2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
b'MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mercuric transport protein periplasmic component
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
2HU9A 4E6KG 1Y56A
chains in the Genus database with same CATH superfamily
2VOPA 2DA1A 3CC21 1QHGA 2EA2A 4ESFA 2I8DA 1IDZA 3WG9A 3OMYA 1BC7C 3ERMA 4MQ9F 3HUGB 4I01A 2ZAEB 2HS5A 4AM3A 1YI2Z 4XLNF 3IRQA 4HX8A 3H0DA 1ETOA 3DEEA 3ZMTA 4ZH4F 1D5VA 2CSOA 1OCZH 3L2WA 2DFIA 5HVQC 2BVLA 1FTTA 2MFZA 5DCMA 3CCQZ 3ZQFA 1XCVA 1WJEA 3QYBA 4BKXA 4YFKF 2GTIA 5D1OA 3BCBA 4OINF 3SDGA 4WXDA 2ECBA 2HI3A 4KT6A 1O3RA 1KU7A 1FY7A 5BPIA 1VQOI 4BYYA 3HPGA 2E35A 2RKHA 3F9KA 2MBFA 1ODDA 1YW7A 2E71A 3ZQCA 1P7JA 1IRFA 4IF4A 2XGXA 3A4CA 4DBQA 3HJEA 4ZDPA 5AIQA 1YIJI 2E1MB 1UZCA 2YR2A 3O8GA 5HS8A 1ZRFA 3CQZJ 2Q4ZA 2K5CA 2DMNA 4CHUA 2IS4A 1RZ4A 2JTVA 2FRHA 3A01B 3JTHA 4RLFA 3H3ZA 2ELJA 3CPWZ 2O7OA 2KIMA 1WJAA 1AOYA 1U2WA 2O3FA 1VQOZ 1S7EA 1X0TA 4IEJA 4EATA 3GLLA 2FF4A 3ELKA 3N05A 4Z2YA 3W2WA 3PIOF 3CCRI 1D5YA 3W6VA 1RO0A 4A3KI 3D5LA 3MVPA 5LRRA 5H20A 5IT9b 1GV5A 3M8JA 1VQ71 4CICA 2WY8Q 4RS8A 1Q7Y1 4O6JA 1FOKA 3GTPJ 2HWVA 3VYSB 4RAGA 3RPUA 1F5TA 3TL4X 1YIJZ 1YJ9Z 1Y6IA 4R1HA 4B3XA 3FISA 2CW0F 1ON2A 3HKZA 3FXQA 3FX3A 1KD12 2IA2A 2MH2A 4BHCA 2OTJ1 5LHHA 3AFHA 2WB1A 1YIT1 2X1CA 4KNYA 2JQ7A 4P9UA 1YW8A 5F04A 4BHPA 2DO7A 2FBIA 1WJBA 1CF7B 2AHQA 4UXNA 3CCRZ 3JRIA 4BH9A 4FX4A 1IGNA 2QA4I 3VYTB 2LG4A 2Z5UA 1SD7A 3IC7A 2GTHA 3P7NA 3FXMA 3RI4A 1FT9A 3S93A 3G4SI 1LUJB 3FBNB 3K1NA 3OYAA 1R71A 5GPAA 1F43A 2LTPA 4B4CA 3PQJA 2R7SA 4II3A 2AXTC 1Z7UA 3KEYA 2VUMI 4M3EA 2V26A 2F4OB 2KT0A 2KDOA 3OYGA 1PUEE 2D5VA 2NVXJ 2BJOA 3ZMZA 1BR4A 5E3OA 4CCJA 2FEZA 4Q4ZF 1HW1A 2BHZA 2XSDC 3GKQA 3CCSI 1BC8C 4A69C 1KU9A 2HDCA 3RCOA 4XICA 3NQOA 5D6FA 3KLOA 2QA4Z 2OCEA 2VKEA 3S1RJ 4UNOA 2VONA 5LGTA 1JGSA 2RNJA 3PQKA 3OW2Y 3ECHA 1HOMA 3G4SZ 1E2XA 1MBHA 1T39A 2D1VA 2M48A 2R5ZB 3BZCA 3DU5A 4MFEA 2ZO4A 2P8TA 2QREB 4LLGF 2A6EF 1TWCI 2L2OA 1XDSA 1J7KA 1IF1A 4A3FI 3TW7A 1E0EA 3VWBA 2G2KA 1T0FA 1U5TB 3GTOI 2JSPA 1LEBA 3FXKA 1TNTA 3E1SA 1HKSA 2MABA 4NUBA 2R92J 1SAUA 2E2II 3GZ6A 5FLXK 3ZQLA 3LSTA 1QU3A 1VQPI 1E17A 4W97A 5L3GA 2EWNA 1O3QA 3HZJA 3BR5A 1TW3A 4IOAF 3G1OA 5FRNA 3W2VA 4CA0A 1JUMA 2JVHA 2LY9A 3B02A 4LGWA 4LB6B 1HC8A 1BW6A 2W48A 4Y17A 3CF5F 4HLYA 1KQ9A 3PNYA 3DLAA 2VUGA 4ASNA 2XSJC 3LL7A 4GFBA 3CCUI 3IX0A 1Q812 5IYDJ 3JREA 3JRCA 5L3CA 2XKOA 3ZPLA 4UB6C 3S2DI 5D4SA 2A6HF 1Q1HA 2ZNYA 1CF7A 2HU9A 2ZMEC 3LSGA 2V3VA 2X9DA 5BNGA 3K9TA 4DYQA 2A6TA 3R0AA 2H1KA 4XRSG 1FPQA 3HOYI 1H89C 2JA8I 2COBA 3F6OA 2X1DA 3ZGKA 3PUBA 1JXSA 1NUIA 2RV8A 5HNHA 1BI1A 3G6E1 4HX4A 4UV8A 3CUQC 3CO6C 2PMUA 4KJZA 1QPMA 3A0HC 1K732 1RKWA 3GF2A 2HQAA 2IAIA 2R7TA 2F4OA 3CZ6A 3S1MJ 3ZCOA 1W0TA 2UUZA 3OYLA 3LA7A 4PDKA 2L9RA 1Y1WJ 2WA0A 4IOCF 4A3DI 1Y8QB 3AG3H 4M9SA 4A5NA 2WY7Q 3QPSA 4PCQA 2ZJRF 5FRMA 1LB2A 4KICA 4BJ5C 2VPLA 3W6KB 2K02A 4M9XA 3OY9A 3HOTA 1RI7A 2BY1A 1XMKA 2ELHA 4AC0A 3QPHA 2J6AA 1WGXA 1ZGJA 2H6BA 3MZLB 2EFQA 4GRIA 4BJTA 1XN7A 3A02A 3LA3A 2VBZA 2K86A 3VPRA 2CS3A 1W2BZ 2TCTA 3C2GA 2E5ZA 3LSHA 2WAQN 1ZG5A 2HR3A 4AUXA 3WTUC 2CV0A 4DZPA 1E3PA 5J47A 4ABZA 2LKXA 3BG7A 4Q5SF 3FMRA 3IR7A 2EV5A 3E5UA 1X1AA 1TQPA 1V54H 3ZQHA 4U0YA 2ZXJA 1J2XA 4P96A 4A2UA 4WXHA 2W00A 4ZTJA 1JI8A 2V8JA 1S3JA 2K4BA 2OPTA 2MLGA 4PGHA 3AL0C 4NBEA 1W7PB 2LH9A 5GAHJ 2F5CA 5E3NA 3CC7Z 4PZJA 1HCRA 2BW3A 5F08A 2L4MA 1K7AA 3QQAA 4GYIA 2QENA 2KLOA 1UCRA 4HEA2 5CQEA 4GO1A 3U1KA 1MNDA 1RPWA 2FE3A 4I0AA 5JHFA 2VE9A 1I6HI 2X6OA 3P9IA 1YW9A 5C44I 2EPFA 2AS5F 2DK5A 1FDIA 3GTMJ 3RKXA 3H5RA 1BOAA 3TKYA 3QYFA 1R36A 2OTJZ 1IN8A 2BZTA 3HRSA 1MJ9A 3OSFA 2QQBA 5GAEJ 3N97A 2XB5A 4BJ6C 3JSOA 2M2EA 1YG2A 4BXUA 1T08B 1UG2A 5DDGA 1KA8A 4LG3A 3OYNA 2HKOA 1IV8A 5M3MJ 3LAJA 3HOWJ 4NDLA 1JTYA 1BJAA 4KUMA 1VQ6I 4CCLA 1JT6A 2LBFB 2DPDA 4YRVA 1VQ9Z 1VF9A 1R00A 2VI6A 5HLTA 3EUHA 3BTLA 3CXCY 3BR3A 2N8GA 3RTRA 4RDUA 2FNAA 4MNUA 1MBGA 1S6LA 2KPMA 2Q8KA 2NS0A 4HBLA 3PSFA 5IYBJ 3CMYA 5J8CA 4XNFA 3OIOA 5T64A 1FYLA 2CW8A 2JK3A 2GIZA 1ZGAA 4BBSJ 4KITB 4L9NA 4QPOA 4M73A 2HFHA 1O3SA 1USTA 4AWXB 1X3WA 3DF8A 1VQ6Z 4ZTFA 2W85A 1MMNA 1WJDA 2Y30A 2PM9A 1H9GA 3I59B 1FOYA 4P55A 3ROUA 1JHHA 2NVTI 3EYIA 1ZRDA 1I3AA 2HTJA 4J00A 3T4NB 3GTQJ 4PFPA 5LHIA 3U21A 3IP4B 4XRMA 2KRHA 5M5WJ 3OYIA 2FQ4A 4A3BJ 2X48A 2DTRA 2IZ3A 5D8KB 2JUGA 3KE2A 2PJPA 3SFZA 3GTJI 4XKWA 3IH3A 1NG7A 1JKPC 2VJIA 1VQ81 5CPRB 4E2ZA 2VBWA 2H8WA 4I09A 3S2WA 3D9XA 3Q9SA 1P4AA 3BG3A 3REOA 2HVRA 4A3LJ 2E2HI 3CJTB 1X3ZA 2P81A 2R7UA 1R23A 1I3QJ 1IXRC 4J01A 3GTKJ 4C9YA 4M71A 3G71Z 4P9FA 2MC3A 4A3EJ 4LITA 1NH3A 2VPXA 2KIUA 2NYXA 5FD6A 4GDFA 4FE4A 3OIQA 3PL8A 4LLNA 4ZZLA 2FX0A 2W24A 1MNMC 3JW4A 4G12A 1ITYA 1IO2A 1I1GA 1IRZA 5IP7I 2D1HA 2L7FP 3ABUA 4DYCA 3F8NA 4EGYA 2H94A 2ME6A 1HSJA 4WF2A 4UB8C 1QNTA 3QOPA 4V19K 3QYEA 4MTDA 2JRMA 2ZB9A 5D1PA 3CCLZ 1MJBA 1DQUA 2VQHA 3GCMA 3I9V2 4IRHA 1PDNC 1VFCA 4R8HA 2P7VB 5FO5A 2OOXB 1W36C 4HSTA 4I7HA 2WAEA 3NARA 1YS6A 1I50I 3RQ4A 1K61A 1LQLA 2JNYA 1OPCA 2HOSA 1J09A 4UUTA 4U0VA 4I02A 2LKSA 1NHAA 3I71A 4DGLA 2KI7B 4XM3A 1YI21 4E2WA 3TGNA 1MGTA 4E7IA 3HHHA 3CCQ1 4RVHA 2JZYA 5J6XA 3MAJA 4KMFA 3I56Z 3GYHX 1UB9A 2A05A 5EJCA 3QPTA 2NOJB 2HEOA 3S15I 3S1QI 5IY5H 4XKCA 2CUEA 1VZ0A 2R4GA 2VT3A 1Y1VJ 1KC81 4RGRA 2YADA 2P6SA 4NQWB 2G9WA 2QF7A 3OYFA 2VODA 2G7UA 3FWEA 3J7ZI 3CMAZ 4HQMA 5BQTA 1OCRH 2EV6A 2OZUA 3E5QA 5CVRA 1S29A 5L3FA 3BY6A 2VKDA 1PYVA 4E7SA 5A2QK 3KYDB 3SEZA 2VBYA 3LWFA 5EDNA 2E2JI 5JR3A 1ZR2A 2ID3A 3RKQA 3P9KA 2F5VA 3WODF 2R7ZJ 2VKHA 1ETXA 3TP3A 1Y1VS 2QR1B 5FLXb 1VQO1 2WV0A 1USPA 3DBLB 3DV8A 3HXLA 3KP3A 1SFOJ 1EH8A 1UMQA 3C2HA 1JJ2Y 1U0JA 1EA3A 1MH3A 2VT2A 1YJNZ 3TP0A 2LREA 3UKGA 3NFZA 2A69F 2AXLA 4B47A 3VSLA 2K5RA 1YE9A 2E7ZA 1YIJ1 1YJ91 4IHWA 2V9PA 3E97A 3E0JB 4N0BA 3QP5A 3FK6A 2R5YB 2OU2A 3HOSA 2OC6A 4CYCB 2K3FA 4I6ZA 1JKQC 2UV1A 3IV5A 2RT9A 1D1CA 3HSEA 4G6TB 3D5RC 2FSWA 5JLWA 1DPUA 1K9M1 2H6CA 1D0YA 1LEAA 1IN5A 1F36A 2K9NA 4NC7A 4MD9A 1Y8RB 1FYKA 2B63I 2HGCA 4BXXJ 4FX0A 3CCR1 3T0YA 3HM5A 5IT9Z 4IHYA 1S72Z 1ETYA 3G1MA 4LD5A 2HQNA 2DFEA 1UJ8A 4G9YA 4MRIA 2DDBA 3GTLI 5GAGJ 3RKWA 3CTAA 3FDYA 1P4XA 3BWGA 4AYBA 2V79A 4GXOA 3G3ZA 2OBPA 4B44A 4KN4X 2KIFA 4A0XA 3BDDA 3RJPA 4Y52I 2IS2A 2XDVA 4HNVA 4L9VA 1TWAJ 3KZYA 4N4NB 2RQPA 1TWFJ 2ZJ2A 3CCJI 4RGXA 2PQ8A 3ML6A 3L9FA 1REPC 3H3VJ 3HOWI 2QA41 3IH4A 1KQSY 2VPRA 2XPVA 2BEOA 2ZBKA 4AD9A 4NQWA 1YQAA 3G4S1 1QPIA 5BMZA 4L5EA 3SZTA 3BR0A 2KDZA 2W03A 2HZDA 3ZMSA 2Y9ZA 1VNDA 4I98B 1WH5A 3BG5A 2KP6A 4QPQA 3HIFA 1PVEA 4A0YA 2EB7A 2L02A 4KIFA 5IT3A 4A3JI 3ZRGA 1I5ZA 1X1DA 2M45A 1QYPA 3QRFF 2MW8A 3HPHA 3H0GJ 4XSZF 2XF6A 1SVOA 2JUCA 3MZ8A 4IHXA 2VB6A 3CCJZ 3NH8A 5F1JA 3G73A 1Q16A 2KFDA 1JUPA 1B9MA 1OISA 2EIMH 4G94A 4XMYA 5E1ZB 5DM6F 3F8BA 4XBFA 1LE8A 1Z67A 3HHGA 5TRDA 1J0RA 4HV5A 2ZMEB 1RUOA 2IW5A 4DJAA 4OOIA 3M07A 3K4BA 4I76A 1USSA 1X4OA 3DEWA 3OOPA 3CCMI 3H36A 2DA4A 2R5YA 3GTQI 5IT9f 2TDXA 4RBOA 3CUQB 5EZHA 2KMUA 1JWHC 2IJLA 1MMAA 2NVUB 4ZYDA 1FIPA 4QWQA 5CVIA 1H8AC 2H09A 3V8KA 4Z6YA 2IV2X 1QVTA 2JA2A 2RBLA 3M8EA 2I3CA 1GLNA 2E1OA 4LIVA 4DOZA 1ZELA 4RS4A 2KL4A 1D0XA 1OCOH 2CMPA 3F6VA 3NH4A 4A3LI 2MYSA 2OAZA 5CVUA 1UAAA 1Z02A 4MHGA 4Y3OA 2KJBA 3GTKI 1DGRM 1OR7C 2R7OA 4IL6C 4ESBA 4Y7NI 1QF8A 2LF7A 5CKTA 3CCMZ 4JX5A 3LQQA 4NB5A 3TMOA 4G7ZF 3MCZA 3JAMZ 3HGYA 2VPYA 3GFJA 1O7LA 2R7QA 4OAYA 4WCGA 4A3EI 2CW7A 3M7GA 3FHNA 4RAYA 4WWCA 2JA5J 1U8RA 1GDTA 2VPWA 2XKPA 4KIBA 2E19A 3J81Z 2V4JC 3L1PA 5M5YJ 1TWGI 2GXGA 4LG0B 3FM3A 3F23A 2VPZA 4FASD 1KQ8A 2W1OA 1ACIA 1K83I 3CPWY 4G8XA 2L54A 3K4JA 1B8IB 1P9QC 1POGA 2MGQA 5KAFC 1WQ2A 3WU0A 3M3YJ 2ZNZA 4HF1A 3LSPA 4HZFA 2IP2A 3BG1B 2A68F 1ZRCA 3I4MJ 1MMDA 3QWLA 2YU3A 2IXSA 3EDPA 1K8A2 2O8XA 2QQAA 1B9NA 1R1TA 4PJJA 4DQ2A 3GFIA 2PN6A 1ZB9A 3I07A 1SMTA 2HNHA 4KISA 1SFKA 4RVGA 3FXLA 3CCEI 5D5WB 3AL0B 2EJRA 3H9GA 1OCCH 1U3EM 1APLC 3K4KA 1J9IA 3JRFA 4BDYA 3HOZJ 2Z33A 3HOXJ 1IG7A 3H3VK 4OIRF 4AIJA 2VJJA 2JWTA 1QQIA 2E9HA 2RPRA 2P7CB 4M9ZA 4NB8A 3RYPA 2FQ3A 2ZMEA 3CDIA 3E6BA 2FOWA 2ZSHB 3PSIA 5KK1A 4D5FA 4EM2A 2OQGA 3DBRB 4RM3A 3RKYA 5FJ8J 3CMEI 3GEZA 2L3DA 5B5EC 1ZKGA 2M5WA 2BE5F 3CP8A 5TJJA 1Y1VI 2EGTA 1ZGWA 2VBXA 1YX5A 3CC71 3ABMH 1M1K1 1IN4A 1SVMA 2LF8A 2WWYA 4XN0A 2UZKA 2X0LA 4A3IJ 2RNGA 1BN5A 2PFBA 3QU6A 4WX9A 1ZTRA 3M4OJ 3E6MA 3JAMf 3DTEA 4A3GJ 2F4MB 2XVCA 3LSKA 4MD8A 4W1UA 2ZXWH 1FBSA 2NOGA 3RQIA 3HL2A 3MEXA 4XSXF 1OJLA 4A6EA 1LDJA 2DYSH 4E7JA 1YRNB 2W84A 2W7NA 4HF0A 3J81f 3CMEZ 2BVMA 1WPKA 3KCCA 1SFOI 5C4JI 2M34A 1KU3A 4PK4A 2AO9A 4CCOA 4PFOA 2B7EA 3R6SA 1K4TA 1O3TA 4IPAA 2OCCH 3DPTA 4BBRJ 2XGCA 3Q0WA 5D4RA 2OTLI 4X6AI 5FKOA 1QVGY 5K7FA 4F92B 4A3CI 4RMNA 3GUDA 2CFXA 1T56A 3DKWA 3W3CA 1IUYA 3LSJA 1N2FA 2ESHA 2JS4A 3HUGA 4XIDA 1CGPA 2KISA 1VQ91 4E7HA 5EGOB 1GXQA 5J1YA 3C2BA 2YX4A 3I53A 4ZC3A 3R0JA 4DZJA 2CQKA 2YPRA 3FXJA 4HQEA 4M3DA 1B8IA 3H1CA 4YIIA 1FLIA 2NAPA 4IRGA 3F72A 3RZDJ 1Q7Y2 1HW2A 6PAXA 5FLMI 4ZJZA 3S17J 1HDPA 3ONQA 4WXCA 4D7NA 1YX3A 3K0LA 2CGPA 1QXFA 1IAWA 1P4WA 1A35A 2QYOA 2GIVA 2STTA 3ECOA 1WH7A 2CYYA 4L9TA 3PO3J 3K7AI 2OTLZ 1W36D 2Q51A 5LRSA 4CXFA 5C4XJ 3HOVJ 1VQ61 4HG2A 3L2VA 9ANTA 1G4DA 3CC4I 2RDPA 3C7JA 5HODA 3A01A 