3PO2I

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I02
3S1NI 3VMGA 3GTMS 4A3KI 3S14I 3HOVI 2PK7A 3Q87A 4NBDA 3S15I 4X6AI 4QTTA 3HOYI 2JR6A 2NVTI 2BJOA 3S1RI 1Y1WI 1TWGI 2E2HI 4NOZA 4NB9A 4Y7NI 3S2DI 3VMHA 2JS4A 3GTGI 2R92I 1R9TI 3GCFA 4A3DI 1ZB8A 4A3LI 3FKII 4NBGA 3HOWI 3I4NI 3H3VJ 5C3EI 3PO3I 1ZB9A 4A3BI 4BBRI 1QYPA 1TWFI 3CQZI 4NBBA 1RLYA 2AKLA 2RBLA 1PFTA 3GTJI 3ESWA 5C44I 2DE6A 3GTQI 2YU9I 1N2FA 3H0GI 1I3QI 2JA8I 4QTUA 3S2HI 4A3II 3VB9A 3PO3S 2P3YA 2KPIA 4NB8A 3EERA 2DE5A 4NBEA 3HOUI 3GTKI 2E2JI 3GTLI 3LUSA 1YUAA 1DL6A 3HOXI 2J6AA 4NBCA 5C4XI 4BXXI 1X3ZA 3HOZI 4A3CI 1TWCI 4NBFA 2R7ZI 1WW9A 2F4MA 3S17I 4A3FI 1USPB 2JNYA 5CM2M 1TFIA 1LQLA 5IP7I 3U50C 1I6HI 1SFOI 2F4OA 1I50I 4Y52I 5C4JI 1Y1VI 3PO2I 4MH4A 3RZDI 1L1OC 2HF1A 5IP9I 3K7AI 3M3YI 4A93I 1WCMI 2K5RA 2JA6I 4BY7I 1VLAA 2NVXI 4A3JI 3D6WA 3S1QI 1ML8A 4XX2A 5FLMI 3S16I 4BBSI 4A3GI 2NVYI 2JA7I 2NVQI 1NUIA 1Y1VS 4A3MI 2E2II 3VMIA 3GTMI 3RZOI 1TWAI 3I07A 3M4OI 2JA5I 3GTOI 1USPA 2B63I 4BY1I 3GTPI 1TWHI 2VUMI 4A3EI 3S1MI 1K83I 2R93I 4NBHA 3GKQA 1X3WA 3I4MI 4NBAA 1RO4A 2DE7A
chains in the Genus database with same CATH superfamily
3S1NI 3G71Z 4MD9A 2PK7A 3S15I 3CCSZ 3CC21 2VUGA 3J81b 2IZ4A 2NVTI 3J81f 2JMOA 4MXUA 2E2HI 4RVGA 3CCM1 1SIWA 3CD61 2PM9A 2R92I 1YJ91 3NH5A 3FKII 1WJ2A 4NBGA 3I4NI 1ZB9A 4BBRI 1QYPA 4E2XA 2AKLA 5A2Qb 4MRIA 3MONA 5A2Qf 2G2KA 1PFTA 2VF1A 1AA6A 3GTJI 3CMA1 1VQP1 3CCJZ 4E33A 1RO2A 1W2BY 3NDJA 3EERA 3CPWY 2EGTA 3MZLB 3CCVZ 2H85A 5T64A 3I551 4MD8A 5C4XI 4BXXI 2W04A 3QWUA 1K8A1 1VQ81 2RHBA 1VQO1 2QLVB 2VPXA 1YJWZ 2E7ZA 2M6NA 2F4MA 1QVGY 3HKZA 4HH4A 2O53A 2JNYA 3G711 3J7A4 2GTIA 2VPZA 1LQLA 3CCS1 2VPYA 1VQ91 2F4OA 1Y1VI 1L1OC 4MD7A 3M3YI 3MZKB 2K5RA 1YHQZ 3CCMZ 4RVDA 2JIQA 3BG1B 3FQMA 4A3JI 3S1QI 4BBSI 3S16I 2JA7I 2NVQI 2GU2A 3F3FC 1KQSZ 3IX0A 3CCU1 3I07A 3GTOI 1USPA 1M1K2 1KRLA 2GTHA 3OW2Y 2R93I 3CCE1 1Q16A 3KIHA 2DE7A 1QVFY 1M1K1 1M902 3GTMS 3CCJ1 3HOVI 4NBDA 3CCRZ 4X6AI 3KIFA 2WAQA 4AYBA 1M901 2AYDA 1TWGI 1N8R2 4TNUA 3CCV1 3CXCZ 2OTL1 4Y7NI 3S2DI 4S1TA 2V45A 1VQM1 2QA41 1VQ8Z 1WZNA 2JS4A 1Z03A 1VQOZ 1Z01A 3CC41 4A3LI 3H3VJ 1NJI2 4A3BI 3CQZI 1RLYA 4NFRA 3G4S1 2RBLA 