3PO2I

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I02
1I6HI 2HF1A 5C4JI 3S17I 1Y1VI 2J6AA 4A3EI 4NBBA 4A93I 5C44I 3U50C 3FKII 3I07A 4NBEA 1I50I 3GTJI 3D6WA 3S1MI 2VUMI 2F4OA 2JA5I 2BJOA 3PO3S 5C4XI 3S16I 4X6AI 3RZOI 1USPA 3LUSA 3PO3I 3S2DI 3HOYI 3HOZI 3GTLI 2NVQI 3S2HI 2JR6A 1USPB 4NBCA 3RZDI 2JA7I 1R9TI 2E2HI 4NBHA 4BBRI 3GTOI 1I3QI 4A3FI 1X3WA 2K5RA 3M3YI 2NVYI 1WCMI 1TWFI 1RO4A 4QTTA 2NVXI 4A3GI 4NBAA 4Y7NI 2AKLA 2DE5A 3S14I 1TFIA 4A3DI 1YUAA 5FLMI 4BY1I 3K7AI 4Y52I 3M4OI 2P3YA 2E2JI 2DE7A 2R93I 1K83I 1NUIA 4NB8A 1TWGI 4BY7I 3S1RI 4NBGA 3CQZI 2R7ZI 3GTMS 4A3CI 5IP7I 3GTQI 4A3BI 3GTGI 3PO2I 1RLYA 2B63I 3GTMI 1TWCI 1ZB9A 2NVTI 1DL6A 3I4MI 1N2FA 4NBFA 4A3LI 2R92I 3HOWI 5CM2M 2KPIA 3VMHA 3EERA 1VLAA 2JS4A 3H3VJ 2DE6A 4A3JI 1PFTA 2JA8I 4QTUA 4BBSI 3HOXI 1ZB8A 3I4NI 3VMIA 3VMGA 2PK7A 2F4MA 4A3II 3S15I 1X3ZA 1LQLA 1QYPA 3GCFA 4A3KI 2E2II 4XX2A 1L1OC 3GTKI 3Q87A 4NB9A 3GTPI 2RBLA 3ESWA 4A3MI 2JNYA 4NOZA 1SFOI 4MH4A 3S1NI 3HOVI 3S1QI 3H0GI 2YU9I 3HOUI 2JA6I 1TWHI 3VB9A 1Y1WI 5IP9I 1TWAI 4BXXI 5C3EI 1ML8A 3GKQA 4NBDA 1Y1VS 1WW9A
chains in the Genus database with same CATH superfamily
1I6HI 3G4SZ 5C4JI 2OOYB 2GU2A 5C44I 3I07A 3CC41 1Q7Y1 3GTJI 3CC7Z 1VQ91 2V3VA 4RVDA 4DGLA 2BJOA 2RIQA 3S16I 1VQL1 3RZOI 3J7A4 3CCM1 1N8R2 2G2KA 2VPZA 2JR6A 4NBCA 2AYDA 5LL6f 1YUKA 2JA7I 2OTL1 1K9M2 3J81f 4BBRI 3GTOI 3M3YI 2NVYI 1TWFI 3I551 1FDOA 3IFUA 3HKZA 2AKLA 3CMA1 2JIQA 1TFIA 1VQ81 1YJ9Z 1YUAA 4HGYA 1ZH1A 3M4OI 2JIOA 3J80b 1NUIA 1QF8A 3CCE1 1Q811 1VQOZ 3G6EZ 4NB8A 4BY7I 2Y0SA 5T64A 3S1RI 3CQZI 2R7ZI 3GTMS 1VQNZ 3F3FC 3G4S1 3TE5B 3CXCY 2B63I 4TNUA 3GTMI 2LFUA 2E9HA 1N2FA 4NBFA 4E2ZA 2IZ4A 1K732 1VLAA 3CC71 1JWHC 4A3JI 1PFTA 2Q51A 1VQ9Z 3CXCZ 2RHBA 2M6NA 5FLXf 2F4MA 3KIHA 3GCFA 2E2II 1NJI1 3CCSZ 3CCLZ 1L1OC 2VUGA 4E2XA 1P9NA 3G711 2QEXZ 2JNYA 4A3MI 5T67A 2YU9I 1YIJ1 1TWHI 3VB9A 5T6BA 1TWAI 1K8A2 3CD6Z 3TDHB 1ML8A 5D1OB 1RO0A 2J6AA 1YJ91 4NBBA 3U50C 3EEDA 4NBEA 1KC82 1I50I 1VQO1 2F4OA 1Q821 3NFZA 1VQ5Z 2JIRA 3CCEZ 3PO3S 4X6AI 2QRCB 1USPA 2PM9A 1WJ2A 3PO3I 2PMZA 3S2DI 5A2Qb 4AYBA 2W03A 2QLVB 1YITZ 1VQ7Z 1VQPZ 4E31A 2Q4ZA 4MD9A 1Q7Y2 4A3FI 2K5RA 3NH8A 4NBAA 