2V9KA 2XV4S 3KYCB 3LUSA 2EZLA 1R22A 2VC0A 2HDWA 1K4SA 1H88C 1WCMJ 2PBIA 4GYGA 5CLSA 3KFWX 1A36A 3CCSZ 2XASA 3VSKA 1LFUP 4DGWB 5C3EI 1TW2A 5F0FA 3PO3S 4HLXA 4CCKA 2R7WA 1UHWA 5HDNA 4RVDA 4GGGA 5EYRA 4BGDA 4BU2A 1T98A 2G0EA 2DA5A 4I2OA 5A2Qb 1W5SA 2ELKA 4BE2A 4YFNF 3A1YA 2FUG2 2PG4A 3X2QH 2DBBA 2DA3A 4JOMA 4OWRB 2XRNA 2Y0SN 3NWSA 2Y0MA 4IO9F 2CQNA 1N25A 3CC4Z 2XAHA 3GVAA 4LJZF 5EEGA 1AA7A 3H0GI 1D3YA 3TO7A 2EQRA 3G711 3HG9A 1XGSA 1YRNA 3S3OA 1XS9A 2XPWA 4HDUA 1VQNI 5ICGA 2XROA 1WZ2A 4CCMA 1FMVA 5IP9I 3CJNA 3D2LA 4RGSA 2JA6J 1VQPZ 2EV0A 3ESWB 2I10A 5LHGA 1L1OC 1OLTA 5F0CA 1VQ5I 3FMQA 4FE7A 2LD5A 3OR1C 3CC2I 2VIXA 1QBJA 4IZZA 3SJMA 3CCL1 1FSHA 2BYVE 2CUZA 3P9CA 2VJ4A 4RB1A 2CV2A 3IF8A 3CCUZ 4ITVA 2K9LA 2DK8A 4JBAA 2XIGA 3BR6A 4U87A 4L5IA 3V8LA 1T2KA 4CZCA 5D5UB 3MZHA 1FP2A 1VQNZ 1PP7U 2DMPA 1W7PD 2DMUA 2K9QA 3IUOA 3I55I 1P6RA 4HH4A 1V4RA 3FK7A 3VMGA 2KJCA 2K7LA 4MO7A 2QLZA 3F8MA 4E7ZA 4Q47A 1B6AA 1UFMA 3MKYB 3B6AA 3JRAA 2JA7J 2PEXA 2GOMA 4KIGA 3I561 1P9NA 3PIPF 4HV6A 3F8CA 2R5ZA 3ABKH 2V45A 1Q861 2L0KA 4AIHA 2GA2A 2JA5I 3EERA 3GLXA 3PNVA 1Q1VA 1R1UA 4BQAA 1YOVB 1LVAA 1U5TA 5T67A 3SZPA 2BBYA 2VC1A 3SQNA 4O5VA 3CMA1 1Z9CA 2P0WA 3I55Z 1FNNA 4XKVA 4RB3C 3PJRA 3BPXA 1TFIA 1V3FA 2HF1A 4UY8I 2ADUA 3J7YJ 1MIJA 1TC3C 4AIDA 2L01A 3IWZA 2CH0A 3SZGA 4G6QA 2NS8A 4RVFA 4ZDLA 5LBQA 5ICEA 3FM5A 2K9SA 2VXZA 5E8IA 1WKMA 1RR8C 3VYRB 3QP6A 2M87A 2RAEA 2HYGD 4A3MJ 1VQ7I 1FIAA 5FGMA 2IVMA 5KHDA 1MD0A 5HOOA 1YJN1 2CWEA 4D1QA 4LOCA 2IGNA 2HPMA 5DYMA 4G7OF 3CQZI 4BY1J 4NB9A 1FMWA 5L3DA 1Q821 2WBMA 2L5QA 4U7DA 3ESWA 3HRUA 2K3PA 1YITI 1ZG1A 2OJED 1ON1A 1YTYA 2XAUA 2B0LA 2VJ5A 5E1WA 4ZYHA 1QO0D 2FD5A 4XN3A 5FLXZ 2ACJA 2WC2A 2V8IA 3HTUA 5LL6f 3FBIB 1EH7A 3CD6I 1N8R1 5E3LA 2M4KA 3QAHA 5FKNA 5ICFA 1S721 3L2QA 4QSHA 2RHBA 1KU2A 3GTPI 1I39A 5FFZA 4EVIA 1WJ2A 1IV6A 1T0FC 2M8EA 1E3OC 3BOQA 3K69A 1IC8A 2ID6A 2JN6A 3M4OI 4NBFA 3KIHA 3GTMS 3WU1B 1T95A 3S2HJ 3BR2A 5AIPA 3WHBA 5EEHA 1Z05A 1I1SA 1XG1A 2K9MA 2HYFA 4B09A 1XX5A 5L3EA 3KZZA 1R9TJ 3ASOH 2DFHA 2BY3A 2JIMA 4S05A 5LEJA 3DU6A 2KRFA 1JE8A 3W2AA 3KYLA 2RGVA 2FBKA 3ASNH 2BV6A 1MBKA 2EFWA 3VTNA 3A0BC 4BBRI 3CD6Z 3AG4H 4BQNA 2Z99A 2DN0A 5JHUA 4YIFA 1VQ4I 2JIPA 1WJCA 4ZDOA 4ENNA 4RGUA 1DP7P 2GQQA 1UHMA 4M3FA 4HDVA 1BI2A 1N75A 2FMYA 2K40A 4MTEA 5M5XJ 4V2GA 3J80K 1FJLA 3KPHA 2KKOA 3LAPA 3DBHB 3CP2A 3Q9VA 2NVXI 4FHTA 2QBYB 4XL9A 4BEHB 2EA4A 4NBDA 3A03A 3LQRA 3CUOA 4LFUA 2QSFX 5GPCA 1K78B 2IRFG 2ESNA 2LK2A 4HSRA 4M6XA 3ZN1A 3JRDA 1GXPA 4IQJA 3CCJ1 3ZR8X 3FMSA 3S1RI 4F3QA 2L7ZA 1QZYA 2DQRA 3PO3I 4YELA 3OS0A 3MWMA 1W7PA 3K4NA 5IOYA 5EEAA 2R93J 5F6FA 4MD7A 4E33A 4BY7J 2DODA 2XAFA 3HOVI 2VKVA 4L0YB 2P4WA 3NDJA 4NC8A 1VQ4Z 2M6NA 1LQ1A 1L0OC 2QQ8A 3DPUA 3VDXA 2ZJPF 3WGIA 3WHCA 3GZ5A 5FLXf 2R0QC 4DNCA 3WTZA 1U9NA 4XOTA 3TBIA 2V1UA 4XLFA 3SEQA 3A2KA 3OYHA 1FOXA 4E6KG 2Z1DA 5B1AH 3WGGA 2Q2EB 1NG6A 2W04A 3KLNA 2R92I 2EILH 1BR2A 4UUSB 4IRIA 1RUNA 2LY2A 3IAM2 3SFIA 1JGGA 2RC4A 2HQRA 1JKOC 1F4KA 3Q87A 3M9AA 4MGRA 5ED4A 5FB2A 2DU9A 2LNBA 3EEDA 1AKHB 1I27A 4F55A 5D5XB 1WWXA 2LBFA 1BM9A 2FBHA 3GFMA 4BNCA 3CCM1 1BW5A 3TOAA 1M901 1OYYA 4OAZA 2JMOA 1SEUA 4HX7A 4RA2A 4B43A 3KIFA 3L00A 1X3UA 4BQOA 1D1AA 2MC4A 3TQNA 3KP7A 3U9GA 3ZQIA 2OA4A 4NNJA 2MD5A 2DJNA 2DTZA 3F0CA 1Z91A 5TISC 2KPIA 1P92A 3HSFA 4QTRA 1OQYA 2WV1A 3CLOA 3VOEA 5HDGA 4A0ZA 2AYDA 2P3YA 2P6TA 2XUBA 5H2FC 3HOUJ 1MMSA 3T8RA 1O4XA 4XLAA 3DP7A 2TRTA 4G7HF 3PNTA 4HAMA 3V42A 1GV2A 1KZHA 3AAFA 2QEXI 2O8KA 3N4MA 2DQLA 1MH4A 2QWWA 3I59A 3K10A 5IYCJ 2BY2A 2YSRA 3I4PA 3S1MI 3AKZA 2DW4A 3BJ6A 3KX2A 2XF7A 1Y1WI 4MH4A 2K85A 3W6JB 1K78A 2JVGA 3I5UA 1IRXA 5F1RA 2LOOA 1ZHFA 2DE6A 3TDZC 1YFHA 3K1MA 4LLLA 5IP6A 2PMZN 2JA7I 3WG7H 4L0ZB 4BUPA 3ERED 3H92A 4RM2A 3VB2A 2ZFUA 3TO9A 1G6NA 1MBJA 2QEXZ 4FISA 3BQYA 5J8FA 1IDYA 4B1RA 3AG2H 2NRAC 3LFKA 5IOZA 1F9NA 4KT5C 5DV5A 2V7FA 2HXOA 4EQQA 4AIKA 1Y8CA 4M6VA 3U50C 4NBCA 3IHUA 1WSUA 2Q2EA 3EUHC 2R3SA 2XPUA 4S04A 2X6WA 2ZFWA 5FFXA 4H0EA 1JJ8C 1ZH5A 2CG4A 4JP0A 2P5VA 2VF1A 1MDMB 1HLVA 2QVOA 1NK3P 2KZVA 2BOLA 1IJWC 1S8NA 4D7MA 1YUAA 3OWTA 2LLKA 3MMYB 4ZZDA 5HS9A 2VLAA 1KC82 2PX9A 1Z3XA 5AN9F 4YG2F 1AKHA 2KHMA 3F8FA 4E7KA 4TNUA 4PSWA 3CME1 3JRHA 2D45A 4E31A 2F48A 1JTXA 1YJWI 4O3MA 2DJIA 1OMIA 2M7AA 3GBGA 1U6GA 2EFOA 3PFYA 4UVAA 3OYDA 3PFIA 1DU0A 4JK1X 2VE8A 3K6GA 2P5KA 4Y13A 1K6YA 1FWZA 1A31A 1DP3A 4CL1A 3NEUA 1TZLA 5TGTA 2JMWA 2MLKA 2LYCA 1LJ9A 1ZG3A 3QWUA 4NH1C 2HDDA 2Z9OA 2W57A 5F27A 2O9LA 4XQFA 3GTMI 1Z01A 1XMXA 2IA0A 3ZQ7A 1EKEA 2HXIA 4MEYF 2F2EA 2STWA 2XF5A 2EFNA 3TDUC 4NBBA 5F64A 2IGOA 2CJJA 4P1WA 5LGNA 1PUFB 1GT0C 3NH5A 1YJWZ 4IQ4A 1TQIA 4H4KC 1S7OA 4NBGA 1JJ2Z 1WJ5A 2Y2ZA 2ZC2A 2GLOA 1QVFY 1R5HA 1GUUA 2AKLA 1K9M2 3OL4A 1FYMA 2OTL1 5FKKA 1HDDC 2IT0A 2M7BA 4QTTA 2Y48A 3D5SC 3FXRA 3MN2A 5HDKA 2NNYA 2PI0A 3IFUA 4A3FJ 1R9TI 3S3NA 2ZKZA 2DI3A 2XAGA 2O6GE 2DE5A 2L4AA 3GTOJ 4M72A 5ILVA 3BJAA 3J7A4 2CQ7A 4M74A 3DCFA 3CCS1 3OIPA 3S32A 3OYBA 2E2IJ 4BBSI 4CUGA 1JT0A 2IEKA 2FU4A 1VQLI 4IVNA 5DCMB 3BR1A 3FKIJ 1VQMI 1H0MA 4QTUA 5D1OB 1NJI1 5DM7F 3V7CA 2BY0A 3K2ZA 4ON0A 1MDMA 3S16J 3CDHA 1QZEA 2L7KA 1YHQI 3F3XA 1TWHJ 2R7XA 1FX7A 2AQEA 2OZ6A 3BTJA 3CC41 2XB0X 3RDIA 3SYTA 2RREA 2Y0SA 4JX4A 3FZVA 4CYCA 4A3BI 1H9TA 2HQ5A 4RAZA 1R6RA 2CUJA 1RESA 5LGUA 4I99C 3S2DJ 2LY1A 2J5PA 3P5JB 2CRGA 2MSYA 3I54A 2MD0A 3H5NA 4Y15A 1VQLZ 5A2QZ 3OV8A 1RO2A 1KQSZ 1X1CA 3LSMA 1VQMZ 1VQP1 2XGDA 3GTGJ 3HOYJ 2JA8J 1MBFA 4IJAA 3GFLA 1W5TA 5DD8A 2KIQA 2QRCB 4CYDA 1YHQZ 1I3QI 1DGWY 1VI0A 1SFXA 4KMUX 2VXDA 4U7BA 1OFCX 1J5YA 3DXJF 3B73A 3UNGC 4AVZA 2ISZA 2C6YA 1G3WA 3CCU1 5L3BA 4RB2C 4MXUA 3MQ0A 1AA6A 3LA2A 5DTDA 3MKZA 4MIMA 3MONA 1NK2P 1VQN1 1VQKI 4HPQA 5KVRA 4A3DJ 1YI2I 3BLYA 2F6CA 3TE5B 3H9JA 4DK1A 1HF0A 3D6WA 1L3LA 3BT9A 3L7WA 1A6QA 4Y33A 3RPQA 1IXCA 1V55H 2E1NA 3ZQQA 1ETQA 4KN7X 2M4GA 2ZSIB 2K3RA 3SHFA 1DU6A 2GAUA 1ETVA 3RYRA 1YUKA 2WTEA 4EJOA 4N4OB 3LSRA 5CYVA 3CLQA 2MA3A 2ZCWA 2VQCA 2GU2A 3OYMA 4LIUA 2A61A 3WE2A 1VQKZ 2RIQA 4MONA 4E2XA 1BI3A 4AU7A 2Y69H 3I551 3HOUI 2NXNB 5E18F 4KFCA 3J80b 2QQ9A 5HLIA 2E1CA 3BZ6A 1MW7A 2WAQA 4AVPA 4EGZA 1GHCA 1O7FA 2LVSA 2YU9J 2HVQA 4BL0B 3KEQA 4XKBA 4I0BA 4HNUA 3KZIC 2R7VA 1FP1D 5CM2M 1D8JA 1R5ID 1FBQA 1KD11 3F21A 5A2Qf 3Q0UA 3CUQA 2BXZA 4N9HA 2BGCA 3CCEZ 1YJ9I 1TTYA 1GVDA 1V5FA 5J1UA 3HB9A 3P5JA 2GZWA 1EH6A 2M3AA 1R4MB 3U2RA 5LLQA 1I6HJ 1WZNA 5E20A 2FXAA 3Q0VA 5JVGF 1YO5C 3S1NJ 1KGSA 2DDAA 5C44J 1FC3A 3DPLC 3Q5FA 2R7FA 3ZMDA 2QCOA 3IH2A 1GVJA 3GO5A 2CQXA 5FROA 2R7ZI 1TQMA 3BZKA 1A5JA 5FLVA 3RZOJ 2BXYA 2E60A 3DKXA 2LP0A 3LFUA 4X0GA 1XGMA 4XX2A 4E30A 2PJRB 2JPCA 2VOOA 3H9QA 5JVTA 3K70C 4LMYA 1RQFA 4YEJA 1QA6A 2YUSA 1S7AA 4V2FA 3GWZA 3OSGA 2V6EA 3FXOA 2CU7A 2LR8A 2EIKH 2QUFA 2WAFA 2YS9A 3VODA 4HYEA 4EWCA 2DT7B 3M1EA 3DKYA 4J19A 4OIPF 1XD7A 1ZH1A 3O3KA 1X2MA 5GTHC 2LC2A 4LG0A 1R49A 4NHJA 1VTNC 4HF2A 4B48A 4XLEA 4F52A 1YLFA 1Y0UA 2HOAA 4RB0A 3L2UA 2J5OA 1OYIA 2M8GX 1OYWA 2PMHA 4A12A 1M1K2 5EZGA 4C3JJ 2F5FA 3WGHA 1Z6TA 5E8GA 1AWCA 1SVLA 1STZA 3S14J 4BXXI 4ENMA 2Q1ZB 1F1ZA 1Z77A 3EPZA 2Z16A 1ERDA 3CD61 1WI3A 4AYBN 4ETSA 4A6DA 2BHYA 2A5WA 2X51A 1QZZA 2EIJH 3CJQB 1DL6A 3K4MA 2FMLA 4FQGA 2O53A 4UUVA 2FNPA 1HSTA 1RIOH 1Z7LA 1XPXA 3MFKA 2JUBA 1G2HA 4DBRA 1ZARA 1BI0A 2NVTJ 3I4NJ 1WFXA 2HPIA 1ZREA 4QIWN 1TWAI 3GMEA 2HOTA 5B1BH 1TWFI 3I0TA 1X1PA 3PM1A 1TT0A 1OKRA 3ZQGA 4M6YA 1LFBA 4CDGA 4FT8A 2NVQJ 2IGMA 2XGEA 3LMMA 1S5LC 4UV9A 4HRIA 1Q811 4PGGA 2KZGA 3GTJJ 3WE3A 1XMAA 4PSXA 3IRRA 3BJOA 3K1PA 1QVGZ 2IPQX 4BS9A 1VQ41 3FQQA 4U88A 4IKFA 3CCVI 1RC9A 2DA7A 1T6SA 4HA8A 4OIOF 2JPBA 4LB5A 2E2HJ 4XLPF 1IRGA 1Z21A 1LDKB 3HRTA 3RIRA 2OOYB 2F4MA 1TBXA 1ENHA 2VQGA 1XCBA 1IN7A 1ORKA 3MD2A 4D0PA 4B3AA 2PJRA 1K731 4NC6A 5BOXA 3FKII 1TP4A 5E1XA 3OL3A 1QRYA 5K5OA 3QOEA 5IP7J 1AHDP 1RNLA 2NVYJ 2KQRA 1RO4A 2LRDA 5JLXA 1U8BA 3S16I 2CQQA 3NRVA 3OW2Z 1TWHI 3BP8A 2HOEA 3PUFA 5K1YA 2XAJA 1C0WA 5B66C 3CCVZ 3SXYA 3V7SA 2QZ8A 2LFUA 5CQGA 3TDHB 3GZNB 1N78A 1RNIA 2K4JA 5EGOA 2O4HA 3JAMb 2BW3B 3OYEA 2CUFA 3SDBA 3ZOBA 3ZXSA 1FSEA 1X19A 3QODA 4BHBA 4EJTA 1W2BY 2X6YA 5DUIA 1I50J 2R7DA 2DFFA 2LKPA 5DS9A 1ZAOA 3J81b 3KP2A 3EUKL 2DAOA 3JTGA 2R6MA 5DEQA 1WHUA 1X2NA 2NS7A 4ZYAA 5D5VB 3GTGI 3T1BA 1O57A 1ZN2A 4HW0A 2GXAA 5ILSA 4C2MJ 5GTIC 5D6EA 1W0UA 4HGZA 2W25A 1VQ5Z 1LVKA 1TNSA 1P2FA 5CVVA 3CC2Z 1I6XA 3BPVA 1X4PA 4PUSA 3S15J 3RSNA 3FXUA 4EJVA 3CMMA 3S1QJ 4DW6A 2DPUA 1A04A 2E7XA 3WTSC 2E5NA 4II2A 5JI6A 1HW5A 2JIQA 4LK1F 3K4CA 2QGUA 4NOZA 4GCVA 3ISPA 4UVBA 1EF4A 1BJZA 2M0CA 1R58A 2E34A 4TV7A 4FETA 1HKTA 3M3YI 3F3FC 3JRBA 1B4AA 2QLVB 3BTCA 2NNNA 2JRTA 1KONA 2E2JJ 2WADA 2QEX1 2PMZA 5HLHA 3I4MI 3CJRB 3CC7I 3OR2C 2CV1A 2DLLA 3ABLH 4LK0F 1W1WE 1X3WB 3J7AO 2DA6A 3CO7C 5CVJA 1ZLJA 1DDNA 1X1BA 4A93J 4D5CA 1W5CC 2LFBA 4OIQF 2F4IA 3HOZI 1ETKA 3HOXI 1MBEA 3I64A 1Q862 4C2UA 1WW9A 3WTVC 4UHTA 4P5OA 2YU9I 3B6CA 2LIYA 2DMQA 2OTJI 2Y9YA 2UXXA 1BIAA 2FJ1A 1LNWA 3LSIA 2W82A 3DEUA 3BTIA 2HKXA 1MSEC 1T38A 2MG4A 1T33A 3IAS2 2Y31A 4QLCU 4BE0A 2EZIA 3GX4X 3VMHA 1VLAA 5K5QA 2FA5A 4IX7A 2O03A 2B63J 4F7ZA 2EH3A 2IZ4A 1KRLA 4RV9A 3O2PE 2E1MC 3BG0B 1VQ7Z 2HYJA 2R7RA 1IZ1A 3OS1A 2XC7A 3O6BB 2L9SA 1Z3YA 3HKZN 1PFTA 4F91B 1FDOA 1FTZA 