1JJ2Y 1VQ9Z 2R6MA 4E2WA 3ESWA 4RVFA 3CMEZ 4HGZA 4E30A 1I3QI 1NJI1 4QTUA 3CC7Z 1YHQ1 1KQSY 3PO3S 2KPIA 4NB8A 1K9M2 3J80b 3J80f 4RS4A 3GTKI 3CCUZ 3IFUA 1DL6A 1S7MA 1K9M1 1VQLZ 3HOZI 1KD12 2V8JA 3CCEZ 1VQN1 2RT9A 1USPB 4RVHA 1KD11 1TFIA 3CCR1 1I6HI 1SFOI 1YUKA 4Y52I 5C4JI 3PO2I 3RZDI 2LFUA 2HF1A 2OTLZ 1WCMI 1VLAA 1VQMZ 3CCLZ 2QA4Z 1Q862 1VQ51 4A3GI 3D9XA 3CC4Z 4CL1A 2LIYA 2E2II 3GTMI 3M4OI 2JA5I 3GTPI 1Q861 1ZH1A 3TDHB 4A3EI 3NH4A 1Z02A 3G4SZ 1X3WA 4E32A 2I3CA 3CME1 3S14I 2ZAEB 1Q812 4QTTA 3CC71 3HOYI 2JR6A 1Y1WI 1Q811 5T6BA 2W03A 4NB9A 2YADA 5T67A 1YJN1 2JIMA 2V8IA 2HU9A 5FLXb 2QR1B 1VQL1 5FLXf 1R9TI 3GCFA 1VQNZ 4A3DI 3HOWI 1VQ61 3PO3I 2PMZA 4NBBA 2QRCB 3NDIA 2RIQA 2DE6A 2KI7B 3GTQI 3H0GI 2E9HA 2V3VA 2Y0SA 3S2HI 3VB9A 2QRDB 3P5JB 3CCL1 1VQ5Z 3G6EZ 1N8R1 1FDIA 1VQ71 3GTLI 3LUSA 3T4NB 1YUAA 3CCQ1 1WIIA 1X3ZA 1Y8CA 3VTNA 4A3CI 4NBFA 4RV9A 2R7ZI 1WW9A 3S17I 2IZ3A 1W2BZ 2O4HA 3IR7A 5CM2M 1YITZ 3NH8A 1NP6A 1RNIA 3I56Z 2M48A 5D1OA 4MH4A 1S72Z 1YIJZ 2Q4ZA 1KC82 3K7AI 2JA6I 1YJNZ 1FDOA 1QVGZ 3D2LA 4XX2A 5FLMI 2JIPA 1KC81 1NUIA 4A3MI 3RZOI 3VMIA 4DGLA 1VQ6Z 3BG0B 1K83I 3F3PC 3CXCY 4NBHA 2P28A 4NBAA 4E31A 1RO4A 2VPWA 2V8KA 3VMGA 4A3KI 1RO0A 2QREB 3Q87A 4DQYB 5AN9F 2BJOA 3S1RI 3G6E1 1VQ7Z 3OW2Z 1Q7Y2 4NOZA 1VQKZ 3CCQZ 2QKDA 3VMHA 1QVFZ 3FQQA 1K8A2 3GTGI 5D1PA 1Q7Y1 1ZB8A 1YI2Z 2OOYB 1P9NA 2QEXZ 2NAPA 5IT9b 2OTJ1 5C3EI 5IT9f 1YIT1 1TWFI 4EWCA 1VQ41 4E2ZA 3TE5B 5C44I 3I561 2RPRA 2YU9I 1N2FA 2JUBA 1S721 1YIJ1 2JA8I 2OZKA 4HGYA 3CC2Z 4A3II 2P3YA 2DE5A 2JIRA 5D1OB 4NBEA 3HOUI 5LL6f 2E2JI 2K3RA 1JJ2Z 3IF8A 3HOXI 2J6AA 2OOXB 2WB1A 4NBCA 3CD6Z 4NH1C 1TWCI 1K732 2LEXA 1X0TA 1YJ9Z 4A3FI 1QF8A 5IP7I 1K731 3U50C 3NFZA 1I50I 3CMAZ 1VQPZ 3JAMb 5IP9I 4A93I 3JAMf 3EEDA 4BY7I 1VQK1 2NVXI 3D6WA 1ML8A 4DK1A 2Q51A 2NVYI 1RQFA 1Y1VS 2JIOA 1JWHC 1YI21 2QEX1 1TWAI 1Q822 3I55Z 4BY1I 2B63I 1TWHI 2OTJZ 2VUMI 4MONA 1QXFA 3CPWZ 3S1MI 2IV2X 4E2YA 1VQ4Z 3GKQA 1YJW1 3I4MI 1Q821
chains in the Genus database with same CATH topology
