3PO2I

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I02
3GTOI 5IP9I 1TWCI 2F4MA 2F4OA 4NBEA 3S14I 3GTMS 3I07A 2E2JI 3RZDI 2E2II 3VMIA 1Y1WI 4QTTA 2JNYA 4A3GI 3EERA 4A3EI 1NUIA 2JA8I 2JS4A 2DE7A 4NOZA 2NVTI 3GTGI 2RBLA 3S15I 1WCMI 5FLMI 4MH4A 1USPA 1TWHI 3M4OI 2B63I 2NVYI 3S1MI 3S17I 5IP7I 2BJOA 2JA5I 1PFTA 1N2FA 1QYPA 1USPB 1DL6A 1VLAA 3GTPI 1X3ZA 2R93I 2JR6A 3GTMI 3Q87A 2JA6I 4A3MI 1ZB9A 3S2DI 3H0GI 2NVXI 4X6AI 4A93I 3GKQA 2R92I 1TWAI 1I50I 3M3YI 4NBDA 1I6HI 3HOYI 3S16I 4BXXI 3HOVI 3K7AI 3S2HI 1Y1VS 3HOZI 5C4XI 4A3FI 2HF1A 2J6AA 4NBGA 2YU9I 3S1NI 4NB9A 2VUMI 4A3DI 4NBCA 3I4MI 1I3QI 3HOUI 2K5RA 3LUSA 2JA7I 4A3BI 4NBFA 2KPIA 5C44I 4A3JI 3U50C 4BBSI 1TWGI 4Y7NI 3PO3S 4NBBA 3HOXI 3GTQI 3GTKI 3VMHA 3CQZI 4NBHA 2DE6A 4NB8A 1TFIA 3PO3I 3VMGA 1ZB8A 4XX2A 4QTUA 3GTLI 1RLYA 1X3WA 3ESWA 3RZOI 1Y1VI 2PK7A 3H3VJ 2R7ZI 3HOWI 3FKII 5C4JI 4NBAA 1YUAA 3GCFA 1L1OC 4BBRI 4A3KI 3S1QI 2AKLA 4A3II 2DE5A 1R9TI 4BY1I 2E2HI 1WW9A 3PO2I 2NVQI 1RO4A 4Y52I 3VB9A 3GTJI 1K83I 1TWFI 3D6WA 4A3CI 2P3YA 1LQLA 1ML8A 4A3LI 3I4NI 1SFOI 3S1RI 5CM2M 5C3EI 4BY7I
chains in the Genus database with same CATH superfamily
4E2YA 2QKDA 3GTOI 2QREB 2WAQA 1KQSZ 1TWCI 1Q7Y1 3GTMS 3RZDI 1Y1WI 4QTTA 2RHBA 2JNYA 4EWCA 1AA6A 4A3EI 1NUIA 3CCQZ 3TE5B 2DE7A 3MZLB 3GTGI 3HKZA 3CPWZ 3S15I 3I55Z 2JMOA 2QEX1 2V8KA 4MH4A 2VPYA 3CMA1 2NVYI 2YADA 1USPB 1KRLA 1VLAA 3EEDA 1S721 3FQMA 2G2KA 2JR6A 4HGYA 3S2DI 4HH4A 2H85A 3I551 1NJI2 1Q16A 4NBDA 1JWHC 3CMAZ 3K7AI 1YJ9Z 1YI21 2HF1A 2J6AA 2KI7B 4NBGA 3J7A4 2V45A 3CME1 1K9M1 3I4MI 3J80b 2JA7I 4NBFA 2IV2X 3CXCZ 3JAMb 3J81f 1ZH1A 1VQ7Z 3U50C 2OTL1 1QVFY 4BBSI 1TWGI 3CCLZ 2RIQA 3PO3S 2GTIA 3CD61 3CCE1 3GTKI 1S72Z 1P9NA 3PO3I 3NDIA 4RVDA 1JJ2Y 1K8A1 3GTLI 3KIHA 3CCRZ 4E31A 2VPZA 1Y1VI 1VQLZ 3H3VJ 1VQ8Z 3GCFA 2RPRA 1RO2A 4BY1I 1VQPZ 2E2HI 3PO2I 3I561 2NVQI 4Y52I 4A3CI 1Q7Y2 1ML8A 4A3LI 3CCEZ 2PM9A 1YJNZ 1SFOI 3G6EZ 2GTHA 4MXUA 1Q862 1VQNZ 3S14I 2F4MA 3IR7A 4NBEA 4E33A 3IFUA 3CCU1 4E32A 4MONA 2E2JI 1KC81 4DQYB 2E2II 2QRCB 4A3GI 3CC4Z 1QVFZ 3I56Z 2JA8I 2E7ZA 2JS4A 3NH8A 2M48A 1KD11 2E9HA 3G71Z 3F3FC 1TWHI 1VQ5Z 3CPWY 1WIIA 2B63I 3IF8A 3M4OI 3S1MI 3S17I 1VQN1 