4NFRA 4A3II 1HBXG 2UWMA 1D1BA 3S1NI 1X3ZB 1VQ9I 3GTLJ 4BAYA 2WB1N 5KNLA 4L18B 3L2RA 1JJ6C 4A3GI 3R4KA 4PJLA 2CFOA 4XONA 3FF5A 2ZXIA 2ETHA 3V7RA 1YITZ 1SC7A 3C3WA 3HGGA 1JHFA 4U0WA 4Y52J 2KRCA 3RZOI 4C30A 1WVRA 3GXOA 1Y56A 4IHVA 4NBQA 4UVCA 4EM0B 1J75A 5ICCA 4XLCA 2ISYA 2OQRA 4YFXF 3HBLA 5LFAA 1Z1DA 2CO5A 3E7LA 3R60A 4L9JA 4BACA 2DE7A 1YJW1 1XB4A 2VN2A 1Q822 1MNEA 2O0YA 3BROA 3DWLE 1SFUA 4NBHA 2PK7A 4MQVA 3MKWB 1RKTA 1ULYA 1R4NB 1ZLKA 3O8HA 4JX6A 1WI9A 2QKLB 1BOBA 2LEXA 3PO2J 1FOWA 3C1DA 2A5YB 4EEFG 1B72B 1XTAA 3DFGA 2A07F 1X58A 1J59A 5KCMA 1XGNA 1N8R2 4FCYA 3RZDI 3G1LA 5EF6A 2COMA 2GM4A 4E2YA 3J7AY 4A3JJ 1LPQA 1IN6A 3S14I 3S17I 3E3VA 3H5AA 4N9IA 5K7HA 3KP6A 4CO8A 3VB9A 1CQTA 1WIIA 3M8FA 2JIOA 1NP6A 3BCAA 3IKTA 3KP5A 4RLQA 2HVSA 3BG9A 1ZYRF 5C4XI 2X1EA 1G3YA 2Y75A 3JSPA 3R61A 5ERIA 1SAXA 1ML8A 2V1XA 1K6OA 4F93B 3DQVC 3F22A 1IW7F 2ME0A 3U1DA 2QRDB 4HGYA 3I4NI 2JT1A 2XRLA 3EUAA 3G71I 1LFPA 5BS6A 3E5XA 3JCUC 3I3LA 3CXCZ 4KDPA 4ESJA 2K27A 1WCMI 2P5LC 2LDUA 4CGZA 2QKMB 3D1NI 2HTSA 3HSRA 3VMIA 3MZKB 2NVQI 3C18A 3EYYA 2OV7A 1MMGA 2YX7A 2GXBA 1VQL1 4D9JA 4EM1A 5AONA 5IT9K 1VQM1 5J1RA 4M3BA 2X6XA 2IBDA 4X1EA 1NTCA 2H8RA 2GBYA 5BPDA 3G6EI 2Q0OA 4CH7A 1U5TC 3V4GA 2X85A 1XSVA 3CCLI 3CDLA 4PJMA 1RRJA 4DQYB 1YHQ1 1R7JA 3M1CA 1USPB 3S8PA 3TW6A 3T5XA 4Y7NJ 3OYCA 2EZKA 1AU7A 3D0SA 3K4LA 4XOPA 5H6QA 5CJ9A 4WK8F 1HQCA 2IS6A 1N77A 3ZP5A 1S7MA 1TWGJ 3BQZA 5B3SH 2JA6I 1MSFC 1TL8A 1D0ZA 4E4HA 4KA4A 1U78A 2NVYI 3K70D 1Y39A 3HDDA 3ZN0A 4YIRX 1YIOA 1K83J 4E32A 2JJ7A 3I56I 3KP4A 1U9OA 4HNTA 4S1TA 1XGOA 4RAFA 3DTKA 3OYJA 2JR6A 5HLGA 2AQFA 3G6EZ 4XR6A 1ZQ3P 1UG0A 1UHSA 3JR9A 1MJAA 1B72A 5H6RA 2RQQA 1ZR4A 3QPLA 5FD5A 3KIOA 4HOBA 1XSXA 5DD4A 3TOBA 1P7IA 2QBYA 2L7MP 1TT5B 2I5UA 4BEHA 3CMAI 5E79C 1UELB 4OMYA 1M1EB 1SD5A 2GA1A 1VQK1 2DOFA 3HC7A 1WRJA 3GW2A 2EFPA 1JUSA 1M902 3IL2A 3EETA 2ECCA 1SFEA 5HNFA 1DUXC 2DCEA 3NAUA 3MKLA 1PP8F 4ZYEA 3HTSB 2EK5A 3BG6A 3E6CC 1XC5A 1BIBA 5DUKA 2P28A 4MLOA 4XLHA 4EMSA 1JKRC 1Y0NA 2UXNA 3VYUB 3VEPA 2MH9A 2V6CA 2EINH 2VQLA 2QM3A 3H35A 4PJ0C 3OYKA 4A3KJ 1YJNI 4OU0A 4A5MA 1KYWA 1OR7A 3QU3A 2DYRH 2Z3YA 5F0HA 5IPAA 4K2EA 4XK4A 3L2CA 2M0MA 2OF7A 3CCE1 1G3SA 5LEKA 4UUSA 3J80Z 4ENJA 3KEOA 5KAIC 5GP9A 1RLYA 1V5GA 2DXIA 1HKQA 3KETA 2OUMA 1FBUA 3UR3C 3WTXC 3GCFA 1BBYA 3H3UA 3ULQB 5J4YA 1SD6A 1S9HA 1QVUA 2JSCA 1R1VA 2V1DA 2M1BA 3TO6A 4XRFA 1E3HA 5C4JJ 1SIWA 2LMDA 2LSOA 1LE8B 1Z6RA 4A3MI 1S72I 1YYVA 3CCYA 2RVCA 3JAMK 2F5EA 2DA2A 1XSDA 4A93I 2HZTA 2L9NA 3WTTC 1EJ9A 2H85A 5FKLA 4BE1A 1V5EA 1IXSB 4BY1I 1LKXA 4X6AJ 4MEXF 3FHZA 2OZKA 4A3CJ 3J81K 4E70A 2QSGX 3FQMA 5K5RA 1DPRA 1KYZA 2ZJQF 4BQQA 3JRGA 1BA5A 3ABTA 3TEDA 2ICWG 5ILUA 2GOXB 2VUMJ 2GWRA 2QSHX 2PLYA 5FLMJ 3WU2C 4KYWA 3HEFA 1ONVA 5EG0B 2E36A 4L5JA 2DT5A 2VASA 1SMYF 1XDUA 2NAZA 4C3IJ 4S0HB 2D2WA 1D8KA 5GADJ 1A6IA 4C3HJ 2XAQA 2F5DA 3NWTA 3Q3SA 4G6DA 3K7AJ 4BDZA 1Z0XA 1BR1A 5J3LA 3COAC 3WTYC 3S2HI 2ZXHA 2V8KA 3G2BA 1FEXA 4B8XA 4M3GA 1FZPB 4PJNA 1TWCJ 4Q48A 3ZMVA 3I58A 1WJFA 2EBIA 3DTIA 4NBAA 2G7HA 2JIRA 3IKVA 2RN7A 2M9HA 2E7WA 2V1NA 1ETWA 4MFDA 5D8LB 2IS1A 2IA1A 4E7LA 5M3FJ 3J80f 5C3EJ 1HA8A 3VFZA 3OOUA 2V9VA 3V8JA 1VQ8I 3RPUD 5DCFA 3MZYA 2IGKA 2X4HA 5JFRA 5E17F 1K79A 2FOKA 3PO2I 4XORA 4CSWA 1Z03A 1OCTC 3WTWC 4DIQA 4BXFA 5FKMA 1BL0A 2O5RA 3CF2A 3LOCA 4EJWA 2W4SA 3CESA 5J40A 1KQ0A 2H27A 4EV0A 4CZZA 2DOEA 2EZHA 5J4VA 1RR7A 1MKMA 4FTHA 1B59A 2DOAA 3IWFA 1B1BA 4Y4RA 2M30A 1TLHB 2B9SA 1YS7A 4ZYGA 2A3SA 3FKJA 5T6BA 4ANJA 1MZBA 2R93I 3L09A 5IP9J 1G3TA 1VQ8Z 4BY7I 1R5GA 3LNQA 3AG1H 1PJRA 4JYKA 2VL8A 3NDIA 5HS7A 1IUFA 3F3PC 2DT6A 1W4MA 1ZK8A 4IXAA 3ZMUA 1ZB8A 3EQLF 4XRSA 1QVFZ 3HYIA 4IHTA 3CCV1 4OMZA 4EJUA 1T8IA 1OCPA 1EV7A 1G59A 4C2TA 3K2AA 2XHKA 4DYRA 1QGPA 1NJI2 2H1LA 2OD5A 1SD4A 1RETA 3E6DA 4JQFA 3DLLF 1PUFA 2DMTA 5EG0A 3T8TA 4R79A 4ENKA 2QKDA 1LDDA 1K8A1 1QHHD 2Z2SB 3S3MA 3FIWA 1SANA 4IHSA 2O61A 5K7ZA 2L9VA 3OS2A 5LD2C 5E3MA 3CCQI 1HXDA 3BC8A 1G8XA 1VQ51 3HRMA 4CCNA
chains in the Genus database with same CATH topology
3CC21 2F5VA 2OOYB 2VKHA 2F4MA 1Y1VS 2QR1B 2VQGA 1QHGA 5FLXb 1VQO1 2I8DA 3DU6A 1USPA 3HXLA 3W2AA 3KYLA 3MD2A 3CD6Z 3VTNA 4BBRI 3C2HA 3OMYA 1U0JA 1EA3A 2PJRA 1K731 1YJNZ 1JJ2Y 4BQNA 2LREA 3FKII 3NFZA 3HUGB 2ZAEB 4B47A 3OL3A 3VSLA 2K5RA 1YE9A 3QOEA 1YI2Z 1YIJ1 3H0DA 1YJ91 3DEEA 2KQRA 3E0JB 3L2WA 1RO4A 1WJCA 2BVLA 2LRDA 5HVQC 2MFZA 4ZDOA 3S16I 2OTJ1 3CCQZ 3OW2Z 1TWHI 3CCVZ 1WJEA 3QYBA 2OC6A 3HOSA 2GTIA 1N75A 5D1OA 3BCBA 2LFUA 5CQGA 2RT9A 3TDHB 2UV1A 1K9M1 4KT6A 1D1CA 4G6TB 3D5RC 3CP2A 1N78A 1RNIA 2O4HA 3JAMb 2NVXI 1D0YA 2BW3B 4XL9A 4BEHB 4NC7A 4MD9A 3HPGA 3SDBA 3OYEA 4NBDA 2B63I 3ZXSA 1X19A 3F9KA 3QODA 1W2BY 2X6YA 4HSRA 3CCR1 4IQJA 3CCJ1 3ZR8X 3J81b 3A4CA 1S72Z 4DBQA 3S1RI 3EUKL 4F3QA 3PO3I 4YELA 3OS0A 2R6MA 3K4NA 4ZDPA 4E33A 4MD7A 4ZYAA 2E1MB 3GTGI 4MRIA 3HOVI 2Q4ZA 3GTLI 2K5CA 2IS4A 3NDJA 3FDYA 4NC8A 4AYBA 1VQ4Z 2M6NA 4RLFA 4HGZA 3DPUA 3VDXA 5FLXf 2ELJA 4B44A 3CPWZ 1VQ5Z 1LVKA 4Y52I 4XOTA 3TBIA 3CC2Z 4PUSA 4XLFA 1WJAA 1X4PA 2XDVA 3SEQA 3RSNA 3OYHA 3A2KA 2IS2A 3CMMA 4E6KG 1VQOZ 2Z1DA 1X0TA 4EATA 2Q2EB 1NG6A 4N4NB 3N05A 3W2WA 1RO0A 4A3KI 2W04A 2E5NA 3D5LA 2R92I 4II2A 1BR2A 3HOWI 3H3VJ 5IT9b 2LY2A 3M8JA 2QA41 1KQSY 3IAM2 2WY8Q 1Q7Y1 1VQ71 3K4CA 3VYSB 4NOZA 3TL4X 1YIJZ 1YJ9Z 1Y6IA 3G4S1 4B3XA 3Q87A 3HKZA 2W03A 2HZDA 4FETA 3M3YI 3EEDA 3F3FC 4F55A 1KD12 2QLVB 2LBFA 2KP6A 4QPQA 1KONA 3AFHA 2WADA 2WB1A 2X1CA 2PMZA 2QEX1 1YIT1 3CCM1 3I4MI 1M901 4A3JI 3ZRGA 1X1DA 1QYPA 4OAZA 2JMOA 3HPHA 3CJRB 4B43A 1WJBA 3KIFA 3OR2C 2CV1A 2XF6A 3CCRZ 2VB6A 4BQOA 1D1AA 2MC4A 3CCJZ 3VYTB 3NH8A 2LG4A 4XMYA 1X1BA 2GTHA 4NNJA 3S93A 2KPIA 2F4IA 3FBNB 3HOZI 3OYAA 2P3YA 3HOXI 1Q862 4DJAA 4C2UA 1WW9A 3K4BA 2R7SA 4P5OA 4XLAA 2YU9I 4II3A 2LIYA 3PNTA 1X4OA 3V42A 3KEYA 3LSIA 2VUMI 2W82A 2V26A 3GTQI 3OYGA 2KDOA 3K10A 5IT9f 2BJOA 3IAS2 4BE0A 1BR4A 3VMHA 4CCJA 1VLAA 2KMUA 4IX7A 1JWHC 2IZ4A 3GKQA 3AKZA 3S1MI 4RV9A 1KRLA 1MMAA 3KX2A 2XF7A 3RCOA 1Y1WI 4MH4A 2E1MC 3BG0B 2QA4Z 1VQ7Z 2R7RA 3OS1A 2JVGA 2XC7A 2L9SA 1IRXA 1Z3YA 2JA2A 2RBLA 2LOOA 1PFTA 4F91B 2I3CA 1GLNA 3OW2Y 4NFRA 3G4SZ 4LIVA 4DOZA 2DE6A 2UWMA 1D1BA 4A3II 3S1NI 1ZELA 4RS4A 5KNLA 2KL4A 1D0XA 2CMPA 2JA7I 3NH4A 3L2RA 2M48A 4A3GI 4A3LI 2MYSA 3DU5A 4PJLA 4BUPA 1UAAA 1Z02A 2CFOA 4RM2A 4XONA 2ZFUA 4Y3OA 2QREB 4A3FI 2ZXIA 1DGRM 1OR7C 2L2OA 2R7OA 1TWCI 4Y7NI 1QF8A 5CKTA 2QEXZ 1E0EA 3CCMZ 1YITZ 3RZOI 2KRCA 3VWBA 4C30A 3TMOA 1Y56A 2G2KA 3GTOI 2JSPA 2R7QA 4OAYA 2V7FA 4A3EI 4XLCA 2CW7A 3GTKI 5LFAA 3E1SA 3FHNA 3U50C 4NBCA 2MABA 4BACA 2DE7A 4NUBA 1YJW1 1SAUA 2E2II 1Q822 1MNEA 3DWLE 2V4JC 3EUHC 2PK7A 4NBHA 1TWGI 1QU3A 2X6WA 3MKWB 2VF1A 2QKLB 4FASD 1BOBA 2W1OA 1K83I 3CPWY 5FRNA 2KZVA 3W2VA 4CA0A 2JVHA 2BOLA 3K4JA 1YUAA 1P9QC 3OWTA 3MMYB 2VLAA 3PNYA 3DLAA 1KC82 5KCMA 2VUGA 1N8R2 1Z3XA 2XSJC 5AN9F 3LL7A 3RZDI 3BG1B 2KHMA 3IX0A 3J7AY 1MMDA 4E2YA 1Q812 3S14I 4E7KA 2IXSA 4TNUA 4PSWA 3H5AA 3CME1 3S17I 4E31A 1K8A2 2DJIA 2M7AA 3GBGA 3PFYA 4PJJA 3OYDA 1ZB9A 4RVGA 3I07A 3VB9A 2HNHA 4KISA 1WIIA 1SFKA 1NP6A 3BCAA 2HU9A 3K6GA 3AL0B 3LSGA 4RLQA 3H9GA 2HVSA 1K6YA 2A6TA 1DP3A 4CL1A 3K4KA 1TZLA 5TGTA 5C4XI 4BDYA 2X1EA 2LYCA 3HOYI 2VJJA 2RPRA 2E9HA 3QWUA 4NH1C 2JA8I 2X1DA 1ML8A 3ZGKA 3PUBA 1NUIA 4XQFA 4NB8A 3GTMI 5HNHA 4F93B 1Z01A 2ZSHB 3DQVC 3PSIA 3G6E1 2QRDB 3I4NI 4HGYA 2XF5A 4KJZA 3EUAA 1K732 4RM3A 4NBBA 1LFPA 3I3LA 2IGOA 3CXCZ 2HQAA 3CP8A 4P1WA 1WCMI 2R7TA 1Y1VI 2EGTA 2F4OA 3CZ6A 2QKMB 3ZCOA 3NH5A 1YX5A 4IQ4A 3VMIA 1YJWZ 3CC71 2UUZA 3OYLA 3MZKB 4H4KC 1M1K1 2NVQI 2OV7A 2WA0A 1MMGA 4A3DI 4NBGA 2WY7Q 1JJ2Z 1WJ5A 4XN0A 1VQL1 1QVFY 4D9JA 2AKLA 1K9M2 5FRMA 3OL4A 1VQM1 2OTL1 4BJ5C 2VPLA 2RNGA 2X6XA 2M7BA 3OY9A 4QTTA 3D5SC 3HOTA 3JAMf 3DTEA 4CH7A 3LSKA 4MD8A 2X85A 2J6AA 4PJMA 3IFUA 4DQYB 1YHQ1 3HL2A 3M1CA 1USPB 3S8PA 3S3NA 1R9TI 3OYCA 3MZLB 4E7JA 2W7NA 3J81f 3K4LA 4GRIA 2BVMA 4XOPA 2DE5A 3CMEZ 5C4JI 1SFOI 4BJTA 2IS6A 4PK4A 3J7A4 4CCOA 4PFOA 3CCS1 2CS3A 3OIPA 3C2GA 3S32A 3OYBA 1N77A 1W2BZ 4BBSI 4CUGA 3DPTA 2E5ZA 3LSHA 1S7MA 2JA6I 4X6AI 1D0ZA 2CV0A 4E4HA 1QVGY 4A3CI 4F92B 2NVYI 4RMNA 3K70D 4QTUA 5D1OB 1NJI1 3W3CA 2JS4A 3BG7A 1N2FA 4E32A 1VQ91 4E7HA 1X1AA 4HNTA 4S1TA 4ZC3A 2L7KA 3OYJA 3DTKA 2R7XA 2JR6A 3G6EZ 2AQFA 4XR6A 2AQEA 1UG0A 3CC41 3SYTA 2W00A 1Q7Y2 2RREA 2Y0SA 2RQQA 4ZTJA 1JI8A 2V8JA 5FLMI 4ZJZA 3AL0C 4A3BI 4NBEA 3ONQA 1R6RA 2CUJA 2LH9A 3CC7Z 2BW3A 2LY1A 4BEHA 1YX3A 1LDKB 3P5JB 1UELB 2KLOA 2MD0A 4HEA2 5CQEA 1VQK1 3H5NA 3HC7A 1VQLZ 3K7AI 2OTLZ 1W36D 1RO2A 1X1CA 1MNDA 3LSMA 2Q51A 1VQMZ 1VQP1 1KQSZ 5JHFA 1I6HI 1M902 1VQ61 4HG2A 5HNFA 2DCEA 5C44I 3L2VA 2QRCB 3H5RA 3BG6A 1I3QI 1YHQZ 3QYFA 2OTJZ 1DGWY 4U7BA 2V9KA 2VXDA 2P28A 4MLOA 3LUSA 3UNGC 4XLHA 4AVZA 3VYUB 4BJ6C 2HDWA 3CCU1 2VQLA 4MXUA 3H35A 4LG3A 3CCSZ 3OYKA 3VSKA 3OYNA 3MKZA 4DGWB 3MONA 5C3EI 1VQN1 3PO3S 4CCKA 2R7WA 4RVDA 4HPQA 2M0MA 4BGDA 3BLYA 4BU2A 3CCE1 2F6CA 3TE5B 3H9JA 4BE2A 4DK1A 5A2Qb 4CCLA 2LBFB 3D6WA 3A1YA 2FUG2 4YRVA 1RLYA 1VQ9Z 4JOMA 1V5GA 4OWRB 2DXIA 2OUMA 5HLTA 3NWSA 4Y33A 3CXCY 3UR3C 3RTRA 3GCFA 3CC4Z 3ZQQA 2M4GA 2ZSIB 1S9HA 2K3RA 2KPMA 1AA7A 3H0GI 3G711 3PSFA 3HG9A 1YUKA 4XNFA 4A3MI 3S3OA 4N4OB 5T64A 2CW8A 4A93I 4CCMA 1FMVA 2L9NA 