1NP6A

Crystal structure of escherichia coli mobb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
170
structure length
158
Chain Sequence
MIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Insight into the role of Escherichia coli MobB in Molybdenum cofactor biosynthesis based on the high resolution crystal structure
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 33
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.120 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1np6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1np6A01
2C9CA 2PX3A 1TQ2A 5HZKA 4KLNA 3BS4A 3UANA 1GP2A 4Q4AA 3LNCA 3H2YA 4PXAA 5B30A 5KHOC 2V1UA 4KODA 2V8OA 4LJYA 2PT5A 3LVRE 1WXQA 2J5XA 4D6PA 2ZI4A 4DDTA 2QSYA 5DI3B 1O3YA 5FUYA 4UNSA 4BZQA 1TF5A 3VNUA 1GKIA 1R8SA 3DO6A 4MKHA 3RRMA 2EFEB 4PC7A 4OHYA 2DFLA 2ONKA 3GPLA 1N6OA 3RAPR 4V0NA 4DXAA 4I1OA 4LYFA 4Q4HA 3D31A 5EZ6B 1XCPA 2XJ9A 4KFTA 2Z83A 4UNRA 5KSYA 2WWYA 4O2LA 4C7OB 1FZQA 2IUTA 1E99A 5JCPA 2J7KA 4QNMA 3CR7A 3RC3A 4CZ2A 1NN3A 1IBRA 4D4KA 5DN6D 2H18A 1N6LA 1Q20A 3WBJA 3WYFA 1E2IA 3IPYA 5A5GA 1SXJE 3TR0A 4IVQA 4OBEA 4BLTA 4OJKA 1JPNA 2D74A 4BFUA 3K70C 1W49A 3KKPA 3BFVA 3LLUA 5FTKA 3BB1A 3LX8A 4MKGA 2FFQA 4W9MC 4BRUA 1D2MA 1E2QA 4QNRA 2GEVA 4C0QC 4TSFD 4GMXA 1G17A 2QP3A 5FI1B 2MMCA 1E9DA 2P67A 3THWB 2CE2X 3AUXA 1BIFA 1HQYE 1NF3A 2X19A 4FXPA 4ZCLA 2YVUA 3CH5A 2DB3A 3TH5A 1SKQA 5L3RA 3OHMA 2I3BA 2KE5A 3SJAA 3L8ZA 3OESA 1N2CE 1QDEA 2LKDA 3AKCA 5H70A 3S1AA 1U0LA 2R65A 3K0CA 4UNPA 3GLGE 1Q21A 3J81k 3ICQB 3RWOA 4Q4AB 1EK0A 4QRHA 4JLKA 3SDZA 5IF9A 4P31A 1NVVQ 2VTKA 5AUQA 1HQCA 3OE7A 4LHXA 2Q21A 5FPKA 3T5GA 1XTQA 1KDRA 1P2UA 2FPKA 2JEOA 1YRAA 4TWZA 5L8VA 2HLDA 3LLMA 5FTMA 2O8EA 4EDHA 1G6HA 3R9WA 3ONWA 4Q9LA 2CL0X 3PUWA 1F48A 1T8TA 3CR8A 4EUNA 1CIPA 4FW9A 5AJZA 2WWHA 3FOZA 4PSKA 5FPHA 4E03A 1U0JA 1JR3A 4Q4HB 2ORVA 2WZQA 4II7A 1OW3B 3O8BA 1G8YA 1T0HB 2QRNA 1PLJA 2QQ0A 2WOJA 1XXHA 2XITA 4KI0A 4M1MA 1U0HC 1XMIA 4PR0A 2VSXA 4ESHA 1KI4A 1KAOA 2YC2C 5ANRB 4F4IA 3D7MA 3ZVLA 4Z8XA 2HYDA 1TU4A 1E2FA 2CHQA 3LXXA 1T3HA 3E2IA 5B57C 2R44A 3ZVMA 3QJYA 5GJCA 3Q85A 5HCNA 4P0TA 3L0IB 4AYTA 1IQPA 4X8LA 2NO7A 3VHLB 4KO8A 1E9FA 3K0FA 1CJKC 3T1OA 5KDDA 4Q9HA 4GRAA 4RZXA 4QJ3A 1PVOA 4YMTA 5B2ZA 4JBWA 3TUZC 4LPSA 3HPRA 2IWRA 2FZ4A 2Q3MA 4RKEA 3W90A 2RGAA 1NLFA 2YC4C 1CKEA 2WVJA 5C46F 1Z6AA 2CLSA 1IN6A 1ZAKA 4Q9JA 1E4VA 2FE4A 1KO7A 2X8AA 2J0QA 2QE7A 3IBGA 4D4JA 2GETA 2WWIA 1TQ6A 3A1SA 2SHKA 4JLBA 4L16A 4PO9A 1KK1A 2GCOA 2V4ZA 1G7TA 3B1WA 3FHOA 3LXRA 5HTKA 4AC9A 1ZD1A 5K8IA 2RGNC 2ZJAA 3AVPA 1M6NA 2QBYA 2ZRBA 4TQAA 4X8HA 2ZE7A 1OIXA 4HZUA 3TJZA 2O52A 3Q7PA 2DFNA 4JS0A 2FNAA 2CJWA 1ZYUA 1YJ5A 1XU4A 4IDPA 5C4GB 4G0NA 3HDTA 4ARZA 5JMTA 4XD7D 5JHHB 2WAYA 4S35A 2WKRA 1VCIA 1FQKA 3QBTA 2BM1A 2HV8A 2HJGA 1KK3A 4Q9KA 3DZ8A 3RS2A 1W0KA 3NEYA 3BRWD 2O8EB 3THYA 2WWXA 4HLUC 2E1RA 1IXSB 5E7JA 3T12A 1Q57A 1D6JA 2DWQA 4BZXA 5L3SA 4FCVA 2Z4RA 2ONJA 3UWOA 4M2LA 1D2EA 4QHTA 4M9SA 2IEYA 3KX2A 3VHXA 2C95A 1KSFX 5E7IA 1XBTA 3AH8A 4EPYA 2XTNA 1WE2A 3FHCB 2D2EA 2FSHA 3FFBA 5SZHB 2X2FA 2UKDA 5DHAA 5H1YA 1NSTA 1XXHB 1QHYA 2IF0A 2YNMA 1CR4A 4YQFA 3U2QA 3ADKA 3I8XA 3RDPA 1KSJA 3Q5EA 2J0UA 1G16A 3MAAC 3N2IA 1Z0DA 3WP0A 4Q19A 1AKEA 4CEJA 5IT5A 2H1LA 5FOUA 5ELXA 1CULC 2UVQA 3QF4A 3K0FB 1DG3A 1W4AA 1G5PA 1JR6A 1LS6A 1FPMA 1EWRA 2PEZA 2KBFA 1LB1B 2VHJA 3KZ1E 2ECKA 5FL3A 1QBKC 2GZDA 4FWTA 3CNNA 4TTQA 2N46A 4RD6A 1KMQA 2QPAA 1G5TA 4TLBA 3EIQA 4OQXA 5J4LA 5DH9A 2VP9A 3KQLA 1RE0A 5A0FA 3BK7A 1HYQA 1X1SA 4QJ5A 5AUOB 1Z0AA 5HZHA 1EFHA 1H8ED 3GJ4A 2FPMA 3HU3A 3UMRA 4ZIRA 4C2TA 2C9OA 3GJ0A 1Z06A 2GCOB 2VF8A 4IOKA 4ZKDA 2YOGA 2QBYB 5DN6A 4W5HA 1Q1EA 3OF5A 4HZUB 3HR7A 4MA4A 2WJVA 3CPEA 1ZC3A 3TE6A 4YMUA 2CJWB 3K0AA 4Q4LA 2WSMA 4GI7A 1HTWA 3IIKA 3B2EA 4ARZB 3V9PA 4QHYA 2DFTA 1HA3A 4QGFA 2QPOA 3IEUA 4TN1A 3THYB 4BFWA 1R8QA 2OESA 3QXJA 5D3MA 4TSFA 4F7WA 1XD2A 2NPIA 3KKNA 4TTPA 4US2R 5L3SB 1W2GA 2CCGA 1BYUA 3LD9A 4M21A 2JDID 1FFHA 1G3IA 1S2MA 2UZ3A 1NKSA 2C5LA 3CX7A 1XNJA 3QKRA 4C0HA 3TSOA 1CTQA 5LB4A 1JPJA 2VF7A 3HR8A 4HZIA 4KU4A 1JR3E 5JSZA 1HUQA 3LVQE 4RD4A 2DHRA 2IYYA 4W5WA 1X8JA 2OM2A 2ZI5A 4Z51A 1FW6A 2ODEA 3W5IA 3SYNA 2FOLA 3CX6A 3GEHA 3RHFA 2JIZD 3NH6A 4LV5B 5DYIA 1G291 1OJLA 2B8TA 1XXHE 2J0UB 4HAXA 4CEJB 3CRW1 2OZEA 2WWGA 3F3YA 4JJKA 3NEJA 4Q1FA 1W2HA 3QF4B 1G9XA 3ZQJA 1ZU5A 4UNNA 4LJ8A 5EUMA 1NRJB 4MH0R 3DKPA 2ZM5A 4HB3A 1KMHA 4M1KA 5IHPA 2Q3HA 3EAQA 2PJRA 1K8RA 4Q18A 3SBDA 4IOJA 3TUIC 2GWHA 3GJ7A 4V0LA 4HLUA 1F5NA 4XOIA 4EIWA 1JJ7A 3TK1A 3QNUA 3VR3A 2AFIE 1KZ7B 3R20A 2HT6A 1EG7A 2GBLC 3RS7A 4URXR 1W36B 1TF7A 1YR9A 4I1VA 4HLCA 2P65A 3LO5A 4Q02A 4BLSA 4ZIRB 1EESA 1BS1A 3WRYC 5DNYB 2OFWA 1LY1A 1OT3A 2JJ2D 1VCMA 1KI9A 4C9BA 1JXOA 4I4LA 1KO4A 3I72A 3QPUA 5E7MA 1XZQA 3DZDA 4QGGA 3K0AB 4A92A 1HURA 1I2DA 2J41A 4MUBA 5KSOA 1ZUNB 4DLXA 2ZUCA 1KO8A 4RKFA 4KFUA 4URWR 5BN3A 3B60A 3VFDA 2NZ8A 1KNXA 4GL2A 1PV4A 4P4UA 2JJ8A 1DTSA 2QORA 5D3MB 1XD2B 2BM0A 1NBMD 3I61A 3GEIA 4HUQB 3ICEA 3M0EA 4QHSA 5JEEA 4RD3A 3CX8A 2ZYTX 5DISB 2ZS8A 2QG6A 5J4KA 3QKRB 2XZPA 4A8JC 