2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
molecule keywords Mercuric transport protein periplasmic component
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
2HU9A 4E6KG 1Y56A
chains in the Genus database with same CATH superfamily
2K3RA 1I6HI 3K2AA 1U8RA 4FE7A 2H27A 2RT9A 2LMDA 2R7UA 4Y4RA 3KLOA 1RKWA 1WH5A 1WH7A 1YIOA 2ID3A 4NQWB 2WY8Q 5E3NA 3S2DJ 2HYGD 3JRGA 5CVJA 3MONA 2VJ4A 5A2Qf 2RNJA 2MH9A 1QRYA 2BZTA 2GOXB 3RPUA 3ZR8X 5GPAA 2YU9I 1WHUA 4KIFA 1KRLA 3MWMA 4XORA 3EETA 1JXSA 2PMHA 5LL6f 3I59A 1FEXA 2FOWA 2NVXI 4A3II 3M7GA 2VPRA 5B1AH 1SAXA 1QVFY 2HF1A 2OF7A 5BOXA 1L3LA 4I09A 5LRSA 3C18A 3V7SA 2ZAEB 3WG9A 3KYLA 2QF7A 5IT9Z 3HGGA 4PSXA 5E1WA 3CPWZ 2E1OA 4JP0A 5CQEA 2GU2A 4V2FA 3ERMA 4MRIA 1IXRC 3BPXA 3S1MJ 1Z1DA 2DA2A 3G1LA 1TWAI 1TWCI 2QQ8A 4ZYDA 2E36A 5E17F 2QLVB 1WWXA 1Z7UA 3H36A 4XN3A 5CPRB 1G4DA 3CCQ1 4M3EA 1WJBA 2RAEA 3KCCA 4KFCA 3JSOA 5JR3A 2XUBA 4FASD 1RZ4A 5EG0A 1O3TA 4LFUA 2DK8A 1YRNA 4UHTA 3W6KB 1YO5C 4PSWA 1P4AA 2RPRA 4B3XA 1DGRM 2DOEA 2IBDA 4QPOA 3L2UA 1EA3A 4AIKA 4HX8A 3Q0VA 4O5VA 3O3KA 6PAXA 2R7SA 2EGTA 3H0GI 1TWAJ 1TWCJ 1HA8A 3S3MA 3HSEA 2KPMA 1XCVA 1MDMA 2QQAA 2DAOA 2EZLA 4G6DA 2Y9YA 3EQLF 2Y0MA 1JUSA 2NOJB 2JUBA 3RZDJ 4IPAA 3VDXA 1BBYA 4MD9A 2M3AA 5BMZA 2H85A 1FOKA 1R4MB 2FU4A 2IGNA 5D5VB 5F08A 1BI0A 2DXIA 3GVAA 1FIPA 3I64A 1TWFJ 4ESFA 3NH5A 2OQRA 1KU9A 3HYIA 2E2II 1ZQ3P 3DF8A 1QQIA 4LG0B 4BNCA 2HOSA 4IKFA 3T1BA 1HSJA 1R49A 3AG3H 2W00A 1WGXA 3DTEA 3FXJA 3VMIA 5FB2A 5LFAA 1IRFA 1D0YA 1V54H 1EKEA 3H35A 3EDPA 2HQ5A 4PUSA 4YELA 1I50I 1Z01A 1ERDA 4DQYB 3BG0B 1XG1A 2B63I 4DZJA 3HTUA 1IRXA 3LQRA 2V8IA 3KETA 1O3SA 4A3FI 4DIQA 3MZ8A 1ZG3A 1S6LA 1WRJA 2H1LA 3GTJI 4GYIA 1HBXG 1HF0A 1QU3A 3IV5A 3IH3A 2F4MA 2XGEA 3CO6C 2HXIA 