3S1NI 3G71Z 4MD9A 2PK7A 3S15I 3CCSZ 3CC21 2VUGA 3J81b 2IZ4A 2NVTI 3J81f 2JMOA 4MXUA 2E2HI 4RVGA 3CCM1 3CD61 2PM9A 2R92I 1YJ91 3NH5A 3FKII 4NBGA 3I4NI 1ZB9A 4BBRI 1QYPA 4E2XA 2AKLA 5A2Qb 4MRIA 3MONA 5A2Qf 2G2KA 1PFTA 2VF1A 3GTJI 3CMA1 1VQP1 3CCJZ 4E33A 1RO2A 1W2BY 3NDJA 3EERA 3CPWY 2EGTA 3MZLB 3CCVZ 2H85A 5T64A 3I551 4MD8A 5C4XI 4BXXI 2W04A 3QWUA 1K8A1 1VQ81 2RHBA 1VQO1 2QLVB 1YJWZ 2M6NA 2F4MA 1QVGY 3HKZA 4HH4A 2O53A 2JNYA 3G711 3J7A4 2GTIA 1LQLA 3CCS1 1VQ91 2F4OA 1Y1VI 1L1OC 4MD7A 3M3YI 3MZKB 2K5RA 1YHQZ 3CCMZ 4RVDA 3BG1B 3FQMA 4A3JI 3S1QI 4BBSI 3S16I 2JA7I 2NVQI 2GU2A 3F3FC 1KQSZ 3IX0A 3CCU1 3I07A 3GTOI 1USPA 1M1K2 1KRLA 2GTHA 3OW2Y 2R93I 3CCE1 3KIHA 2DE7A 1QVFY 1M1K1 1M902 3GTMS 3CCJ1 3HOVI 4NBDA 3CCRZ 4X6AI 3KIFA 2WAQA 4AYBA 1M901 1TWGI 1N8R2 4TNUA 3CCV1 3CXCZ 2OTL1 4Y7NI 3S2DI 4S1TA 1VQM1 2QA41 1VQ8Z 2JS4A 1Z03A 1VQOZ 1Z01A 3CC41 4A3LI 3H3VJ 1NJI2 4A3BI 3CQZI 1RLYA 4NFRA 3G4S1 2RBLA 1JJ2Y 1VQ9Z 2R6MA 4E2WA 3ESWA 4RVFA 3CMEZ 4HGZA 4E30A 1I3QI 1NJI1 4QTUA 3CC7Z 1YHQ1 1KQSY 3PO3S 2KPIA 4NB8A 1K9M2 3J80b 3J80f 4RS4A 3GTKI 3CCUZ 3IFUA 1DL6A 1S7MA 1K9M1 1VQLZ 3HOZI 1KD12 2V8JA 3CCEZ 1VQN1 2RT9A 1USPB 4RVHA 1KD11 1TFIA 3CCR1 1I6HI 1SFOI 1YUKA 4Y52I 5C4JI 3PO2I 3RZDI 2LFUA 2HF1A 2OTLZ 1WCMI 1VLAA 1VQMZ 3CCLZ 2QA4Z 1Q862 1VQ51 4A3GI 3D9XA 3CC4Z 4CL1A 2LIYA 2E2II 3GTMI 3M4OI 2JA5I 3GTPI 1Q861 1ZH1A 3TDHB 4A3EI 3NH4A 1Z02A 3G4SZ 1X3WA 4E32A 2I3CA 3CME1 3S14I 2ZAEB 1Q812 4QTTA 3CC71 3HOYI 2JR6A 1Y1WI 1Q811 5T6BA 2W03A 4NB9A 2YADA 5T67A 1YJN1 2V8IA 2HU9A 5FLXb 2QR1B 1VQL1 5FLXf 1R9TI 3GCFA 1VQNZ 4A3DI 3HOWI 1VQ61 3PO3I 2PMZA 4NBBA 2QRCB 3NDIA 2RIQA 2DE6A 2KI7B 3GTQI 3H0GI 2E9HA 2Y0SA 3S2HI 3VB9A 2QRDB 3P5JB 3CCL1 1VQ5Z 3G6EZ 1N8R1 1VQ71 3GTLI 3LUSA 3T4NB 1YUAA 3CCQ1 1WIIA 1X3ZA 3VTNA 4A3CI 4NBFA 4RV9A 2R7ZI 1WW9A 3S17I 2IZ3A 1W2BZ 2O4HA 5CM2M 1YITZ 3NH8A 1NP6A 1RNIA 3I56Z 2M48A 5D1OA 4MH4A 1S72Z 1YIJZ 2Q4ZA 1KC82 3K7AI 2JA6I 1YJNZ 1QVGZ 4XX2A 5FLMI 1KC81 1NUIA 4A3MI 3RZOI 3VMIA 4DGLA 1VQ6Z 3BG0B 1K83I 3F3PC 3CXCY 4NBHA 2P28A 4NBAA 4E31A 1RO4A 2V8KA 3VMGA 4A3KI 1RO0A 2QREB 3Q87A 4DQYB 5AN9F 2BJOA 3S1RI 3G6E1 1VQ7Z 3OW2Z 1Q7Y2 4NOZA 1VQKZ 3CCQZ 2QKDA 3VMHA 1QVFZ 3FQQA 1K8A2 3GTGI 5D1PA 1Q7Y1 1ZB8A 1YI2Z 2OOYB 1P9NA 2QEXZ 5IT9b 2OTJ1 5C3EI 5IT9f 1YIT1 1TWFI 4EWCA 1VQ41 4E2ZA 3TE5B 5C44I 3I561 2RPRA 2YU9I 1N2FA 