2F43A 3IQXA 4BLRA 2KSQA 1ZM3A 2X1VA 1D9ZA 2XZOA 3RANA 4NU0A 3C5HA 4Q01A 3EWAA 3FKSD 4M9XA 3F5FA 2C99A 1W5SA 1QF9A 4XD7A 1WQ1R 1XDBA 3A4LA 1RVDA 2A5FA 3WMEA 3LY5A 2I1QA 4B3XA 4LI0A 2REXB 3DHWC 3W6PA 4B3FX 1W47A 3CRVA 3QOFA 1GG2A 3PQCA 4QBFA 4TLAA 2Z5FA 1ZUHA 1PLLA 3VMFA 4TYYA 4PQFA 1KMHB 5JJLA 5F98A 4I99A 2VHQA 1YQTA 4IDQA 2QM8A 2WM9B 5B64A 1UDWA 4GNKA 2OCYC 3LBHA 1R5OA 4LYAA 1JQJC 5FR2A 1SHKA 2H5EA 3GFOA 4GBMA 1SULA 3I62A 3RS4A 3KUDA 2H7VA 5FOTA 5JI3E 2HEIA 2ZJBA 5CK4A 1N0VC 2G3YA 3M6AA 1KJZA 2QQEA 3NG1A 3R7WB 3SU8A 1II8B 1NP6A 1YZTA 4N1AA 5DSZA 3RYTC 4EAQA 4XVUA 1OFTA 3W8RA 1T3SA 1SVWA 5E3HA 4U7DA 4EFMA 3ZZ0A 4M1SA 1SVLA 3MWKA 1EFUA 1G19A 2UZIR 5FPTA 4F4JA 1T3LA 1ZNZA 5E4FA 5FPSA 1Y63A 1QVAA 1RZ3A 2ODBA 3KJGA 1W4RA 3B1VA 2IYRA 3EZ7A 3LV8A 2F6RA 3SFZA 1M1YE 4DUGD 1V5WA 4ABYA 3KKOA 1LW7A 3X1DA 4XTRA 2CNWA 3X1YA 2W6ID 5HKKD 4GPTA 1OLOA 5EXXA 2OXRA 1DAGA 1XMVA 2QSZA 3RS5A 2C03A 2YWGA 2ZJ5A 4B2PA 4JZKA 1TEXA 3NHBA 1ZRHA 4ZV4A 4B74A 3PUZA 1E2HA 2OUKA 1OIWA 4Q1BA 1H8EA 5DLQC 1M2OB 3H4MA 1N25A 1FUUA 4Q1EA 2JLXA 1YVDA 1G1MA 2F43B 5AUPB 4FD2A 4OHXA 2ERXA 3T1TA 1Z63A 1Z29A 4DZZA 3NBFA 4FCTA 5FL7A 4DVGA 1S3GA 4P4SA 1E69A 4FMCB 2V6JA 4M8NE 1NVVR 2RGGA 4JKYA 1GL6A 4P32A 2QN6A 3GJXC 4MKIA 4ZCMA 1DE0A 2ZS7A 1KI6B 421PA 3H84A 3L8YA 4D4MA 3I3SR 2MSEB 1ZMXA 4QM6A 3BOSA 4E22A 3PEVA 2ZRHA 4IXNA 1ZIPA 4O0MA 5FFMA 2VO1A 3I8SA 2ZTSA 3P27A 3SNHA 4BASA 4ZPXA 1D2NA 2JDIA 5FTLA 1A5TA 2F3RA 4QKQA 3REFA 3N5CA 4FMCF 1R6BX 1W0JD 3X1XA 2J1LA 2QMHA 3I92A 4B6FA 4O3MA 4NMMA 5GVSA 5JECA 2IS2A 3BAFA 3C4JA 4NYJQ 1Q1QA 4A8JA 2BWJA 2JIZA 2ZXUA 5KNCA 3VQTA 2Q6TA 1NY6A 3A1UA 3SYLA 3ZS9A 4JVMA 4KBFA 2J9RA 2RMKA 1TUEA 1P9NA 3MWLA 1AS2A 1O87A 1P9RA 1KHTA 1WRBA 5KSPA 1OFUX 1KIMA 4DIEA 4EJSC 3KQUA 1X8KA 2VRWA 4ZI2A 3LRPA 3ZLJA 2IK8A 4TQUS 1CR0A 1MO3A 2YOHA 1RYFA 1XB2A 1OH8A 2P6UA 3CF0A 3Q72A 3WNBA 3LQRA 4BEBA 5KPJA 2R62A 1T5IA 1GDDA 3SR0A 1Q44A 1CF4A 2P5SA 3QKUA 1CJUC 2KBEA 1B23P 1RC8A 3DVLA 2O5VA 2RKOA 4R2IA 4ILEA 4TLCA 2FN4A 1TADA 2YZ2A 1AZSC 1T9HA 3NBXX 5FUVA 2ANCA 2VYFA 1TL7C 3PUXA 3JZMA 3B8HA 4WZBE 1OB5A 3EZ6A 4ASUD 2JJ2A 2W0MA 4PTLA 4D25A 4CGZA 2Z6VA 2BBWA 1MO5A 1G4AE 1E0SA 2EFDB 2W00A 1S0UA 4P4SB 3GFTA 3P26A 1KDTA 3I73A 2VSOA 3Q7QA 3TMKA 1U2RA 1CR1A 1U99A 1PLKA 4S2EA 2J46A 3TKLA 2R6DA 5CLLA 5DO9A 2QAJA 1Z2CA 4URVR 2BEKA 2NIPA 5G3ZA 3WMGA 1Z47A 3BD9A 4C0AC 2YINC 1AM4D 2C98A 4US1R 1ESNA 5JJKA 1NBMA 1OKKA 2XZLA 1A7JA 1ZP6A 4LPKA 1GUAA 1QG2A 3OIUA 3K70D 1F60A 1UADA 2G0TA 1N0WA 1SZPA 3T1QA 4BPBA 2VP2A 1CRPA 1AKYA 1FL9A 4G5QA 3AB3A 4JSYA 2R6AA 3WYAA 4DLTA 2BKUA 1F6BA 2PZEA 3DDCA 2XTZA 3K09C 4CYMA 3FKSA 3OZXA 4KFRA 4A8JB 4M9ZA 5CJ2A 1FNMA 1AS0A 2QAGA 3LW7A 4L9SA 2GJKA 4JVLA 4C3ZA 3G5UA 2F9LA 2WPDD 5KDLA 5KU1A 4AY2A 2PJZA 1EFCA 1Z3IX 2W0SA 2CHGA 2BBSA 4LWZA 1D5CA 3U7EB 4PHGA 5CIQA 1NIJA 4BLPA 4GOXA 1R0WA 4A2PA 4TZ0A 2IYQA 4HDOB 3AF0A 3UPUA 1E2NA 2AXPA 1DAHA 2D62A 4MQBA 4AYWA 2FA9A 2DCUA 4HEJA 4PC1A 2IEZA 4EPVA 2ZRDA 3CRMA 3ZJYA 1RW4A 1DVRA 2G83A 5AWFC 1E0AA 2WSSD 1G3RA 4LBWA 4H1VA 2K5UA 5EUQB 1G18A 2REOA 2AWNA 2HF9A 4A1FA 3VR5A 1CS4C 4V02A 2QT1A 1KTVA 3K9LA 3AKDA 4URYR 1I2MA 1YRBA 2BIFA 3D6TB 4B71A 1Q1ZA 2YWEA 1GM5A 2VH5R 4KVAA 2BMEA 4N0DA 3GD7A 2NPFA 1NVXQ 4DLZA 4Q00A 4B3DA 1JXMA 4KAXA 4DUGA 2JGNA 3ZD6A 4BFSA 4D0LB 2XNDD 2W6IA 1VECA 5HKKA 3PEUA 2NO0A 2AXNA 3VTKA 1W44A 2ZSBA 1MKYA 4EJSA 4PZYA 4D0NA 4LY6A 4JLJA 3P4XA 1XZPA 2VP6A 2ZQ5A 4KBGA 1ZBDA 1TQDA 5JJIA 3AGQA 3A1VA 4NCNA 4YXWD 3NBZC 1NG1A 3TIFA 3VX4A 3U6KA 4GFDA 1Q3HA 3RSLA 2ODNA 3IQWA 4PO8A 1KJYA 1Q1BA 4W5JA 3W5JA 1GNPA 4JSTA 4A6PA 5M04A 2X2EA 3UXMA 4DT1A 3I1FA 1P4SA 3NIBA 2OLKA 1UDXA 2ORWA 1Z28A 4JL6A 2QMOA 3FE2A 2FU5C 1P72A 1GIAA 2BBOA 4TMZA 5CITA 1KKMA 1FNNA 3G0HA 2QAGB 3IO5A 4QL3A 3KTAA 5DGXA 2C96A 2XJ4A 4JBXA 2QTVB 2HYIC 2QTFA 3PVSA 5L3QB 3K8YA 3ASZA 1E96A 1FMLA 1TPZA 3QY0A 4RVCA 2DFKB 4DLYA 1GRNA 3VR1A 4DSOA 2GCPA 1SVMA 1WF3A 1ZINA 4PANA 5FTJA 2BJVA 5CB6A 4QOSA 4U00A 3BB4A 2RGCA 2ZU6A 3K0EA 1QHHA 2G88A 3TLXA 5JHGB 2XXAA 1G64A 1XP8A 1ZM2A 1CR2A 1IAQA 1W0JA 4Q1DA 5E95A 2IYWA 1H8HD 2PEYA 4TL9A 4A82A 2VP4A 3T35A 4KCGA 1H65A 3PR1A 2XTMA 3ADDA 4N0EA 4LCBA 3K09A 1XFAA 5LD2C 1K6MA 1PUJA 3QPWA 2XB2A 1XMJA 2QMEA 4FN5A 3U3KA 2ORIA 3TVDA 1AQYA 2ZRLA 5CM9C 1E1QD 1G5RA 3AF4A 1WMSA 2PH1A 2VA8A 2N1BA 3W3ZB 1WB9A 1XCMA 3AVYA 1XTIA 2AR7A 2DY1A 4EJSB 2IHBA 2F1JA 1HH4A 1GL9B 2VPPA 3D3QA 3R9IA 3NH9A 2GEDA 1GNQA 2GZAA 5DE3A 2HXSA 3ADBA 2YJTD 1E2JA 1TAGA 4BE7B 1DARA 4PSVA 2PLRA 2WHXA 4Q21A 4R2HA 4BQSA 4JVNA 4U02A 4FMBB 3KXLA 2CL6X 3EPHA 1NBME 5JFGA 3C8UA 4BGDA 4H9GA 2LWIA 4D2IA 4ASUA 4DT1B 1GTVA 5TV2A 2EVWX 1E9BA 4TYNA 3CONA 3I32A 4MRNA 4RZUA 2XSZD 2CHVA 2GXAA 3TR5A 3KJHA 5FBWB 3NBYC 1G7CA 1G7SA 3KTAB 1OB2A 1AJEA 2IWHA 4ZI3A 4PC6A 3KQNA 4R71A 4MKFA 2BV3A 3S1AB 3B6EA 2ZRKA 2O0KA 3EC2A 3T06B 1KZGB 1VYTA 2G1KA 1CU1A 4IVPA 3WXMA 1Z6YA 2IA5A 3GLFA 2ZREA 1XEWX 4PAMA 1FOEB 2D7CA 2DR3A 3PENA 3PUVA 3EPLA 4JL8A 2PX0A 3U61B 2BHRA 3X1ZA 1GAJA 3AVXA 1Z08A 5SZJA 2F1HA 1QHHB 2XXAB 4DB2A 5AJXA 1ZM4A 2MSDB 4XWKA 1CXZA 2OG2A 3JZAA 5EJEA 2JLRA 1ZM9A 1DBSA 