2DE5A 3CCS1 3CCL1 4BY1I 4Y52I 2P3YA 2O53A 3IX0A 2QEX1 4RS4A 4HH4A 3G71Z 2JMOA 1TWGI 1VQ4Z 1KRLA 1Q16A 3CCUZ 1YIJZ 3P5JB 3CD61 2OTJZ 4CL1A 1YJN1 3GTQI 3IF8A 1YI2Z 2V8IA 2H85A 1TWCI 1DL6A 1M902 4E32A 4A3LI 3CPWY 2KPIA 3VMHA 2JS4A 2QREB 5AN9F 1N8R1 2RPRA 4QTUA 4BBSI 3D9XA 1RQFA 1Q812 3HOXI 1VQ51 1ZB8A 3I4NI 3NH4A 1KD12 4RVHA 2OOXB 1SIWA 3GTKI 3CPWZ 3CMEZ 3FQQA 4NOZA 2OZKA 4MXUA 2IZ3A 5IT9f 1RO2A 1YIT1 2W04A 3MONA 1VQ71 1VQP1 3CCQZ 1AA6A 3KIFA 1Y1VS 3QWUA 1Q862 2JIPA 3S17I 1Y1VI 4A3EI 3FKII 1QXFA 5A2Qf 3NH5A 4RV9A 4MD8A 3S1MI 2VUMI 2JA5I 3BG0B 2IV2X 1VQ41 5C4XI 3CCU1 3FQMA 2OTJ1 4EWCA 2ZAEB 1YJWZ 3LUSA 3HOZI 1YJNZ 1YI21 4MONA 2NVQI 3S2HI 2WAQA 4DK1A 2NAPA 2E2HI 4NBHA 3MZKB 1M1K2 2LIYA 4QTTA 2NVXI 1Q822 4Y7NI 1K8A1 2QRDB 4A3DI 3CME1 2E2JI 3NDJA 3VTNA 1YHQZ 2V8JA 3CCQ1 4NBGA 1QVFY 3I56Z 1WZNA 1X0TA 2VF1A 1QVGY 3J80f 3NDIA 4NFRA 2I3CA 3PO2I 2VPYA 4A3BI 1RLYA 1Z02A 2RT9A 2NVTI 5D1PA 2LEXA 2R92I 1QVFZ 3EERA 1QVGZ 3VMGA 1WIIA 3S15I 1FDIA 1X3ZA 1YJW1 2YADA 2HU9A 4E30A 3ESWA 3T4NB 1SFOI 4MH4A 3S1NI 3HOVI 3CCVZ 2V8KA 2JA6I 3CCJZ 5D1OA 5IP9I 4BXXI 1VQMZ 2K3RA 1Z03A 2V45A 1W2BY 2GTIA 2HF1A 3OW2Y 4A93I 1K9M1 1S7MA 4MD7A 3CCRZ 1YHQ1 1VQKZ 1Y8CA 3D6WA 1W2BZ 3JAMb 1M901 3OW2Z 4E2WA 3I561 4S1TA 2WB1A 3HOYI 3GTLI 1KD11 1USPB 2QR1B 4E33A 2E7ZA 3BG1B 3RZDI 1S721 2QA4Z 1R9TI 2R6MA 3CC2Z 1NJI2 4RVFA 1I3QI 1VQ6Z 1KQSY 1X3WA 1WCMI 1RO4A 4A3GI 3S14I 2P28A 1K731 5FLMI 3F3PC 3K7AI 2VPXA 2JUBA 4RVGA 3CC4Z 2DE7A 2R93I 1K83I 3J81b 1KQSZ 1Q861 3D2LA 4NH1C 3CCV1 4MRIA 3CCJ1 4HGZA 1VQM1 1VQLZ 4A3CI 5IP7I 3GTGI 3CCMZ 3MZLB 1JJ2Y 1ZB9A 3I4MI 3HOWI 5CM2M 3CCR1 2OTLZ 1VQK1 3H3VJ 2DE6A 2M48A 2JA8I 3I55Z 3VMIA 2KI7B 2PK7A 1JJ2Z 5IT9b 4A3II 3CMAZ 1LQLA 1QYPA 2GTHA 1RNIA 4A3KI 1VQ8Z 1NP6A 1Z01A 2QKDA 4XX2A 3Q87A 2JIMA 4NB9A 1KC81 3GTPI 2RBLA 1M1K1 2EGTA 3G6E1 2O4HA 2VPWA 3S1QI 3H0GI 3HOUI 2QA41 1Y1WI 3CC21 5FLXb 1S72Z 5C3EI 3IR7A 1VQN1 3GKQA 4NBDA 1VQ61 1WW9A 3JAMf 4DQYB 4E2YA
chains in the Genus database with same CATH topology