2JA5I 1PFTA 1N2FA 2IZ3A 5D1PA 3GTPI 1YIJ1 1Q861 1X3ZA 1VQM1 3CC7Z 1VQOZ 4E30A 2R93I 1RQFA 3CCMZ 2QA41 1ZB9A 4RS4A 1N8R2 3D2LA 2LIYA 3CCSZ 3NH5A 2V8JA 1TWAI 1I50I 2I3CA 2W03A 2JIQA 1I6HI 3HOVI 1VQ51 1YJ91 2QRDB 4A3FI 3S1NI 2OTJ1 1K732 2VUMI 4DGLA 1W2BZ 3CMEZ 4NBCA 3HOUI 2K5RA 3LUSA 2KPIA 4E2XA 3HOXI 1VQ4Z 3CD6Z 4CL1A 1YJW1 3GTQI 3CQZI 4NBHA 1RLYA 1K9M2 3RZOI 2QA4Z 1VQL1 2R7ZI 2HU9A 2LFUA 3FKII 2IZ4A 2M6NA 3F3PC 3TDHB 1KD12 2Q4ZA 1WZNA 2QLVB 4BBRI 3CCJZ 1Z02A 2NAPA 1R9TI 1Q811 1WW9A 1SIWA 2O53A 1K83I 1KC82 4S1TA 2EGTA 1LQLA 3J80f 3CC2Z 2VF1A 4DK1A 5CM2M 5C3EI 4X6AI 5T67A 2VPWA 2Q51A 3I07A 1YJWZ 1M1K1 1YITZ 3VMIA 5A2Qb 2QR1B 4NOZA 2NVTI 2RBLA 3CCJ1 3CC21 1WCMI 3CCUZ 1X0TA 2K3RA 1K8A2 1JJ2Z 3MONA 1M1K2 1DL6A 2P28A 1VQ61 3CCV1 2GU2A 3CCM1 2OZKA 2JUBA 2ZAEB 2V3VA 3H0GI 4RVHA 4A93I 1VQ71 2OTLZ 2O4HA 3G4SZ 3G6E1 3M3YI 2JIMA 4NFRA 4NH1C 3HOYI 3S16I 2JIRA 1NJI1 3S2HI 3FQQA 3J81b 4NB9A 5A2Qf 1S7MA 5T64A 1I3QI 3CCVZ 4A3BI 3VTNA 4RV9A 5C44I 5LL6f 4Y7NI 4E2WA 1VQ91 3VMHA 3CCL1 1VQ6Z 1YI2Z 1VQ81 1ZB8A 4QTUA 2OTJZ 1Z01A 1X3WA 3ESWA 2AYDA 2PK7A 1YHQ1 3HOWI 3QWUA 2VPXA 1VQO1 3CCR1 2Y0SA 4NBAA 1YUAA 1L1OC 3S1QI 4MD9A 2AKLA 2W04A 3CCS1 4MD7A 1TWFI 3D6WA 3NDJA 2P3YA 2RT9A 1Y8CA 1KQSY 3I4NI 1RNIA 1Z03A 5IP9I 2OOYB 1M902 2F4OA 3IX0A 2V8IA 1YIT1 3OW2Z 1Q812 1YIJZ 3EERA 2LEXA 3CCQ1 1QVGY 5IT9f 5FLXf 5AN9F 2QEXZ 5FLMI 1USPA 3G711 3MZKB 1W2BY 5FLXb 2BJOA 5IP7I 1QYPA 5D1OA 1QXFA 3NFZA 1VQKZ 1M901 5T6BA 2WB1A 3GTMI 3Q87A 2JA6I 4A3MI 2NVXI 3CC71 1VQP1 1K731 3GKQA 3P5JB 4HGZA 2R92I 1FDOA 3KIFA 1QVGZ 1Q822 1RO0A 4BXXI 5D1OB 1FDIA 1Q821 1Y1VS 3HOZI 1NP6A 5C4XI 1VQMZ 2YU9I 3D9XA 3CXCY 4A3DI 1N8R1 3OW2Y 3T4NB 4MRIA 5IT9b 3G4S1 4A3JI 4NBBA 1WJ2A 1VQK1 2DE6A 4NB8A 1TFIA 4AYBA 3VMGA 4XX2A 2JIPA 1VQ41 2OOXB 4RVFA 1YJN1 5C4JI 4A3KI 3BG0B 2JIOA 1QF8A 4A3II 2DE5A 2VUGA 2R6MA 1VQ9Z 4MD8A 4RVGA 1RO4A 3VB9A 1YUKA 3GTJI 3NH4A 3BG1B 4TNUA 3CC41 4E2ZA 2PMZA 1YHQZ 3JAMf 3S1RI 4BY7I
chains in the Genus database with same CATH topology