2GXSA 4ZO4A 4DDVA 1ELOA 5H8WA 4JYBA 1XTRA 3HPQA 1E2KA 3SZRA 3B9PA 3R8FA 2NOAA 2WOOA 1MH1A 2WPDA 3BH7A 3W6NA 1KYIA 2P0EA 1UBCA 2GRJA 2QPTA 3LFUA 3HP1A 4GT1A 4B73A 2O8CA 2EQBA 2W2TA 1YZGA 3GJ6A 3I4LA 1KNQA 4MRVA 1P73A 2ZR0A 1YZLA 3CWQA 1NVWQ 2A9KA 2A5DA 4C0SA 1KI7A 3FVQA 3BFXA 1SVIA 3MJRA 1KAGA 5SZKB 3VKWA 3BJIC 2JLUA 2JLVA 3PFIA 3TUJC 1LVGA 1RKBA 1GRRA 3RNLA 3W6OA 4J0QA 2WSSA 4JLNA 2EYQA 3GQBA 2CK3D 2RB4A 4DSUA 2J7PD 4IDOA 5JRJA 2P6NA 1FX0A 4FWIB 4NCHA 1GFIA 2QA5A 3AGPA 4R7ZA 4RD1A 1Z6GA 2Q9CA 2GNOA 3EA0A 1AK2A 4HDCA 1OSNA 6Q21A 5FH9A 3KXKA 1Z22A 2H16A 4X8OA 3BH0A 2GTPA 4LOAA 3GMTA 2V1XA 1RYHA 2C04A 4MUAA 4P4TA 2HDNB 5EE3A 3ZYCA 221PA 2VLIA 2HCJB 3LW8A 4BZPA 4NZYA 3O47A 2XNDA 2RAPA 3CPJB 1NN0A 3B13B 4EPWA 1JAIA 4AIIA 3GLFB 2OO7A 2YOFA 3TQCA 2WIAA 2ODWA 3QXCA 2F55A 4F92B 4RJLA 1N6IA 2OCAA 3SEAA 3B9QA 3QQ5A 3L0OA 2OT3B 5DHFA 1DPFA 4YXWA 3T1VA 4TYQA 2C77A 2OILA 1XTJA 4PC3A 4JMPA 4AKEA 3K70B 5BXQC 1KI3A 5J4YA 5EQTA 1UBGA 3Q3JB 2IUUA 3AP3A 3OEHD 4KXFB 3AP2A 3IPXA 5CK5A 2ZVPX 521PA 1DAKA 3GFPA 4B3CA 4NPHA 3BWDD 2N42A 4R98A 3T15A 2D7DA 3SHFA 1XPUA 3MSXA 2W2VA 1JBKA 3U4QA 1KY3A 2ATVA 3FMOB 3EZFA 1AZTA 3BORA 2IYSA 1KI1A 4L15A 4EQ6A 3VKGA 2EFCB 4JT2A 3EIHA 2O8CB 4NCIA 3ETLA 2RGNA 1VHLA 3IHWA 5BQ5A 4A9AA 2J3EA 2GVDC 3QF7A 2QT0A 5KDOA 4TMWA 4RY2A 4OQFA 3A36A 4GZMA 4HYYA 1NMYA 2OXCA 3MLEA 3UATA 2RCNA 5AJWA 2VP5A 4DLUA 4DRZA 5K8UA 2GA8A 3VX3A 3FMPB 1L4UA 5JLJA 4U5XA 2FSFA 1IN7A 3OFND 3CB4A 3CH4B 3FFAA 1H8HA 2OCPA 4B35A 1J70A 1Z6XA 1Z0JA 4DEYA 2LKCA 3NC0C 4JL5A 1U98A 4FCWA 4JIMA 2EU8A 2Q3FA 5GVRA 3U44A 1LFDB 1N6PA 5F3WB 1J7KA 2DYKA 4OQLA 2BCJQ 1HEIA 4DB4A 1JB1A 1ZCBA 2XNSA 2ZRPA 3VR2A 4WZAE 5JCZA 1TTTA 3MWYW 2AK2A 1COWD 4C0LA 3P4YA 5EXTA 4V0OA 1QHSA 2HCBA 5JZVA 4TYPA 1DAIA 1XCGB 1A2KC 2EWVA 4N3NA 1AA9A 1W4CA 1E1QA 4HI0E 1NN5A 3CBQA 3P32A 3KJEA 1Y3AA 2R6GA 1ZUIA 4QXAA 2XX3A 5BYJA 2R9VA 2NO6A 4DEXA 3PJRA 3UMFA 2RGEA 1SQ5A 1W7AA 1UBEA 3M4YA 2BJWA 2CLDX 2Z4SA 2ZE8A 4NYIR 5C4MA 4JLOA 1E0JA 3PV0A 4WVFA 3GLFE 4DC9A 4L4UA 4TL7A 1UJ2A 4IDNA 1S96A 3R9XA 1OFIA 4FIDA 4LRWA 3SI7A 1M34E 4WW0A 4ZDJA 4BECA 3I5XA 1MRNA 3B78A 3U7HB 2OAQ1 2NQ2C 1BO6A 2QROA 4LJ6A 5A4JA 3NTUA 3U4QB 2FFAA 3HYRA 4QBHA 5JSZB 4YMVA 2D06A 3EC1A 1DAMA 1KOFA 2ZAOA 5FOSA 1AS3A 4DBLC 3A1WA 5FBVB 5JS8A 5GADl 2R8RA 4LBYA 4C4PA 2BVNA 4EQ6B 5JI2E 5KO2A 1E3MA 1G4UR 1QVRA 5BN4A 2CEAA 5GJWC 3WY9A 1G20E 2RGDA 4MGYR 2JA1A 2V9PA 3SJZA 1K5GA 3JVUA 3PUYA 4CT5A 1MR3F 4Z1MD 4AKHA 2ZITA 3E70C 3ZDQA 2AHOA 4AURA 4LBVA 3T34A 3GCGA 5FPYA 1N3BA 5AJVB 4ZKEA 3GP8A 2GAAA 1DO0A 2ZRFA 1ANKA 1PUIA 5DIFA 1QHNA 1X3SA 1X1RA 1A82A 1ZM7A 2F7SA 1EX7A 4YDHB 1ZNXA 2PBRA 4URUR 1FTSA 1NN1A 2CL7X 3U44B 3QSYA 1G21E 4IOMA 3CZQA 3LX5A 1K5DA 3W3AA 3UIEA 4JLAA 2RHMA 2AWOA 3AVOA 2A5YB 1E1RD 1LF0A 3LBIA 2ZJZA 1LNZA 1N5KA 2GXQA 2I1VB 2OFOA 1JECA 1JNYA 1NY5A 4B44A 4FI3C 3VKHA 3DMDA 2PZGA 2J59A 4B47A 4CW7A 5FOVA 1G3MA 1AN0A 3QG5A 4JLVA 5CJPA 3DOFA 3KKMA 2IS4A 1C4OA 1FP6A 4UQOA 1U9IC 3AKYA 1SVSA 1YR6A 1VTKA 3CF2A 1GOTA 2G9NA 5DI9A 2VIIA 2ZYWX 3BE4A 4IKEA 4HB2A 4OK5A 4X8MA 3DPUA 4LJ4A 3N2EA 3FTQA 1B0UA 3N70A 1OH6A 2KWIA 3DMNA 4C30A 3Q8XB 3ECCA 5FOXA 4C0KA 4NHOA 1YKSA 4NL4H 3FWYA 5FR1A 2JCSA 3OAAD 3QG1A 4LJ5A 4LC1A 5LB2A 1CJMA 2J0VA 1XF9A 3SN6A 2BKEA 2GBLA 4QGAA 1NG9A 3NDPA 4Q5IA 1M7HA 4Q7KA 1G41A 5TY0A 2XOKD 1OE0A 1J8YF 4A0RA 2GILA 4Q1CA 2D2FA 3P1JA 4QFMA 5KOYA 3W34A 4KYIB 5EP1A 1IOZA 3CNOA 4NYMQ 5UKDA 3GEEA 1DAFA 2ZANA 3LAWA 3QXSA 2WJYA 4Y0VA 3LA6A 3RRNA 4DLSA 4QM7A 8OHMA 2CDNA 2VHCA 4CRWB 3AF3A 3L82B 4JVSB 2W58A 3DKVA 1U94A 4TL6A 3OEHA 2OE2A 2VSFA 3CW2A 1MOZA 3TAUA 2QM7A 1JAHA 5H68A 1E94E 1HT1E 3ZS8A 4F38A 1NKTA 2GCNA 2JLYA 2ZUBA 3C41J 4UNQA 3IGFA 1CRQA 5BW8A 1P60A 4C2UA 1BOFA 1CLUA 1GWNA 2B7CA 5G40A 3ZIAD 3ZZUA 4NE2A 3CIOA 3AM1A 2VHUA 4DKXA 5GJVC 2IXFA 2P3SA 3TAHA 1XWIA 4A6XA 3FYHA 4IEEA 1IXRC 1UAAA 2WKQA 1NSFA 4GZLA 1HE1C 3NC1C 4MGZR 4KJZA 2ZRNA 2FGKA 5BYKA 2Z0MA 3WHLA 3L43A 2ZSDA 1QHIA 1FQJA 3SOPA 5HE8A 2X77A 1E2EA 1X86B 4DSNA 1W5TA 4M9QA 1VYVA 2IYTA 2IYLD 2DWOA 4JLMA 2P6RA 4B3BA 2JJ1D 3B1YA 4DIDA 4NH0A 1S3SA 1G3UA 3RWMB 4E5UA 4DCTA 3REGA 1RRPA 1XMSA 1Z0FA 3OFNA 4OI4A 4KFSA 1YZKA 3MD0A 4KVGA 4C0JA 2O8FA 1XD9A 2ZJ8A 2EW1A 4HB4A 3HJNA 4PQRA 4WAUA 1JALA 3EASA 2XB4A 2ZJYA 2CBZA 1RIFA 2OV2A 5EXPA 2GEUA 2PT7A 4ERNA 4NTZA 5C1BA 1COWA 3A4NA 1QHXA 1LF5A 1IONA 1Z0KA 2ATXA 4YMSA 1G8GA 2RGBA 3QEJA 1C1YA 1E79D 3QVUA 4PHTA 3TW4A 1LTQA 3CZPA 4YMWA 3WBKA 5DI3A 2OSBA 1SKYB 1XJCA 1S4QA 4LDJA 1TX4B 4IRUB 4R9UC 4HAZA 4D4LA 1XPRA 3HU2A 1I4LD 3WNDA 2BOVA 2ZE6A 1KJWA 1R0YA 1G3QA 1U9IA 4OI1A 1DAEA 5IK2D 2ZRJA 1S9DA 1EFRD 1WCV1 4K46A 4YDSA 5IDVA 1VG1A 5F9FA 3EPKA 1E2PA 1RRGA 2WAXA 3HYTA 3IIJA 2AN9A 3GJ8A 2A78A 4M1TA 4LK2A 1GRQA 3K0CC 4RZ3A 1N6RA 1OPXA 3GJ3A 4AK9A 3THXA 1E6CA 2A7QA 1CJTC 3TVTA 3C15C 3IIMA 1IN5A 4JKIA 4QBGB 3U3JA 1YHNA 1KK0A 2EYUA 2Q0HA 1KKLA 3OIWA 3EG5A 2GAOA 3ZH9B 3TBKA 2DWPA 1UEIA 3P20A 1N5JA 4DCUA 1PZNA 2FF7A 3WYGA 4PX9A 4TTRA 4WBSA 1Q22A 3LH5A 3AV0B 1YZUA 1RRFA 1CJVC 3B1ZA 3D8BA 1XJQA 3FPAA 4K81B 5G53C 2JLWA 3SQXA 1P5ZB 1Q12A 2OAP1 1LS1A 