1I6HI 3G4SZ 5C4JI 2OOYB 2GU2A 5C44I 3I07A 3CC41 1Q7Y1 3GTJI 3CC7Z 1VQ91 4RVDA 4DGLA 2BJOA 2RIQA 3S16I 1VQL1 3RZOI 3J7A4 3CCM1 1N8R2 2G2KA 2JR6A 4NBCA 5LL6f 1YUKA 2JA7I 2OTL1 1K9M2 3J81f 4BBRI 3GTOI 3M3YI 2NVYI 1TWFI 3I551 3IFUA 3HKZA 2AKLA 3CMA1 1TFIA 1VQ81 1YJ9Z 1YUAA 4HGYA 1ZH1A 3M4OI 3J80b 1NUIA 1QF8A 3CCE1 1Q811 1VQOZ 3G6EZ 4NB8A 4BY7I 2Y0SA 5T64A 3S1RI 3CQZI 2R7ZI 3GTMS 1VQNZ 3F3FC 3G4S1 3TE5B 3CXCY 2B63I 4TNUA 3GTMI 2LFUA 2E9HA 1N2FA 4NBFA 4E2ZA 2IZ4A 1K732 1VLAA 3CC71 1JWHC 4A3JI 1PFTA 2Q51A 1VQ9Z 3CXCZ 2RHBA 2M6NA 5FLXf 2F4MA 3KIHA 3GCFA 2E2II 1NJI1 3CCSZ 3CCLZ 1L1OC 2VUGA 4E2XA 1P9NA 3G711 2QEXZ 2JNYA 4A3MI 5T67A 2YU9I 1YIJ1 1TWHI 3VB9A 5T6BA 1TWAI 1K8A2 3CD6Z 3TDHB 1ML8A 5D1OB 1RO0A 2J6AA 1YJ91 4NBBA 3U50C 3EEDA 4NBEA 1KC82 1I50I 1VQO1 2F4OA 1Q821 3NFZA 1VQ5Z 3CCEZ 3PO3S 4X6AI 2QRCB 1USPA 2PM9A 3PO3I 2PMZA 3S2DI 5A2Qb 4AYBA 2W03A 2QLVB 1YITZ 1VQ7Z 1VQPZ 4E31A 2Q4ZA 4MD9A 1Q7Y2 4A3FI 2K5RA 3NH8A 4NBAA 2DE5A 3CCS1 3CCL1 4BY1I 4Y52I 2P3YA 2O53A 3IX0A 2QEX1 4RS4A 4HH4A 3G71Z 2JMOA 1TWGI 1VQ4Z 1KRLA 3CCUZ 1YIJZ 3P5JB 3CD61 2OTJZ 4CL1A 1YJN1 3GTQI 3IF8A 1YI2Z 2V8IA 2H85A 1TWCI 1DL6A 1M902 4E32A 4A3LI 3CPWY 2KPIA 3VMHA 2JS4A 2QREB 5AN9F 1N8R1 2RPRA 4QTUA 4BBSI 3D9XA 1RQFA 1Q812 3HOXI 1VQ51 1ZB8A 3I4NI 3NH4A 1KD12 4RVHA 2OOXB 3GTKI 3CPWZ 3CMEZ 3FQQA 4NOZA 2OZKA 4MXUA 2IZ3A 5IT9f 1RO2A 1YIT1 2W04A 3MONA 1VQ71 1VQP1 3CCQZ 3KIFA 1Y1VS 3QWUA 1Q862 3S17I 1Y1VI 4A3EI 3FKII 5A2Qf 3NH5A 4RV9A 4MD8A 3S1MI 2VUMI 2JA5I 3BG0B 1VQ41 5C4XI 3CCU1 3FQMA 2OTJ1 4EWCA 2ZAEB 1YJWZ 3LUSA 3HOZI 1YJNZ 1YI21 4MONA 2NVQI 3S2HI 2WAQA 4DK1A 2E2HI 4NBHA 3MZKB 1M1K2 2LIYA 4QTTA 2NVXI 1Q822 4Y7NI 1K8A1 2QRDB 4A3DI 3CME1 2E2JI 3NDJA 1YHQZ 3VTNA 2V8JA 3CCQ1 4NBGA 1QVFY 3I56Z 1X0TA 2VF1A 1QVGY 3J80f 3NDIA 4NFRA 2I3CA 3PO2I 4A3BI 1RLYA 1Z02A 2RT9A 2NVTI 5D1PA 2R92I 1QVFZ 3EERA 1QVGZ 3VMGA 1WIIA 3S15I 1X3ZA 1YJW1 2YADA 2HU9A 4E30A 3ESWA 3T4NB 1SFOI 4MH4A 3S1NI 3HOVI 3CCVZ 2V8KA 2JA6I 3CCJZ 5D1OA 5IP9I 4BXXI 1VQMZ 2K3RA 1Z03A 1W2BY 2GTIA 2HF1A 3OW2Y 4A93I 1K9M1 1S7MA 4MD7A 3CCRZ 1YHQ1 1VQKZ 3D6WA 1W2BZ 3JAMb 1M901 3OW2Z 4E2WA 3I561 4S1TA 2WB1A 3HOYI 3GTLI 1KD11 1USPB 2QR1B 4E33A 3RZDI 3BG1B 1S721 2QA4Z 1R9TI 2R6MA 3CC2Z 1NJI2 4RVFA 1I3QI 1VQ6Z 1KQSY 1X3WA 1WCMI 1RO4A 4A3GI 3S14I 2P28A 1K731 5FLMI 3F3PC 3K7AI 2JUBA 4RVGA 3CC4Z 2DE7A 