4E2YA 2QKDA 3GTOI 2QREB 2WAQA 1KQSZ 1TWCI 1Q7Y1 3GTMS 3RZDI 1Y1WI 4QTTA 2RHBA 2JNYA 4EWCA 4A3EI 1NUIA 3CCQZ 3TE5B 2DE7A 3MZLB 3GTGI 3HKZA 3CPWZ 3S15I 3I55Z 2JMOA 2QEX1 2V8KA 4MH4A 3CMA1 2NVYI 2YADA 1USPB 1KRLA 1VLAA 3EEDA 1S721 3FQMA 2G2KA 2JR6A 4HGYA 3S2DI 4HH4A 2H85A 3I551 1NJI2 4NBDA 1JWHC 3CMAZ 3K7AI 1YJ9Z 1YI21 2HF1A 2J6AA 2KI7B 4NBGA 3J7A4 3CME1 1K9M1 3I4MI 3J80b 2JA7I 4NBFA 3CXCZ 3JAMb 3J81f 1ZH1A 1VQ7Z 3U50C 2OTL1 1QVFY 4BBSI 1TWGI 3CCLZ 2RIQA 3PO3S 2GTIA 3CD61 3CCE1 3GTKI 1S72Z 1P9NA 3PO3I 3NDIA 4RVDA 1JJ2Y 1K8A1 3GTLI 3KIHA 3CCRZ 4E31A 1Y1VI 1VQLZ 3H3VJ 1VQ8Z 3GCFA 2RPRA 1RO2A 4BY1I 1VQPZ 2E2HI 3PO2I 3I561 2NVQI 4Y52I 4A3CI 1Q7Y2 1ML8A 4A3LI 3CCEZ 2PM9A 1YJNZ 1SFOI 3G6EZ 2GTHA 4MXUA 1Q862 1VQNZ 3S14I 2F4MA 4NBEA 4E33A 3IFUA 3CCU1 4E32A 4MONA 2E2JI 1KC81 4DQYB 2E2II 2QRCB 4A3GI 3CC4Z 1QVFZ 3I56Z 2JA8I 2JS4A 3NH8A 2M48A 1KD11 2E9HA 3G71Z 3F3FC 1TWHI 1VQ5Z 3CPWY 1WIIA 2B63I 3IF8A 3M4OI 3S1MI 3S17I 1VQN1 2JA5I 1PFTA 1N2FA 2IZ3A 5D1PA 3GTPI 1YIJ1 1Q861 1X3ZA 1VQM1 3CC7Z 1VQOZ 4E30A 2R93I 1RQFA 3CCMZ 2QA41 1ZB9A 4RS4A 1N8R2 2LIYA 3CCSZ 3NH5A 2V8JA 1TWAI 1I50I 2I3CA 2W03A 1I6HI 3HOVI 1VQ51 1YJ91 2QRDB 4A3FI 3S1NI 2OTJ1 1K732 2VUMI 4DGLA 1W2BZ 3CMEZ 4NBCA 3HOUI 2K5RA 3LUSA 2KPIA 4E2XA 3HOXI 1VQ4Z 3CD6Z 4CL1A 1YJW1 3GTQI 3CQZI 4NBHA 1RLYA 1K9M2 3RZOI 2QA4Z 1VQL1 2R7ZI 2HU9A 2LFUA 3FKII 2IZ4A 2M6NA 3F3PC 3TDHB 1KD12 2Q4ZA 2QLVB 4BBRI 3CCJZ 1Z02A 1R9TI 1Q811 1WW9A 2O53A 1K83I 1KC82 4S1TA 2EGTA 1LQLA 3J80f 3CC2Z 2VF1A 4DK1A 5CM2M 5C3EI 4X6AI 5T67A 2Q51A 3I07A 1YJWZ 1M1K1 1YITZ 3VMIA 5A2Qb 2QR1B 4NOZA 2NVTI 2RBLA 3CCJ1 3CC21 1WCMI 3CCUZ 1X0TA 2K3RA 1K8A2 1JJ2Z 3MONA 1M1K2 1DL6A 2P28A 1VQ61 3CCV1 2GU2A 3CCM1 2OZKA 2JUBA 2ZAEB 3H0GI 4RVHA 4A93I 1VQ71 2OTLZ 2O4HA 3G4SZ 3G6E1 3M3YI 4NFRA 4NH1C 3HOYI 3S16I 1NJI1 3S2HI 3FQQA 3J81b 4NB9A 5A2Qf 1S7MA 5T64A 1I3QI 3CCVZ 4A3BI 3VTNA 4RV9A 5C44I 5LL6f 4Y7NI 4E2WA 1VQ91 3VMHA 3CCL1 1VQ6Z 1YI2Z 1VQ81 1ZB8A 4QTUA 2OTJZ 1Z01A 1X3WA 3ESWA 2PK7A 1YHQ1 3HOWI 3QWUA 1VQO1 3CCR1 2Y0SA 4NBAA 1YUAA 1L1OC 3S1QI 4MD9A 2AKLA 2W04A 3CCS1 4MD7A 1TWFI 3D6WA 3NDJA 2P3YA 2RT9A 1KQSY 3I4NI 1RNIA 1Z03A 5IP9I 2OOYB 1M902 2F4OA 3IX0A 2V8IA 1YIT1 3OW2Z 1Q812 1YIJZ 3EERA 3CCQ1 1QVGY 5IT9f 5FLXf 5AN9F 2QEXZ 5FLMI 1USPA 3G711 3MZKB 1W2BY 5FLXb 2BJOA 5IP7I 1QYPA 5D1OA 3NFZA 1VQKZ 1M901 5T6BA 