2H17A 4RSGA 5HPYB 1IN4A 1FUKA 1G6OA 2B92A 2GHIA 3KL4A 4GP7A 4LJAA 2RHDA 4TT3D 4B33A 1HV8A 3KDSE 2XAUA 5J5CA 5TDHA 4B3GA 4JJZA 1U81A 2G1JA 1VDZA 3E1SA 5FOWA 3LWNA 3SJBA 1L2TA 5J40A 2OFXA 1ZC4A 3WMFA 3GLIA 2IYXA 3SS8A 1M74A 1YR7A 4I1SA 1E1RA 3K53A 2ZSAA 3A8TA 1YU9A 1AQUA 3F0TA 4XH9B 4BWYA 4Z8YA 1R7RA 1UF9A 1T6NA 1QZXA 4MRRA 4TMXA 1NMXA 2NO1A 1ONBA 1TU3A 3EZ2A 3L0PA 4M1YA 3RSOA 1ZVQA 1VPLA 3W9YA 4K8OA 1V43A 1VCOA 5EE5B 3CLVA 4ZCIA 4CEIA 3LQQA 4JLDA 2ZRGA 1IJFA 2C2HA 2D3WA 1GSIA 1L4YA 2RGXA 5HE9A 5HR5A 1MABA 3FDIA 2BDTA 1QG4A 1SKYE 5JWOA 5KPDA 3KB2A 1W36D 3SFVA 5EP4A 3FMFA 2GJSA 1NIPA 4GSYA 1SHZA 4M4SA 4M1OA 5K8LA 1G8HA 3U6BA 2BEJA 3GLHA 4NP6A 4Q7LA 1T8UA 3OAAA 3WRXC 5HCIA 4MYHA 2C8VA 4AWXA 1N6NA 1UKZA 4KSCA 3THXB 4M1WA 4M53A 4PZLA 2QI9C 2ZETA 5F9HA 2AKAB 4NONA 2XOKA 1GKUB 1FTNA 4GMDA 2VL7A 4NBSA 2PCJA 1OIVA 2F3TA 1Z6TA 3PCRB 3EARA 1ZJ6A 3KQKA 3AQ4A 1XPOA 4HATA 3A58B 3H0KA 4PFSA 2AX4A 3PIRA 4GP6A 1ZCAA 1JEEA 1VIAA 1W1WA 3B85A 2E87A 2FEMA 4LZZA 4B76A 1IXZA 1M7GA 4DLVA 1U8YA 2EFGA 3V4FA 1IHUA 3W8NA 1KO1A 1GL7A 3EX7C 5CYOA 4IDHA 4QC2A 3H1TA 1IN8A 4PHHA 1TQ4A 4PHFA 4DDWA 3U3MA 2A2ZA 3QE0A 3ZIAA 1OXSC 2AFHE 1T91A 4XTCS 3GLIB 2ZEJA 2ZSFA 1Q3TA 5CDFA 2TMKA 4G1UC 1E2DA 1HY3A 1VHTA 3LDAA 4BFTA 4HDQB 4ITRC 3SE0A 5EE0A 2WWWA 1XRJA 1FMJA 1G8FA 2Q9BA 3QXXA 1UKEA 4HAWA 1NMZA 3MRSA 1ESMA 3AF1A 3O8RA 3A37A 4A2WA 1RFLA 2FFHA 4Q9IA 5KNDA 1S9HA 2AD1A 4CEIB 2Z43A 1W4BA 2JJ1A 4O25A 1II0A 4NDZA 4BEJA 3TGPA 1W36C 1D8TA 1MABB 1ZD8A 2GK7A 4MITA 4D26A 4Y0AA 1D9XA 1J90A 4RFSA 3DEFA 4Q03A 2BCGY 4YONB 4HAVA 4MDFA 2KI5A 1MV5A 3GLHB 2CCKA 2OBLA 3KB1A 4GOKA 4KV9A 1T5LA 4P33A 2FGJA 4HUTA 1X8LA 1GKYA 4ACBA 3KUCA 3BBPA 2IHYA 2BC9A 3PITA 2WMOB 3QKSA 4RD2A 4RFVA 1E79A 4EFLA 2GF0A 2G6BA 2CVHA 2IW3A 5IRCD 4B2LA 4MGIR 4TMTA 4GDFA 4QG7A 4PSAA 4B32A 2GDJA 2WKPA 4WA7A 3TNFA 3SYKA 3VR6A 2PMDA 4A0GA 1TNDA 1EFTA 4LHWA 4A0HA 2JLSA 2QGZA 4MYUA 4RCZA 4BRWA 4XVRA 2F1IA 2ZI6A 1A4RA 3MGCA 1E2MA 4E09A 3VAAA 4B2IA 1W48A 1XTSA 3L0SA 3FMIA 5KSZA 5IK2A 5KNBA 4CIDA 4QBIA 3ADCA 1EFRA 4ESVA 1UEJA 4LHYA 1VMAA 1CBUA 2QTHA 2IL1A 4ZDIA 4XSHA 4US0R 1P62B 4QJ4A 4DCSA 4TMVA 1Z2AA 5EP2A 2VHTA 3CKLA 4A36A 2GZHA 4KLZA 5LDDC 1N6HA 1OH7A 5EXSA 1NJFA 2QEQA 1TUIA 4TLDA 2LCFA 4NKRA 3BIFA 3RRYA 3CNLA 4FINA 821PA 5J4HA 3ZVNA 3CPHA 3GLIE 2QL6A 1KSGA 1A2BA 2GF9A 3NXSA 1UFQA 1TEVA 2IXGA 2C78A 1AGRA 2V55B 1OFHA 2V7QD 1E0KA 3AVWA 3ASYA 1GNRA 1T4GA 2W2XA 3ZQ6A 4LC0A 1N5IA 2JAQA 1P75A 4IHQA 3UK6A 3IKJA 1E9EA 5FTNA 3KKQA 2MMGA 2ZPTX 1II9A 4G5SA 5TB5A 1ETUA 3IUYA 1S1MA 4D81A 4TT3A 1SVOA 1JQLB 2BMDA 4NCKA 3VNVA 2QU8A 2C9YA 3K0SA 3V4RA 2HXYA 2A30A 4Q7MB 4TLEA 5EP3A 2QRZA 3EXAA 3UKDA 4Q47A 2NZJA 4RFSB 4OL0A 2B6HA 3NVAA 1KY2A 4AD8A 2J45A 3AEZA 1HT2E 4LJ7A 2OBNA 1MRSA 1R4AA 5FBQB 1R5BA 1E9CA 4WXPA 2W83A 3NWJA 3BH6A 2ZRCA 2YYZA 2W6JD 5JWHA 3GLHE 3QKSB 3T5DA 3AKEA 5FBRB 2B8WA 3CRRA 1KDPA 4JBYA 2ZRMA 2EWWA 4CVNA 1R0ZA 4LJ9A 3ND8A 4BFZA 4XWOA 2FJUA 4NYMR 3ND9A 3Q5DA 2QUZA 1JJVA 2CNWD 4CEHA 5TVKA 2OHFA 2P5TB 3ZGXA 3EZ9A 1YZQA 4DSTA 5AK0A 3AP1A 4B48A 4H1UA 3UWKA 1ZIOA 1P6XA 2O0JA 3DM5A 3QKTA 2O0HA 4MYCA 1OV4A 3SBEA 4C0BA 4IW3B 3K9GA 4B43A 1L8QA 2JLZA 4Q1AA 4LYJA 4YC7A 1EXMA 2IYUA 3RS0A 1IY2A 4BFXA 1W46A 3AVQA 5AJYA 2CVFA 5BWMA 2EFHB 3RLFA 4NYJR 5FL7D 4EKDA 4TZ6A 4UXJA 1DELA 3X1WA 3SHWA 4OI0A 1VCNA 1SXJD 4AG5A 3E5HA 2QNRA 4IJMA 1IJEA 1TF2A 1UM8A 2FSGA 3EW9A 4G01B 5CDFE 2HF8A 3A6PC 1VYUA 3QBVA 2F1RA 1YE8A 4OHVA 2ZRIA 1TMKA 2KJQA 2OLJA 2NMVA 1FP7A 4KSBA 3TSWA 1EWQA 1BMFD 3CWZA 4CF7A 1S8FA 1RRCA 4G5RA 3VU9A 4HUQA 2FPLA 1ZW6A 4DLRA 3QIAA 2G0NA 2V3CC 5B58C 1KSHA 1KI2A 2ZVQX 4A2QA 1P61B 3DOEA 1VIYA 3SJCA 1VG9B 2IT1A 2V6IA 4MYTA 5CM8B 2V54A 3VR4A 4WZ6A 2ZSEA 2CE7A 4NCJA 4OJQA 3H86A 4UXIA 4CT4B 5C2JB 2CCJA 1OHHD 3X2SA 3ZZTA 4EFNA 4F4CA 1FX0B 3QI2A 4PPGA 1EX6A 1L7VC 2PL3A 3OIYA 2R2AA 1E2LA 3OEED 4A15A 4IVRA 1X6VA 3K1JA 4XWAA 2RH5A 4CDGA 1J2JA 2BMFA 2HT1A 4B6EA 2FWRA 1WP9A 5JEDA 4CEHB 2IYZA 4IEIA 1UPTA 2OCBA 4Q48A 5LBIA 5LD2B 2Q9AA 4Q7JB 2JASA 5G3YA 3T61A 2FV8A 2ZYVX 4HLQB 1Z0IA 4Q4JA 4YLGA 4EPTA 1XEFA 5TMPA 4IOLA 1R10A 2ZJ2A 4HLDA 1VG0B 1CEEA 2A5JA 4LBZA 5KUTA 2GJ9A 2R6FA 3QXHA 3R7WA 1II8A 4AI6A 2FG5A 2VQSA 2ZI3A 4MDEA 3F8TA 2ZI9A 3ZVRA 2WJHA 3FGNA 2IS1A 2GJ8A 4RD0A 1G8PA 2O8BA 1DEKA 4UXHA 4DLWA 3QENA 1NL3A 1NI3A 1SXJC 5LPNA 5J4VA 3RC8A 2IS6A 4B34A 3C14C 3Q9LA 1WA5A 4XSGA 2XSZA 2NTYC 2A3RA 3R8CA 4XIGS 1QRAA 1SVKA 3PEWA 3SQWA 2QZ4A 1M8PA 4ZDKA 2I4IA 1ZD9A 2ZYUX 1F3OA 5CYPA 3UG6A 5KYKA 4DDUA 5J47A 1P2TA 1XX6A 2IYVA 3EWSA 1BKDR 4TQ9A 4UJ5A 4BLQA 5C18A 5JWRA 2J87A 2QMUA 2YWFA 1E32A 1OKKD 5F2EA 1AGPA 3VU9B 1F2TA 2YKGA 3MCAA 4G3XA 2PCLA 1U8ZA 4V0MA 4OKSA 1P9WA 4G5GA 2E9SA 3HU1A 4G5OA 4F91B 1RPZA 5FUXA 3BGWA 4TMKA 1J8MF 4DJTA 3G82C 2WTUA 3GJ5A 2PMKA 2XGJA 1P3JA 1E9AA 1VKJA 3FKQA 1XEXA 1AIPA 1OYYA 1R2QA 621PA 4KITB 4ON9A 1Z8FA 3AVUA 4IXMA 4WOPA 4HAUA 2B21A 2VEDA 1YR8A 2V7QA 1Z5ZA 2Y8EA 4P3YA 4WIAA 1KI6A 2QP9X 2VBCA 1GVNB 4PPFA 1IY0A 2ZROA 2ZIAA 1WDTA 3L2OB 4Z54A 2AD5A 1QHGA 5JS7A 1OYWA 1US8A 3TRFA 3KJIA 3U7GA 1OXXK 3C7KA 1UBFA 3RS3A 3K9HA 4OHWA 