2R93I 1K83I 3J81b 1KQSZ 1Q861 4NH1C 3CCV1 4MRIA 3CCJ1 4HGZA 1VQM1 1VQLZ 4A3CI 5IP7I 3GTGI 3CCMZ 3MZLB 1JJ2Y 1ZB9A 3I4MI 3HOWI 5CM2M 3CCR1 2OTLZ 1VQK1 3H3VJ 2DE6A 2M48A 2JA8I 3I55Z 3VMIA 2KI7B 2PK7A 1JJ2Z 5IT9b 4A3II 3CMAZ 1LQLA 1QYPA 2GTHA 1RNIA 4A3KI 1VQ8Z 1NP6A 1Z01A 2QKDA 4XX2A 3Q87A 4NB9A 1KC81 3GTPI 2RBLA 1M1K1 2EGTA 3G6E1 2O4HA 3S1QI 3H0GI 3HOUI 2QA41 1Y1WI 3CC21 5FLXb 1S72Z 5C3EI 1VQN1 3GKQA 4NBDA 1VQ61 1WW9A 3JAMf 4DQYB 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H I;  2HF1 A;  5C4J I;  3S17 I;  1Y1V I;  2J6A A;  4A3E I;  4NBB A;  4A93 I;  5C44 I;  3U50 C;  3FKI I;  3I07 A;  4NBE A;  1I50 I;  3GTJ I;  3D6W A;  3S1M I;  2VUM I;  2F4O A;  2JA5 I;  2BJO A;  3PO3 S;  5C4X I;  3S16 I;  4X6A I;  3RZO I;  1USP A;  3LUS A;  3PO3 I;  3S2D I;  3HOY I;  3HOZ I;  3GTL I;  2NVQ I;  3S2H I;  2JR6 A;  1USP B;  4NBC A;  3RZD I;  2JA7 I;  1R9T I;  2E2H I;  4NBH A;  4BBR I;  3GTO I;  1I3Q I;  4A3F I;  1X3W A;  2K5R A;  3M3Y I;  2NVY I;  1WCM I;  1TWF I;  1RO4 A;  4QTT A;  2NVX I;  4A3G I;  4NBA A;  4Y7N I;  2AKL A;  2DE5 A;  3S14 I;  1TFI A;  4A3D I;  1YUA A;  5FLM I;  4BY1 I;  3K7A I;  4Y52 I;  3M4O I;  2P3Y A;  2E2J I;  2DE7 A;  2R93 I;  1K83 I;  1NUI A;  4NB8 A;  1TWG I;  4BY7 I;  3S1R I;  4NBG A;  3CQZ I;  2R7Z I;  3GTM S;  4A3C I;  5IP7 I;  3GTQ I;  4A3B I;  3GTG I;  3PO2 I;  1RLY A;  2B63 I;  3GTM I;  1TWC I;  1ZB9 A;  2NVT I;  1DL6 A;  3I4M I;  1N2F A;  4NBF A;  4A3L I;  2R92 I;  3HOW I;  5CM2 M;  2KPI A;  3VMH A;  3EER A;  1VLA A;  2JS4 A;  3H3V J;  2DE6 A;  4A3J I;  1PFT A;  2JA8 I;  4QTU A;  4BBS I;  3HOX I;  1ZB8 A;  3I4N I;  3VMI A;  3VMG A;  2PK7 A;  2F4M A;  4A3I I;  3S15 I;  1X3Z A;  1LQL A;  1QYP A;  3GCF A;  4A3K I;  2E2I I;  4XX2 A;  1L1O C;  3GTK I;  3Q87 A;  4NB9 A;  3GTP I;  2RBL A;  3ESW A;  4A3M I;  2JNY A;  4NOZ A;  1SFO I;  4MH4 A;  3S1N I;  3HOV I;  3S1Q I;  3H0G I;  2YU9 I;  3HOU I;  2JA6 I;  1TWH I;  3VB9 A;  1Y1W I;  5IP9 I;  1TWA I;  4BXX I;  5C3E I;  1ML8 A;  3GKQ A;  4NBD A;  1Y1V S;  1WW9 A; 
#chains in the Genus database with same CATH topology