2JUBA 1S721 1YIJ1 2JA8I 2OZKA 4HGYA 3CC2Z 4A3II 2P3YA 2DE5A 5D1OB 4NBEA 3HOUI 5LL6f 2E2JI 2K3RA 1JJ2Z 3IF8A 3HOXI 2J6AA 2OOXB 2WB1A 4NBCA 3CD6Z 4NH1C 1TWCI 1K732 1YJ9Z 1X0TA 4A3FI 1QF8A 5IP7I 1K731 3U50C 3NFZA 1I50I 3CMAZ 1VQPZ 3JAMb 5IP9I 4A93I 3JAMf 3EEDA 4BY7I 1VQK1 2NVXI 3D6WA 1ML8A 4DK1A 2Q51A 2NVYI 1RQFA 1Y1VS 1JWHC 1YI21 2QEX1 1TWAI 1Q822 3I55Z 4BY1I 2B63I 1TWHI 2OTJZ 2VUMI 4MONA 3CPWZ 3S1MI 4E2YA 1VQ4Z 3GKQA 1YJW1 3I4MI 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N I;  3VMG A;  3GTM S;  4A3K I;  3S14 I;  3HOV I;  2PK7 A;  3Q87 A;  4NBD A;  3S15 I;  4X6A I;  4QTT A;  3HOY I;  2JR6 A;  2NVT I;  2BJO A;  3S1R I;  1Y1W I;  1TWG I;  2E2H I;  4NOZ A;  4NB9 A;  4Y7N I;  3S2D I;  3VMH A;  2JS4 A;  3GTG I;  2R92 I;  1R9T I;  3GCF A;  4A3D I;  1ZB8 A;  4A3L I;  3FKI I;  4NBG A;  3HOW I;  3I4N I;  3H3V J;  5C3E I;  3PO3 I;  1ZB9 A;  4A3B I;  4BBR I;  1QYP A;  1TWF I;  3CQZ I;  4NBB A;  1RLY A;  2AKL A;  2RBL A;  1PFT A;  3GTJ I;  3ESW A;  5C44 I;  2DE6 A;  3GTQ I;  2YU9 I;  1N2F A;  3H0G I;  1I3Q I;  2JA8 I;  4QTU A;  3S2H I;  4A3I I;  3VB9 A;  3PO3 S;  2P3Y A;  2KPI A;  4NB8 A;  3EER A;  2DE5 A;  4NBE A;  3HOU I;  3GTK I;  2E2J I;  3GTL I;  3LUS A;  1YUA A;  1DL6 A;  3HOX I;  2J6A A;  4NBC A;  5C4X I;  4BXX I;  1X3Z A;  3HOZ I;  4A3C I;  1TWC I;  4NBF A;  2R7Z I;  1WW9 A;  2F4M A;  3S17 I;  4A3F I;  1USP B;  2JNY A;  5CM2 M;  1TFI A;  1LQL A;  5IP7 I;  3U50 C;  1I6H I;  1SFO I;  2F4O A;  1I50 I;  4Y52 I;  5C4J I;  1Y1V I;  3PO2 I;  4MH4 A;  3RZD I;  1L1O C;  2HF1 A;  5IP9 I;  3K7A I;  3M3Y I;  4A93 I;  1WCM I;  2K5R A;  2JA6 I;  4BY7 I;  1VLA A;  2NVX I;  4A3J I;  3D6W A;  3S1Q I;  1ML8 A;  4XX2 A;  5FLM I;  3S16 I;  4BBS I;  4A3G I;  2NVY I;  2JA7 I;  2NVQ I;  1NUI A;  1Y1V S;  4A3M I;  2E2I I;  3VMI A;  3GTM I;  3RZO I;  1TWA I;  3I07 A;  3M4O I;  2JA5 I;  3GTO I;  1USP A;  2B63 I;  4BY1 I;  3GTP I;  1TWH I;  2VUM I;  4A3E I;  3S1M I;  1K83 I;  2R93 I;  4NBH A;  3GKQ A;  1X3W A;  3I4M I;  4NBA A;  1RO4 A;  2DE7 A; 
#chains in the Genus database with same CATH topology