2VBZA 3TDZC 4B44A 4CCOA 4NFRA 1YI2Z 4P9UA 2M0MA 2M8EA 3D1NI 3N97A 3QPSA 3B02A 1X1PA 1I39A 3DU5A 3F9KA 2DMTA 2ISYA 1V5GA 4E7ZA 3WTSC 3GTQI 1D1BA 4ZYHA 3QYFA 2AHQA 4Z6YA 3WTWC 1BIAA 2RQPA 1HCRA 4KA4A 3ABMH 3BQZA 1VQK1 2BW3A 2VC0A 5C3EJ 2CJJA 5HLHA 1ETVA 2DYRH 2CH0A 2GTHA 4BKXA 1VFCA 1QVGY 3GTMI 3GKQA 1U0JA 3PUBA 2QKMB 4QSHA 3HSFA 1N78A 2OTJI 4IJAA 5EDNA 2LSOA 3JRAA 1LDKB 4I0AA 1X1DA 4XICA 3BZKA 2ZJ2A 4BGDA 1VQNI 4IOAF 1WJFA 2BY3A 3PO2I 5A2Qb 2UZKA 1SAUA 2LNBA 1ETQA 3K4BA 5IPAA 2R4GA 2X4HA 1LB2A 2JIMA 2X48A 3MEXA 4XLNF 2K86A 2E34A 4BXFA 4YFKF 5J47A 5HDNA 4NC7A 2X1DA 3CCEZ 3GFLA 3RJPA 5D5WB 3FHZA 2V9KA 5IP9J 5FJ8J 3ROUA 2O6GE 1W2BY 4Y7NI 1I27A 2WB1A 4MQ9F 1Q16A 2F4OB 1X3UA 5IT9f 4A6EA 2M2EA 1JUMA 2YADA 4G7HF 3JTGA 1S8NA 3NAUA 4F93B 4U0VA 1Q1HA 2L3DA 1Y8RB 4II2A 3VYTB 4GRIA 2NYXA 4HNVA 3I56Z 2ISZA 2Z33A 5HS7A 2K27A 2QBYA 1K9M2 5C3EI 2V6EA 3TW7A 3H92A 1IXCA 3ZN0A 1Z91A 3ABUA 3DFGA 1UG0A 4YIIA 2K9MA 2QKLB 3F21A 5DM7F 2XAQA 4XNFA 3OS1A 2KISA 4V2GA 3CXCZ 2QEX1 1HXDA 4EMSA 3A4CA 4M6YA 1P6RA 4BH9A 2DO7A 2DQLA 3K6GA 3GTJJ 2TDXA 4A3GJ 3AG2H 1MSEC 3PM1A 2O8XA 4KN7X 4L9TA 3T4NB 5CYVA 5IYBJ 2LVSA 3I4PA 5DEQA 3HKZN 2Y30A 4NUBA 1XS9A 1MZBA 3FHNA 5C4JI 1B6AA 5JVGF 3BTJA 4NBGA 4P55A 1FSHA 5D1OB 4L0ZB 4XLHA 3DEWA 3JAMZ 4M6XA 1G3SA 1ENHA 3FM5A 3HZJA 1SD5A 3ZQQA 3L00A 5DCMA 1QHGA 3GW2A 3RYRA 1S7MA 1WJDA 1WI3A 5J4YA 2A6HF 4C3JJ 2COBA 2ACJA 2LR8A 2ID6A 4L9VA 5ILSA 1BM9A 9ANTA 1Z02A 5TISC 1ZB8A 3P9KA 5F1RA 1JTYA 3DPUA 3QYEA 2MGQA 3HOZJ 3I07A 1IN8A 1TBXA 2K7LA 2LREA 2EZKA 4CCKA 1OQYA 2F4MB 3RKXA 1HKSA 3K4JA 4LIUA 4BBRJ 3LUSA 2XAHA 5K1YA 3CD61 2WV1A 2QA4I 1WFXA 1YG2A 1V3FA 1K83J 5FLMI 3I55Z 1YIJZ 1ZGAA 3ZQIA 4XR6A 4EEFG 1VQMI 2GAUA 2R7QA 2DOAA 3DQVC 5GAHJ 4JYKA 1LE8A 3Q5FA 