 1I6H I;  3G4S Z;  5C4J I;  2OOY B;  2GU2 A;  5C44 I;  3I07 A;  3CC4 1;  1Q7Y 1;  3GTJ I;  3CC7 Z;  1VQ9 1;  2V3V A;  4RVD A;  4DGL A;  2BJO A;  2RIQ A;  3S16 I;  1VQL 1;  3RZO I;  3J7A 4;  3CCM 1;  1N8R 2;  2G2K A;  2VPZ A;  2JR6 A;  4NBC A;  2AYD A;  5LL6 f;  1YUK A;  2JA7 I;  2OTL 1;  1K9M 2;  3J81 f;  4BBR I;  3GTO I;  3M3Y I;  2NVY I;  1TWF I;  3I55 1;  1FDO A;  3IFU A;  3HKZ A;  2AKL A;  3CMA 1;  2JIQ A;  1TFI A;  1VQ8 1;  1YJ9 Z;  1YUA A;  4HGY A;  1ZH1 A;  3M4O I;  2JIO A;  3J80 b;  1NUI A;  1QF8 A;  3CCE 1;  1Q81 1;  1VQO Z;  3G6E Z;  4NB8 A;  4BY7 I;  2Y0S A;  5T64 A;  3S1R I;  3CQZ I;  2R7Z I;  3GTM S;  1VQN Z;  3F3F C;  3G4S 1;  3TE5 B;  3CXC Y;  2B63 I;  4TNU A;  3GTM I;  2LFU A;  2E9H A;  1N2F A;  4NBF A;  4E2Z A;  2IZ4 A;  1K73 2;  1VLA A;  3CC7 1;  1JWH C;  4A3J I;  1PFT A;  2Q51 A;  1VQ9 Z;  3CXC Z;  2RHB A;  2M6N A;  5FLX f;  2F4M A;  3KIH A;  3GCF A;  2E2I I;  1NJI 1;  3CCS Z;  3CCL Z;  1L1O C;  2VUG A;  4E2X A;  1P9N A;  3G71 1;  2QEX Z;  2JNY A;  4A3M I;  5T67 A;  2YU9 I;  1YIJ 1;  1TWH I;  3VB9 A;  5T6B A;  1TWA I;  1K8A 2;  3CD6 Z;  3TDH B;  1ML8 A;  5D1O B;  1RO0 A;  2J6A A;  1YJ9 1;  4NBB A;  3U50 C;  3EED A;  4NBE A;  1KC8 2;  1I50 I;  1VQO 1;  2F4O A;  1Q82 1;  3NFZ A;  1VQ5 Z;  2JIR A;  3CCE Z;  3PO3 S;  4X6A I;  2QRC B;  1USP A;  2PM9 A;  1WJ2 A;  3PO3 I;  2PMZ A;  3S2D I;  5A2Q b;  4AYB A;  2W03 A;  2QLV B;  1YIT Z;  1VQ7 Z;  1VQP Z;  4E31 A;  2Q4Z A;  4MD9 A;  1Q7Y 2;  4A3F I;  2K5R A;  3NH8 A;  4NBA A;  2DE5 A;  3CCS 1;  3CCL 1;  4BY1 I;  4Y52 I;  2P3Y A;  2O53 A;  3IX0 A;  2QEX 1;  4RS4 A;  4HH4 A;  3G71 Z;  2JMO A;  1TWG I;  1VQ4 Z;  1KRL A;  1Q16 A;  3CCU Z;  1YIJ Z;  3P5J B;  3CD6 1;  2OTJ Z;  4CL1 A;  1YJN 1;  3GTQ I;  3IF8 A;  1YI2 Z;  2V8I A;  2H85 A;  1TWC I;  1DL6 A;  1M90 2;  4E32 A;  4A3L I;  3CPW Y;  2KPI A;  3VMH A;  2JS4 A;  2QRE B;  5AN9 F;  1N8R 1;  2RPR A;  4QTU A;  4BBS I;  3D9X A;  1RQF A;  1Q81 2;  3HOX I;  1VQ5 1;  1ZB8 A;  3I4N I;  3NH4 A;  1KD1 2;  4RVH A;  2OOX B;  1SIW A;  3GTK I;  3CPW Z;  3CME Z;  3FQQ A;  4NOZ A;  2OZK A;  4MXU A;  2IZ3 A;  5IT9 f;  1RO2 A;  1YIT 1;  2W04 A;  3MON A;  1VQ7 1;  1VQP 1;  3CCQ Z;  1AA6 A;  3KIF A;  1Y1V S;  3QWU