA 4CV3A 3TG2A 1DOHA 4O2AB 4GQIA 1B8NA 2O20A 3M7IA 3RRZA 3GZNB 2Q45A 2Z8YA 4OU5A 4AP5A 3LC1O 2EZ8A 3T34A 1UT5A 5BVHA 4FOSA 3ZCVA 1KI2A 1G9TA 4B3SB 2YV1A 2MR6A 3GUCA 3UM9A 2VXBA 2CGEA 2X9QA 4EFLA 1MCZA 1K4YA 1IWOA 1Y9AA 4YMWA 3ZKWA 4C14A 3BB3A 1PJTA 1WD5A 4I1UA 1Z9BA 1QTRA 1SHJA 1GPUA 1GL6A 1H0RA 1LVGA 1FVXA 1G5QA 2ZWMA 3CRVA 3DTVB 4FSDA 5D2CA 1ML3A 4HAYA 1ZC4A 3NT5A 4FDTA 4CBVA 1BU5A 4EHHA 5HQTA 2OHHA 1NBAA 421PA 1P5JA 1DPFA 2ZPAA 2CL0X 4RC9A 1WXEA 4OQFA 3QLVA 3RVSA 3H18A 2ZOSA 4RHEA 3A7DA 2WVGA 1FP2A 3GFTA 1ECLA 3OZFA 4G5YA 1T3GA 3V32A 3N2NA 1C2TA 1CY2A 3QU4A 1A8UA 4JA2A 3GNQA 1T8WA 4XLZA 5EVCA 5FTNA 2V7QA 4D6PA 2GGSA 1P17A 1VPDA 3K6JA 2LXNA 4KBGA 4M88A 2YX1A 3N2GB 4YRGA 5L6MB 4KPUB 5HG0A 2QUKA 1C4OA 3GRZA 5GONF 1KZYC 2Q8QA 4BX8A 4ZCMA 1X70A 3UN1A 2WJ6A 2ZDQA 2X0RA 3KM0A 4QAJA 2O0JA 3LPCA 1H6BA 2YICA 2PT6A 2H4HA 4LNUA 1FQJA 1CQIB 3PCTA 3DQPA 4K9LA 2OZEA 1EGAA 2CVZA 3DNPA 3O3NB 4EYOA 1DKNA 1WCIA 3B82A 5AESA 2LTAA 3D8UA 4B7AA 4GL2A 3CRNA 3DM5A 4WHMA 3NBUA 1I2DA 2YZKA 4HEHA 3VMFA 4PZCA 2AK3A 2Q2OA 2XECA 1W4ZA 4ITRC 3ZHZA 2D1QA 4BO5A 3C4JA 3PP8A 3HCBA 3RH0A 1NVGA 4Q01A 5E4JA 3UBMA 1ZONA 2B8EA 5HKAA 3KAJA 1DAKA 2JK0A 4FIZA 2E82A 2V6GA 5K0SA 1WCYA 2TYSB 1Z5VA 3I3SR 5AW9A 1X1AA 4H3KB 4NBHA 3LCMA 4WCFB 5DNAA 1XC7A 5LM3A 2BSQA 5IHXA 2EDCA 4M9RA 4G67A 4R16A 3W5SA 3WC4A 1Z75A 1Z25A 1V37A 3PG5A 3DLPX 4GPBA 4TN1A 1JIUA 2V8JA 2NZVG 4QWWA 5NLLA 3TTVA 4D92A 2VP0A 1Y80A 4V38A 5J4YA 2I8LA 2EG9A 3R5TA 1EUCB 4O02B 1LS1A 3RSZA 1QK4A 1SHUX 2O4HA 1X7ZA 2F64A 5LBIA 1AVTA 4IUYA 1V47A 1W29A 4OJNA 5K3AA 4IDNA 3LY9A 1T9HA 2GD0A 4URZR 5IJAA 1WY5A 2HTEA 3QLTA 1KQNA 2YJGA 3HOWI 1J2JA 1G5IA 4RIGA 1J70A 2FPPB 3K0AB 2VDKB 3RYIA 2WJVA 3G1WA 3T5CA 4C0LA 1VP3A 3COWA 4F85A 5IRCD 1I2ZA 2J9XB 3ECCA 4BTLA 1UXJA 2B3TA 1K7XB 1OFHA 2C4HA 3QLUA 4X97A 2XOXA 4S3MA 1AZWA 4H6XA 5AYVA 5ALPA 2B35A 3IQXA 4AKHA 5TPZA 1QO0D 2AMYA 1EK6A 4LSZA 2A5JA 2GKSA 4KK3A 4GKVA 3T1OA 1MJ5A 1NT2A 5THXA 3HPRA 3QKWA 3NOXA 3UUFA 4ER3A 4CMAA 2FQ1A 2NX2A 5C8VA 1QP7A 3G6EZ 4IJWA 1YQ9A 1YIAA 2XTJA 1PG2A 1U4OA 3FPSA 4FFMA 5T4HA 3PGA1 3UMJA 3SVLA 2O53A 4RDCA 1NXPA 2DPMA 1I3NA 2DBQA 1VL5A 3WLPA 2HCTA 3MLEA 2BJVA 1RXEA 2RMKA 4H7JA 3NAZA 1NV8A 1CUJA 3LOPA 3T7CA 1EWKA 5BQ5A 1GLGA 1W46A 5J9FA 3IE2A 2OECA 4CQLB 1O0BA 2YV5A 5JSYA 3WNZA 1PGQA 1Y63A 1H8EA 2VF8A 3P2MA 2Q3DA 2WG2A 1NRJB 3EZLA 3IT1A 4M2LA 1AJEA 3NTQA 2AE2A 1H93A 4GBGA <