 3S1N I;  3G71 Z;  4MD9 A;  2PK7 A;  3S15 I;  3CCS Z;  3CC2 1;  2VUG A;  3J81 b;  2IZ4 A;  2NVT I;  3J81 f;  2JMO A;  4MXU A;  2E2H I;  4RVG A;  3CCM 1;  1SIW A;  3CD6 1;  2PM9 A;  2R92 I;  1YJ9 1;  3NH5 A;  3FKI I;  1WJ2 A;  4NBG A;  3I4N I;  1ZB9 A;  4BBR I;  1QYP A;  4E2X A;  2AKL A;  5A2Q b;  4MRI A;  3MON A;  5A2Q f;  2G2K A;  1PFT A;  2VF1 A;  1AA6 A;  3GTJ I;  3CMA 1;  1VQP 1;  3CCJ Z;  4E33 A;  1RO2 A;  1W2B Y;  3NDJ A;  3EER A;  3CPW Y;  2EGT A;  3MZL B;  3CCV Z;  2H85 A;  5T64 A;  3I55 1;  4MD8 A;  5C4X I;  4BXX I;  2W04 A;  3QWU A;  1K8A 1;  1VQ8 1;  2RHB A;  1VQO 1;  2QLV B;  2VPX A;  1YJW Z;  2E7Z A;  2M6N A;  2F4M A;  1QVG Y;  3HKZ A;  4HH4 A;  2O53 A;  2JNY A;  3G71 1;  3J7A 4;  2GTI A;  2VPZ A;  1LQL A;  3CCS 1;  2VPY A;  1VQ9 1;  2F4O A;  1Y1V I;  1L1O C;  4MD7 A;  3M3Y I;  3MZK B;  2K5R A;  1YHQ Z;  3CCM Z;  4RVD A;  2JIQ A;  3BG1 B;  3FQM A;  4A3J I;  3S1Q I;  4BBS I;  3S16 I;  2JA7 I;  2NVQ I;  2GU2 A;  3F3F C;  1KQS Z;  3IX0 A;  3CCU 1;  3I07 A;  3GTO I;  1USP A;  1M1K 2;  1KRL A;  2GTH A;  3OW2 Y;  2R93 I;  3CCE 1;  1Q16 A;  3KIH A;  2DE7 A;  1QVF Y;  1M1K 1;  1M90 2;  3GTM S;  3CCJ 1;  3HOV I;  4NBD A;  3CCR Z;  4X6A I;  3KIF A;  2WAQ A;  4AYB A;  1M90 1;  2AYD A;  1TWG I;  1N8R 2;  4TNU A;  3CCV 1;  3CXC Z;  2OTL 1;  4Y7N I;  3S2D I;  4S1T A;  2V45 A;  1VQM 1;  2QA4 1;  1VQ8 Z;  1WZN A;  2JS4 A;  1Z03 A;  1VQO Z;  1Z01 A;  3CC4 1;  4A3L I;  3H3V J;  1NJI 2;  4A3B I;  3CQZ I;  1RLY A;  4NFR A;  3G4S 1;  2RBL A;  1JJ2 Y;  1VQ9 Z;  2R6M A;  4E2W A;  3ESW A;  4RVF A;  3CME Z;  4HGZ A;  4E30 A;  1I3Q I;  1NJI 1;  4QTU A;  3CC7 Z;  1YHQ 1;  1KQS Y;  3PO3 S;  2KPI A;  4NB8 A;  1K9M 2;  3J80 b;  3J80 f;  4RS4 A;  3GTK I;  3CCU Z;  3IFU A;  1DL6 A;  1S7M A;  1K9M 1;  1VQL Z;  3HOZ I;  1KD1 2;  2V8J A;  3CCE Z;  1VQN 1;  2RT9 A;  1USP B;  4RVH A;  1KD1 1;  1TFI A;  3CCR 1;  1I6H I;  1SFO I;  1YUK A;  4Y52 I;  5C4J I;  3PO2 I;  3RZD I;  2LFU A;  2HF1 A;  2OTL Z;  1WCM I;  1VLA A;  1VQM Z;  3CCL Z;  2QA4 Z;  1Q86 2;  1VQ5 1;  4A3G I;  3D9X A;  3CC4 Z;  4CL1 A;  2LIY A;  2E2I I;  3GTM I;  3M4O I;  2JA5 I;  3GTP I;  1Q86 1;  1ZH1 A;  3TDH B;  4A3E I;  3NH4 A;  1Z02 A;  3G4S Z;  1X3W A;  4E32 