A;  1Q86 2;  2JIP A;  3S17 I;  1Y1V I;  4A3E I;  3FKI I;  1QXF A;  5A2Q f;  3NH5 A;  4RV9 A;  4MD8 A;  3S1M I;  2VUM I;  2JA5 I;  3BG0 B;  2IV2 X;  1VQ4 1;  5C4X I;  3CCU 1;  3FQM A;  2OTJ 1;  4EWC A;  2ZAE B;  1YJW Z;  3LUS A;  3HOZ I;  1YJN Z;  1YI2 1;  4MON A;  2NVQ I;  3S2H I;  2WAQ A;  4DK1 A;  2NAP A;  2E2H I;  4NBH A;  3MZK B;  1M1K 2;  2LIY A;  4QTT A;  2NVX I;  1Q82 2;  4Y7N I;  1K8A 1;  2QRD B;  4A3D I;  3CME 1;  2E2J I;  3NDJ A;  3VTN A;  1YHQ Z;  2V8J A;  3CCQ 1;  4NBG A;  1QVF Y;  3I56 Z;  1WZN A;  1X0T A;  2VF1 A;  1QVG Y;  3J80 f;  3NDI A;  4NFR A;  2I3C A;  3PO2 I;  2VPY A;  4A3B I;  1RLY A;  1Z02 A;  2RT9 A;  2NVT I;  5D1P A;  2LEX A;  2R92 I;  1QVF Z;  3EER A;  1QVG Z;  3VMG A;  1WII A;  3S15 I;  1FDI A;  1X3Z A;  1YJW 1;  2YAD A;  2HU9 A;  4E30 A;  3ESW A;  3T4N B;  1SFO I;  4MH4 A;  3S1N I;  3HOV I;  3CCV Z;  2V8K A;  2JA6 I;  3CCJ Z;  5D1O A;  5IP9 I;  4BXX I;  1VQM Z;  2K3R A;  1Z03 A;  2V45 A;  1W2B Y;  2GTI A;  2HF1 A;  3OW2 Y;  4A93 I;  1K9M 1;  1S7M A;  4MD7 A;  3CCR Z;  1YHQ 1;  1VQK Z;  1Y8C A;  3D6W A;  1W2B Z;  3JAM b;  1M90 1;  3OW2 Z;  4E2W A;  3I56 1;  4S1T A;  2WB1 A;  3HOY I;  3GTL I;  1KD1 1;  1USP B;  2QR1 B;  4E33 A;  2E7Z A;  3BG1 B;  3RZD I;  1S72 1;  2QA4 Z;  1R9T I;  2R6M A;  3CC2 Z;  1NJI 2;  4RVF A;  1I3Q I;  1VQ6 Z;  1KQS Y;  1X3W A;  1WCM I;  1RO4 A;  4A3G I;  3S14 I;  2P28 A;  1K73 1;  5FLM I;  3F3P C;  3K7A I;  2VPX A;  2JUB A;  4RVG A;  3CC4 Z;  2DE7 A;  2R93 I;  1K83 I;  3J81 b;  1KQS Z;  1Q86 1;  3D2L A;  4NH1 C;  3CCV 1;  4MRI A;  3CCJ 1;  4HGZ A;  1VQM 1;  1VQL Z;  4A3C I;  5IP7 I;  3GTG I;  3CCM Z;  3MZL B;  1JJ2 Y;  1ZB9 A;  3I4M I;  3HOW I;  5CM2 M;  3CCR 1;  2OTL Z;  1VQK 1;  3H3V J;  2DE6 A;  2M48 A;  2JA8 I;  3I55 Z;  3VMI A;  2KI7 B;  2PK7 A;  1JJ2 Z;  5IT9 b;  4A3I I;  3CMA Z;  1LQL A;  1QYP A;  2GTH A;  1RNI A;  4A3K I;  1VQ8 Z;  1NP6 A;  1Z01 A;  2QKD A;  4XX2 A;  3Q87 A;  2JIM A;  4NB9 A;  1KC8 1;  3GTP I;  2RBL A;  1M1K 1;  2EGT A;  3G6E 1;  2O4H A;  2VPW A;  3S1Q I;  3H0G I;  3HOU I;  2QA4 1;  1Y1W I;  3CC2 1;  5FLX b;  1S72 Z;  5C3E I;  3IR7 A;  1VQN 1;  3GKQ A;  4NBD A;  1VQ6 1;  1WW9 A;  3JAM f;  4DQY B;  4E2Y A; 