4Q5SF 3Q0UA 1ZYRF 2CQ7A 2M30A 2W84A 1UB9A 1IN4A 1QF8A 2KIMA 1FMWA 4HX7A 5KK1A 2WAFA 1HKTA 4I2OA 5IYCJ 1WZ2A 2LG4A 3JAMK 4CHUA 1T0FC 3R61A 4LG0A 4U88A 3RPQA 2ZFWA 1JJ2Z 1JUPA 5TJJA 3GFMA 2YX4A 3HRUA 3SFZA 4XRMA 2JN6A 2F6CA 4M3DA 1LEAA 5HNFA 4J01A 3ZMUA 2STTA 4OU0A 2Z9OA 4X6AJ 1X0TA 3S1RJ 4DW6A 2IV2X 5A2QZ 1M1K1 1ACIA 1K78A 2D1HA 1UJ8A 2VQGA 4H4KC 4P9FA 5GPCA 4UB6C 4UY8I 3BY6A 4BBRI 2FEZA 4BDZA 1EJ9A 3Q87A 1V5EA 4O6JA 5KHDA 2AXTC 1S9HA 1XDSA 1N8R1 3VYUB 4XRFA 1GVJA 2NAPA 1BW6A 5D4RA 4CGZA 2P28A 3PO3S 2OJED 4GXOA 5FKNA 3JRBA 1BC8C 3VB9A 3KP4A 1K4SA 2L4MA 4KMFA 4IZZA 3BPVA 1E3OC 3G6EI 5EEHA 1I3AA 2DOFA 5J1YA 5KVRA 2QA41 1E17A 3LA2A 1QVGZ 2CMPA 3LSMA 1IN7A 2DQRA 3PL8A 4WXCA 3B73A 1J0RA 2VC1A 2X51A 2EA4A 1IW7F 2QWWA 3I53A 3JSPA 2WY7Q 3KP3A 4OAYA 1KD11 4DGLA 1RESA 4F7ZA 3UR3C 3ZP5A 3PIOF 1K732 2EFPA 2E2IJ 2GOMA 2QYOA 3G6EZ 3ML6A 5AONA 2P7CB 1QZYA 1DU6A 2FF4A 2EV5A 3BT9A 3ISPA 1SVOA 2QCOA 3KZIC 3K1PA 1B72B 4EWCA 4PFPA 1ZTRA 3D5SC 3BZCA 1I6HJ 2HR3A 5FD5A 2R5YA 3MKWB 3SHFA 4E7LA 4NBDA 1T6SA 4RM3A 1VQP1 5EEAA 3G1MA 3COAC 3L7WA 4GYGA 4EM0B 4HSTA 2OTLZ 5ERIA 4A3DJ 2VT2A 3CJQB 4DYQA 3MMYB 3B6AA 3TGNA 5IT9K 1AWCA 2CWEA 3TEDA 5D1OA 3SEQA 2YU9J 3FXQA 2PBIA 5E3OA 3CF5F 3C2GA 4WF2A 2UWMA 4NH1C 2KJBA 1POGA 2HYFA 2XSJC 3H5NA 3OW2Z 3WTZA 3MAJA 2F5VA 3G73A 1J9IA 3WGIA 2VPLA 2P6SA 1ETYA 3BR0A 4AIDA 2OTJ1 3L9FA 4Y33A 1A36A 2E2HJ 3IR7A 2NRAC 3A2KA 5HDKA 4E2WA 3IC7A 1OCPA 1USPB 4BAYA 1X19A 2JSPA 2L02A 2A61A 2XB5A 2CG4A 1TTYA 2FNPA 1HOMA 3G4SZ 2KJCA 3CCYA 4NBCA 1D0XA 2DMPA 3SQNA 3J80b 2HXOA 4CCMA 3OYAA 1VQPI 3RZDI 3FX3A 4A3MJ 3I4NJ 2CFOA 1MJAA 1XMXA 3PO2J 3ESWA 3KP2A 2A6EF 5D8LB 1W1WE 1LFBA 2EBIA 5IP7J 1N25A 1VQKZ 1TC3C 1RNLA 4P5OA 3E6BA 2BJOA 2CUEA 1TP4A 4X1EA 4AWXB 2CQQA 