5TARA 2DPXA 2HUPA 4Q4JB 1GITA 2NG1A 4DCNA 2QY9A 3M1IA 3IHLA 3TW8B 4LHVA 5GJBA 2FH5B 3U3RA 2BMJA 2BBTA 2WBLC 2WICA 4PO1A 2IX3A 1HE8B 1S1CA 2O8DA 3U5ZB 2CK3A 4L5BA 5TXGA 3IBYA 3MJHA 2J7PA 2IF2A 4MGKR 4AG6A 4E07A 1BH2A 2NO9A 3U60B 2W6JA 2O8BB 3HWSA 3CRQA 4BLOA 1Q0UA 2WWFA 1SGWA 1E9RA 4IFBA 5DYGA 4DCVA 1I4DD 3JVVA 4URZR 1G7RA 4OI2A 4UJ3A 3LBNA 4LHZA 5AR1A 5JBQA 3CM0A 1XD8A 4GOJA 2F9MA 3B5JA 1DADA 2MSCB 2QENA 2VP0A 4LUCA 4WXRA 2GXUA 3I5YA 1DOAA 1CP2A 2J0SA 2QGNA 2H92A 5K8TA 1OF1A 3PG5A 1KK2A 1BYIA 1DO2A 1ZNYA 3RABA 2WJIA 4MRSA 1MT0A 2IUSA 1KO5A 4JYCA 2ZS9A 4ACAA 2FSIA 4POAA 1F2TB 1P2SA 2CXXA 1N5LA 1XTKA 2KB0A 2PZFA 2ZRAA 4I1UA 2ZI7A 3K9NA 2YV5A 1IM2A 2GKSA 2QP4A 3C16C 4PZZA 2P2LA 4OK6A 1OH5A 3B1XA 4EPXA 3UMSA 2YWHA 3MWJA 4L9WA 1E98A 2QAGC 1PJRA 3THOA 1NJGA 2OEPA 4KHZA 2ZR7A 4Q66C 3EPJA 4M0LA 1U8AA 1ZNWA 1XEXB 3KFXA 2GJAA 3O8CA 3IO3A 4LGMA 2FZLA 2ZJOA 3A4MA 1SXJA 5EE9A 1J99A 1YZNA 4W7SA 4D80A 2H57A 3CO5A 2ZE5A 1NNEA 2AKYA 2B7BA 2WV9A 721PA 3PEYA 3NHAA 1RJ9A 3QPVA 4LV6A 3EA5A 4D82A 4XJXA 2GVZC 3IILA 3KFVA 3B82A 3BXZA 3FB4A 1US8B 5FI0B 3WP1B 3IEVA 1BMFA 4AKIA 4PC2A 4DHEA 3OE7D 5EE1A 3RVBA 3SC3A 1E9SA 1Z83A 5AUNB 4LYHA 1T0JB 2HLDD 1C9KA 3V00A 4B75A 4LSGA 1JEDA 1Z07A 4I81A 3PXGA 1F2UA 1LV7A 4D0GA 4HB0A 4PAOA 1JI0A 1DG1G 2DBYA 2FMXA 1NLYA 3MMPA 4RZ2A 4XVQA 2FDCA 3QVVA 2JATA 2REBA 3MUFA 3B7GA 1WBDA 1JR3D 1OHHA 4HSEA 5P21A 4F93B 2O8DB 4DWJA 1KDOA 3MG9A 2FX3A 2ZR9A 4JLPA 4TYWA 1P7CA 3DL0A 3GLGA 1OXUA 3OEEA 3CUEF 4OQNA 1N0UA 4BFVA 2IBMA 1VG8A 2G77B 4KYUA 5L3VA 3WNCA 3QUSA 4PPNA 4A4DA 3AUYA 1GZSA 1E2GA 1OXVA 4A0FA 1U90A 3DM9B 4OK3A 4FMDB 4TL8A 2YHSA 4UKDA 2FEOA 3UG7A 3BFKA 1ODFA 4V0KA 1R5NA 1NLZA 3IDQA 4HAYA 1KI8A 5EZ5A 5KTYA 2HJVA 3U7FB 1GILA 2H8KA 4V03A 5BN5A 3NDBB 3AVVA 3U3OA 4QGHA 2IXEA 3MFYA 2D4HA 2ZAMA 3AF2A 5CLQA 3TSZA 1OXTA 4PPQA 1E4YA 2ERYA 3KQHA 4PQYA 1UKVY 4PAQA 4BUJA 1XEWY 5G41A 2GK6A 2JLQA 2WJJA 3A1TA 4JT4A 2FFBA 121PA 1MO6A 4V0ME 2QE7D 4C7OA 2XEXA 3CF6R 2PLFA 1KGDA 4ZDWA 4FMDF 4AKGA 3ZD7A 1SXJB 2R6CA 2ZUDA 2CMKA 5JRZA 5FUWA 3C5CA 3O8DA 4BFYA 5D3QA 1A1VA 2ASEA 1RJ9B 4IFEA 4OQMA 3RRZA 3EIEA 5FBLB 2CLCX 3BB3A 2ANBA 5SZIA 3TQFA 1NVUQ 4NYIQ 1W0KD 4MRPA 2AL7A 4LV8B 4RCYA 4Z1MA 4O2RA 4OHZA 1F2UB 2WJGA 3BERA 5CB8A 2OBMA 2WIBA 3QEOA 3OIVA 5CIWA 1DS6A 3NKVA 4L8GA 4M22A 3THWA 1XJ0A 2ZU0C 3KXIA 1R0XA 2AK3A 1UKYA 2L0XA 2IC5A 1ZU4A 2NGRA 3BC1A 4OYHA 1WBBA 3AVTA 2WMNB 2O8FB 4EPRA 1MO4A 1P2VA 4LX0A 3GLGB 4AYXA 1EGAA 2A5GA 1M7BA 3WHKA 1N6KA 2GESA 5L3QA 3FHTA 1I4TD 1IY1A
chains in the Genus database with same CATH superfamily
2C9CA 2PX3A 4LCEA 4OXKA 3USCS 4CM4A 5IKEA 1XWFA 2ZSHA 4PNPA 3ZE1B 2H4ZA 4HEA1 1GP2A 1WLYA 2A1TS 1QQBA 1PSZA 3LNCA 3H2YA 4QOGA 3OZDA 5BV0A 3DCIA 1BJKA 4CMEA 4MZDA 1J8QA 4UTRA 1EVQA 5L6LB 3THRA 4KODA 3U56A 2V8OA 3L0BA 3QMWA 1S6YA 5AW6A 2PT5A 3FYCA 3AR8A 1WXQA 2AJBA 2IPXA 2ZI4A 1H5UA 1IQUA 2QSYA 4UDNA 1Y34E 2G6TA 3O8NA 4AJ9A 4F2HA 1TF5A 3R7SA 3VNUA 1GKIA 1R8SA 3D8SA 3DO6A 3R0XA 2EFEB 4PC7A 1EM8B 1X7XA 1N5MA 2W2QA 3R6WA 3RAPR 4V0NA 2AUMA 4HDMA 3EUAA 4PCAA 4M55A 1FEZA 2RBGA 4Q4HA 1QIMA 3D31A 4CUKA 3EXEA 4EYQA 3SHVA 1N8KA 3VDMA 2UUCB 2XJ9A 3A3PA 3C6XA 3K96A 1LRJA 1O5OA 2RJNA 4BMZA 3OI7A 4M36A 4ZZ3A 4UNRA 1RYZA 4R1UA 4C7OB 3F90A 1FZQA 4PONA 2IUTA 3L7IA 4B3HA 4ZN6A 1E99A 1SK9A 4OQZA 2YXNA 2BCEA 5JCPA 4G2TA 1D4FA 4AY6A 3AFOA 1RWVA 2V59A 4TRNA 3CC21 4E12A 1NN3A 1GGNA 3COVA 4BX0A 2NYUA 1UBRS 1U8FO 3VGJA 3WBJA 4FBGA 4NWIA 1PNQA 1K2WA 5DTRA 4GVXA 4H6XA 1DIGA 3IPYA 4NBTA 4O3FA 4Y2TA 5ADHA 1B41A 1G55A 3OJWA 5FP0A 5TSDA 4Y7NI 1EPUA 1Y3BE 2JH3A 3S4YA 3TR0A 4P3KA 1ACJA 2D74A 2GAFA 5EPOA 3EDRA 5G1NA 1T2CA 5KJ6A 4NV1A 3K70C 2VYVD 4PIVA 1TM2A 3FD8A 3Q0TA 4YAUA 1SELA 3CME1 4U39A 3LX8A 4K6KA 1MAWA 1P6UA 1I6KA 2FY8A 5DBHX 1E2QA 1R9NA 1F4PA 4G8JA 3EQ9A 1ULZA 4DA7A 3OPQA 3FYUA 4ZAZA 4GMXA 1G17A 1T2VA 3D3JA 2MMCA 1ZSNA 2I4MA 3FSEA 1U2SA 4LMRA 3INYA 3TL3A 4IP0A 2IZ4A 3NS7A 5KEIA 1YI8A 3ZK8A 2AE2A 1HQYE 2X19A 2W90A 4FXPA 1O97D 1G2QA 3R0ZA 3LT1A 1FCJA 2DSNA 4TV9F 3TH5A 3T9BA 1A8HA 4FFOA 4LZAA 3ZQUA 3PL1A 1A69A 4GD3Q 1T29A 3OESA 2XUKA 4W6ZA 1N2CE 1QDEA 3WQHA 4YPFA 3DMHA 4E46A 2VHWA 1SBIA 2QG4A 3P94A 4LDQA 1QVFZ 4OLAA 1I7PA 3K05A 5AK3A 3J81k 4RWZA 1U9JA 4UBKA 2YJZA 2AMLA 3RWOA 2J3LA 4QRHA 4E11A 4ZU1X 3HZHA 4YRSA 1IATA 3TCKA 2HMAA 2W4MA 3DV0A 4PZUA 2PGIA 3HKBA 1UC9A 2VTKA 4FS8A 4KAAA 3O4RA 1PV2A 1UWCA 1SQSA 4Y6LA 2PDAA 1HE4A 3PJFA 3DVRX 1KIAA 1XYYA 1IDN1 5CT8A 5SY9A 3TOVA 4C06A 4EDHA 2Z5LA 3GLUA 4JUAA 4AB1A 1E1LA 2A0UA 2ZWIA 3ONWA 3VJKA 2DLDA 4TUYB 4DMCA 1TVMA 5LR6A 5LWHA 2AG5A 1QFJA 3MWFA 4M0CA 4Q39A 4Y1RB 4M9CA 3EW7A 3FOZA 2C7VA 3IOEA 4PSKA 3AWIA 2HHLA 2X3FA 5FPHA 4E03A 1KDVA 2X3UA 3JQFA 3DC7A 1RP1A 1AO0A 1WNTA 2OHJA 5LU8A 2MT9A 2AOTA 3PC8C 4LXXA 4YUXA 5IM4F 1CQZA 2ORED 4Z4QA 1G8YA 1PLJA 4MB2A 3CGGA 5AJHA 1R9TI 3M2TA 3RIYA 5KYYA 4KI0A 1NF8A 5FKJA 1U0HC 3MUOA 4QXQA 2VSXA 4ESHA 2FR1A 4LOIA 3ERCA 4A1OA 1R6AA 3D7MA 3H42B 4ZYTA 3Q9NA 5JE8A 4ND2A 4FLEA 4MLDA 1NJI1 3QJYA 1VQK1 1YCFA 4OAPA 2R4QA 2X8BA 3ITNA 3Q85A 3L0IB 3K30A 3TCXB 4K6CA 2NO7A 3C1OA 3K0FA 1SMKA 