#chains in the Genus database with same CATH homology
 1I6H I;  3G4S Z;  5C4J I;  2OOY B;  2GU2 A;  5C44 I;  3I07 A;  3CC4 1;  1Q7Y 1;  3GTJ I;  3CC7 Z;  1VQ9 1;  4RVD A;  4DGL A;  2BJO A;  2RIQ A;  3S16 I;  1VQL 1;  3RZO I;  3J7A 4;  3CCM 1;  1N8R 2;  2G2K A;  2JR6 A;  4NBC A;  5LL6 f;  1YUK A;  2JA7 I;  2OTL 1;  1K9M 2;  3J81 f;  4BBR I;  3GTO I;  3M3Y I;  2NVY I;  1TWF I;  3I55 1;  3IFU A;  3HKZ A;  2AKL A;  3CMA 1;  1TFI A;  1VQ8 1;  1YJ9 Z;  1YUA A;  4HGY A;  1ZH1 A;  3M4O I;  3J80 b;  1NUI A;  1QF8 A;  3CCE 1;  1Q81 1;  1VQO Z;  3G6E Z;  4NB8 A;  4BY7 I;  2Y0S A;  5T64 A;  3S1R I;  3CQZ I;  2R7Z I;  3GTM S;  1VQN Z;  3F3F C;  3G4S 1;  3TE5 B;  3CXC Y;  2B63 I;  4TNU A;  3GTM I;  2LFU A;  2E9H A;  1N2F A;  4NBF A;  4E2Z A;  2IZ4 A;  1K73 2;  1VLA A;  3CC7 1;  1JWH C;  4A3J I;  1PFT A;  2Q51 A;  1VQ9 Z;  3CXC Z;  2RHB A;  2M6N A;  5FLX f;  2F4M A;  3KIH A;  3GCF A;  2E2I I;  1NJI 1;  3CCS Z;  3CCL Z;  1L1O C;  2VUG A;  4E2X A;  1P9N A;  3G71 1;  2QEX Z;  2JNY A;  4A3M I;  5T67 A;  2YU9 I;  1YIJ 1;  1TWH I;  3VB9 A;  5T6B A;  1TWA I;  1K8A 2;  3CD6 Z;  3TDH B;  1ML8 A;  5D1O B;  1RO0 A;  2J6A A;  1YJ9 1;  4NBB A;  3U50 C;  3EED A;  4NBE A;  1KC8 2;  1I50 I;  1VQO 1;  2F4O A;  1Q82 1;  3NFZ A;  1VQ5 Z;  3CCE Z;  3PO3 S;  4X6A I;  2QRC B;  1USP A;  2PM9 A;  3PO3 I;  2PMZ A;  3S2D I;  5A2Q b;  4AYB A;  2W03 A;  2QLV B;  1YIT Z;  1VQ7 Z;  1VQP Z;  4E31 A;  2Q4Z A;  4MD9 A;  1Q7Y 2;  4A3F I;  2K5R A;  3NH8 A;  4NBA A;  2DE5 A;  3CCS 1;  3CCL 1;  4BY1 I;  4Y52 I;  2P3Y A;  2O53 A;  3IX0 A;  2QEX 1;  4RS4 A;  4HH4 A;  3G71 Z;  2JMO A;  1TWG I;  1VQ4 Z;  1KRL A;  3CCU Z;  1YIJ Z;  3P5J B;  3CD6 1;  2OTJ Z;  4CL1 A;  1YJN 1;  3GTQ I;  3IF8 A;  1YI2 Z;  2V8I A;  2H85 A;  1TWC I;  1DL6 A;  1M90 2;  4E32 A;  4A3L I;  3CPW Y;  2KPI A;  3VMH A;  2JS4 A;  2QRE B;  5AN9 F;  1N8R 1;  2RPR A;  4QTU A;  4BBS I;  3D9X A;  1RQF A;  1Q81 2;  3HOX I;  1VQ5 1;  1ZB8 A;  3I4N I;  3NH4 A;  1KD1 2;  4RVH A;  2OOX B;  3GTK I;  3CPW Z;  3CME Z;  3FQQ A;  4NOZ A;  2OZK A;  4MXU A;  2IZ3 A;  5IT9 f;  1RO2 A;  1YIT 1;  2W04 A;  