4OWRB 5JHFA 2PEXA 1DGWY 5EZHA 3REOA 1U8BA 4NBHA 3S1MI 5AIPA 2P81A 3O6BB 2OZ6A 5FLXb 2K5RA 3OYMA 2KQRA 4E7JA 3LSTA 1HDPA 4RA2A 5CVUA 1VQOZ 2Z99A 5IY5H 2O0YA 1W5TA 4RS8A 1R00A 2JNYA 1W0TA 3A02A 1SEUA 2QZ8A 4WX9A 1SFOJ 3S16I 3H9JA 1JT0A 3UKGA 3CJTB 1O3RA 4AIJA 1BJZA 2DTRA 1BR1A 4LG3A 4BBSJ 1RNIA 4IHTA 2CW7A 3FKJA 3GFIA 4BU2A 2CUFA 1U5TA 4NBBA 2HVQA 1OYWA 3S14J 2HTJA 5J8CA 3FQQA 4WXDA 3NEUA 3GTKJ 1N2FA 1L0OC 1SFXA 1LQLA 3EUHC 3WTUC 1IUYA 1UHMA 3FXKA 1SVMA 1B9NA 2BW3B 4HNTA 3AKZA 2XPUA 4HQEA 2FSWA 2B63J 2HTSA 2FBHA 3HM5A 1W36D 2XGDA 3X2QH 4LLLA 3V7RA 4E2XA 3M3YJ 3CC21 4G8XA 2V1DA 2Y48A 4AYBA 2L9NA 1X1BA 3S16J 2L7MP 1FMVA 4E31A 3FKII 1JHHA 1S7AA 2E2JI 5M5WJ 1S3JA 2AQEA 2AYDA 3N4MA 3U50C 1A6IA 3CTAA 3H9QA 1IV6A 1UHWA 2MLKA 3OV8A 1PUEE 3HRTA 5E79C 3H3VJ 2LFBA 5AIQA 1P2FA 3AL0B 4HX4A 1VQ91 1WI9A 1Z6RA 1R1UA 4G94A 3U9GA 3I55I 1YIJI 4NOZA 1FBSA 4NDLA 3F23A 1D5YA 3FF5A 1WCMI 2NS8A 1B9MA 1YYVA 1ETWA 2GBYA 2O53A 2V1NA 2JA8I 2G0EA 3QP5A 4RS4A 2W82A 4HZFA 4DYCA 1X3WA 3S15I 5CKTA 1M1EB 2Y75A 2IS1A 2FBKA 3P5JA 3GX4X 2EA2A 2JMOA 1DP7P 2R7VA 2VUGA 1R4NB 4LD5A 2IGMA 1FLIA 1VQ7I 2W25A 4I6ZA 1JKPC 1PFTA 3R60A 5FKOA 3DTKA 2CUZA 3ELKA 3WU2C 2A05A 3MD2A 3I71A 4DOZA 2JJ7A 2K40A 3FK7A 1BW5A 3N05A 2R5YB 1Q7Y1 3MZKB 1E3HA 4PJMA 1TWGI 3BTCA 2MBFA 1B72A 1QGPA 2EINH 2Q2EA 5IOZA 3AG4H 3WU0A 3TP0A 3FXLA 2EJRA 2A68F 1I5ZA 1R5ID 1A35A 1ZK8A 1YFHA 2FE3A 5JVTA 4XSXF 5LEJA 5CLSA 2R3SA 5H6QA 1TWHI 4F91B 3I551 3QPLA 1YIJ1 4G9YA 2VXDA 1Z3XA 5LLQA 4B09A 4S05A 3ESWB 4J00A 2DK5A 3KZYA 3CC7I 4L0YB 1FZPB 1W0UA 2VUMI 5T6BA 4AYBN 2V79A 3ABLH 1X1AA 4M9SA 5DV5A 3QOEA 3GF2A 3TDUC 3K4KA 4ABZA 1PDNC 2DBBA 3U2RA 3DCFA 5K7FA 1TQMA 4BY7J 3TOBA 2DJIA 2E1MB 2M1BA 1XX5A 2ZKZA 3RIRA 1RUOA 5AN9F 2DT7B 2O7OA 