4B6SA 3MJCA 3G3EA 2CXRA 3OQVA 3SBOA 1QJ4A 1M10A 1XQYA 3BICA 3H6HA 3O83A 4YMTA 4ZYLA 1PVOA 4PG8A 4F5EA 2NACA 3PRHA 4IY1A 4QFCA 2AFIA 2Y05A 3HPRA 1O57A 4FGJA 4BXXI 1YUBA 1NLFA 2HTEA 1CKEA 4LY0A 1P0PA 2FI1A 4QOHA 5B6PA 4QBKA 1AMUA 2CLSA 4D8WA 4FJ1A 3R7NA 2QQGA 2VJOA 3HFJA 1JJFA 4NBLA 3W79A 1WKBA 2NXEA 3IMKA 3CF4G 1EE1A 3DMRA 4XUEA 1VGVA 2J0QA 2QE7A 3IBGA 2WFMA 5WRFA 3PGXA 3Q2IA 4DNOA 5INTA 1GPWB 2XYRA 3A1SA 4JLBA 1Z0SA 4IDGA 4TYWA 3B1WA 3I04M 3LXRA 5HTKA 3CXCY 4B3TB 1GCIA 3TRKA 3AVPA 3NC4A 1QIJA 4N8SA 1V3TA 5AMXA 1SQGA 2BTOA 4HZUA 4PIPA 3FIUA 4C4OA 1ZBQA 4C21A 5EEHA 1ZYUA 4UM7A 1QZ3A 3PI7A 1XU4A 5C4GB 1BD3A 1ESDA 2G63A 4K9SA 1SHTX 2ZJ7A 4H7DA 3WLTA 1XTBA 3PGLA 4S35A 4AROA 1ZY2A 3QBTA 1RACA 4IO0A 4MV3A 5A6SA 1QE3A 2NZ2A 1E3DA 2QD5A 3H5OA 1DJQA 5D51S 1W0KA 3PEEA 3BRWD 1IHDA 1UINA 1U6JA 2IELA 3F6BX 1ZI9A 3LFTA 5E7JA 3T12A 1Q0QA 1IZ7A 1D6JA 2GKOA 4ZCQA 4BZXA 4QQRA 1NVKA 4FCVA 2Z4RA 2X9GA 1NUPA 4LZNA 4WESB 4ENVA 1MHTA 1Y1SA 2I34A 3SCZA 1CE8A 4YO7A 2IEYA 3KX2A 3VHXA 2C95A 2Q28A 1Z2DA 4LXUA 4ZV9A 3PYLA 1C9EA 1R6UA 2BW0A 3AH8A 3E53A 4N76A 5M34A 2CSUA 3OUUA 3QHPA 5SZHB 1K8ZB 4CR7A 3PKIA 2P5YA 2WM8A 1BCRB 2ZPUA 4NHEA 3V4ZA 3F3PC 5EIWA 5CW1A 1CR4A 2JFQA 4JROA 1PR5A 5DULA 3U2QA 4F5DA 5F35A 4DR6B 1G2OA 3KVRA 3JD4A 4RSMA 3Q8LA 1KJNA 4ALMA 2J0UA 3MAAC 3N2IA 2QF7A 1Q0SA 1RXCA 1ZG3A 1WKVA 4RKQA 4ZT4A 3E7WA 4EF4A 2H1LA 1UXHA 1ZHHA 2H3EA 1CWUA 2UVQA 3QF4A 4IZOA 4XYMA 3KTFA 5EIOA 3LCCA 1UKCA 2IW1A 3S2YA 2YZKA 4AXXA 1EWRA 1VRCA 2KBFA 3AUUA 3VYRB 1DQRA 2VHJA 3LF2A 4M87A 1I7NA 4DZTA 5GINE 4HXGA 4ADSG 2PXHA 4H1WA 1YE5A 4UATA 4F21A 1VQ61 4H4EA 1AT1A 2HPAA 1OREA 3BD7A 1WXGA 2O54A 3SM9A 4ZT2A 3PRYA 1N1DA 4ZAXA 3HXMA 4OQXA 3KQLA 4ZO8A 4RUKA 3THSA 1A97A 2EV9A 2XZTA 2YJ6A 1RNLA 3COZA 1SBHA 2NTNA 3IVGA 1EFHA 4C2TA 5A03A 2Q3EA 1O4WA 2GCOB 2VF8A 4ZKDA 4DRYA 2RAFA 5CYGA 5AOVA 5HGJA 4ZQGA 2QBYB 1OA1A 2WB1A 1Q1EA 3MTIA 4CRWB 3CPEA 5AOCA 3JQBA 4KUEA 3ER8A 2CJWB 5A4MS 1PU2A 2FXVA 2ACWA 2WSMA 2PNFA 3ND5A 4E1AA 1ZUNA 5ADUS 3GGGA 3IIKA 4ARZB 2Z9CA 4INZA 4UM9B 1WD5A 3V9PA 4RA9B 1A2QA 5AHXA 4ZEWA 1BHJA 4TKMA 3KPVA 4PX5A 3S1NI 2VYQA 2YTZA 3NWPA 3Q9UA 5EQFA 2ZGVA 5KKNB 1NATA 3L84A 4PS0A 1PP4A 4OJNA 4BFWA 4K6MA 3W5AA 4NR0A 2OESA 4JJ7A 2BGGA 3QXJA 3AI3A 2G4VA 5GZ6A 1CUVA 1YHZA 4RM3A 4Y2RA 3RJTA 3TL6A 3EY9A 3KKNA 4US2R 3PIIA 4M98A 3E05A 4JEHA 4YIHA 1JG6A 2JDID 3ZW9A 3WA6A 1FFHA 2UZ3A 1TYZA 3STTA 4BP8A 4LKOA 2VTEA 5LB4A 2PA0A 1J2RA 3HR8A 1JR3E 4KU4A 4I4CA 4TM8A 2E48A 1VZ3A 1X8JA 2XBLA 4CMEC 4MQMA 3PQ7A 2R8PA 4U7TB 3KLOA 3RC2A 4YCLA 1QVWA 3CX6A 2BGLA 4G4SO 1QG0A 5DYIA 1MIOA 5C53B 3PXBA 4KIJA 1VQ7Z 1M902 3ZCXA 1XXHE 4BJ3A 4KPEC 2V8IA 2CJPA 4LVOA 2HB6A 4WX2B 3W2IA 2SBTA 3JQEA 5FO1A 2P0AA 3RS9A 1W2HA 1QYDA 4FJ0A 4YCNA 5ILQA 1VCHA 1ZEMA 2B98A 2QZPA 4FGSA 4FOLA 4LJ8A 4AZSA 3T41A 1NRJB 3ZQJA 2VAPA 4WLUA 1XDWA 4QYIB 1KMHA 3Q87A 3QOXA 4DQDA 4ZGBA 1BXGA 1R4MA 3UBMA 5BV2P 2PJRA 1ULHA 4ISBA 4PG6A 4Q18A 4IOJA 3ZWNA 1LRLA 4V0LA 1IE3A 4AG3A 3LC0A 1VLLA 3E0QA 5LZ9A 1B76A 1KZ7B 2RI0A 3KXPA 3C2QA 2EP8A 1C3LA 2VDOB 1RWPA 3AY6A 1TLLA 4P08A 3LO5A 4BLSA 2FUEA 4YRPA 1NPYA 3RK0A 1C4KA 3WO0A 1NVFA 2QLBA 1A98A 4D42A 4ZYXA 5DNYB 3CE9A 3C3WA 5ALJA 2OFWA 1KKUA 1YS7A 4ZYUA 4BP9A 4KSYA 3K9CA 3D4OA 4GL4A 4UHEA 4HDSA 1KD12 3BGDA 1JXOA 4I4LA 4E0BA 2C54A 5B7PA 4XB2A 4CLRA 5KQSA 4CFYA 1BHSA 1JP7A 5E7MA 5AXBA 5TF4A 4BU1A 1XZQA 4YRLA 5DNDA 5ED0A 4NBHA 3H11A 4CODB 3IQIX 2RARA 2PG3A 4MK4A 3R5SA 4PZPA 5KSOA 2GU2A 5CB4A 1G98A 1VPVA 2FW9A 1O6BA 2QR3A 2Y27A 1XLVA 1R4NA 3JQGA 2M6RA 3DL4A 3ID6C 3B9BA 4DLXA 3F2IA 3SPXA 1KO8A 3D0RA 4KFUA 4REQB 4X7PA 3VZBA 4PFQA 3G8YA 1DTSA 1K9M1 3QOYA 4RXTA 2QORA 3VNAA 5CNIA 2XCSB 1XD2B 2BM0A 4IJ5A 3CVWA 3I83A 2FDRA 1RO2A 4BKQA 4P7BA 4MRIA 1FC0A 3UWMA 4COOA 2R3SA 5JEEA 4X0EA 3CX8A 3D3WA 5K1ZA 4F3TA 1EU1A 1ZXLA 2GN1A 1M2OA 5F1YA 5J4KA 4M7RA 1FFSA 3DKKA 3FNQA 3TG2A 3FPFA 2FPOA 1E2BA 1JA0A 1WUTA 2KSQA 4O4JF 1NXOA 4UUBA 3K15A 2E1PA 3WK7A 3IALA 2X1VA 4JQSA 1P2GA 4NU0A 4INOA 4Q01A 1O6CA 1CVRA 2PXAA 4WECA 3H9UA 4YRTA 1N4AA 1WABA 2QIOA 3QTTA 2C99A 4CMHA 2PMBA 2PZBA 2H1WA 1XZHA 2FE1A 2WF5A 3CC7Z 3NR2A 4XB6B 5LP6F 2A5FA 4DIOA 2MR6A 3AXSA 1ONOA 3KKEA 2D59A 4LI0A 5E9AA 5DNEA 3W90A 1WZIA 4BCCA 4JXZA 3MJFA 5CA1A 4B3FX 1Z03A 4RK0A 3KALA 3QOFA 3PQCA 5DTQA 3WIUA 5LIPA 5FHQA 1O95D 1ZUHA 1PLLA 3VMFA 1IZYA 3CZRA 3UQYS 4DA8A 4RV9A 1C1XB 3AX6A 5JS2A 2TS1A 4IDQA 4JI2B 2QM8A 2OCYC 2ONYA 2F1KA 2CLLB 5BSUA 3VKFA 2BF4A 3V7NA 4C6SA 2YBDA 4EB6A 2DLNA 1JAZA 1K1EA 1Z5GA 4G0XA 4GBMA 1I36A 4P2BA 2XCIA 3G5MA 5CYFA 3VO8A 1TAHA 4OQDA 3UV3A 4C4YA 3I2KA 5FOTA 4EI7A 5JI3E 2HEIA 3B7WA 5CK4A 1N0VC 2G3YA 1DPGA 4G63A 1KJZA 2PZ8A 3FMVA 1D1SA 2QQEA 4MS3A 3R7WB 1II8B 1HOXA 3UJ3X 1NP6A 1R74A 2AJLI 2MYNA 4I55B 5EHIA 5BYBA 4Y3UA 3W8RA 1T3SA 1R4ZA 2POQX 4P3PA 4H7PA 4L5CA 4IIJA 2ATEA 4OB7A 2M48A 1FYDA 4NENA 3SLGA 4CV1A 1O08A 3IUSA 3LY7A 1RT9A 2H0QA 5EIBD 1EFUA 1G19A 1ZNZA 1Y63A 5ITZA 1QVAA 3LV8A 3Q12A 2IYRA 4BVGA 4C6RA 1JUDA 1M1YE 2VQ6A 4I6GA 2JS4A 4URHA 4EF6A 3KKOA 1WMDA 3X1DA 5CTJA 1BA3A 2F8TA 4MUMA 1NQVA 1A7UA 1OLOA 3NWEA 3BFPA 3JQ9C 3D43A 