3MON A;  1VQ7 1;  1VQP 1;  3CCQ Z;  3KIF A;  1Y1V S;  3QWU A;  1Q86 2;  3S17 I;  1Y1V I;  4A3E I;  3FKI I;  5A2Q f;  3NH5 A;  4RV9 A;  4MD8 A;  3S1M I;  2VUM I;  2JA5 I;  3BG0 B;  1VQ4 1;  5C4X I;  3CCU 1;  3FQM A;  2OTJ 1;  4EWC A;  2ZAE B;  1YJW Z;  3LUS A;  3HOZ I;  1YJN Z;  1YI2 1;  4MON A;  2NVQ I;  3S2H I;  2WAQ A;  4DK1 A;  2E2H I;  4NBH A;  3MZK B;  1M1K 2;  2LIY A;  4QTT A;  2NVX I;  1Q82 2;  4Y7N I;  1K8A 1;  2QRD B;  4A3D I;  3CME 1;  2E2J I;  3NDJ A;  1YHQ Z;  3VTN A;  2V8J A;  3CCQ 1;  4NBG A;  1QVF Y;  3I56 Z;  1X0T A;  2VF1 A;  1QVG Y;  3J80 f;  3NDI A;  4NFR A;  2I3C A;  3PO2 I;  4A3B I;  1RLY A;  1Z02 A;  2RT9 A;  2NVT I;  5D1P A;  2R92 I;  1QVF Z;  3EER A;  1QVG Z;  3VMG A;  1WII A;  3S15 I;  1X3Z A;  1YJW 1;  2YAD A;  2HU9 A;  4E30 A;  3ESW A;  3T4N B;  1SFO I;  4MH4 A;  3S1N I;  3HOV I;  3CCV Z;  2V8K A;  2JA6 I;  3CCJ Z;  5D1O A;  5IP9 I;  4BXX I;  1VQM Z;  2K3R A;  1Z03 A;  1W2B Y;  2GTI A;  2HF1 A;  3OW2 Y;  4A93 I;  1K9M 1;  1S7M A;  4MD7 A;  3CCR Z;  1YHQ 1;  1VQK Z;  3D6W A;  1W2B Z;  3JAM b;  1M90 1;  3OW2 Z;  4E2W A;  3I56 1;  4S1T A;  2WB1 A;  3HOY I;  3GTL I;  1KD1 1;  1USP B;  2QR1 B;  4E33 A;  3RZD I;  3BG1 B;  1S72 1;  2QA4 Z;  1R9T I;  2R6M A;  3CC2 Z;  1NJI 2;  4RVF A;  1I3Q I;  1VQ6 Z;  1KQS Y;  1X3W A;  1WCM I;  1RO4 A;  4A3G I;  3S14 I;  2P28 A;  1K73 1;  5FLM I;  3F3P C;  3K7A I;  2JUB A;  4RVG A;  3CC4 Z;  2DE7 A;  2R93 I;  1K83 I;  3J81 b;  1KQS Z;  1Q86 1;  4NH1 C;  3CCV 1;  4MRI A;  3CCJ 1;  4HGZ A;  1VQM 1;  1VQL Z;  4A3C I;  5IP7 I;  3GTG I;  3CCM Z;  3MZL B;  1JJ2 Y;  1ZB9 A;  3I4M I;  3HOW I;  5CM2 M;  3CCR 1;  2OTL Z;  1VQK 1;  3H3V J;  2DE6 A;  2M48 A;  2JA8 I;  3I55 Z;  3VMI A;  2KI7 B;  2PK7 A;  1JJ2 Z;  5IT9 b;  4A3I I;  3CMA Z;  1LQL A;  1QYP A;  2GTH A;  1RNI A;  4A3K I;  1VQ8 Z;  1NP6 A;  1Z01 A;  2QKD A;  4XX2 A;  3Q87 A;  4NB9 A;  1KC8 1;  3GTP I;  2RBL A;  1M1K 1;  2EGT A;  3G6E 1;  2O4H A;  3S1Q I;  3H0G I;  3HOU I;  2QA4 1;  1Y1W I;  3CC2 1;  5FLX b;  1S72 Z;  5C3E I;  1VQN 1;  3GKQ A;  4NBD A;  1VQ6 1;  1WW9 A;  3JAM f;  4DQY B;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...