2VQCA 4KITB 4LIUA 3OYMA 4BE1A 2GU2A 4QPOA 2H85A 5IP9I 1VQKZ 1V5EA 4BY1I 1LKXA 2RIQA 4MONA 2OZKA 4AU7A 4E2XA 3I551 1VQPZ 3HOUI 1X3WA 1L1OC 3J80b 1OLTA 4ZTFA 3FQMA 1VQ6Z 1MMNA 1WJDA 1MW7A 2WAQA 4BQQA 2PM9A 3OR1C 2VIXA 2HVQA 4BL0B 4XKBA 2NVTI 4IZZA 3CCL1 4HNUA 2GOXB 2R7VA 4J00A 3T4NB 2CUZA 5CM2M 2VJ4A 4PFPA 2CV2A 3U21A 3IP4B 3IF8A 4ITVA 2K9LA 2KRHA 3CCUZ 1KD11 4U87A 3OYIA 5A2Qf 4CZCA 2VASA 2IZ3A 1VQNZ 2JUGA 3IUOA 3GTJI 3CCEZ 4XKWA 1V5FA 1NG7A 1VQ81 2VJIA 3NWTA 5CPRB 4BDZA 4HH4A 3VMGA 4E2ZA 2M3AA 1BR1A 4E7ZA 3S2HI 3D9XA 2ZXHA 3MKYB 2V8KA 3DPLC 2GOMA 2HVRA 3G2BA 1X3ZA 3I561 2E2HI 2R7UA 1P9NA 4PJNA 5FROA 4J01A 2R7ZI 4C9YA 3DKXA 2E60A 4XX2A 3LFUA 1WJFA 4X0GA 4E30A 3G71Z 1Q861 3DTIA 3EERA 4NBAA 2JA5I 3PNVA 2PJRB 4LITA 3H9QA 1RQFA 3K70C 4YEJA 3OIQA 2V1NA 3PL8A 2IS1A 5T67A 4E7LA 3J80f 2V6EA 1HA8A 2WAFA 3OOUA 3CMA1 2P0WA 3RPUD 3I55Z 5IP7I 4XKVA 4EWCA 2DT7B 2IGKA 3DKYA 3S2DI 3PJRA 1TFIA 1ZH1A 3PO2I 4XORA 4CSWA 1Z03A 2HF1A 2LC2A 4DIQA 4B48A 4XLEA 4BXFA 2CH0A 2O5RA 3SZGA 3CF2A 4F52A 3QYEA 3L2UA 4RVFA 2W4SA 3CESA 4ZDLA 5D1PA 3CCLZ 1M1K2 1DQUA 2VQHA 2VXZA 3I9V2 3VYRB 2DOAA 4BXXI 2OOXB 1W36C 4HSTA 4Y4RA 2Q1ZB 2WAEA 1I50I 3RQ4A 1LQLA 3EPZA 2Z16A 1ERDA 3CD61 3FKJA 2JNYA 5T6BA 5KHDA 1J09A 5HOOA 4ANJA 1YJN1 2R93I 4D1QA 2A5WA 2X51A 1VQ8Z 2IGNA 3CJQB 2HPMA 3K4MA 4BY7I 1DL6A 1PJRA 3CQZI 2VL8A 3NDIA 2KI7B 4XM3A 2O53A 3F3PC 2DT6A 4NB9A 4DGLA 1FMWA 4E2WA 1YI21 1ZB8A 1Z7LA 2WBMA 4E7IA 1Q821 1QVFZ 2L5QA 3ESWA 3CCQ1 2K3PA 4RVHA 3I56Z 3CCV1 2JUBA 4DBRA 2NOJB 3S15I 2XAUA 1G59A 1WFXA 2HPIA 2VJ5A 3S1QI 4XKCA 4C2TA 4XN3A 1TWAI 1VZ0A 1TWFI 2R4GA 1NJI2 2V8IA 1TT0A 2YADA 5LL6f 3FBIB 1KC81 1N8R1 4NQWB 2M4KA 3OYFA 1S721 4JQFA 3CMAZ 2IGMA 3LMMA 3L2QA 4HRIA 2RHBA 1Q811 3GTPI 4R79A 2QKDA 1K8A1 1QHHD 2Z2SB 3S3MA 1T0FC 4PSXA 3M4OI 3OS2A 4NBFA 1QVGZ 5LD2C 3KIHA 4BS9A 1VQ41 3GTMS 3FQQA 1T95A 4IKFA 2VKDA 1PYVA 4E7SA 3BC8A 1G8XA 3SEZA 1VQ51 2E2JI 2K9MA 4CCNA 1Z21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HU9 A;  4E6K G;  1Y56 A; 
#chains in the Genus database with same CATH topology
 2VOP A;  2DA1 A;  3CC2 1;  1QHG A;  2EA2 A;  4ESF A;  2I8D A;  1IDZ A;  3WG9 A;  3OMY A;  1BC7 C;  3ERM A;  4MQ9 F;  3HUG B;  4I01 A;  2ZAE B;  2HS5 A;  4AM3 A;  1YI2 Z;  4XLN F;  3IRQ A;  4HX8 A;  3H0D A;  1ETO A;  3DEE A;  3ZMT A;  4ZH4 F;  1D5V A;  2CSO A;  1OCZ H;  3L2W A;  2DFI A;  5HVQ C;  2BVL A;  1FTT A;  2MFZ A;  5DCM A;  3CCQ Z;  3ZQF A;  1XCV A;  1WJE A;  3QYB A;  4BKX A;  4YFK F;  2GTI A;  5D1O A;  3BCB A;  4OIN F;  3SDG A;  4WXD A;  2ECB A;  2HI3 A;  4KT6 A;  1O3R A;  1KU7 A;  1FY7 A;  5BPI A;  1VQO I;  4BYY A;  3HPG A;  2E35 A;  2RKH A;  3F9K A;  2MBF A;  1ODD A;  1YW7 A;  2E71 A;  3ZQC A;  1P7J A;  1IRF A;  4IF4 A;  2XGX A;  3A4C A;  4DBQ A;  3HJE A;  4ZDP A;  5AIQ A;  1YIJ I;  2E1M B;  1UZC A;  2YR2 A;  3O8G A;  5HS8 A;  1ZRF A;  3CQZ J;  2Q4Z A;  2K5C A;  2DMN A;  4CHU A;  2IS4 A;  1RZ4 A;  2JTV A;  2FRH A;  3A01 B;  3JTH A;  4RLF A;  3H3Z A;  2ELJ A;  3CPW Z;  2O7O A;  2KIM A;  1WJA A;  1AOY A;  1U2W A;  2O3F A;  1VQO Z;  1S7E A;  1X0T A;  4IEJ A;  4EAT A;  3GLL A;  2FF4 A;  3ELK A;  3N05 A;  4Z2Y A;  3W2W A;  3PIO F;  3CCR I;  1D5Y A;  3W6V A;  1RO0 A;  4A3K I;  3D5L A;  3MVP A;  5LRR A;  5H20 A;  5IT9 b;  1GV5 A;  3M8J A;  1VQ7 1;  4CIC A;  2WY8 Q;  4RS8 A;  1Q7Y 1;  4O6J A;  1FOK A;  3GTP J;  2HWV A;  3VYS B;  4RAG A;  3RPU A;  1F5T A;  3TL4 X;  1YIJ Z;  1YJ9 Z;  1Y6I A;  4R1H A;  4B3X A;  3FIS A;  2CW0 F;  1ON2 A;  3HKZ A;  3FXQ A;  3FX3 A;  1KD1 2;  2IA2 A;  2MH2 A;  4BHC A;  2OTJ 1;  5LHH A;  3AFH A;  2WB1 A;  1YIT 1;  2X1C A;  4KNY A;  2JQ7 A;  4P9U A;  1YW8 A;  5F04 A;  4BHP A;  2DO7 A;  2FBI A;  1WJB A;  1CF7 B;  2AHQ A;  4UXN A;  3CCR Z;  3JRI A;  4BH9 A;  4FX4 A;  1IGN A;  2QA4 I;  3VYT B;  2LG4 A;  2Z5U A;  1SD7 A;  3IC7 A;  2GTH A;  3P7N A;  3FXM A;  3RI4 A;  1FT9 A;  3S93 A;  3G4S I;  1LUJ B;  3FBN B;  3K1N A;  3OYA A;  1R71 A;  5GPA A;  1F43 A;  2LTP A;  4B4C A;  3PQJ A;  2R7S A;  4II3 A;  2AXT C;  1Z7U A;  3KEY A;  2VUM I;  4M3E A;  2V26 A;  2F4O B;  2KT0 A;  2KDO A;  3OYG A;  1PUE E;  2D5V A;  2NVX J;  2BJO A;  3ZMZ A;  1BR4 A;  5E3O A;  4CCJ A;  2FEZ A;  4Q4Z F;  1HW1 A;  2BHZ A;  2XSD C;  3GKQ A;  3CCS I;  1BC8 C;  4A69 C;  1KU9 A;  2HDC A;  3RCO A;  4XIC A;  3NQO A;  5D6F A;  3KLO A;  2QA4 Z;  2OCE A;  2VKE A;  3S1R J;  4UNO A;  2VON A;  5LGT A;  1JGS A;  2RNJ A;  3PQK A;  3OW2 Y;  3ECH A;  1HOM A;  3G4S Z;  1E2X A;  1MBH A;  1T39 A;  2D1V A;  2M48 A;  2R5Z B;  3BZC A;  3DU5 A;  4MFE A;  2ZO4 A;  2P8T A;  2QRE B;  4LLG F;  2A6E F;  1TWC I;  2L2O A;  1XDS A;  1J7K A;  1IF1 A;  4A3F I;  3TW7 A;  1E0E A;  3VWB A;  2G2K A;  1T0F A;  1U5T B;  3GTO I;  2JSP A;  1LEB A;  3FXK A;  1TNT A;  3E1S A;  1HKS A;  2MAB A;  4NUB A;  2R92 J;  1SAU A;  2E2I I;  3GZ6 A;  5FLX K;  3ZQL A;  3LST A;  1QU3 A;  1VQP I;  1E17 A;  4W97 A;  5L3G A;  2EWN A;  1O3Q A;  3HZJ A;  3BR5 A;  1TW3 A;  4IOA F;  3G1O A;  5FRN A;  3W2V A;  4CA0 A;  1JUM A;  2JVH A;  2LY9 A;  3B02 A;  4LGW A;  4LB6 B;  1HC8 A;  1BW6 A;  2W48 A;  4Y17 A;  3CF5 F;  4HLY A;  1KQ9 A;  3PNY A;  3DLA A;  2VUG A;  4ASN A;  2XSJ C;  3LL7 A;  4GFB A;  3CCU I;  3IX0 A;  1Q81 2;  5IYD J;  3JRE A;  3JRC A;  5L3C A;  2XKO A;  3ZPL A;  4UB6 C;  3S2D I;  5D4S A;  2A6H F;  1Q1H A;  2ZNY A;  1CF7 A;  2HU9 A;  2ZME C;  3LSG A;  2V3V A;  2X9D A;  5BNG A;  3K9T A;  4DYQ A;  2A6T A;  3R0A A;  2H1K A;  4XRS G;  1FPQ A;  3HOY I;  1H89 C;  2JA8 I;  2COB A;  3F6O A;  2X1D A;  3ZGK A;  3PUB A;  1JXS A;  1NUI A;  2RV8 A;  5HNH A;  1BI1 A;  3G6E 1;  4HX4 A;  4UV8 A;  3CUQ C;  3CO6 C;  2PMU A;  4KJZ A;  1QPM A;  3A0H C;  1K73 2;  1RKW A;  3GF2 A;  2HQA A;  2IAI A;  2R7T A;  2F4O A;  3CZ6 A;  3S1M J;  3ZCO A;  1W0T A;  2UUZ A;  3OYL A;  3LA7 A;  4PDK A;  2L9R A;  1Y1W J;  2WA0 A;  4IOC F;  4A3D I;  1Y8Q B;  3AG3 H;  4M9S A;  4A5N A;  2WY7 Q;  3QPS A;  4PCQ A;  2ZJR F;  5FRM A;  1LB2 A;  4KIC A;  4BJ5 C;  2VPL A;  3W6K B;  2K02 A;  4M9X A;  3OY9 A;  3HOT A;  1RI7 A;  2BY1 A;  1XMK A;  2ELH A;  4AC0 A;  3QPH A;  2J6A A;  1WGX A;  1ZGJ A;  2H6B A;  3MZL B;  2EFQ A;  4GRI A;  4BJT A;  1XN7 A;  3A02 A;  3LA3 A;  2VBZ A;  2K86 A;  3VPR A;  2CS3 A;  1W2B Z;  2TCT A;  3C2G A;  2E5Z A;  3LSH A;  2WAQ N;  1ZG5 A;  2HR3 A;  4AUX A;  3WTU C;  2CV0 A;  4DZP A;  1E3P A;  5J47 A;  4ABZ A;  2LKX A;  3BG7 A;  4Q5S F;  3FMR A;  3IR7 A;  2EV5 A;  3E5U A;  1X1A A;  1TQP A;  1V54 H;  3ZQH A;  4U0Y A;  2ZXJ A;  1J2X A;  4P96 A;  4A2U A;  4WXH A;  2W00 A;  4ZTJ A;  1JI8 A;  2V8J A;  1S3J A;  2K4B A;  2OPT A;  2MLG A;  4PGH A;  3AL0 C;  4NBE A;  1W7P B;  2LH9 A;  5GAH J;  2F5C A;  5E3N A;  3CC7 Z;  4PZJ A;  1HCR A;  2BW3 A;  5F08 A;  2L4M A;  1K7A A;  3QQA A;  4GYI A;  2QEN A;  2KLO A;  1UCR A;  4HEA 2;  5CQE A;  4GO1 A;  3U1K A;  1MND A;  1RPW A;  2FE3 A;  4I0A A;  5JHF A;  2VE9 A;  1I6H I;  2X6O A;  3P9I A;  1YW9 A;  5C44 I;  2EPF A;  2AS5 F;  2DK5 A;  1FDI A;  3GTM J;  3RKX A;  3H5R A;  1BOA A;  3TKY A;  3QYF A;  1R36 A;  2OTJ Z;  1IN8 A;  2BZT A;  3HRS A;  1MJ9 A;  3OSF A;  2QQB A;  5GAE J;  3N97 A;  2XB5 A;  4BJ6 C;  3JSO A;  2M2E A;  1YG2 A;  4BXU A;  1T08 B;  1UG2 A;  5DDG A;  1KA8 A;  4LG3 A;  3OYN A;  2HKO A;  1IV8 A;  5M3M J;  3LAJ A;  3HOW J;  4NDL A;  1JTY A;  1BJA A;  4KUM A;  1VQ6 I;  4CCL A;  1JT6 A;  2LBF B;  2DPD A;  4YRV A;  1VQ9 Z;  1VF9 A;  1R00 A;  2VI6 A;  5HLT A;  3EUH A;  3BTL A;  3CXC Y;  3BR3 A;  2N8G A;  3RTR A;  4RDU A;  2FNA A;  4MNU A;  1MBG A;  1S6L A;  2KPM A;  2Q8K A;  2NS0 A;  4HBL A;  3PSF A;  5IYB J;  3CMY A;  5J8C A;  4XNF A;  3OIO A;  5T64 A;  1FYL A;  2CW8 A;  2JK3 A;  2GIZ A;  1ZGA A;  4BBS J;  4KIT B;  4L9N A;  4QPO A;  4M73 A;  2HFH A;  1O3S A;  1UST A;  4AWX B;  1X3W A;  3DF8 A;  1VQ6 Z;  4ZTF A;  2W85 A;  1MMN A;  1WJD A;  2Y30 A;  2PM9 A;  1H9G A;  3I59 B;  1FOY A;  4P55 A;  3ROU A;  1JHH A;  2NVT I;  3EYI A;  1ZRD A;  1I3A A;  2HTJ A;  4J00 A;  3T4N B;  3GTQ J;  4PFP A;  5LHI A;  3U21 A;  3IP4 B;  4XRM A;  2KRH A;  5M5W J;  3OYI A;  2FQ4 A;  4A3B J;  2X48 A;  2DTR A;  2IZ3 A;  5D8K B;  2JUG A;  3KE2 A;  2PJP A;  3SFZ A;  3GTJ I;  4XKW A;  3IH3 A;  1NG7 A;  1JKP C;  2VJI A;  1VQ8 1;  5CPR B;  4E2Z A;  2VBW A;  2H8W A;  4I09 A;  3S2W A;  3D9X A;  3Q9S A;  1P4A A;  3BG3 A;  3REO A;  2HVR A;  4A3L J;  2E2H I;  3CJT B;  1X3Z A;  2P81 A;  2R7U A;  1R23 A;  1I3Q J;  1IXR C;  4J01 A;  3GTK J;  4C9Y A;  4M71 A;  3G71 Z;  4P9F A;  2MC3 A;  4A3E J;  4LIT A;  1NH3 A;  2VPX A;  2KIU A;  2NYX A;  5FD6 A;  4GDF A;  4FE4 A;  3OIQ A;  3PL8 A;  4LLN A;  4ZZL A;  2FX0 A;  2W24 A;  1MNM C;  3JW4 A;  4G12 A;  1ITY A;  1IO2 A;  1I1G A;  1IRZ A;  5IP7 I;  2D1H A;  2L7F P;  3ABU A;  4DYC A;  3F8N A;  4EGY A;  2H94 A;  2ME6 A;  1HSJ A;  4WF2 A;  4UB8 C;  1QNT A;  3QOP A;  4V19 K;  3QYE A;  4MTD A;  2JRM A;  2ZB9 A;  5D1P A;  3CCL Z;  1MJB A;  1DQU A;  2VQH A;  3GCM A;  3I9V 2;  4IRH A;  1PDN C;  1VFC A;  4R8H A;  2P7V B;  5FO5 A;  2OOX B;  1W36 C;  4HST A;  4I7H A;  2WAE A;  3NAR A;  1YS6 A;  1I50 I;  3RQ4 A;  1K61 A;  1LQL A;  