2WB1A 3GTMI 3Q87A 2JA6I 4A3MI 2NVXI 3CC71 1VQP1 1K731 3GKQA 3P5JB 4HGZA 2R92I 3KIFA 1QVGZ 1Q822 1RO0A 4BXXI 5D1OB 1Q821 1Y1VS 3HOZI 1NP6A 5C4XI 1VQMZ 2YU9I 3D9XA 3CXCY 4A3DI 1N8R1 3OW2Y 3T4NB 4MRIA 5IT9b 3G4S1 4A3JI 4NBBA 1VQK1 2DE6A 4NB8A 1TFIA 4AYBA 3VMGA 4XX2A 1VQ41 2OOXB 4RVFA 1YJN1 5C4JI 4A3KI 3BG0B 1QF8A 4A3II 2DE5A 2VUGA 2R6MA 1VQ9Z 4MD8A 4RVGA 1RO4A 3VB9A 1YUKA 3GTJI 3NH4A 3BG1B 4TNUA 4E2ZA 3CC41 2PMZA 1YHQZ 3JAMf 3S1RI 4BY7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO I;  5IP9 I;  1TWC I;  2F4M A;  2F4O A;  4NBE A;  3S14 I;  3GTM S;  3I07 A;  2E2J I;  3RZD I;  2E2I I;  3VMI A;  1Y1W I;  4QTT A;  2JNY A;  4A3G I;  3EER A;  4A3E I;  1NUI A;  2JA8 I;  2JS4 A;  2DE7 A;  4NOZ A;  2NVT I;  3GTG I;  2RBL A;  3S15 I;  1WCM I;  5FLM I;  4MH4 A;  1USP A;  1TWH I;  3M4O I;  2B63 I;  2NVY I;  3S1M I;  3S17 I;  5IP7 I;  2BJO A;  2JA5 I;  1PFT A;  1N2F A;  1QYP A;  1USP B;  1DL6 A;  1VLA A;  3GTP I;  1X3Z A;  2R93 I;  2JR6 A;  3GTM I;  3Q87 A;  2JA6 I;  4A3M I;  1ZB9 A;  3S2D I;  3H0G I;  2NVX I;  4X6A I;  4A93 I;  3GKQ A;  2R92 I;  1TWA I;  1I50 I;  3M3Y I;  4NBD A;  1I6H I;  3HOY I;  3S16 I;  4BXX I;  3HOV I;  3K7A I;  3S2H I;  1Y1V S;  3HOZ I;  5C4X I;  4A3F I;  2HF1 A;  2J6A A;  4NBG A;  2YU9 I;  3S1N I;  4NB9 A;  2VUM I;  4A3D I;  4NBC A;  3I4M I;  1I3Q I;  3HOU I;  2K5R A;  3LUS A;  2JA7 I;  4A3B I;  4NBF A;  2KPI A;  5C44 I;  4A3J I;  3U50 C;  4BBS I;  1TWG I;  4Y7N I;  3PO3 S;  4NBB A;  3HOX I;  3GTQ I;  3GTK I;  3VMH A;  3CQZ I;  4NBH A;  2DE6 A;  4NB8 A;  1TFI A;  3PO3 I;  3VMG A;  1ZB8 A;  4XX2 A;  4QTU A;  3GTL I;  1RLY A;  1X3W A;  3ESW A;  3RZO I;  1Y1V I;  2PK7 A;  3H3V J;  2R7Z I;  3HOW I;  3FKI I;  5C4J I;  4NBA A;  1YUA A;  3GCF A;  1L1O C;  4BBR I;  4A3K I;  3S1Q I;  2AKL A;  4A3I I;  2DE5 A;  1R9T I;  4BY1 I;  2E2H I;  1WW9 A;  3PO2 I;  2NVQ I;  1RO4 A;  4Y52 I;  3VB9 A;  3GTJ I;  1K83 I;  1TWF I;  3D6W A;  4A3C I;  2P3Y A;  1LQL A;  1ML8 A;  4A3L I;  3I4N I;  1SFO I;  3S1R I;  5CM2 M;  5C3E I;  4BY7 I; 
#chains in the Genus database with same CATH topology