A;  2I3C A;  3CME 1;  3S14 I;  2ZAE B;  1Q81 2;  4QTT A;  3CC7 1;  3HOY I;  2JR6 A;  1Y1W I;  1Q81 1;  5T6B A;  2W03 A;  4NB9 A;  2YAD A;  5T67 A;  1YJN 1;  2JIM A;  2V8I A;  2HU9 A;  5FLX b;  2QR1 B;  1VQL 1;  5FLX f;  1R9T I;  3GCF A;  1VQN Z;  4A3D I;  3HOW I;  1VQ6 1;  3PO3 I;  2PMZ A;  4NBB A;  2QRC B;  3NDI A;  2RIQ A;  2DE6 A;  2KI7 B;  3GTQ I;  3H0G I;  2E9H A;  2V3V A;  2Y0S A;  3S2H I;  3VB9 A;  2QRD B;  3P5J B;  3CCL 1;  1VQ5 Z;  3G6E Z;  1N8R 1;  1FDI A;  1VQ7 1;  3GTL I;  3LUS A;  3T4N B;  1YUA A;  3CCQ 1;  1WII A;  1X3Z A;  1Y8C A;  3VTN A;  4A3C I;  4NBF A;  4RV9 A;  2R7Z I;  1WW9 A;  3S17 I;  2IZ3 A;  1W2B Z;  2O4H A;  3IR7 A;  5CM2 M;  1YIT Z;  3NH8 A;  1NP6 A;  1RNI A;  3I56 Z;  2M48 A;  5D1O A;  4MH4 A;  1S72 Z;  1YIJ Z;  2Q4Z A;  1KC8 2;  3K7A I;  2JA6 I;  1YJN Z;  1FDO A;  1QVG Z;  3D2L A;  4XX2 A;  5FLM I;  2JIP A;  1KC8 1;  1NUI A;  4A3M I;  3RZO I;  3VMI A;  4DGL A;  1VQ6 Z;  3BG0 B;  1K83 I;  3F3P C;  3CXC Y;  4NBH A;  2P28 A;  4NBA A;  4E31 A;  1RO4 A;  2VPW A;  2V8K A;  3VMG A;  4A3K I;  1RO0 A;  2QRE B;  3Q87 A;  4DQY B;  5AN9 F;  2BJO A;  3S1R I;  3G6E 1;  1VQ7 Z;  3OW2 Z;  1Q7Y 2;  4NOZ A;  1VQK Z;  3CCQ Z;  2QKD A;  3VMH A;  1QVF Z;  3FQQ A;  1K8A 2;  3GTG I;  5D1P A;  1Q7Y 1;  1ZB8 A;  1YI2 Z;  2OOY B;  1P9N A;  2QEX Z;  2NAP A;  5IT9 b;  2OTJ 1;  5C3E I;  5IT9 f;  1YIT 1;  1TWF I;  4EWC A;  1VQ4 1;  4E2Z A;  3TE5 B;  5C44 I;  3I56 1;  2RPR A;  2YU9 I;  1N2F A;  2JUB A;  1S72 1;  1YIJ 1;  2JA8 I;  2OZK A;  4HGY A;  3CC2 Z;  4A3I I;  2P3Y A;  2DE5 A;  2JIR A;  5D1O B;  4NBE A;  3HOU I;  5LL6 f;  2E2J I;  2K3R A;  1JJ2 Z;  3IF8 A;  3HOX I;  2J6A A;  2OOX B;  2WB1 A;  4NBC A;  3CD6 Z;  4NH1 C;  1TWC I;  1K73 2;  2LEX A;  1X0T A;  1YJ9 Z;  4A3F I;  1QF8 A;  5IP7 I;  1K73 1;  3U50 C;  3NFZ A;  1I50 I;  3CMA Z;  1VQP Z;  3JAM b;  5IP9 I;  4A93 I;  3JAM f;  3EED A;  4BY7 I;  1VQK 1;  2NVX I;  3D6W A;  1ML8 A;  4DK1 A;  2Q51 A;  2NVY I;  1RQF A;  1Y1V S;  2JIO A;  1JWH C;  1YI2 1;  2QEX 1;  1TWA I;  1Q82 2;  3I55 Z;  4BY1 I;  2B63 I;  1TWH I;  2OTJ Z;  2VUM I;  4MON A;  1QXF A;  3CPW Z;  3S1M I;  2IV2 X;  4E2Y A;  1VQ4 Z;  3GKQ A;  1YJW 1;  3I4M I;  1Q82 1; 