2JNY A;  1OPC A;  2HOS A;  1J09 A;  4UUT A;  4U0V A;  4I02 A;  2LKS A;  1NHA A;  3I71 A;  4DGL A;  2KI7 B;  4XM3 A;  1YI2 1;  4E2W A;  3TGN A;  1MGT A;  4E7I A;  3HHH A;  3CCQ 1;  4RVH A;  2JZY A;  5J6X A;  3MAJ A;  4KMF A;  3I56 Z;  3GYH X;  1UB9 A;  2A05 A;  5EJC A;  3QPT A;  2NOJ B;  2HEO A;  3S15 I;  3S1Q I;  5IY5 H;  4XKC A;  2CUE A;  1VZ0 A;  2R4G A;  2VT3 A;  1Y1V J;  1KC8 1;  4RGR A;  2YAD A;  2P6S A;  4NQW B;  2G9W A;  2QF7 A;  3OYF A;  2VOD A;  2G7U A;  3FWE A;  3J7Z I;  3CMA Z;  4HQM A;  5BQT A;  1OCR H;  2EV6 A;  2OZU A;  3E5Q A;  5CVR A;  1S29 A;  5L3F A;  3BY6 A;  2VKD A;  1PYV A;  4E7S A;  5A2Q K;  3KYD B;  3SEZ A;  2VBY A;  3LWF A;  5EDN A;  2E2J I;  5JR3 A;  1ZR2 A;  2ID3 A;  3RKQ A;  3P9K A;  2F5V A;  3WOD F;  2R7Z J;  2VKH A;  1ETX A;  3TP3 A;  1Y1V S;  2QR1 B;  5FLX b;  1VQO 1;  2WV0 A;  1USP A;  3DBL B;  3DV8 A;  3HXL A;  3KP3 A;  1SFO J;  1EH8 A;  1UMQ A;  3C2H A;  1JJ2 Y;  1U0J A;  1EA3 A;  1MH3 A;  2VT2 A;  1YJN Z;  3TP0 A;  2LRE A;  3UKG A;  3NFZ A;  2A69 F;  2AXL A;  4B47 A;  3VSL A;  2K5R A;  1YE9 A;  2E7Z A;  1YIJ 1;  1YJ9 1;  4IHW A;  2V9P A;  3E97 A;  3E0J B;  4N0B A;  3QP5 A;  3FK6 A;  2R5Y B;  2OU2 A;  3HOS A;  2OC6 A;  4CYC B;  2K3F A;  4I6Z A;  1JKQ C;  2UV1 A;  3IV5 A;  2RT9 A;  1D1C A;  3HSE A;  4G6T B;  3D5R C;  2FSW A;  5JLW A;  1DPU A;  1K9M 1;  2H6C A;  1D0Y A;  1LEA A;  1IN5 A;  1F36 A;  2K9N A;  4NC7 A;  4MD9 A;  1Y8R B;  1FYK A;  2B63 I;  2HGC A;  4BXX J;  4FX0 A;  3CCR 1;  3T0Y A;  3HM5 A;  5IT9 Z;  4IHY A;  1S72 Z;  1ETY A;  3G1M A;  4LD5 A;  2HQN A;  2DFE A;  1UJ8 A;  4G9Y A;  4MRI A;  2DDB A;  3GTL I;  5GAG J;  3RKW A;  3CTA A;  3FDY A;  1P4X A;  3BWG A;  4AYB A;  2V79 A;  4GXO A;  3G3Z A;  2OBP A;  4B44 A;  4KN4 X;  2KIF A;  4A0X A;  3BDD A;  3RJP A;  4Y52 I;  2IS2 A;  2XDV A;  4HNV A;  4L9V A;  1TWA J;  3KZY A;  4N4N B;  2RQP A;  1TWF J;  2ZJ2 A;  3CCJ I;  4RGX A;  2PQ8 A;  3ML6 A;  3L9F A;  1REP C;  3H3V J;  3HOW I;  2QA4 1;  3IH4 A;  1KQS Y;  2VPR A;  2XPV A;  2BEO A;  2ZBK A;  4AD9 A;  4NQW A;  1YQA A;  3G4S 1;  1QPI A;  5BMZ A;  4L5E A;  3SZT A;  3BR0 A;  2KDZ A;  2W03 A;  2HZD A;  3ZMS A;  2Y9Z A;  1VND A;  4I98 B;  1WH5 A;  3BG5 A;  2KP6 A;  4QPQ A;  3HIF A;  1PVE A;  4A0Y A;  2EB7 A;  2L02 A;  4KIF A;  5IT3 A;  4A3J I;  3ZRG A;  1I5Z A;  1X1D A;  2M45 A;  1QYP A;  3QRF F;  2MW8 A;  3HPH A;  3H0G J;  4XSZ F;  2XF6 A;  1SVO A;  2JUC A;  3MZ8 A;  4IHX A;  2VB6 A;  3CCJ Z;  3NH8 A;  5F1J A;  3G73 A;  1Q16 A;  2KFD A;  1JUP A;  1B9M A;  1OIS A;  2EIM H;  4G94 A;  4XMY A;  5E1Z B;  5DM6 F;  3F8B A;  4XBF A;  1LE8 A;  1Z67 A;  3HHG A;  5TRD A;  1J0R A;  4HV5 A;  2ZME B;  1RUO A;  2IW5 A;  4DJA A;  4OOI A;  3M07 A;  3K4B A;  4I76 A;  1USS A;  1X4O A;  3DEW A;  3OOP A;  3CCM I;  3H36 A;  2DA4 A;  2R5Y A;  3GTQ I;  5IT9 f;  2TDX A;  4RBO A;  3CUQ B;  5EZH A;  2KMU A;  1JWH C;  2IJL A;  1MMA A;  2NVU B;  4ZYD A;  1FIP A;  4QWQ A;  5CVI A;  1H8A C;  2H09 A;  3V8K A;  4Z6Y A;  2IV2 X;  1QVT A;  2JA2 A;  2RBL A;  3M8E A;  2I3C A;  1GLN A;  2E1O A;  4LIV A;  4DOZ A;  1ZEL A;  4RS4 A;  2KL4 A;  1D0X A;  1OCO H;  2CMP A;  3F6V A;  3NH4 A;  4A3L I;  2MYS A;  2OAZ A;  5CVU A;  1UAA A;  1Z02 A;  4MHG A;  4Y3O A;  2KJB A;  3GTK I;  1DGR M;  1OR7 C;  2R7O A;  4IL6 C;  4ESB A;  4Y7N I;  1QF8 A;  2LF7 A;  5CKT A;  3CCM Z;  4JX5 A;  3LQQ A;  4NB5 A;  3TMO A;  4G7Z F;  3MCZ A;  3JAM Z;  3HGY A;  2VPY A;  3GFJ A;  1O7L A;  2R7Q A;  4OAY A;  4WCG A;  4A3E I;  2CW7 A;  3M7G A;  3FHN A;  4RAY A;  4WWC A;  2JA5 J;  1U8R A;  1GDT A;  2VPW A;  2XKP A;  4KIB A;  2E19 A;  3J81 Z;  2V4J C;  3L1P A;  5M5Y J;  1TWG I;  2GXG A;  4LG0 B;  3FM3 A;  3F23 A;  2VPZ A;  4FAS D;  1KQ8 A;  2W1O A;  1ACI A;  1K83 I;  3CPW Y;  4G8X A;  2L54 A;  3K4J A;  1B8I B;  1P9Q C;  1POG A;  2MGQ A;  5KAF C;  1WQ2 A;  3WU0 A;  3M3Y J;  2ZNZ A;  4HF1 A;  3LSP A;  4HZF A;  2IP2 A;  3BG1 B;  2A68 F;  1ZRC A;  3I4M J;  1MMD A;  3QWL A;  2YU3 A;  2IXS A;  3EDP A;  1K8A 2;  2O8X A;  2QQA A;  1B9N A;  1R1T A;  4PJJ A;  4DQ2 A;  3GFI A;  2PN6 A;  1ZB9 A;  3I07 A;  1SMT A;  2HNH A;  4KIS A;  1SFK A;  4RVG A;  3FXL A;  3CCE I;  5D5W B;  3AL0 B;  2EJR A;  3H9G A;  1OCC H;  1U3E M;  1APL C;  3K4K A;  1J9I A;  3JRF A;  4BDY A;  3HOZ J;  2Z33 A;  3HOX J;  1IG7 A;  3H3V K;  4OIR F;  4AIJ A;  2VJJ A;  2JWT A;  1QQI A;  2E9H A;  2RPR A;  2P7C B;  4M9Z A;  4NB8 A;  3RYP A;  2FQ3 A;  2ZME A;  3CDI A;  3E6B A;  2FOW A;  2ZSH B;  3PSI A;  5KK1 A;  4D5F A;  4EM2 A;  2OQG A;  3DBR B;  4RM3 A;  3RKY A;  5FJ8 J;  3CME I;  3GEZ A;  2L3D A;  5B5E C;  1ZKG A;  2M5W A;  2BE5 F;  3CP8 A;  5TJJ A;  1Y1V I;  2EGT A;  1ZGW A;  2VBX A;  1YX5 A;  3CC7 1;  3ABM H;  1M1K 1;  1IN4 A;  1SVM A;  2LF8 A;  2WWY A;  4XN0 A;  2UZK A;  2X0L A;  4A3I J;  2RNG A;  1BN5 A;  2PFB A;  3QU6 A;  4WX9 A;  1ZTR A;  3M4O J;  3E6M A;  3JAM f;  3DTE A;  4A3G J;  2F4M B;  2XVC A;  3LSK A;  4MD8 A;  4W1U A;  2ZXW H;  1FBS A;  2NOG A;  3RQI A;  3HL2 A;  3MEX A;  4XSX F;  1OJL A;  4A6E A;  1LDJ A;  2DYS H;  4E7J A;  1YRN B;  2W84 A;  2W7N A;  4HF0 A;  3J81 f;  3CME Z;  2BVM A;  1WPK A;  3KCC A;  1SFO I;  5C4J I;  2M34 A;  1KU3 A;  4PK4 A;  2AO9 A;  4CCO A;  4PFO A;  2B7E A;  3R6S A;  1K4T A;  1O3T A;  4IPA A;  2OCC H;  3DPT A;  4BBR J;  2XGC A;  3Q0W A;  5D4R A;  2OTL I;  4X6A I;  5FKO A;  1QVG Y;  5K7F A;  4F92 B;  4A3C I;  4RMN A;  3GUD A;  2CFX A;  1T56 A;  3DKW A;  3W3C A;  1IUY A;  3LSJ A;  1N2F A;  2ESH A;  2JS4 A;  3HUG A;  4XID A;  1CGP A;  2KIS A;  1VQ9 1;  4E7H A;  5EGO B;  1GXQ A;  5J1Y A;  3C2B A;  2YX4 A;  3I53 A;  4ZC3 A;  3R0J A;  4DZJ A;  2CQK A;  2YPR A;  3FXJ A;  4HQE A;  4M3D A;  1B8I A;  3H1C A;  4YII A;  1FLI A;  2NAP A;  4IRG A;  3F72 A;  3RZD J;  1Q7Y 2;  1HW2 A;  6PAX A;  5FLM I;  4ZJZ A;  3S17 J;  1HDP A;  3ONQ A;  4WXC A;  4D7N A;  1YX3 A;  3K0L A;  2CGP A;  1QXF A;  1IAW A;  1P4W A;  1A35 A;  2QYO A;  2GIV A;  2STT A;  3ECO A;  1WH7 A;  2CYY A;  4L9T A;  3PO3 J;  3K7A I;  2OTL Z;  1W36 D;  2Q51 A;  5LRS A;  4CXF A;  5C4X J;  3HOV J;  1VQ6 1;  4HG2 A;  3L2V A;  9ANT A;  1G4D A;  3CC4 I;  2RDP A;  3C7J A;  5HOD A;  3A01 A;  2V9K A;  2XV4 S;  3KYC B;  3LUS A;  2EZL A;  1R22 A;  2VC0 A;  2HDW A;  1K4S A;  1H88 C;  1WCM J;  2PBI A;  4GYG A;  5CLS A;  3KFW X;  1A36 A;  3CCS Z;  2XAS A;  3VSK A;  1LFU P;  4DGW B;  5C3E I;  1TW2 A;  5F0F A;  3PO3 S;  4HLX A;  4CCK A;  2R7W A;  1UHW A;  5HDN A;  4RVD A;  4GGG A;  5EYR A;  4BGD A;  4BU2 A;  1T98 A;  2G0E A;  2DA5 A;  4I2O A;  5A2Q b;  1W5S A;  2ELK A;  4BE2 A;  4YFN F;  3A1Y A;  2FUG 2;  2PG4 A;  3X2Q H;  2DBB A;  2DA3 A;  4JOM A;  4OWR B;  2XRN A;  2Y0S N;  3NWS A;  2Y0M A;  4IO9 F;  2CQN A;  1N25 A;  3CC4 Z;  2XAH A;  3GVA A;  4LJZ F;  5EEG A;  1AA7 A;  3H0G I;  1D3Y A;  3TO7 A;  2EQR A;  3G71 1;  3HG9 A;  1XGS A;  1YRN A;  3S3O A;  1XS9 A;  2XPW A;  4HDU A;  1VQN I;  5ICG A;  2XRO A;  1WZ2 A;  4CCM A;  1FMV A;  5IP9 I;  3CJN A;  3D2L A;  4RGS A;  2JA6 J;  1VQP Z;  2EV0 A;  3ESW B;  2I10 A;  5LHG A;  1L1O C;  1OLT A;  5F0C A;  1VQ5 I;  3FMQ A;  4FE7 A;  2LD5 A;  3OR1 C;  3CC2 I;  2VIX A;  1QBJ A;  4IZZ A;  3SJM A;  3CCL 1;  1FSH A;  2BYV E;  2CUZ A;  3P9C A;  2VJ4 A;  4RB1 A;  2CV2 A;  3IF8 A;  3CCU Z;  4ITV A;  2K9L A;  2DK8 A;  4JBA A;  2XIG A;  3BR6 A;  4U87 A;  4L5I A;  3V8L A;  1T2K A;  4CZC A;  5D5U B;  3MZH A;  1FP2 A;  1VQN Z;  1PP7 U;  2DMP A;  1W7P D;  2DMU A;  2K9Q A;  3IUO A;  3I55 I;  1P6R A;  4HH4 A;  1V4R A;  3FK7 A;  3VMG A;  2KJC A;  2K7L A;  4MO7 A;  2QLZ A;  3F8M A;  4E7Z A;  4Q47 A;  1B6A A;  1UFM A;  3MKY B;  3B6A A;  3JRA A;  2JA7 J;  2PEX A;  2GOM A;  4KIG A;  3I56 1;  1P9N A;  3PIP F;  4HV6 A;  3F8C A;  2R5Z A;  3ABK H;  2V45 A;  1Q86 1;  2L0K A;  4AIH A;  2GA2 A;  2JA5 I;  3EER A;  3GLX A;  3PNV A;  1Q1V A;  1R1U A;  4BQA A;  1YOV B;  1LVA A;  1U5T A;  5T67 A;  3SZP A;  2BBY A;  2VC1 A;  3SQN A;  4O5V A;  3CMA 1;  1Z9C A;  2P0W A;  3I55 Z;  1FNN A;  4XKV A;  4RB3 C;  3PJR A;  3BPX A;  1TFI A;  1V3F A;  2HF1 A;  4UY8 I;  2ADU A;  3J7Y J;  1MIJ A;  1TC3 C;  4AID A;  2L01 A;  3IWZ A;  2CH0 A;  3SZG A;  4G6Q A;  2NS8 A;  4RVF A;  4ZDL A;  5LBQ A;  5ICE A;  3FM5 A;  2K9S A;  2VXZ A;  5E8I A;  1WKM A;  1RR8 C;  3VYR B;  3QP6 A;  2M87 A;  2RAE A;  2HYG D;  4A3M J;  1VQ7 I;  1FIA A;  5FGM A;  2IVM A;  5KHD A;  1MD0 A;  5HOO A;  1YJN 1;  2CWE A;  4D1Q A;  4LOC A;  2IGN A;  2HPM A;  5DYM A;  4G7O F;  3CQZ I;  4BY1 J;  4NB9 A;  1FMW A;  5L3D A;  1Q82 1;  2WBM A;  2L5Q A;  4U7D A;  3ESW A;  3HRU A;  2K3P A;  1YIT I;  1ZG1 A;  2OJE D;  1ON1 A;  1YTY A;  2XAU A;  2B0L A;  2VJ5 A;  5E1W A;  4ZYH A;  1QO0 D;  2FD5 A;  4XN3 A;  5FLX Z;  2ACJ A;  2WC2 A;  2V8I A;  3HTU A;  5LL6 f;  3FBI B;  1EH7 A;  3CD6 I;  1N8R 1;  5E3L A;  2M4K A;  3QAH A;  5FKN A;  5ICF A;  1S72 1;  3L2Q A;  4QSH A;  2RHB A;  1KU2 A;  3GTP I;  1I39 A;  5FFZ A;  4EVI A;  1WJ2 A;  1IV6 A;  1T0F C;  2M8E A;  1E3O C;  3BOQ A;  3K69 A;  1IC8 A;  2ID6 A;  2JN6 A;  3M4O I;  4NBF A;  3KIH A;  3GTM S;  3WU1 B;  1T95 A;  3S2H J;  3BR2 A;  5AIP A;  3WHB