 4E2Y A;  2QKD A;  3GTO I;  2QRE B;  2WAQ A;  1KQS Z;  1TWC I;  1Q7Y 1;  3GTM S;  3RZD I;  1Y1W I;  4QTT A;  2RHB A;  2JNY A;  4EWC A;  1AA6 A;  4A3E I;  1NUI A;  3CCQ Z;  3TE5 B;  2DE7 A;  3MZL B;  3GTG I;  3HKZ A;  3CPW Z;  3S15 I;  3I55 Z;  2JMO A;  2QEX 1;  2V8K A;  4MH4 A;  2VPY A;  3CMA 1;  2NVY I;  2YAD A;  1USP B;  1KRL A;  1VLA A;  3EED A;  1S72 1;  3FQM A;  2G2K A;  2JR6 A;  4HGY A;  3S2D I;  4HH4 A;  2H85 A;  3I55 1;  1NJI 2;  1Q16 A;  4NBD A;  1JWH C;  3CMA Z;  3K7A I;  1YJ9 Z;  1YI2 1;  2HF1 A;  2J6A A;  2KI7 B;  4NBG A;  3J7A 4;  2V45 A;  3CME 1;  1K9M 1;  3I4M I;  3J80 b;  2JA7 I;  4NBF A;  2IV2 X;  3CXC Z;  3JAM b;  3J81 f;  1ZH1 A;  1VQ7 Z;  3U50 C;  2OTL 1;  1QVF Y;  4BBS I;  1TWG I;  3CCL Z;  2RIQ A;  3PO3 S;  2GTI A;  3CD6 1;  3CCE 1;  3GTK I;  1S72 Z;  1P9N A;  3PO3 I;  3NDI A;  4RVD A;  1JJ2 Y;  1K8A 1;  3GTL I;  3KIH A;  3CCR Z;  4E31 A;  2VPZ A;  1Y1V I;  1VQL Z;  3H3V J;  1VQ8 Z;  3GCF A;  2RPR A;  1RO2 A;  4BY1 I;  1VQP Z;  2E2H I;  3PO2 I;  3I56 1;  2NVQ I;  4Y52 I;  4A3C I;  1Q7Y 2;  1ML8 A;  4A3L I;  3CCE Z;  2PM9 A;  1YJN Z;  1SFO I;  3G6E Z;  2GTH A;  4MXU A;  1Q86 2;  1VQN Z;  3S14 I;  2F4M A;  3IR7 A;  4NBE A;  4E33 A;  3IFU A;  3CCU 1;  4E32 A;  4MON A;  2E2J I;  1KC8 1;  4DQY B;  2E2I I;  2QRC B;  4A3G I;  3CC4 Z;  1QVF Z;  3I56 Z;  2JA8 I;  2E7Z A;  2JS4 A;  3NH8 A;  2M48 A;  1KD1 1;  2E9H A;  3G71 Z;  3F3F C;  1TWH I;  1VQ5 Z;  3CPW Y;  1WII A;  2B63 I;  3IF8 A;  3M4O I;  3S1M I;  3S17 I;  1VQN 1;  2JA5 I;  1PFT A;  1N2F A;  2IZ3 A;  5D1P A;  3GTP I;  1YIJ 1;  1Q86 1;  1X3Z A;  1VQM 1;  3CC7 Z;  1VQO Z;  4E30 A;  2R93 I;  1RQF A;  3CCM Z;  2QA4 1;  1ZB9 A;  4RS4 A;  1N8R 2;  3D2L A;  2LIY A;  3CCS Z;  3NH5 A;  2V8J A;  1TWA I;  1I50 I;  2I3C A;  2W03 A;  2JIQ A;  1I6H I;  3HOV I;  1VQ5 1;  1YJ9 1;  2QRD B;  4A3F I;  3S1N I;  2OTJ 1;  1K73 2;  2VUM I;  4DGL A;  1W2B Z;  3CME Z;  4NBC A;  3HOU I;  2K5R A;  3LUS A;  2KPI A;  4E2X A;  3HOX I;  1VQ4 Z;  3CD6 Z;  4CL1 A;  1YJW 1;  3GTQ I;  3CQZ I;  4NBH A;  1RLY A;  1K9M 2;  3RZO I;  2QA4 Z;  1VQL 1;  2R7Z I;  2HU9 A;  2LFU A;  3FKI I;  2IZ4 A;  2M6N A;  3F3P C;  3TDH B;  1KD1 2;  2Q4Z A;  1WZN A;  2QLV B;  4BBR I;  3CCJ Z;  