5T67A 4A2UA 4F3QA 3EERA 3CXCY 4BE1A 2O61A 2RKHA 1CQTA 3QYBA 5FROA 3AL0C 2K85A 1AHDP 4CO8A 4CYDA 4D7NA 1V4RA 4XK4A 2AKLA 3KLNA 1RI7A 2FJ1A 2M48A 3VB2A 3CCJI 1Y1VJ 4BJTA 4DNCA 1G3WA 2KFDA 3HDDA 5HLTA 4ZYEA 1R71A 1O7LA 1XB4A 2OCEA 2G2KA 2LOOA 3LFKA 4EM1A 3H0DA 1CF7B 1Y0NA 3E7LA 3K70C 1BIBA 2XB0X 3F3PC 4A12A 4RB2C 2L7FP 4S04A 4E32A 2PJRB 1T95A 4A0ZA 1VQ5Z 3T0YA 2L54A 4A3KJ 3HSRA 4UUSA 3HC7A 4XKWA 1H88C 2JTVA 4K2EA 2EK5A 4RVFA 1QXFA 4MIMA 1X2MA 2EFQA 3J7AY 3VTNA 1O57A 2JPCA 2E1NA 1GXPA 2R7TA 3F22A 3DKXA 1W2BZ 2HS5A 2KIUA 4HYEA 5HNHA 3WGHA 2HQAA 2VKEA 1ZRDA 1OLTA 1J5YA 2OZKA 1VQ6Z 3M1CA 2QEXI 1F36A 1Y6IA 3RPUD 5E18F 5DYMA 1U78A 3DP7A 4E4HA 2EV0A 3LMMA 3H9GA 1VQPZ 3GMEA 1Y1WJ 3GLXA 1GHCA 3RI4A 2KHMA 2UUZA 3BQYA 1FOYA 4XQFA 3AFHA 3A03A 4OIQF 3VPRA 2QRCB 2C6YA 4IOCF 2XPWA 2LBFA 3KFWX 4MD8A 4C2UA 2DLLA 3A1YA 3PSFA 2XRLA 3ZRGA 4U0WA 1VQ71 4M3FA 1NG6A 4IHSA 3BZ6A 4XN0A 3PNYA 3SYTA 2F5CA 1T2KA 3LL7A 4B43A 4BJ5C 5F6FA 5HLIA 3J81f 3R4KA 3I561 4CZCA 3ZGKA 4XONA 4ESJA 3I54A 4HA8A 3DXJF 2VIXA 3H1CA 2V7FA 1UAAA 1DL6A 1SFEA 1ZR2A 1Q822 1S7OA 3ZQ7A 1TNTA 4LLGF 4WK8F 3DBLB 4KJZA 3WTTC 2L01A 1OR7C 1DUXC 3SEZA 2LF8A 4OMZA 3HGYA 1YITZ 3BR2A 1J2XA 3OW2Y 3F3FC 4HQMA 2V26A 1K61A 2JIOA 4MXUA 3ZMDA 1B59A 2BXYA 5F0HA 4C3HJ 3MVPA 3F8FA 4HSRA 3BTLA 4BE2A 2VF1A 3IRQA 4ZYGA 2O5RA 1OCTC 4EJWA 1E2XA 2W04A 1GVDA 2DYSH 1MNMC 1VF9A 1S7EA 2CFXA 2ZNZA 1KA8A 4D1QA 2JUGA 2I3CA 3NDJA 2LIYA 3CUQA 3L09A 2OD5A 2LC2A 5C44I 3PIPF 3M07A 4A3EJ 2IRFG 4A3LJ 1ZR4A 1MGTA 3PNTA 3MKYB 4A3DI 2TCTA 3VEPA 2HFHA 2RNGA 4ASNA 2JA5I 1Z7LA 3CMA1 1SMYF 1VQ51 4H0EA 1GV5A 4AD9A 1MBKA 1XC5A 1Z9CA 1W5CC 3QU6A 1C0WA 2B0LA 2IS6A 3G711 2QENA 1MBFA 4NNJA 1I3QI 5FKKA 2GQQA 2R7WA 1O3QA 2E7ZA 1YJWZ 1MMSA 1E3PA 2CS3A 4BL0B 