A;  5EEH A;  1Z05 A;  1I1S A;  1XG1 A;  2K9M A;  2HYF A;  4B09 A;  1XX5 A;  5L3E A;  3KZZ A;  1R9T J;  3ASO H;  2DFH A;  2BY3 A;  2JIM A;  4S05 A;  5LEJ A;  3DU6 A;  2KRF A;  1JE8 A;  3W2A A;  3KYL A;  2RGV A;  2FBK A;  3ASN H;  2BV6 A;  1MBK A;  2EFW A;  3VTN A;  3A0B C;  4BBR I;  3CD6 Z;  3AG4 H;  4BQN A;  2Z99 A;  2DN0 A;  5JHU A;  4YIF A;  1VQ4 I;  2JIP A;  1WJC A;  4ZDO A;  4ENN A;  4RGU A;  1DP7 P;  2GQQ A;  1UHM A;  4M3F A;  4HDV A;  1BI2 A;  1N75 A;  2FMY A;  2K40 A;  4MTE A;  5M5X J;  4V2G A;  3J80 K;  1FJL A;  3KPH A;  2KKO A;  3LAP A;  3DBH B;  3CP2 A;  3Q9V A;  2NVX I;  4FHT A;  2QBY B;  4XL9 A;  4BEH B;  2EA4 A;  4NBD A;  3A03 A;  3LQR A;  3CUO A;  4LFU A;  2QSF X;  5GPC A;  1K78 B;  2IRF G;  2ESN A;  2LK2 A;  4HSR A;  4M6X A;  3ZN1 A;  3JRD A;  1GXP A;  4IQJ A;  3CCJ 1;  3ZR8 X;  3FMS A;  3S1R I;  4F3Q A;  2L7Z A;  1QZY A;  2DQR A;  3PO3 I;  4YEL A;  3OS0 A;  3MWM A;  1W7P A;  3K4N A;  5IOY A;  5EEA A;  2R93 J;  5F6F A;  4MD7 A;  4E33 A;  4BY7 J;  2DOD A;  2XAF A;  3HOV I;  2VKV A;  4L0Y B;  2P4W A;  3NDJ A;  4NC8 A;  1VQ4 Z;  2M6N A;  1LQ1 A;  1L0O C;  2QQ8 A;  3DPU A;  3VDX A;  2ZJP F;  3WGI A;  3WHC A;  3GZ5 A;  5FLX f;  2R0Q C;  4DNC A;  3WTZ A;  1U9N A;  4XOT A;  3TBI A;  2V1U A;  4XLF A;  3SEQ A;  3A2K A;  3OYH A;  1FOX A;  4E6K G;  2Z1D A;  5B1A H;  3WGG A;  2Q2E B;  1NG6 A;  2W04 A;  3KLN A;  2R92 I;  2EIL H;  1BR2 A;  4UUS B;  4IRI A;  1RUN A;  2LY2 A;  3IAM 2;  3SFI A;  1JGG A;  2RC4 A;  2HQR A;  1JKO C;  1F4K A;  3Q87 A;  3M9A A;  4MGR A;  5ED4 A;  5FB2 A;  2DU9 A;  2LNB A;  3EED A;  1AKH B;  1I27 A;  4F55 A;  5D5X B;  1WWX A;  2LBF A;  1BM9 A;  2FBH A;  3GFM A;  4BNC A;  3CCM 1;  1BW5 A;  3TOA A;  1M90 1;  1OYY A;  4OAZ A;  2JMO A;  1SEU A;  4HX7 A;  4RA2 A;  4B43 A;  3KIF A;  3L00 A;  1X3U A;  4BQO A;  1D1A A;  2MC4 A;  3TQN A;  3KP7 A;  3U9G A;  3ZQI A;  2OA4 A;  4NNJ A;  2MD5 A;  2DJN A;  2DTZ A;  3F0C A;  1Z91 A;  5TIS C;  2KPI A;  1P92 A;  3HSF A;  4QTR A;  1OQY A;  2WV1 A;  3CLO A;  3VOE A;  5HDG A;  4A0Z A;  2AYD A;  2P3Y A;  2P6T A;  2XUB A;  5H2F C;  3HOU J;  1MMS A;  3T8R A;  1O4X A;  4XLA A;  3DP7 A;  2TRT A;  4G7H F;  3PNT A;  4HAM A;  3V42 A;  1GV2 A;  1KZH A;  3AAF A;  2QEX I;  2O8K A;  3N4M A;  2DQL A;  1MH4 A;  2QWW A;  3I59 A;  3K10 A;  5IYC J;  2BY2 A;  2YSR A;  3I4P A;  3S1M I;  3AKZ A;  2DW4 A;  3BJ6 A;  3KX2 A;  2XF7 A;  1Y1W I;  4MH4 A;  2K85 A;  3W6J B;  1K78 A;  2JVG A;  3I5U A;  1IRX A;  5F1R A;  2LOO A;  1ZHF A;  2DE6 A;  3TDZ C;  1YFH A;  3K1M A;  4LLL A;  5IP6 A;  2PMZ N;  2JA7 I;  3WG7 H;  4L0Z B;  4BUP A;  3ERE D;  3H92 A;  4RM2 A;  3VB2 A;  2ZFU A;  3TO9 A;  1G6N A;  1MBJ A;  2QEX Z;  4FIS A;  3BQY A;  5J8F A;  1IDY A;  4B1R A;  3AG2 H;  2NRA C;  3LFK A;  5IOZ A;  1F9N A;  4KT5 C;  5DV5 A;  2V7F A;  2HXO A;  4EQQ A;  4AIK A;  1Y8C A;  4M6V A;  3U50 C;  4NBC A;  3IHU A;  1WSU A;  2Q2E A;  3EUH C;  2R3S A;  2XPU A;  4S04 A;  2X6W A;  2ZFW A;  5FFX A;  4H0E A;  1JJ8 C;  1ZH5 A;  2CG4 A;  4JP0 A;  2P5V A;  2VF1 A;  1MDM B;  1HLV A;  2QVO A;  1NK3 P;  2KZV A;  2BOL A;  1IJW C;  1S8N A;  4D7M A;  1YUA A;  3OWT A;  2LLK A;  3MMY B;  4ZZD A;  5HS9 A;  2VLA A;  1KC8 2;  2PX9 A;  1Z3X A;  5AN9 F;  4YG2 F;  1AKH A;  2KHM A;  3F8F A;  4E7K A;  4TNU A;  4PSW A;  3CME 1;  3JRH A;  2D45 A;  4E31 A;  2F48 A;  1JTX A;  1YJW I;  4O3M A;  2DJI A;  1OMI A;  2M7A A;  3GBG A;  1U6G A;  2EFO A;  3PFY A;  4UVA A;  3OYD A;  3PFI A;  1DU0 A;  4JK1 X;  2VE8 A;  3K6G A;  2P5K A;  4Y13 A;  1K6Y A;  1FWZ A;  1A31 A;  1DP3 A;  4CL1 A;  3NEU A;  1TZL A;  5TGT A;  2JMW A;  2MLK A;  2LYC A;  1LJ9 A;  1ZG3 A;  3QWU A;  4NH1 C;  2HDD A;  2Z9O A;  2W57 A;  5F27 A;  2O9L A;  4XQF A;  3GTM I;  1Z01 A;  1XMX A;  2IA0 A;  3ZQ7 A;  1EKE A;  2HXI A;  4MEY F;  2F2E A;  2STW A;  2XF5 A;  2EFN A;  3TDU C;  4NBB A;  5F64 A;  2IGO A;  2CJJ A;  4P1W A;  5LGN A;  1PUF B;  1GT0 C;  3NH5 A;  1YJW Z;  4IQ4 A;  1TQI A;  4H4K C;  1S7O A;  4NBG A;  1JJ2 Z;  1WJ5 A;  2Y2Z A;  2ZC2 A;  2GLO A;  1QVF Y;  1R5H A;  1GUU A;  2AKL A;  1K9M 2;  3OL4 A;  1FYM A;  2OTL 1;  5FKK A;  1HDD C;  2IT0 A;  2M7B A;  4QTT A;  2Y48 A;  3D5S C;  3FXR A;  3MN2 A;  5HDK A;  2NNY A;  2PI0 A;  3IFU A;  4A3F J;  1R9T I;  3S3N A;  2ZKZ A;  2DI3 A;  2XAG A;  2O6G E;  2DE5 A;  2L4A A;  3GTO J;  4M72 A;  5ILV A;  3BJA A;  3J7A 4;  2CQ7 A;  4M74 A;  3DCF A;  3CCS 1;  3OIP A;  3S32 A;  3OYB A;  2E2I J;  4BBS I;  4CUG A;  1JT0 A;  2IEK A;  2FU4 A;  1VQL I;  4IVN A;  5DCM B;  3BR1 A;  3FKI J;  1VQM I;  1H0M A;  4QTU A;  5D1O B;  1NJI 1;  5DM7 F;  3V7C A;  2BY0 A;  3K2Z A;  4ON0 A;  1MDM A;  3S16 J;  3CDH A;  1QZE A;  2L7K A;  1YHQ I;  3F3X A;  1TWH J;  2R7X A;  1FX7 A;  2AQE A;  2OZ6 A;  3BTJ A;  3CC4 1;  2XB0 X;  3RDI A;  3SYT A;  2RRE A;  2Y0S A;  4JX4 A;  3FZV A;  4CYC A;  4A3B I;  1H9T A;  2HQ5 A;  4RAZ A;  1R6R A;  2CUJ A;  1RES A;  5LGU A;  4I99 C;  3S2D J;  2LY1 A;  2J5P A;  3P5J B;  2CRG A;  2MSY A;  3I54 A;  2MD0 A;  3H5N A;  4Y15 A;  1VQL Z;  5A2Q Z;  3OV8 A;  1RO2 A;  1KQS Z;  1X1C A;  3LSM A;  1VQM Z;  1VQP 1;  2XGD A;  3GTG J;  3HOY J;  2JA8 J;  1MBF A;  4IJA A;  3GFL A;  1W5T A;  5DD8 A;  2KIQ A;  2QRC B;  4CYD A;  1YHQ Z;  1I3Q I;  1DGW Y;  1VI0 A;  1SFX A;  4KMU X;  2VXD A;  4U7B A;  1OFC X;  1J5Y A;  3DXJ F;  3B73 A;  3UNG C;  4AVZ A;  2ISZ A;  2C6Y A;  1G3W A;  3CCU 1;  5L3B A;  4RB2 C;  4MXU A;  3MQ0 A;  1AA6 A;  3LA2 A;  5DTD A;  3MKZ A;  4MIM A;  3MON A;  1NK2 P;  1VQN 1;  1VQK I;  4HPQ A;  5KVR A;  4A3D J;  1YI2 I;  3BLY A;  2F6C A;  3TE5 B;  3H9J A;  4DK1 A;  1HF0 A;  3D6W A;  1L3L A;  3BT9 A;  3L7W A;  1A6Q A;  4Y33 A;  3RPQ A;  1IXC A;  1V55 H;  2E1N A;  3ZQQ A;  1ETQ A;  4KN7 X;  2M4G A;  2ZSI B;  2K3R A;  3SHF A;  1DU6 A;  2GAU A;  1ETV A;  3RYR A;  1YUK A;  2WTE A;  4EJO A;  4N4O B;  3LSR A;  5CYV A;  3CLQ A;  2MA3 A;  2ZCW A;  2VQC A;  2GU2 A;  3OYM A;  4LIU A;  2A61 A;  3WE2 A;  1VQK Z;  2RIQ A;  4MON A;  4E2X A;  1BI3 A;  4AU7 A;  2Y69 H;  3I55 1;  3HOU I;  2NXN B;  5E18 F;  4KFC A;  3J80 b;  2QQ9 A;  5HLI A;  2E1C A;  3BZ6 A;  1MW7 A;  2WAQ A;  4AVP A;  4EGZ A;  1GHC A;  1O7F A;  2LVS A;  2YU9 J;  2HVQ A;  4BL0 B;  3KEQ A;  4XKB A;  4I0B A;  4HNU A;  3KZI C;  2R7V A;  1FP1 D;  5CM2 M;  1D8J A;  1R5I D;  1FBQ A;  1KD1 1;  3F21 A;  5A2Q f;  3Q0U A;  3CUQ A;  2BXZ A;  4N9H A;  2BGC A;  3CCE Z;  1YJ9 I;  1TTY A;  1GVD A;  1V5F A;  5J1U A;  3HB9 A;  3P5J A;  2GZW A;  1EH6 A;  2M3A A;  1R4M B;  3U2R A;  5LLQ A;  1I6H J;  1WZN A;  5E20 A;  2FXA A;  3Q0V A;  5JVG F;  1YO5 C;  3S1N J;  1KGS A;  2DDA A;  5C44 J;  1FC3 A;  3DPL C;  3Q5F A;  2R7F A;  3ZMD A;  2QCO A;  3IH2 A;  1GVJ A;  3GO5 A;  2CQX A;  5FRO A;  2R7Z I;  1TQM A;  3BZK A;  1A5J A;  5FLV A;  3RZO J;  2BXY A;  2E60 A;  3DKX A;  2LP0 A;  3LFU A;  4X0G A;  1XGM A;  4XX2 A;  4E30 A;  2PJR B;  2JPC A;  2VOO A;  3H9Q A;  5JVT A;  3K70 C;  4LMY A;  1RQF A;  4YEJ A;  1QA6 A;  2YUS A;  1S7A A;  4V2F A;  3GWZ A;  3OSG A;  2V6E A;  3FXO A;  2CU7 A;  2LR8 A;  2EIK H;  2QUF A;  2WAF A;  2YS9 A;  3VOD A;  4HYE A;  4EWC A;  2DT7 B;  3M1E A;  3DKY A;  4J19 A;  4OIP F;  1XD7 A;  1ZH1 A;  3O3K A;  1X2M A;  5GTH C;  2LC2 A;  4LG0 A;  1R49 A;  4NHJ A;  1VTN C;  4HF2 A;  4B48 A;  4XLE A;  4F52 A;  1YLF A;  1Y0U A;  2HOA A;  4RB0 A;  3L2U A;  2J5O A;  1OYI A;  2M8G X;  1OYW A;  2PMH A;  4A12 A;  1M1K 2;  5EZG A;  4C3J J;  2F5F A;  3WGH A;  1Z6T A;  5E8G A;  1AWC A;  1SVL A;  1STZ A;  3S14 J;  4BXX I;  4ENM A;  2Q1Z B;  1F1Z A;  1Z77 A;  3EPZ A;  2Z16 A;  1ERD A;  3CD6 1;  1WI3 A;  4AYB N;  4ETS A;  4A6D A;  2BHY A;  2A5W A;  2X51 A;  1QZZ A;  2EIJ H;  3CJQ B;  1DL6 A;  3K4M A;  2FML A;  4FQG A;  2O53 A;  4UUV A;  2FNP A;  1HST A;  1RIO H;  1Z7L A;  1XPX A;  3MFK A;  2JUB A;  1G2H A;  4DBR A;  1ZAR A;  1BI0 A;  2NVT J;  3I4N J;  1WFX A;  2HPI A;  1ZRE A;  4QIW N;  1TWA I;  3GME A;  2HOT A;  5B1B H;  1TWF I;  3I0T A;  1X1P A;  3PM1 A;  1TT0 A;  1OKR A;  3ZQG A;  4M6Y A;  1LFB A;  4CDG A;  4FT8 A;  2NVQ J;  2IGM A;  2XGE A;  3LMM A;  1S5L C;  4UV9 A;  4HRI A;  1Q81 1;  4PGG A;  2KZG A;  3GTJ J;  3WE3 A;  1XMA A;  4PSX A;  3IRR A;  3BJO A;  3K1P A;  1QVG Z;  2IPQ X;  4BS9 A;  1VQ4 1;  3FQQ A;  4U88 A;  4IKF A;  3CCV I;  1RC9 A;  2DA7 A;  1T6S A;  4HA8 A;  4OIO F;  2JPB A;  4LB5 A;  2E2H J;  4XLP F;  1IRG A;  1Z21 A;  1LDK B;  3HRT A;  3RIR A;  2OOY B;  2F4M A;  1TBX A;  1ENH A;  2VQG A;  1XCB A;  1IN7 A;  1ORK A;  3MD2 A;  4D0P A;  4B3A A;  2PJR A;  1K73 1;  4NC6 A;  5BOX A;  3FKI I;  1TP4 A;  5E1X A;  3OL3 A;  1QRY A;  5K5O A;  3QOE A;  5IP7 J;  1AHD P;  1RNL A;  2NVY J;  2KQR A;  1RO4 A;  2LRD A;  5JLX A;  1U8B A;  3S16 I;  2CQQ A;  3NRV A;  3OW2 Z;  1TWH I;  3BP8 A;  2HOE A;  3PUF A;  5K1Y A;  2XAJ A;  1C0W A;  5B66 C;  3CCV Z;  3SXY A;  3V7S A;  2QZ8 A;  2LFU A;  5CQG A;  3TDH B;  3GZN B;  1N78 A;  1RNI A;  2K4J A;  5EGO A;  2O4H A;  3JAM b;  2BW3 B;  3OYE A;  2CUF A;  3SDB A;  3ZOB A;  3ZXS A;  1FSE A;  1X19 A;  3QOD A;  4BHB A;  4EJT A;  1W2B Y;  2X6Y A;  5DUI A;  1I50 J;  2R7D A;  2DFF