1Y37A 1YIJ1 1RXEA 1YB2A 3OCXA 4TVOA 3RS5A 5M5BA 2H4JA 3GJSA 4B3IA 4AM8A 3E3LA 1E63A 5JQGB 4YP9A 3KSBC 4QYTA 1XQ9A 2QTWB 1HLPA 4XX1A 5CX1B 3CC8A 2AOWA 3H5RA 3HBMA 6ABPA 1E6MA 3OZVA 3FI0A 1OROA 3DCYA 4MVJP 4Q1BA 1LPSA 4DQKA 1A77A 4IF6A 4DMHA 3RUDA 4HTAA 5IVIA 4HGQA 3KR0A 5DXJA 2JLXA 2E7ZA 1YVDA 4MDYA 3P2OA 1BC5A 1SQ6A 4FGKA 4RF2A 1YR3A 2H2WA 3T1TA 5FLMI 2PL9A 5LYJF 4HQRA 2JIMA 1CJSA 1GQ2A 2G04A 2PK7A 3TXAA 3UJCA 2WWRA 3T7CA 5C1DA 1ZGCA 5EKSA 1S3GA 2A57A 3R75A 4FMCB 1A04A 1ZK2A 1V8FA 4D43A 1AX9A 1NVVR 4OHRA 3PPIA 2RGGA 1T9CA 2JHGA 4I3FA 2C9DA 4JKYA 4P32A 4KMOA 3EYAA 3FZQA 3RHSA 1SU4A 5DBIA 3TZHA 9ABPA 1KIFA 2A0YA 421PA 3H84A 4C76A 2C4NA 3L8YA 4JWKA 4QATA 2MSEB 4EKIA 2HH9A 2VNHA 3PO3I 4RJ2A 2VJAA 1EFDN 1T8RA 2FW1A 4NDNE 1ZIPA 3HM2A 2QRDB 3DW3X 2ZTHA 3H8VA 3P27A 2WSYB 4JXJA 3BT7A 1D2NA 2BRUC 3DR5A 4J07A 4L8YA 1P5FA 3ZHRA 1VP9A 3OPVA 4LRXA 4RJIA 4OAQA 2R25B 1N9KA 3CURA 4YDRA 5DOVA 3ZOKA 2WA2A 4ZEMA 5KKCA 1E1KA 3HSYA 3REFA 4XRGA 5JSHA 3A6HA 1R6BX 2XD4A 2QMHA 5HQ3B 2IS2A 4NMMA 3D5QA 4KO3S 1U0GA 3JVDA 4MAFA 1I3QI 1P7ZA 3FCUB 2AXEA 1DG9A 3U4HA 2HA2A 1GUDA 2BEWB 2HKIA 3VQTA 3A1UA 3L93A 3PHLA 2FG6C 1GV0A 3SYLA 3ZS9A 4EHNA 4JVMA 4YAOA 2AH5A 1QV7A 4V1CI 3HLKA 5IT4A 2HREA 4F4UA 4HNRA 3MJ4A 3BA6A 3NATA 1GAEO 2WVAA 1P19A 5AI0A 1KHTA 3CU5A 4GC9A 2G07A 1IJBA 1B2LA 1KIMA 3M6XA 3TBHA 4EJSC 5L7TA 1X8KA 3LUPA 3HHEA 2PBZA 3DFUA 1J9EA 3VKVA 3W2HA 5KJCA 3GC6A 1CR0A 1U8TA 3HKDB 1OH8A 1ETHA 1PQYA 2P6UA 1WUJS 2HFKA 3H5NA 2CLFB 3Q72A 4HBZA 1H2HA 2R62A 4HYQA 4LRSB 5KPJA 3LVFO 3OTQA 4EVRA 3SR0A 1XQXA 4JJ8A 2C29D 2JGFA 1RXWA 3T5CA 3QKUA 1DUIA 1OI4A 3K9WA 1CJUC 1LV8A 2KBEA 5DLPA 3EVAA 3OUTA 2O5VA 1B23P 3HL0A 2IDKA 2FN4A 1O5IA 3G2NA 3MFQA 5IW8A 2H8GA 3H99A 1CIVA 3AEKB 5DBEX 2J3KA 2WU0A 2YZ2A 3GRUA 2P7HA 3H1EA 2BGRA 3OCVA 3NHUA 3M6IA 2P62A 4R1PA 5FUVA 2VYFA 3WLIA 1HFWA 5FADA 3JZMA 3B8HA 2OGSA 3EZ6A 4YUYA 3N8HA 2OG1A 1KHHA 1C50A 1RBZA 3LOUA 4PTLA 4D25A 1KGSA 1XYVA 3F74A 2PD4A 2TECE 4LF4B 3V1NA 2NAFA 3DMTA 3ICPA 2EFDB 3CMA1 5DGHA 4R54A 1IUOA 4Y2UA 3ELDA 4Z4HA 1L7DA 1UWVA 1DO8A 3I73A 5HJ5A 4MV4A 2VSOA 3TMKA 3PQ5A 5AK5A 1JHOA 4C89A 1G9TA 1E6UA 2R6DA 2D0PB 5JISA 2A4MA 1Z2CA 2PKQP 5ALOA 5HG0A 3T0IA 5ICEA 1JWHC 1V16B 2BEKA 1F8YA 5I9LA 1Z47A 2H7YA 4ZT3A 4ZGWA 4OD0A 3QEAZ 1Y6QA 4C0AC 5A7FA 5C9ZA 2DBZA 5C52B 5HCUA 4U6NA 3WLLA 6NULA 1XZDA 2C98A 3QELB 1YB1A 4UU8A 5JAUA 1EBFA 3AT1A 4K05A 1QYIA 1T1JA 2AVNA 2VH2A 1M9NA 4LPKA 1SCKA 1GUAA 2JMOA 1UK6A 2HCRA 3EB9A 2PS9A 2JA6I 2FRVA 4LEIA 5FNZA 1OAKA 1F60A 2G0TA 1YGYA 1N0WA 2EZUA 2C3UA 3ISVA 1QLWA 4IUCS 3T1QA 1PIWA 2IYAA 3S2EA 2AJCA 3FCSB 4G5QA 4JSYA 4U2EA 2R6AA 3DT9A 3EGCA 3WGYA 4AJLA 3OLWA 4DF3A 5JXHA 1V8OA 2NM0A 2PWZA 4BWFB 5FNVF 2FOIA 3DDCA 3GUUA 3UB4A 4CYMA 2PUVA 3V4OA 3FKSA 1K5HA 3L4SO 3HC7A 3OP4A 3OZXA 2WIJA 3HY3A 3EIUA 4FFSA 2XXJA 4G6ZA 4MQFB 4PQGA 1FFYA 4YO8A 1CY0A 3DE5X 1A9PA 1YIAA 4HDAA 3CRNA 3VH3A 4K9LA 5TF0A 1ECLA 2G71A 1AZLA 4OBBA 4EL5A 2GJKA 1EVZA 3RTCA 4JVLA 4X6YA 3GNTA 1YVRA 5KU1A 4X7BA 1XN1A 2A6PA 1EFCA 3JYLA 1YJWZ 3T5PA 5BT9A 3G7UA 1ZIYA 5FYDA 2W0SA 4EW2A 1VIDA 2Q46A 3I4FA 1UBOS 1NNUA 2D0DA 3L7LA 3PHHA 4N39A 3U7EB 3R0JA 3WI7A 3PXEA 5IDQA 1VE6A 3ZXUB 1WCIA 2NSYA 4F3CA 2VWQA 1BXKA 1R6DA 1ZESA 3ELWA 1Y8CA 1K88A 3V4SA 3O92A 4AYWA 1XMQB 4HEJA 2W4QA 1TCVA 4PC1A 4RK5A 4EPVA 1SCJA 3HXQA 1ZH1A 1L7OA 2ZRDA 4Q7EA 4WCFB 2X2OA 5IAGA 3RO7A 4GKKB 3H9QA 1RW4A 2G83A 4DRXA 5IAKA 1G3RA 2IEAA 3UV6A 2ZIGA 3QVTA 3HS3A 1D5WA 2OCGA 3AG5A 4A1FA 4AVYA 3NAQA 3LY8A 4A0SA 1SHJA 4PLGA 4PLZA 1I2MA 2BIFA 1WIIA 4BY1I 1C5KA 3SJ7A 3D6TB 1SUEA 3HI6A 3U4IA 4IGAA 1Q1ZA 4V3BA 3JAMA 4DR2B 3FBWA 4KVAA 3N59A 4X54A 5ES4B 1N3YA 4Q00A 1AVTA 4AJ4A 4WL0A 1VQP1 1TMYA 2FWJA 2GZSA 2Q3DA 2AG8A 3HA2A 3IT3A 2C7PA 4C4SA 2C58A 4K8RB 1JXMA 2XLCA 1UM9B 4PBSA 3WKEA 4CQLB 1HRDA 1AV6A 3H04A 1CDOA 4ZAVA 5LUBA 4QASA 4N40A 4BFSA 3CIFA 9LDTA 3ZHTA 1I6MA 5BVGA 1I3CA 3STUA 2C97A 4QEDA 1H3NA 2ZSBA 4WY2A 4NF2A 4PZYA 3SY8A 4D0NA 2ZWOA 3ESAA 3TMAA 5JY1A 4JLJA 3ER9A 1PF7E 5A3JA 4JENA 1A9SA 4W1QA 5B12A 2G28A 4DLAA 5E1DA 1GUZA 3WDKA 3A1VA 2ZJ4A 3BMOA 4NCNA 4TTIA 3IV6A 4YXWD 4BNGA 2VZLA 1OBVA 3PHCA 4C20A 2TMYA 2VJKA 3II6X 4L07A 3M4JA 3KC2A 4GFDA 3VX4A 1ZHOA 3AUAA 3W5JA 2VC2B 1JQ5A 3E9RA 5FWXA 4DT1A 3I1FA 3V1TC 3FLMA 2OLKA 2HK6A 2Z4TA 4NJMB 4P8RA 5E2AA 1Z28A 4F2DA 3H87A 1YQXA 2HWWA 1P72A 1KL7A 4Q24A 3UPTA 4C3VA 2ZKIA 3BMCB 1BROA 4O2AF 2EKQA 3G0HA 1FNNA 4JQYA 1MB4A 2NW6A 3LK6A 1QCDA 4IILA 2APJA 3HN2A 1NW3A 1Y81A 4KMRA 2EJUA 1HR0B 2QTVB 4J0DA 4ZVQA 2ZIFA 2QTFA 1MDBA 4EYEA 4ZHSA 2TMGA 4MEAA 4UULA 3HYNA 1FMLA 3AW8A 1WMFA 2QRVB 3QY0A 3ZGVA 2EBFX 1EUCB 3HXLA 4J0GA 1PJ8A 4GEGA 3T4PA 2VDJA 4I5GA 1X7ZA 4DLYA 3VR1A 1KWKA 3ROKA 3H9CA 1A4UA 1SBCA 2XPCA 3T4EA 4YV0A 2GX6A 3EVBA 4HWGA 2ASVA 2ZATA 5EA2A 5FTJA 4AUNA 5J3JA 1GNTA 4WT7A 3FCAA 1OWNA 2ZU6A 4CCWA 1QHHA 3D3NA 5JHGB 4LOHA 1U0BB 5TQ2B 1QNFA 1XP8A 5ARDA 5EHXA 4PBRA 4Q1DA 5E95A 5IZCC 3HO6A 2H4XA 4L8VA 3HJHA 3RJ9A 1T1GA 2LEXA 2C4WA 2Y4NA 3PGMA 5B1DA 3PR1A 4OFXA 5JD4A 2IZ0A 4QU9A 3EZYA 2XUQA 4YROA 4N0EA 5LQKA 1S4MA 4LCBA 3VR2D 5LD2C 3O9ZA 1PUJA 1U0EA 