4FX4A 3V8LA 4LLNA 2DFHA 3C3WA 3OYHA 1R5GA 2PFBA 1P7IA 1Z0XA 3OYNA 3W2AA 1DQUA 4KICA 3IFUA 3JRDA 1KC81 2FX0A 4RV9A 4FQGA 1Q812 2J6AA 2FA5A 5D6FA 3TO6A 3PJRA 3PFIA 4XSZF 4ZTJA 4RB1A 2ESHA 2XSDC 2HPIA 1TW2A 3F8MA 2A69F 5F64A 2RREA 1IXSB 2BYVE 2DA3A 1VQ8I 2DMUA 3M8FA 2QR1B 1OCOH 1VQ7Z 4UUVA 4TNUA 2MFZA 2VT3A 3W2VA 3CCU1 2EFNA 2R7XA 4XLFA 2HI3A 3GTQJ 1WJCA 2YR2A 4MEYF 3PO3J 3CCM1 2E1MC 1ETXA 2BXZA 4HDUA 1ULYA 5L3DA 1TQPA 2KKOA 2R7FA 3RKWA 1UELB 4YG2F 2R7ZJ 3ZQLA 3LSKA 2DMQA 5GP9A 2HVSA 2VLAA 2M5WA 4B48A 3GTMJ 4XKCA 3GLLA 4UNOA 2L0KA 5EF6A 2R92J 3CCV1 4I02A 2P3YA 1HW2A 1VQLI 5JHUA 3DPTA 3FMRA 3RSNA 1T0FA 1OISA 2DMNA 2ZSIB 3CMEI 1U9NA 2W24A 4RAGA 1D8JA 5CJ9A 3HOWJ 3F8BA 3SZGA 4HV6A 2JA5J 3OYIA 1VQ9Z 3OR2C 3CCUZ 2V8KA 3GO5A 2PI0A 2NVXJ 3DKWA 1FJLA 1U5TB 3WG7H 3IHUA 5ICGA 3NQOA 1GV2A 1JKQC 2IZ4A 2W4SA 1JJ2Y 2VOPA 1LKXA 3HEFA 4PZJA 1MSFC 2Z2SB 3HUGB 3K0LA 3BG9A 2I8DA 3KP6A 1TL8A 3GTGI 3V8KA 1BI2A 2OA4A 1D8KA 2Y2ZA 4A5MA 3Q0WA 5LBQA 1JE8A 2VPXA 1YJ9I 3CCUI 3D6WA 3TE5B 5FKLA 1SFUA 4JX5A 1Z21A 4ETSA 5L3BA 1R1TA 3OR1C 3TW6A 3VYSB 3E5QA 3HOYI 1OYYA 2QSGX 2IA0A 4FTHA 2X6WA 2N8GA 2NVQJ 4CUGA 2IZ3A 4GCVA 4QTTA 2DPDA 3QODA 1KZHA 3CESA 4E7SA 2MC4A 2V6CA 4N4OB 1BR2A 2FQ4A 4IEJA 4XM3A 4ZJZA 3QU3A 4RLFA 1M901 1YHQ1 1U9OA 1KQ9A 4RGRA 2IGOA 2LK2A 3CMAI 3OYDA 3EYIA 1FYMA 5D6EA 1VQ5I 3GTLJ 2F2EA 4XKBA 4PGGA 2M7BA 4M3BA 3K1MA 4I76A 5DTDA 5IP6A 2HZTA 3M1EA 1R22A 1A6QA 3BROA 1YW9A 1QO0D 2QSFX 3FBIB 1VQN1 1S5LC 3GBGA 4XRSG 3ABKH 4KUMA 1MBHA 1ZRFA 3ZCOA 3NARA 4IQ4A 3HIFA 1QBJA 3HOWI 4A3JJ 3FZVA 2YU3A 2BVMA 1GLNA 1RIOH 2RDPA 1LEBA 4RAFA 2BY2A 3JREA 3DTIA 2LD5A 1FTZA 5CQGA 1K9M1 1ZGJA 1RKTA 4G6TB 2IJLA 2P5VA 3CCSZ 3CCMZ 3S3NA 1N8R2 1YUAA 2GXGA 5FLMJ 2W7NA 1XSXA 3GTOJ 3KEOA 1AKHA 