A;  2LKP A;  5DS9 A;  1ZAO A;  3J81 b;  3KP2 A;  3EUK L;  2DAO A;  3JTG A;  2R6M A;  5DEQ A;  1WHU A;  1X2N A;  2NS7 A;  4ZYA A;  5D5V B;  3GTG I;  3T1B A;  1O57 A;  1ZN2 A;  4HW0 A;  2GXA A;  5ILS A;  4C2M J;  5GTI C;  5D6E A;  1W0U A;  4HGZ A;  2W25 A;  1VQ5 Z;  1LVK A;  1TNS A;  1P2F A;  5CVV A;  3CC2 Z;  1I6X A;  3BPV A;  1X4P A;  4PUS A;  3S15 J;  3RSN A;  3FXU A;  4EJV A;  3CMM A;  3S1Q J;  4DW6 A;  2DPU A;  1A04 A;  2E7X A;  3WTS C;  2E5N A;  4II2 A;  5JI6 A;  1HW5 A;  2JIQ A;  4LK1 F;  3K4C A;  2QGU A;  4NOZ A;  4GCV A;  3ISP A;  4UVB A;  1EF4 A;  1BJZ A;  2M0C A;  1R58 A;  2E34 A;  4TV7 A;  4FET A;  1HKT A;  3M3Y I;  3F3F C;  3JRB A;  1B4A A;  2QLV B;  3BTC A;  2NNN A;  2JRT A;  1KON A;  2E2J J;  2WAD A;  2QEX 1;  2PMZ A;  5HLH A;  3I4M I;  3CJR B;  3CC7 I;  3OR2 C;  2CV1 A;  2DLL A;  3ABL H;  4LK0 F;  1W1W E;  1X3W B;  3J7A O;  2DA6 A;  3CO7 C;  5CVJ A;  1ZLJ A;  1DDN A;  1X1B A;  4A93 J;  4D5C A;  1W5C C;  2LFB A;  4OIQ F;  2F4I A;  3HOZ I;  1ETK A;  3HOX I;  1MBE A;  3I64 A;  1Q86 2;  4C2U A;  1WW9 A;  3WTV C;  4UHT A;  4P5O A;  2YU9 I;  3B6C A;  2LIY A;  2DMQ A;  2OTJ I;  2Y9Y A;  2UXX A;  1BIA A;  2FJ1 A;  1LNW A;  3LSI A;  2W82 A;  3DEU A;  3BTI A;  2HKX A;  1MSE C;  1T38 A;  2MG4 A;  1T33 A;  3IAS 2;  2Y31 A;  4QLC U;  4BE0 A;  2EZI A;  3GX4 X;  3VMH A;  1VLA A;  5K5Q A;  2FA5 A;  4IX7 A;  2O03 A;  2B63 J;  4F7Z A;  2EH3 A;  2IZ4 A;  1KRL A;  4RV9 A;  3O2P E;  2E1M C;  3BG0 B;  1VQ7 Z;  2HYJ A;  2R7R A;  1IZ1 A;  3OS1 A;  2XC7 A;  3O6B B;  2L9S A;  1Z3Y A;  3HKZ N;  1PFT A;  4F91 B;  1FDO A;  1FTZ A;  4NFR A;  4A3I I;  1HBX G;  2UWM A;  1D1B A;  3S1N I;  1X3Z B;  1VQ9 I;  3GTL J;  4BAY A;  2WB1 N;  5KNL A;  4L18 B;  3L2R A;  1JJ6 C;  4A3G I;  3R4K A;  4PJL A;  2CFO A;  4XON A;  3FF5 A;  2ZXI A;  2ETH A;  3V7R A;  1YIT Z;  1SC7 A;  3C3W A;  3HGG A;  1JHF A;  4U0W A;  4Y52 J;  2KRC A;  3RZO I;  4C30 A;  1WVR A;  3GXO A;  1Y56 A;  4IHV A;  4NBQ A;  4UVC A;  4EM0 B;  1J75 A;  5ICC A;  4XLC A;  2ISY A;  2OQR A;  4YFX F;  3HBL A;  5LFA A;  1Z1D A;  2CO5 A;  3E7L A;  3R60 A;  4L9J A;  4BAC A;  2DE7 A;  1YJW 1;  1XB4 A;  2VN2 A;  1Q82 2;  1MNE A;  2O0Y A;  3BRO A;  3DWL E;  1SFU A;  4NBH A;  2PK7 A;  4MQV A;  3MKW B;  1RKT A;  1ULY A;  1R4N B;  1ZLK A;  3O8H A;  4JX6 A;  1WI9 A;  2QKL B;  1BOB A;  2LEX A;  3PO2 J;  1FOW A;  3C1D A;  2A5Y B;  4EEF G;  1B72 B;  1XTA A;  3DFG A;  2A07 F;  1X58 A;  1J59 A;  5KCM A;  1XGN A;  1N8R 2;  4FCY A;  3RZD I;  3G1L A;  5EF6 A;  2COM A;  2GM4 A;  4E2Y A;  3J7A Y;  4A3J J;  1LPQ A;  1IN6 A;  3S14 I;  3S17 I;  3E3V A;  3H5A A;  4N9I A;  5K7H A;  3KP6 A;  4CO8 A;  3VB9 A;  1CQT A;  1WII A;  3M8F A;  2JIO A;  1NP6 A;  3BCA A;  3IKT A;  3KP5 A;  4RLQ A;  2HVS A;  3BG9 A;  1ZYR F;  5C4X I;  2X1E A;  1G3Y A;  2Y75 A;  3JSP A;  3R61 A;  5ERI A;  1SAX A;  1ML8 A;  2V1X A;  1K6O A;  4F93 B;  3DQV C;  3F22 A;  1IW7 F;  2ME0 A;  3U1D A;  2QRD B;  4HGY A;  3I4N I;  2JT1 A;  2XRL A;  3EUA A;  3G71 I;  1LFP A;  5BS6 A;  3E5X A;  3JCU C;  3I3L A;  3CXC Z;  4KDP A;  4ESJ A;  2K27 A;  1WCM I;  2P5L C;  2LDU A;  4CGZ A;  2QKM B;  3D1N I;  2HTS A;  3HSR A;  3VMI A;  3MZK B;  2NVQ I;  3C18 A;  3EYY A;  2OV7 A;  1MMG A;  2YX7 A;  2GXB A;  1VQL 1;  4D9J A;  4EM1 A;  5AON A;  5IT9 K;  1VQM 1;  5J1R A;  4M3B A;  2X6X A;  2IBD A;  4X1E A;  1NTC A;  2H8R A;  2GBY A;  5BPD A;  3G6E I;  2Q0O A;  4CH7 A;  1U5T C;  3V4G A;  2X85 A;  1XSV A;  3CCL I;  3CDL A;  4PJM A;  1RRJ A;  4DQY B;  1YHQ 1;  1R7J A;  3M1C A;  1USP B;  3S8P A;  3TW6 A;  3T5X A;  4Y7N J;  3OYC A;  2EZK A;  1AU7 A;  3D0S A;  3K4L A;  4XOP A;  5H6Q A;  5CJ9 A;  4WK8 F;  1HQC A;  2IS6 A;  1N77 A;  3ZP5 A;  1S7M A;  1TWG J;  3BQZ A;  5B3S H;  2JA6 I;  1MSF C;  1TL8 A;  1D0Z A;  4E4H A;  4KA4 A;  1U78 A;  2NVY I;  3K70 D;  1Y39 A;  3HDD A;  3ZN0 A;  4YIR X;  1YIO A;  1K83 J;  4E32 A;  2JJ7 A;  3I56 I;  3KP4 A;  1U9O A;  4HNT A;  4S1T A;  1XGO A;  4RAF A;  3DTK A;  3OYJ A;  2JR6 A;  5HLG A;  2AQF A;  3G6E Z;  4XR6 A;  1ZQ3 P;  1UG0 A;  1UHS A;  3JR9 A;  1MJA A;  1B72 A;  5H6R A;  2RQQ A;  1ZR4 A;  3QPL A;  5FD5 A;  3KIO A;  4HOB A;  1XSX A;  5DD4 A;  3TOB A;  1P7I A;  2QBY A;  2L7M P;  1TT5 B;  2I5U A;  4BEH A;  3CMA I;  5E79 C;  1UEL B;  4OMY A;  1M1E B;  1SD5 A;  2GA1 A;  1VQK 1;  2DOF A;  3HC7 A;  1WRJ A;  3GW2 A;  2EFP A;  1JUS A;  1M90 2;  3IL2 A;  3EET A;  2ECC A;  1SFE A;  5HNF A;  1DUX C;  2DCE A;  3NAU A;  3MKL A;  1PP8 F;  4ZYE A;  3HTS B;  2EK5 A;  3BG6 A;  3E6C C;  1XC5 A;  1BIB A;  5DUK A;  2P28 A;  4MLO A;  4XLH A;  4EMS A;  1JKR C;  1Y0N A;  2UXN A;  3VYU B;  3VEP A;  2MH9 A;  2V6C A;  2EIN H;  2VQL A;  2QM3 A;  3H35 A;  4PJ0 C;  3OYK A;  4A3K J;  1YJN I;  4OU0 A;  4A5M A;  1KYW A;  1OR7 A;  3QU3 A;  2DYR H;  2Z3Y A;  5F0H A;  5IPA A;  4K2E A;  4XK4 A;  3L2C A;  2M0M A;  2OF7 A;  3CCE 1;  1G3S A;  5LEK A;  4UUS A;  3J80 Z;  4ENJ A;  3KEO A;  5KAI C;  5GP9 A;  1RLY A;  1V5G A;  2DXI A;  1HKQ A;  3KET A;  2OUM A;  1FBU A;  3UR3 C;  3WTX C;  3GCF A;  1BBY A;  3H3U A;  3ULQ B;  5J4Y A;  1SD6 A;  1S9H A;  1QVU A;  2JSC A;  1R1V A;  2V1D A;  2M1B A;  3TO6 A;  4XRF A;  1E3H A;  5C4J J;  1SIW A;  2LMD A;  2LSO A;  1LE8 B;  1Z6R A;  4A3M I;  1S72 I;  1YYV A;  3CCY A;  2RVC A;  3JAM K;  2F5E A;  2DA2 A;  1XSD A;  4A93 I;  2HZT A;  2L9N A;  3WTT C;  1EJ9 A;  2H85 A;  5FKL A;  4BE1 A;  1V5E A;  1IXS B;  4BY1 I;  1LKX A;  4X6A J;  4MEX F;  3FHZ A;  2OZK A;  4A3C J;  3J81 K;  4E70 A;  2QSG X;  3FQM A;  5K5R A;  1DPR A;  1KYZ A;  2ZJQ F;  4BQQ A;  3JRG A;  1BA5 A;  3ABT A;  3TED A;  2ICW G;  5ILU A;  2GOX B;  2VUM J;  2GWR A;  2QSH X;  2PLY A;  5FLM J;  3WU2 C;  4KYW A;  3HEF A;  1ONV A;  5EG0 B;  2E36 A;  4L5J A;  2DT5 A;  2VAS A;  1SMY F;  1XDU A;  2NAZ A;  4C3I J;  4S0H B;  2D2W A;  1D8K A;  5GAD J;  1A6I A;  4C3H J;  2XAQ A;  2F5D A;  3NWT A;  3Q3S A;  4G6D A;  3K7A J;  4BDZ A;  1Z0X A;  1BR1 A;  5J3L A;  3COA C;  3WTY C;  3S2H I;  2ZXH A;  2V8K A;  3G2B A;  1FEX A;  4B8X A;  4M3G A;  1FZP B;  4PJN A;  1TWC J;  4Q48 A;  3ZMV A;  3I58 A;  1WJF A;  2EBI A;  3DTI A;  4NBA A;  2G7H A;  2JIR A;  3IKV A;  2RN7 A;  2M9H A;  2E7W A;  2V1N A;  1ETW A;  4MFD A;  5D8L B;  2IS1 A;  2IA1 A;  4E7L A;  5M3F J;  3J80 f;  5C3E J;  1HA8 A;  3VFZ A;  3OOU A;  2V9V A;  3V8J A;  1VQ8 I;  3RPU D;  5DCF A;  3MZY A;  2IGK A;  2X4H A;  5JFR A;  5E17 F;  1K79 A;  2FOK A;  3PO2 I;  4XOR A;  4CSW A;  1Z03 A;  1OCT C;  3WTW C;  4DIQ A;  4BXF A;  5FKM A;  1BL0 A;  2O5R A;  3CF2 A;  3LOC A;  4EJW A;  2W4S A;  3CES A;  5J40 A;  1KQ0 A;  2H27 A;  4EV0 A;  4CZZ A;  2DOE A;  2EZH A;  5J4V A;  1RR7 A;  1MKM A;  4FTH A;  1B59 A;  2DOA A;  3IWF A;  1B1B A;  4Y4R A;  2M30 A;  1TLH B;  2B9S A;  1YS7 A;  4ZYG A;  2A3S A;  3FKJ A;  5T6B A;  4ANJ A;  1MZB A;  2R93 I;  3L09 A;  5IP9 J;  1G3T A;  1VQ8 Z;  4BY7 I;  1R5G A;  3LNQ A;  3AG1 H;  1PJR A;  4JYK A;  2VL8 A;  3NDI A;  5HS7 A;  1IUF A;  3F3P C;  2DT6 A;  1W4M A;  1ZK8 A;  4IXA A;  3ZMU A;  1ZB8 A;  3EQL F;  4XRS A;  1QVF Z;  3HYI A;  4IHT A;  3CCV 1;  4OMZ A;  4EJU A;  1T8I A;  1OCP A;  1EV7 A;  1G59 A;  4C2T A;  3K2A A;  2XHK A;  4DYR A;  1QGP A;  1NJI 2;  2H1L A;  2OD5 A;  1SD4 A;  1RET A;  3E6D A;  4JQF A;  3DLL F;  1PUF A;  2DMT A;  5EG0 A;  3T8T A;  4R79 A;  4ENK A;  2QKD A;  1LDD A;  1K8A 1;  1QHH D;  2Z2S B;  3S3M A;  3FIW A;  1SAN A;  4IHS A;  2O61 A;  5K7Z A;  2L9V A;  3OS2 A;  5LD2 C;  5E3M A;  3CCQ I;  1HXD A;  3BC8 A;  1G8X A;  1VQ5 1;  3HRM A;  4CCN A; 
#chains in the Genus database with same CATH homology
 3CC2 1;  2F5V A;  2OOY B;  2VKH A;  2F4M A;  1Y1V S;  2QR1 B;  2VQG A;  1QHG A;  5FLX b;  1VQO 1;  2I8D A;  3DU6 A;  1USP A;  3HXL A;  3W2A A;  3KYL A;  3MD2 A;  3CD6 Z;  3VTN A;  4BBR I;  3C2H A;  3OMY A;  1U0J A;  1EA3 A;  2PJR A;  1K73 1;  1YJN Z;  1JJ2 Y;  4BQN A;  2LRE A;  3FKI I;  3NFZ A;  3HUG B;  2ZAE B;  4B47 A;  3OL3 A;  3VSL A;  2K5R A;  1YE9 A;  3QOE A;  1YI2 Z;  1YIJ 1;  3H0D A;  1YJ9 1;  3DEE A;  2KQR A;  3E0J B;  3L2W A;  1RO4 A;  1WJC A;  2BVL A;  2LRD A;  5HVQ C;  2MFZ A;  4ZDO A;  3S16 I;  2OTJ 1;  3CCQ Z;  3OW2 Z;  1TWH I;  3CCV Z;  1WJE A;  3QYB A;  2OC6 A;  3HOS A;  2GTI A;  1N75 A;  5D1O A;  3BCB A;  2LFU A;  5CQG A;  2RT9 A;  3TDH B;  2UV1 A;  1K9M 1;  4KT6 A;  1D1C A;  4G6T B;  3D5R C;  3CP2 A;  1N78 A;  1RNI A;  2O4H A;  3JAM b;  2NVX I;  1D0Y A;  2BW3 B;  4XL9 A;  4BEH B;  4NC7 A;  4MD9 A;  3HPG A;  3SDB A;  3OYE A;  4NBD A;  2B63 I;  3ZXS A;  1X19 A;  3F9K A;  3QOD A;  1W2B Y;  2X6Y A;  4HSR A;  3CCR 1;  4IQJ A;  3CCJ 1;  3ZR8 X;  3J81 b;  3A4C A;  1S72 Z;  4DBQ A;  3S1R I;  3EUK L;  4F3Q A;  3PO3 I;  4YEL A;  3OS0 A;  2R6M A;  3K4N A;  4ZDP A;  4E33 A;  4MD7 A;  4ZYA A;  2E1M B;  3GTG I;  4MRI A;  3HOV I;  2Q4Z A;  3GTL I;  2K5C A;  2IS4 A;  3NDJ A;  3FDY A;  4NC8 A;  4AYB A;  1VQ4 Z;  2M6N A;  4RLF A;  4HGZ A;  3DPU A;  3VDX A;  5FLX f;  2ELJ A;  4B44 A;  3CPW Z;  1VQ5 Z;  1LVK A;  4Y52 I;  4XOT A;  3TBI A;  3CC2 Z;  4PUS A;  4XLF A;  1WJA A;  1X4P A;  2XDV A;  3SEQ A;  3RSN A;  3OYH