1Z02 A;  2NAP A;  1R9T I;  1Q81 1;  1WW9 A;  1SIW A;  2O53 A;  1K83 I;  1KC8 2;  4S1T A;  2EGT A;  1LQL A;  3J80 f;  3CC2 Z;  2VF1 A;  4DK1 A;  5CM2 M;  5C3E I;  4X6A I;  5T67 A;  2VPW A;  2Q51 A;  3I07 A;  1YJW Z;  1M1K 1;  1YIT Z;  3VMI A;  5A2Q b;  2QR1 B;  4NOZ A;  2NVT I;  2RBL A;  3CCJ 1;  3CC2 1;  1WCM I;  3CCU Z;  1X0T A;  2K3R A;  1K8A 2;  1JJ2 Z;  3MON A;  1M1K 2;  1DL6 A;  2P28 A;  1VQ6 1;  3CCV 1;  2GU2 A;  3CCM 1;  2OZK A;  2JUB A;  2ZAE B;  2V3V A;  3H0G I;  4RVH A;  4A93 I;  1VQ7 1;  2OTL Z;  2O4H A;  3G4S Z;  3G6E 1;  3M3Y I;  2JIM A;  4NFR A;  4NH1 C;  3HOY I;  3S16 I;  2JIR A;  1NJI 1;  3S2H I;  3FQQ A;  3J81 b;  4NB9 A;  5A2Q f;  1S7M A;  5T64 A;  1I3Q I;  3CCV Z;  4A3B I;  3VTN A;  4RV9 A;  5C44 I;  5LL6 f;  4Y7N I;  4E2W A;  1VQ9 1;  3VMH A;  3CCL 1;  1VQ6 Z;  1YI2 Z;  1VQ8 1;  1ZB8 A;  4QTU A;  2OTJ Z;  1Z01 A;  1X3W A;  3ESW A;  2AYD A;  2PK7 A;  1YHQ 1;  3HOW I;  3QWU A;  2VPX A;  1VQO 1;  3CCR 1;  2Y0S A;  4NBA A;  1YUA A;  1L1O C;  3S1Q I;  4MD9 A;  2AKL A;  2W04 A;  3CCS 1;  4MD7 A;  1TWF I;  3D6W A;  3NDJ A;  2P3Y A;  2RT9 A;  1Y8C A;  1KQS Y;  3I4N I;  1RNI A;  1Z03 A;  5IP9 I;  2OOY B;  1M90 2;  2F4O A;  3IX0 A;  2V8I A;  1YIT 1;  3OW2 Z;  1Q81 2;  1YIJ Z;  3EER A;  2LEX A;  3CCQ 1;  1QVG Y;  5IT9 f;  5FLX f;  5AN9 F;  2QEX Z;  5FLM I;  1USP A;  3G71 1;  3MZK B;  1W2B Y;  5FLX b;  2BJO A;  5IP7 I;  1QYP A;  5D1O A;  1QXF A;  3NFZ A;  1VQK Z;  1M90 1;  5T6B A;  2WB1 A;  3GTM I;  3Q87 A;  2JA6 I;  4A3M I;  2NVX I;  3CC7 1;  1VQP 1;  1K73 1;  3GKQ A;  3P5J B;  4HGZ A;  2R92 I;  1FDO A;  3KIF A;  1QVG Z;  1Q82 2;  1RO0 A;  4BXX I;  5D1O B;  1FDI A;  1Q82 1;  1Y1V S;  3HOZ I;  1NP6 A;  5C4X I;  1VQM Z;  2YU9 I;  3D9X A;  3CXC Y;  4A3D I;  1N8R 1;  3OW2 Y;  3T4N B;  4MRI A;  5IT9 b;  3G4S 1;  4A3J I;  4NBB A;  1WJ2 A;  1VQK 1;  2DE6 A;  4NB8 A;  1TFI A;  4AYB A;  3VMG A;  4XX2 A;  2JIP A;  1VQ4 1;  2OOX B;  4RVF A;  1YJN 1;  5C4J I;  4A3K I;  3BG0 B;  2JIO A;  1QF8 A;  4A3I I;  2DE5 A;  2VUG A;  2R6M A;  1VQ9 Z;  4MD8 A;  4RVG A;  1RO4 A;  3VB9 A;  1YUK A;  3GTJ I;  3NH4 A;  3BG1 B;  4TNU A;  3CC4 1;  4E2Z A;  2PMZ A;  1YHQ Z;  3JAM f;  3S1R I;  4BY7 I; 