5LDHA 2ZB4A 4FN5A 3U3KA 2ORIA 1AQYA 1EFPA 1Z4KA 2YS6A 4L74A 1VSTA 2COEA 1IFXA 2AOUB 3OQPA 3ZN2A 1E1QD 1C7RA 3VUFA 3UJ8A 3FVWA 4EHIA 5EWJA 1M8KA 3A4TA 5J5AA 2PH1A 2GQ0A 1JIKA 1KYWA 1JHYA 1P3Y1 4EW1A 1D04A 1JDNA 1X39A 2AR7A 5DEIA 1HH4A 3K9QO 2B61A 1GL9B 2NWQA 3P9RA 5K4GA 1PX0A 2H2FA 1AUVA 2GEDA 1GNQA 2GZAA 1QP8A 2B4QA 1VYHA 2HXSA 1X3LA 2YJTD 3G0GA 4K9KA 5AW3A 4PE5B 1Y82A 2BMWA 4Q21A 3TQIA 1QPZA 1JQ3A 3FOWA 4TX1A 4XIYA 3M5DA 4X95A 3EEOA 2I6QA 3V8VA 2BPOA 1M1K1 2ZIEA 3V3TA 4EWLA 2NNLD 1IBMB 3CPWZ 4H9GA 4X92A 1P5RA 1P8AA 4CPDA 1P33A 3N8NA 3AHDA 3AIMA 4PYKA 2QV0A 5TV2A 3I32A 2AEJA 2JFWA 2RGYA 5L7YA 2P91A 2VXBA 1I2BA 4IIXA 4RZUA 2XSZD 2XF2A 5C3MA 3T5AA 1X8XA 2CHVA 1B0ZA 5LMCA 2HRDA 4P82A 3KJHA 2WZCA 3CHYA 3OZWA 5DT9A 5HFNA 1G7CA 2AI1A 2G72A 1T4CA 1AJEA 1ZWLA 4EGSA 5IJWA 4MKFA 3BZBA 3H75A 2VJDA 2FEAA 2HY7A 2O0KA 3EC2A 3T06B 4C22A 3U3DA 1VYTA 2G1KA 1CU1A 4BX9A 1MU0A 3RTAA 1FFGA 4N5IX 3B5EA 3ROMA 3EVGA 4ZVMA 4ARBA 1XEWX 3JASA 3L41A 4R5HA 4XM2A 4QZVA 1GTL1 1MEOA 3HVIA 2DR3A 2IP1A 3O91A 2QMYA 3WQBA 1EA7A 1PK9A 3DQPA 3PUVA 3QA3E 3U4MA 3AZPA 3KWFA 4K9PA 3R7AA 3NTXA 4AO7A 3TECE 2BHRA 1ZCFA 2LDXA 2WHPA 5G0VA 3FTDA 3MPUA 1NHGA 1N7IA 2F1HA 1KH1A 5SZJA 1VQLZ 3P2KA 5DNWA 2XXAB 3P97A 2J5BA 3EEBA 5IHXA 1MTOA 1USPA 4KZPA 4GQBA 2O53A 1N1EA 4MJ3A 4CL2A 1YJBA 2OG2A 3R3SA 4UU1A 1MJ5A 2AUNA 1VQ81 3INGA 3LDFA 4CCAA 3RC1A 4JC4A 3CSSA 3IBSA 3WSVA 4P58A 4EARA 4JOCA 2DTXA 3KTDA 1JJ2Z 1JG4A 3W04A 1U4SA 3R8FA 5IP7I 2XWSA 1FNBA 1MH1A 1G20A 1XZNA 3HMKA 1E8DA 1KYIA 1BDJA 1K0FA 1QYVA 1MLDA 2O7RA 4GT1A 4JODA 2ZIXA 1T8PA 2EQBA 1Z7WA 2W2TA 3HCWA 1PGJA 1VPEA 3VR4H 4IH4A 2JI6A 4D44A 1YJ9Z 3PSAA 5LQNA 1VE5A 5LSAA 1EAYA 2GNAA 1X1BA 2E5WA 2RHCA 4JY7A 1N9GA 1WB4A 4MJLA 2JKZA 4C04A 4MA5A 3DWIA 2GBFA 1OLSB 3FVQA 2ZWMA 3NOVA 3VKWA 2JLUA 3KZCA 5CBPB 4I1PA 3DJFA 1CUJA 2PUJA 3HM9A 4YV7A 3TUJC 5F7XA 4UC0A 1QGOA 4ALLA 1GRRA 3RNLA 3BJEA 1ULSA 1XZAA 2QRLA 7REQA 1HNXB 3H1GA 2QJOA 4DR5B 1Z4PX 3G71Z 2HD4A 2JIPA 1PJAA 1TIPA 3FQMA 2QSUA 3GH3A 4IDOA 1Z12A 4NCHA 4P4GA 4RD1A 5CGZA 3OLXA 4WZAB 2NU6A 1CYEA 2GWRA 2Q9CA 2ZSUA 4FWBA 3RRFA 3VH4A 2FW8A 3DA8A 4MRMB 3FKII 1OSNA 2KW5A 6Q21A 2Q5FA 3FHLA 4MS1B 4YYEA 4Z2AA 1FFBA 3U48A 1K7CA 3KXKA 4J3JA 3OHPA 2O6HA 1BJRE 4H7JA 3GMTA 3SAJA 2H63A 2V1XA 1IY9A 1F2VA 3NCHA 4MXUA 2IPLA 3LTEA 4IXDA 2C04A 4ND6A 2H52A 2HDNB 3F98A 5IJAA 5B2FA 2HCJB 3HNOA 2FR0A 2GD1O 3TQOA 4BZPA 4NZYA 4I5DA 4BXOB 1P6QA 4CM8B 3CPJB 5ERXA 2B1IA 4UUMA 2R6MA 2DGDA 1T9GS 4AIIA 2HHAA 2I2XB 1W88B 2GPAA 3N2ZB 3J80A 4KMMA 2ES4A 2XRZA 3P2MA 2OCAA 3SEAA 1B43A 4B7UA 5AW7A 3L0OA 2XCRB 4B4VA 3D7RA 5DHFA 5AVVA 4XX2A 4MQ5A 3RV4A 2VK8A 1FUYB 2OILA 2R96A 3LE8A 4OQYA 4AJNA 4PC3A 3WMXA 4AP5A 3K70B 5A06A 3ZHXA 1M34B 1WW2A 1BN7A 1VHDA 5JDIA 4IFTA 3ZCSA 4PYIA 1ZB9A 3W2TA 2IUUA 2WSIA 5DM0A 2VTBB 3IPXA 4OQ4A 4W9NC 3E8MA 2ZVPX 4EG3A 4BVBA 4WKBA 1R0SA 1XL0A 3GFPA 3JALB 3AEYA 4XA8A 2FPIB 4EA7A 1QHFA 3BWDD 3F6SA 4YH1A 2HRBA 4L5YA 1H4TA 4GMFA 3SHFA 1GR1A 3MSXA 2ZZMA 5G0TA 3OZAA 3GR6A 2EKLA 5J43A 1D0IA 1CY1A 1EVYA 1RQ7A 2ATVA 1VC2A 1OUMA 3FMOB 2IGBA 3LWBA 1AZTA 8ATCA 3L8FA 1C0EA 1DGQA 2O2ZA 3H83A 2EFCB 4NB8A 1SEPA 1HFEL 2YV1A 2FPGB 3EIHA 3ETLA 3VNQA 4DYVA 5I9IA 2O8CB 1WHSA 4NARA 1A9TA 1Q7BA 3PWTA 2PVPA 3NH4A 2Y93A 4UMVA 5JNVA 5ISMA 4GLOA 2HK9A 3R4VA 5LXTF 4DMMA 1N8R1 3PJGA 2DU8A 4CKXA 2OXCA 3RFCA 1JDSA 3CCQZ 1F12A 2VP5A 2GA8A 3AW9A 4DLUA 4DRZA 4L78A 4AZ3B 4LQCA 5JLAA 3CLRD 1DIOB 2A35A 4ZAGA 4N82A 5F2KA 1IMOA 5JLJA 1TKRA 5C3UA 2I6FA 1J21A 2FSFA 3PICA 2RIRA 3KM0A 2CHEA 2VKTA 3V46A 2OKCA 2RCYA 4J91A 3I551 4B35A 1H8HA 1VJTA 2OCPA 3B48A 3MZ0A 3TJMA 3B5IA 2VNJA 1SY7A 2V6BA 3GP3A 1W73A 2N1MA 2Q0XA 4JIMA 5GVRA 4DBVO 5F3WB 2G80A 3KIHA 4MX8A 4XM1A 4MUJA 2REQA 4E2YA 4EX6A 3SXJA 1PJ2A 1G0OA 2XNSA 2OBFA 1T8SA 2B8JA 4C88A 3T3HA 1COWD 3U37A 2XT6A 1A72A 4V0OA 1QHSA 1PYOA 2P9ZA 3IT1A 1XCGB 1A2KC 1H2BA 3PNMA 1W4CA 2HU5A 3L0YA 2VCHA 4N3NA 3ZK9A 4F8EA 3QU9A 3CBQA 1KFKB 3MMXA 4JC0A 1WR8A 4FLFA 4K9OA 4L4SA 3TLBA 3KJEA 3VBEA 1IM8A 1Y3AA 3WNQA 3WFZA 5CVCA 4X5OA 3GUYA 2DECA 3AG6A 3PJRA 4AZWA 4BV8A 4GUDA 1SVUA 1K732 2QYTA 5DNCA 2P2GA 3PYMA 1HYEA 1MEJA 1MORA 5I3CA 3QU5A 4Q9NA 4NYIR 2OA0A 3T5MA 2P3OA 5C4MA 1H42A 2Q8QA 2O20A 5D1OB 3CMMA 3M9WA 3UHJA 2QKDA 1VE7A 2F90A 2LE0A 4AMZA 4HCJA 1FXWA 2GHQA 1NASA 4KH1A 3WGIA 1U3VA 1UJ2A 4BWVA 4OUDA 3MT9A 4TZKA 3D8HA 3T9CA 1CUXA 2I7DA 4WW0A 1RE1A 3WWCA 4U0JA 4JBLA 4X85A 1NI5A 3U7HB 5F7OA 2OAQ1 2QROA 4H1HA 4KP7A 4IPTA 3E1KA 1QDLB 4LJ6A 2DUMA 4E7OA 4DMRA 2BJHA 3U4QB 3L5KA 5JSZB 3TQTA 4WLNA 3I52A 1KOFA 5FOSA 2WAOA 1N2ZA 2R8RA 2MIIA 4QDJA 1GCOA 3NFYA 4BJHB 1QVRA 1LJ8A 1YKGA 5IABA 3QFRA 2VEOA 2CEAA 4PLVA 5GJWC 4JP5A 4OGWA 4LXYA 3VSAA 1RNIA 1AHHA 3I2HA 3RYIA 1X7HA 2RGDA 3RAJA 1NNLA 2BUAA 5AW1A 2JA1A 2V9PA 3IDAA 2QJTA 2GN6A 4CT5A 1MR3F 3T7AA 4Z1MD 1VQ41 1U2TA 3OOJA 2P9FA 4A3EI 1EEXB 3T34A 5I7VA 1RC1A 3EK2A 2D1YA 3EZXA 1ZJWA 3ZDDA 1MGPA 5E2BA 1ULTA 1SUSA 5CA0F 4H7EA 4CL0A 5LLSA 5L51A 1W85A 2PBRA 5DPMA 1NN1A 4RNDB 5D85A 3V1LA 4MVYA 2XOXA 1I9GA 3OUZA 3EHEA 2CVPA 1VL1A 1GPBA 8MHTA 3IR6A 2R5NA 5CNJA 4JLAA 1BGXT 4OV6B