A;  3A2K A;  2IS2 A;  3CMM A;  4E6K G;  1VQO Z;  2Z1D A;  1X0T A;  4EAT A;  2Q2E B;  1NG6 A;  4N4N B;  3N05 A;  3W2W A;  1RO0 A;  4A3K I;  2W04 A;  2E5N A;  3D5L A;  2R92 I;  4II2 A;  1BR2 A;  3HOW I;  3H3V J;  5IT9 b;  2LY2 A;  3M8J A;  2QA4 1;  1KQS Y;  3IAM 2;  2WY8 Q;  1Q7Y 1;  1VQ7 1;  3K4C A;  3VYS B;  4NOZ A;  3TL4 X;  1YIJ Z;  1YJ9 Z;  1Y6I A;  3G4S 1;  4B3X A;  3Q87 A;  3HKZ A;  2W03 A;  2HZD A;  4FET A;  3M3Y I;  3EED A;  3F3F C;  4F55 A;  1KD1 2;  2QLV B;  2LBF A;  2KP6 A;  4QPQ A;  1KON A;  3AFH A;  2WAD A;  2WB1 A;  2X1C A;  2PMZ A;  2QEX 1;  1YIT 1;  3CCM 1;  3I4M I;  1M90 1;  4A3J I;  3ZRG A;  1X1D A;  1QYP A;  4OAZ A;  2JMO A;  3HPH A;  3CJR B;  4B43 A;  1WJB A;  3KIF A;  3OR2 C;  2CV1 A;  2XF6 A;  3CCR Z;  2VB6 A;  4BQO A;  1D1A A;  2MC4 A;  3CCJ Z;  3VYT B;  3NH8 A;  2LG4 A;  4XMY A;  1X1B A;  2GTH A;  4NNJ A;  3S93 A;  2KPI A;  2F4I A;  3FBN B;  3HOZ I;  3OYA A;  2P3Y A;  3HOX I;  1Q86 2;  4DJA A;  4C2U A;  1WW9 A;  3K4B A;  2R7S A;  4P5O A;  4XLA A;  2YU9 I;  4II3 A;  2LIY A;  3PNT A;  1X4O A;  3V42 A;  3KEY A;  3LSI A;  2VUM I;  2W82 A;  2V26 A;  3GTQ I;  3OYG A;  2KDO A;  3K10 A;  5IT9 f;  2BJO A;  3IAS 2;  4BE0 A;  1BR4 A;  3VMH A;  4CCJ A;  1VLA A;  2KMU A;  4IX7 A;  1JWH C;  2IZ4 A;  3GKQ A;  3AKZ A;  3S1M I;  4RV9 A;  1KRL A;  1MMA A;  3KX2 A;  2XF7 A;  3RCO A;  1Y1W I;  4MH4 A;  2E1M C;  3BG0 B;  2QA4 Z;  1VQ7 Z;  2R7R A;  3OS1 A;  2JVG A;  2XC7 A;  2L9S A;  1IRX A;  1Z3Y A;  2JA2 A;  2RBL A;  2LOO A;  1PFT A;  4F91 B;  2I3C A;  1GLN A;  3OW2 Y;  4NFR A;  3G4S Z;  4LIV A;  4DOZ A;  2DE6 A;  2UWM A;  1D1B A;  4A3I I;  3S1N I;  1ZEL A;  4RS4 A;  5KNL A;  2KL4 A;  1D0X A;  2CMP A;  2JA7 I;  3NH4 A;  3L2R A;  2M48 A;  4A3G I;  4A3L I;  2MYS A;  3DU5 A;  4PJL A;  4BUP A;  1UAA A;  1Z02 A;  2CFO A;  4RM2 A;  4XON A;  2ZFU A;  4Y3O A;  2QRE B;  4A3F I;  2ZXI A;  1DGR M;  1OR7 C;  2L2O A;  2R7O A;  1TWC I;  4Y7N I;  1QF8 A;  5CKT A;  2QEX Z;  1E0E A;  3CCM Z;  1YIT Z;  3RZO I;  2KRC A;  3VWB A;  4C30 A;  3TMO A;  1Y56 A;  2G2K A;  3GTO I;  2JSP A;  2R7Q A;  4OAY A;  2V7F A;  4A3E I;  4XLC A;  2CW7 A;  3GTK I;  5LFA A;  3E1S A;  3FHN A;  3U50 C;  4NBC A;  2MAB A;  4BAC A;  2DE7 A;  4NUB A;  1YJW 1;  1SAU A;  2E2I I;  1Q82 2;  1MNE A;  3DWL E;  2V4J C;  3EUH C;  2PK7 A;  4NBH A;  1TWG I;  1QU3 A;  2X6W A;  3MKW B;  2VF1 A;  2QKL B;  4FAS D;  1BOB A;  2W1O A;  1K83 I;  3CPW Y;  5FRN A;  2KZV A;  3W2V A;  4CA0 A;  2JVH A;  2BOL A;  3K4J A;  1YUA A;  1P9Q C;  3OWT A;  3MMY B;  2VLA A;  3PNY A;  3DLA A;  1KC8 2;  5KCM A;  2VUG A;  1N8R 2;  1Z3X A;  2XSJ C;  5AN9 F;  3LL7 A;  3RZD I;  3BG1 B;  2KHM A;  3IX0 A;  3J7A Y;  1MMD A;  4E2Y A;  1Q81 2;  3S14 I;  4E7K A;  2IXS A;  4TNU A;  4PSW A;  3H5A A;  3CME 1;  3S17 I;  4E31 A;  1K8A 2;  2DJI A;  2M7A A;  3GBG A;  3PFY A;  4PJJ A;  3OYD A;  1ZB9 A;  4RVG A;  3I07 A;  3VB9 A;  2HNH A;  4KIS A;  1WII A;  1SFK A;  1NP6 A;  3BCA A;  2HU9 A;  3K6G A;  3AL0 B;  3LSG A;  4RLQ A;  3H9G A;  2HVS A;  1K6Y A;  2A6T A;  1DP3 A;  4CL1 A;  3K4K A;  1TZL A;  5TGT A;  5C4X I;  4BDY A;  2X1E A;  2LYC A;  3HOY I;  2VJJ A;  2RPR A;  2E9H A;  3QWU A;  4NH1 C;  2JA8 I;  2X1D A;  1ML8 A;  3ZGK A;  3PUB A;  1NUI A;  4XQF A;  4NB8 A;  3GTM I;  5HNH A;  4F93 B;  1Z01 A;  2ZSH B;  3DQV C;  3PSI A;  3G6E 1;  2QRD B;  3I4N I;  4HGY A;  2XF5 A;  4KJZ A;  3EUA A;  1K73 2;  4RM3 A;  4NBB A;  1LFP A;  3I3L A;  2IGO A;  3CXC Z;  2HQA A;  3CP8 A;  4P1W A;  1WCM I;  2R7T A;  1Y1V I;  2EGT A;  2F4O A;  3CZ6 A;  2QKM B;  3ZCO A;  3NH5 A;  1YX5 A;  4IQ4 A;  3VMI A;  1YJW Z;  3CC7 1;  2UUZ A;  3OYL A;  3MZK B;  4H4K C;  1M1K 1;  2NVQ I;  2OV7 A;  2WA0 A;  1MMG A;  4A3D I;  4NBG A;  2WY7 Q;  1JJ2 Z;  1WJ5 A;  4XN0 A;  1VQL 1;  1QVF Y;  4D9J A;  2AKL A;  1K9M 2;  5FRM A;  3OL4 A;  1VQM 1;  2OTL 1;  4BJ5 C;  2VPL A;  2RNG A;  2X6X A;  2M7B A;  3OY9 A;  4QTT A;  3D5S C;  3HOT A;  3JAM f;  3DTE A;  4CH7 A;  3LSK A;  4MD8 A;  2X85 A;  2J6A A;  4PJM A;  3IFU A;  4DQY B;  1YHQ 1;  3HL2 A;  3M1C A;  1USP B;  3S8P A;  3S3N A;  1R9T I;  3OYC A;  3MZL B;  4E7J A;  2W7N A;  3J81 f;  3K4L A;  4GRI A;  2BVM A;  4XOP A;  2DE5 A;  3CME Z;  5C4J I;  1SFO I;  4BJT A;  2IS6 A;  4PK4 A;  3J7A 4;  4CCO A;  4PFO A;  3CCS 1;  2CS3 A;  3OIP A;  3C2G A;  3S32 A;  3OYB A;  1N77 A;  1W2B Z;  4BBS I;  4CUG A;  3DPT A;  2E5Z A;  3LSH A;  1S7M A;  2JA6 I;  4X6A I;  1D0Z A;  2CV0 A;  4E4H A;  1QVG Y;  4A3C I;  4F92 B;  2NVY I;  4RMN A;  3K70 D;  4QTU A;  5D1O B;  1NJI 1;  3W3C A;  2JS4 A;  3BG7 A;  1N2F A;  4E32 A;  1VQ9 1;  4E7H A;  1X1A A;  4HNT A;  4S1T A;  4ZC3 A;  2L7K A;  3OYJ A;  3DTK A;  2R7X A;  2JR6 A;  3G6E Z;  2AQF A;  4XR6 A;  2AQE A;  1UG0 A;  3CC4 1;  3SYT A;  2W00 A;  1Q7Y 2;  2RRE A;  2Y0S A;  2RQQ A;  4ZTJ A;  1JI8 A;  2V8J A;  5FLM I;  4ZJZ A;  3AL0 C;  4A3B I;  4NBE A;  3ONQ A;  1R6R A;  2CUJ A;  2LH9 A;  3CC7 Z;  2BW3 A;  2LY1 A;  4BEH A;  1YX3 A;  1LDK B;  3P5J B;  1UEL B;  2KLO A;  2MD0 A;  4HEA 2;  5CQE A;  1VQK 1;  3H5N A;  3HC7 A;  1VQL Z;  3K7A I;  2OTL Z;  1W36 D;  1RO2 A;  1X1C A;  1MND A;  3LSM A;  2Q51 A;  1VQM Z;  1VQP 1;  1KQS Z;  5JHF A;  1I6H I;  1M90 2;  1VQ6 1;  4HG2 A;  5HNF A;  2DCE A;  5C44 I;  3L2V A;  2QRC B;  3H5R A;  3BG6 A;  1I3Q I;  1YHQ Z;  3QYF A;  2OTJ Z;  1DGW Y;  4U7B A;  2V9K A;  2VXD A;  2P28 A;  4MLO A;  3LUS A;  3UNG C;  4XLH A;  4AVZ A;  3VYU B;  4BJ6 C;  2HDW A;  3CCU 1;  2VQL A;  4MXU A;  3H35 A;  4LG3 A;  3CCS Z;  3OYK A;  3VSK A;  3OYN A;  3MKZ A;  4DGW B;  3MON A;  5C3E I;  1VQN 1;  3PO3 S;  4CCK A;  2R7W A;  4RVD A;  4HPQ A;  2M0M A;  4BGD A;  3BLY A;  4BU2 A;  3CCE 1;  2F6C A;  3TE5 B;  3H9J A;  4BE2 A;  4DK1 A;  5A2Q b;  4CCL A;  2LBF B;  3D6W A;  3A1Y A;  2FUG 2;  4YRV A;  1RLY A;  1VQ9 Z;  4JOM A;  1V5G A;  4OWR B;  2DXI A;  2OUM A;  5HLT A;  3NWS A;  4Y33 A;  3CXC Y;  3UR3 C;  3RTR A;  3GCF A;  3CC4 Z;  3ZQQ A;  2M4G A;  2ZSI B;  1S9H A;  2K3R A;  2KPM A;  1AA7 A;  3H0G I;  3G71 1;  3PSF A;  3HG9 A;  1YUK A;  4XNF A;  4A3M I;  3S3O A;  4N4O B;  5T64 A;  2CW8 A;  4A93 I;  4CCM A;  1FMV A;  2L9N A;  2VQC A;  4KIT B;  4LIU A;  3OYM A;  4BE1 A;  2GU2 A;  4QPO A;  2H85 A;  5IP9 I;  1VQK Z;  1V5E A;  4BY1 I;  1LKX A;  2RIQ A;  4MON A;  2OZK A;  4AU7 A;  4E2X A;  3I55 1;  1VQP Z;  3HOU I;  1X3W A;  1L1O C;  3J80 b;  1OLT A;  4ZTF A;  3FQM A;  1VQ6 Z;  1MMN A;  1WJD A;  1MW7 A;  2WAQ A;  4BQQ A;  2PM9 A;  3OR1 C;  2VIX A;  2HVQ A;  4BL0 B;  4XKB A;  2NVT I;  4IZZ A;  3CCL 1;  4HNU A;  2GOX B;  2R7V A;  4J00 A;  3T4N B;  2CUZ A;  5CM2 M;  2VJ4 A;  4PFP A;  2CV2 A;  3U21 A;  3IP4 B;  3IF8 A;  4ITV A;  2K9L A;  2KRH A;  3CCU Z;  1KD1 1;  4U87 A;  3OYI A;  5A2Q f;  4CZC A;  2VAS A;  2IZ3 A;  1VQN Z;  2JUG A;  3IUO A;  3GTJ I;  3CCE Z;  4XKW A;  1V5F A;  1NG7 A;  1VQ8 1;  2VJI A;  3NWT A;  5CPR B;  4BDZ A;  4HH4 A;  3VMG A;  4E2Z A;  2M3A A;  1BR1 A;  4E7Z A;  3S2H I;  3D9X A;  2ZXH A;  3MKY B;  2V8K A;  3DPL C;  2GOM A;  2HVR A;  3G2B A;  1X3Z A;  3I56 1;  2E2H I;  2R7U A;  1P9N A;  4PJN A;  5FRO A;  4J01 A;  2R7Z I;  4C9Y A;  3DKX A;  2E60 A;  4XX2 A;  3LFU A;  1WJF A;  4X0G A;  4E30 A;  3G71 Z;  1Q86 1;  3DTI A;  3EER A;  4NBA A;  2JA5 I;  3PNV A;  2PJR B;  4LIT A;  3H9Q A;  1RQF A;  3K70 C;  4YEJ A;  3OIQ A;  2V1N A;  3PL8 A;  2IS1 A;  5T67 A;  4E7L A;  3J80 f;  2V6E A;  1HA8 A;  2WAF A;  3OOU A;  3CMA 1;  2P0W A;  3RPU D;  3I55 Z;  5IP7 I;  4XKV A;  4EWC A;  2DT7 B;  2IGK A;  3DKY A;  3S2D I;  3PJR A;  1TFI A;  1ZH1 A;  3PO2 I;  4XOR A;  4CSW A;  1Z03 A;  2HF1 A;  2LC2 A;  4DIQ A;  4B48 A;  4XLE A;  4BXF A;  2CH0 A;  2O5R A;  3SZG A;  3CF2 A;  4F52 A;  3QYE A;  3L2U A;  4RVF A;  2W4S A;  3CES A;  4ZDL A;  5D1P A;  3CCL Z;  1M1K 2;  1DQU A;  2VQH A;  2VXZ A;  3I9V 2;  3VYR B;  2DOA A;  4BXX I;  2OOX B;  1W36 C;  4HST A;  4Y4R A;  2Q1Z B;  2WAE A;  1I50 I;  3RQ4 A;  1LQL A;  3EPZ A;  2Z16 A;  1ERD A;  3CD6 1;  3FKJ A;  2JNY A;  5T6B A;  5KHD A;  1J09 A;  5HOO A;  4ANJ A;  1YJN 1;  2R93 I;  4D1Q A;  2A5W A;  2X51 A;  1VQ8 Z;  2IGN A;  3CJQ B;  2HPM A;  3K4M A;  4BY7 I;  1DL6 A;  1PJR A;  3CQZ I;  2VL8 A;  3NDI A;  2KI7 B;  4XM3 A;  2O53 A;  3F3P C;  2DT6 A;  4NB9 A;  4DGL A;  1FMW A;  4E2W A;  1YI2 1;  1ZB8 A;  1Z7L A;  2WBM A;  4E7I A;  1Q82 1;  1QVF Z;  2L5Q A;  3ESW A;  3CCQ 1;  2K3P A;  4RVH A;  3I56 Z;  3CCV 1;  2JUB A;  4DBR A;  2NOJ B;  3S15 I;  2XAU A;  1G59 A;  1WFX A;  2HPI A;  2VJ5 A;  3S1Q I;  4XKC A;  4C2T A;  4XN3 A;  1TWA I;  1VZ0 A;  1TWF I;  2R4G A;  1NJI 2;  2V8I A;  1TT0 A;  2YAD A;  5LL6 f;  3FBI B;  1KC8 1;  1N8R 1;  4NQW B;  2M4K A;  3OYF A;  1S72 1;  4JQF A;  3CMA Z;  2IGM A;  3LMM A;  3L2Q A;  4HRI A;  2RHB A;  1Q81 1;  3GTP I;  4R79 A;  2QKD A;  1K8A 1;  1QHH D;  2Z2S B;  3S3M A;  1T0F C;  4PSX A;  3M4O I;  3OS2 A;  4NBF A;  1QVG Z;  5LD2 C;  3KIH A;  4BS9 A;  1VQ4 1;  3GTM S;  3FQQ A;  1T95 A;  4IKF A;  2VKD A;  1PYV A;  4E7S A;  3BC8 A;  1G8X A;  3SEZ A;  1VQ5 1;  2E2J I;  2K9M A;  4CCN A;  1Z21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...