#chains in the Genus database with same CATH homology
 4E2Y A;  2QKD A;  3GTO I;  2QRE B;  2WAQ A;  1KQS Z;  1TWC I;  1Q7Y 1;  3GTM S;  3RZD I;  1Y1W I;  4QTT A;  2RHB A;  2JNY A;  4EWC A;  4A3E I;  1NUI A;  3CCQ Z;  3TE5 B;  2DE7 A;  3MZL B;  3GTG I;  3HKZ A;  3CPW Z;  3S15 I;  3I55 Z;  2JMO A;  2QEX 1;  2V8K A;  4MH4 A;  3CMA 1;  2NVY I;  2YAD A;  1USP B;  1KRL A;  1VLA A;  3EED A;  1S72 1;  3FQM A;  2G2K A;  2JR6 A;  4HGY A;  3S2D I;  4HH4 A;  2H85 A;  3I55 1;  1NJI 2;  4NBD A;  1JWH C;  3CMA Z;  3K7A I;  1YJ9 Z;  1YI2 1;  2HF1 A;  2J6A A;  2KI7 B;  4NBG A;  3J7A 4;  3CME 1;  1K9M 1;  3I4M I;  3J80 b;  2JA7 I;  4NBF A;  3CXC Z;  3JAM b;  3J81 f;  1ZH1 A;  1VQ7 Z;  3U50 C;  2OTL 1;  1QVF Y;  4BBS I;  1TWG I;  3CCL Z;  2RIQ A;  3PO3 S;  2GTI A;  3CD6 1;  3CCE 1;  3GTK I;  1S72 Z;  1P9N A;  3PO3 I;  3NDI A;  4RVD A;  1JJ2 Y;  1K8A 1;  3GTL I;  3KIH A;  3CCR Z;  4E31 A;  1Y1V I;  1VQL Z;  3H3V J;  1VQ8 Z;  3GCF A;  2RPR A;  1RO2 A;  4BY1 I;  1VQP Z;  2E2H I;  3PO2 I;  3I56 1;  2NVQ I;  4Y52 I;  4A3C I;  1Q7Y 2;  1ML8 A;  4A3L I;  3CCE Z;  2PM9 A;  1YJN Z;  1SFO I;  3G6E Z;  2GTH A;  4MXU A;  1Q86 2;  1VQN Z;  3S14 I;  2F4M A;  4NBE A;  4E33 A;  3IFU A;  3CCU 1;  4E32 A;  4MON A;  2E2J I;  1KC8 1;  4DQY B;  2E2I I;  2QRC B;  4A3G I;  3CC4 Z;  1QVF Z;  3I56 Z;  2JA8 I;  2JS4 A;  3NH8 A;  2M48 A;  1KD1 1;  2E9H A;  3G71 Z;  3F3F C;  1TWH I;  1VQ5 Z;  3CPW Y;  1WII A;  2B63 I;  3IF8 A;  3M4O I;  3S1M I;  3S17 I;  1VQN 1;  2JA5 I;  1PFT A;  1N2F A;  2IZ3 A;  5D1P A;  3GTP I;  1YIJ 1;  1Q86 1;  1X3Z A;  1VQM 1;  3CC7 Z;  1VQO Z;  4E30 A;  2R93 I;  1RQF A;  3CCM Z;  2QA4 1;  1ZB9 A;  4RS4 A;  1N8R 2;  2LIY A;  3CCS Z;  3NH5 A;  2V8J A;  1TWA I;  1I50 I;  2I3C A;  2W03 A;  1I6H I;  3HOV I;  1VQ5 1;  1YJ9 1;  2QRD B;  4A3F I;  3S1N I;  2OTJ 1;  1K73 2;  2VUM I;  4DGL A;  1W2B Z;  3CME Z;  4NBC A;  3HOU I;  2K5R A;  3LUS A;  2KPI A;  4E2X A;  3HOX I;  1VQ4 Z;  3CD6 Z;  4CL1 A;  1YJW 1;  3GTQ I;  3CQZ I;  4NBH A;  1RLY A;  1K9M 2;  3RZO I;  2QA4 Z;  1VQL 1;  2R7Z I;  2HU9 A;  2LFU A;  3FKI I;  2IZ4 A;  2M6N A;  3F3P