#chains in the Genus database with same CATH homology
 3S1N I;  3G71 Z;  4MD9 A;  2PK7 A;  3S15 I;  3CCS Z;  3CC2 1;  2VUG A;  3J81 b;  2IZ4 A;  2NVT I;  3J81 f;  2JMO A;  4MXU A;  2E2H I;  4RVG A;  3CCM 1;  3CD6 1;  2PM9 A;  2R92 I;  1YJ9 1;  3NH5 A;  3FKI I;  4NBG A;  3I4N I;  1ZB9 A;  4BBR I;  1QYP A;  4E2X A;  2AKL A;  5A2Q b;  4MRI A;  3MON A;  5A2Q f;  2G2K A;  1PFT A;  2VF1 A;  3GTJ I;  3CMA 1;  1VQP 1;  3CCJ Z;  4E33 A;  1RO2 A;  1W2B Y;  3NDJ A;  3EER A;  3CPW Y;  2EGT A;  3MZL B;  3CCV Z;  2H85 A;  5T64 A;  3I55 1;  4MD8 A;  5C4X I;  4BXX I;  2W04 A;  3QWU A;  1K8A 1;  1VQ8 1;  2RHB A;  1VQO 1;  2QLV B;  1YJW Z;  2M6N A;  2F4M A;  1QVG Y;  3HKZ A;  4HH4 A;  2O53 A;  2JNY A;  3G71 1;  3J7A 4;  2GTI A;  1LQL A;  3CCS 1;  1VQ9 1;  2F4O A;  1Y1V I;  1L1O C;  4MD7 A;  3M3Y I;  3MZK B;  2K5R A;  1YHQ Z;  3CCM Z;  4RVD A;  3BG1 B;  3FQM A;  4A3J I;  3S1Q I;  4BBS I;  3S16 I;  2JA7 I;  2NVQ I;  2GU2 A;  3F3F C;  1KQS Z;  3IX0 A;  3CCU 1;  3I07 A;  3GTO I;  1USP A;  1M1K 2;  1KRL A;  2GTH A;  3OW2 Y;  2R93 I;  3CCE 1;  3KIH A;  2DE7 A;  1QVF Y;  1M1K 1;  1M90 2;  3GTM S;  3CCJ 1;  3HOV I;  4NBD A;  3CCR Z;  4X6A I;  3KIF A;  2WAQ A;  4AYB A;  1M90 1;  1TWG I;  1N8R 2;  4TNU A;  3CCV 1;  3CXC Z;  2OTL 1;  4Y7N I;  3S2D I;  4S1T A;  1VQM 1;  2QA4 1;  1VQ8 Z;  2JS4 A;  1Z03 A;  1VQO Z;  1Z01 A;  3CC4 1;  4A3L I;  3H3V J;  1NJI 2;  4A3B I;  3CQZ I;  1RLY A;  4NFR A;  3G4S 1;  2RBL A;  1JJ2 Y;  1VQ9 Z;  2R6M A;  4E2W A;  3ESW A;  4RVF A;  3CME Z;  4HGZ A;  4E30 A;  1I3Q I;  1NJI 1;  4QTU A;  3CC7 Z;  1YHQ 1;  1KQS Y;  3PO3 S;  2KPI A;  4NB8 A;  1K9M 2;  3J80 b;  3J80 f;  4RS4 A;  3GTK I;  3CCU Z;  3IFU A;  1DL6 A;  1S7M A;  1K9M 1;  1VQL Z;  3HOZ I;  1KD1 2;  2V8J A;  3CCE Z;  1VQN 1;  2RT9 A;  1USP B;  4RVH A;  1KD1 1;  1TFI A;  3CCR 1;  1I6H I;  1SFO I;  1YUK A;  4Y52 I;  5C4J I;  3PO2 I;  3RZD I;  2LFU A;  2HF1 A;  2OTL Z;  1WCM I;  1VLA A;  1VQM Z;  3CCL Z;  2QA4 Z;  1Q86 2;  1VQ5 1;  4A3G I;  3D9X A;  3CC4 Z;  4CL1 A;  2LIY A;  2E2I I;  3GTM I;  3M4O I;  2JA5 I;  3GTP I;  1Q86 1;  1ZH1 A;  3TDH B;  