C;  3TDH B;  1KD1 2;  2Q4Z A;  2QLV B;  4BBR I;  3CCJ Z;  1Z02 A;  1R9T I;  1Q81 1;  1WW9 A;  2O53 A;  1K83 I;  1KC8 2;  4S1T A;  2EGT A;  1LQL A;  3J80 f;  3CC2 Z;  2VF1 A;  4DK1 A;  5CM2 M;  5C3E I;  4X6A I;  5T67 A;  2Q51 A;  3I07 A;  1YJW Z;  1M1K 1;  1YIT Z;  3VMI A;  5A2Q b;  2QR1 B;  4NOZ A;  2NVT I;  2RBL A;  3CCJ 1;  3CC2 1;  1WCM I;  3CCU Z;  1X0T A;  2K3R A;  1K8A 2;  1JJ2 Z;  3MON A;  1M1K 2;  1DL6 A;  2P28 A;  1VQ6 1;  3CCV 1;  2GU2 A;  3CCM 1;  2OZK A;  2JUB A;  2ZAE B;  3H0G I;  4RVH A;  4A93 I;  1VQ7 1;  2OTL Z;  2O4H A;  3G4S Z;  3G6E 1;  3M3Y I;  4NFR A;  4NH1 C;  3HOY I;  3S16 I;  1NJI 1;  3S2H I;  3FQQ A;  3J81 b;  4NB9 A;  5A2Q f;  1S7M A;  5T64 A;  1I3Q I;  3CCV Z;  4A3B I;  3VTN A;  4RV9 A;  5C44 I;  5LL6 f;  4Y7N I;  4E2W A;  1VQ9 1;  3VMH A;  3CCL 1;  1VQ6 Z;  1YI2 Z;  1VQ8 1;  1ZB8 A;  4QTU A;  2OTJ Z;  1Z01 A;  1X3W A;  3ESW A;  2PK7 A;  1YHQ 1;  3HOW I;  3QWU A;  1VQO 1;  3CCR 1;  2Y0S A;  4NBA A;  1YUA A;  1L1O C;  3S1Q I;  4MD9 A;  2AKL A;  2W04 A;  3CCS 1;  4MD7 A;  1TWF I;  3D6W A;  3NDJ A;  2P3Y A;  2RT9 A;  1KQS Y;  3I4N I;  1RNI A;  1Z03 A;  5IP9 I;  2OOY B;  1M90 2;  2F4O A;  3IX0 A;  2V8I A;  1YIT 1;  3OW2 Z;  1Q81 2;  1YIJ Z;  3EER A;  3CCQ 1;  1QVG Y;  5IT9 f;  5FLX f;  5AN9 F;  2QEX Z;  5FLM I;  1USP A;  3G71 1;  3MZK B;  1W2B Y;  5FLX b;  2BJO A;  5IP7 I;  1QYP A;  5D1O A;  3NFZ A;  1VQK Z;  1M90 1;  5T6B A;  2WB1 A;  3GTM I;  3Q87 A;  2JA6 I;  4A3M I;  2NVX I;  3CC7 1;  1VQP 1;  1K73 1;  3GKQ A;  3P5J B;  4HGZ A;  2R92 I;  3KIF A;  1QVG Z;  1Q82 2;  1RO0 A;  4BXX I;  5D1O B;  1Q82 1;  1Y1V S;  3HOZ I;  1NP6 A;  5C4X I;  1VQM Z;  2YU9 I;  3D9X A;  3CXC Y;  4A3D I;  1N8R 1;  3OW2 Y;  3T4N B;  4MRI A;  5IT9 b;  3G4S 1;  4A3J I;  4NBB A;  1VQK 1;  2DE6 A;  4NB8 A;  1TFI A;  4AYB A;  3VMG A;  4XX2 A;  1VQ4 1;  2OOX B;  4RVF A;  1YJN 1;  5C4J I;  4A3K I;  3BG0 B;  1QF8 A;  4A3I I;  2DE5 A;  2VUG A;  2R6M A;  1VQ9 Z;  4MD8 A;  4RVG A;  1RO4 A;  3VB9 A;  1YUK A;  3GTJ I;  3NH4 A;  3BG1 B;  4TNU A;  4E2Z A;  3CC4 1;  2PMZ A;  1YHQ Z;  3JAM f;  3S1R I;  4BY7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...