4A3E I;  3NH4 A;  1Z02 A;  3G4S Z;  1X3W A;  4E32 A;  2I3C A;  3CME 1;  3S14 I;  2ZAE B;  1Q81 2;  4QTT A;  3CC7 1;  3HOY I;  2JR6 A;  1Y1W I;  1Q81 1;  5T6B A;  2W03 A;  4NB9 A;  2YAD A;  5T67 A;  1YJN 1;  2V8I A;  2HU9 A;  5FLX b;  2QR1 B;  1VQL 1;  5FLX f;  1R9T I;  3GCF A;  1VQN Z;  4A3D I;  3HOW I;  1VQ6 1;  3PO3 I;  2PMZ A;  4NBB A;  2QRC B;  3NDI A;  2RIQ A;  2DE6 A;  2KI7 B;  3GTQ I;  3H0G I;  2E9H A;  2Y0S A;  3S2H I;  3VB9 A;  2QRD B;  3P5J B;  3CCL 1;  1VQ5 Z;  3G6E Z;  1N8R 1;  1VQ7 1;  3GTL I;  3LUS A;  3T4N B;  1YUA A;  3CCQ 1;  1WII A;  1X3Z A;  3VTN A;  4A3C I;  4NBF A;  4RV9 A;  2R7Z I;  1WW9 A;  3S17 I;  2IZ3 A;  1W2B Z;  2O4H A;  5CM2 M;  1YIT Z;  3NH8 A;  1NP6 A;  1RNI A;  3I56 Z;  2M48 A;  5D1O A;  4MH4 A;  1S72 Z;  1YIJ Z;  2Q4Z A;  1KC8 2;  3K7A I;  2JA6 I;  1YJN Z;  1QVG Z;  4XX2 A;  5FLM I;  1KC8 1;  1NUI A;  4A3M I;  3RZO I;  3VMI A;  4DGL A;  1VQ6 Z;  3BG0 B;  1K83 I;  3F3P C;  3CXC Y;  4NBH A;  2P28 A;  4NBA A;  4E31 A;  1RO4 A;  2V8K A;  3VMG A;  4A3K I;  1RO0 A;  2QRE B;  3Q87 A;  4DQY B;  5AN9 F;  2BJO A;  3S1R I;  3G6E 1;  1VQ7 Z;  3OW2 Z;  1Q7Y 2;  4NOZ A;  1VQK Z;  3CCQ Z;  2QKD A;  3VMH A;  1QVF Z;  3FQQ A;  1K8A 2;  3GTG I;  5D1P A;  1Q7Y 1;  1ZB8 A;  1YI2 Z;  2OOY B;  1P9N A;  2QEX Z;  5IT9 b;  2OTJ 1;  5C3E I;  5IT9 f;  1YIT 1;  1TWF I;  4EWC A;  1VQ4 1;  4E2Z A;  3TE5 B;  5C44 I;  3I56 1;  2RPR A;  2YU9 I;  1N2F A;  2JUB A;  1S72 1;  1YIJ 1;  2JA8 I;  2OZK A;  4HGY A;  3CC2 Z;  4A3I I;  2P3Y A;  2DE5 A;  5D1O B;  4NBE A;  3HOU I;  5LL6 f;  2E2J I;  2K3R A;  1JJ2 Z;  3IF8 A;  3HOX I;  2J6A A;  2OOX B;  2WB1 A;  4NBC A;  3CD6 Z;  4NH1 C;  1TWC I;  1K73 2;  1YJ9 Z;  1X0T A;  4A3F I;  1QF8 A;  5IP7 I;  1K73 1;  3U50 C;  3NFZ A;  1I50 I;  3CMA Z;  1VQP Z;  3JAM b;  5IP9 I;  4A93 I;  3JAM f;  3EED A;  4BY7 I;  1VQK 1;  2NVX I;  3D6W A;  1ML8 A;  4DK1 A;  2Q51 A;  2NVY I;  1RQF A;  1Y1V S;  1JWH C;  1YI2 1;  2QEX 1;  1TWA I;  1Q82 2;  3I55 Z;  4BY1 I;  2B63 I;  1TWH I;  2OTJ Z;  2VUM I;  4MON A;  3CPW Z;  3S1M I;  4E2Y A;  1VQ4 Z;  3GKQ A;  1YJW 1;  3I4M I;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...