2CU7A 1YS6A 4QPQA 5B5EC 3MZYA 3CC2I 1APLC 2IVMA 4CYCA 1U3EM 1GT0C 1FBUA 3IF8A 2RC4A 2R5ZB 1FOWA 1FNNA 2V9VA 1LE8B 1AOYA 1OYIA 3L2QA 1FSEA 4BEHA 2Z5UA 2XAJA 2LKXA 4Y15A 3OIOA 3J80Z 1KQSZ 1MNEA 2XHKA 4XKVA 1RETA 1K79A 2ZMEB 5DD4A 2M0CA 3TMOA 4D5FA 4L5JA 2P4WA 3D5LA 5HODA 1QA6A 1XCBA 3CCL1 2JIQA 1R9TJ 3CME1 3CZ6A 1OR7A 2XKOA 1NHAA 5HS8A 4R8HA 3CMYA 2MSYA 2ZXIA 4RAYA 2YSRA 4IVNA 4P96A 2ADUA 3TL4X 3OYGA 3QP6A 5D1PA 2R6MA 2VQCA 1FWZA 3BG7A 4YFXF 3HOYJ 1VQ8Z 1UHSA 3VMGA 2CO5A 3E0JB 3DBHB 1MNDA 2FXAA 3GTKI 3CC41 3DLLF 1UG2A 1XSVA 3S2DI 3C1DA 3CCQI 5KCMA 1IDZA 1FP2A 5HOOA 2MG4A 3VYRB 1QZZA 2XAFA 2CW0F 1DP3A 1SD4A 2V4JC 1W7PD 1QPIA 4MNUA 3JR9A 4FETA 4CYCB 2VONA 3P5JB 4QIWN 5JLWA 1CF7A 2M4KA 1MKMA 2DT6A 4PFOA 3CCEI 4A3IJ 1T39A 4E2YA 3Q9VA 2ZMEC 4L5EA 1G6NA 4HV5A 1VQ41 1X3ZA 1P9QC 5D4SA 5F0FA 3LSIA 4X6AI 1T56A 2L5QA 2OOXB 3LA3A 3SJMA 2D1VA 4DYRA 4L18B 1RQFA 3BCBA 2BY1A 1STZA 3G4SI 1BL0A 1JGSA 2G7HA 4NBFA 1NJI2 1A04A 3D5RC 2K9NA 1JHFA 2HDCA 2IAIA 3K10A 3MQ0A 2EZHA 1G8XA 3H0GJ 2UV1A 1KONA 3DKYA 4AC0A 3LNQA 4QTRA 2GLOA 1WJ2A 4HPQA 5DDGA 4MQVA 3CC71 1V5FA 3WHCA 4YEJA 2JS4A 4ZC3A 2F48A 4V19K 4PJNA 3PFYA 1Q821 3VSKA 2FUG2 2XV4S 1VTNC 4XMYA 4II3A 1BI3A 3BJAA 3DLAA 2G9WA 1USTA 4RB0A 2OUMA 4HNUA 2AQFA 1IO2A 3BWGA 3MCZA 3S15J 5M5YJ 3ASNH 1OJLA 5EGOA 2R7ZI 2E35A 3CP8A 2UXNA 2Y9ZA 4XL9A 3W2WA 2FRHA 3NWTA 3QOPA 5ICFA 3MN2A 4D7MA 3HJEA 2M34A 3H5RA 2XDVA 3OOPA 1BI1A 1YLFA 3IAM2 5M3FJ 1YW8A 2XAGA 2QEXZ 1XGSA 2ZJQF 2QSHX 3CO7C 4BY1J 3ONQA 5HLGA 5KNLA 2WWYA 1ETOA 2X6OA 4A3KI 2OV7A 3IH4A 3OL3A 3BJOA 3E1SA 4BQNA 2PN6A 2RV8A 2HYJA 2XVCA 4EV0A 3S3OA 4D0PA 2DA6A 3GUDA 2WB1N 4QLCU 3S17I 4EJVA 1MMAA 1RO2A 2XRNA 4DJAA 1VQ9I 3HHHA 2HKOA 5LHGA 3DPLC 3DV8A 2O8KA 2DU9A 1HC8A 2IT0A 2VBXA 2H1KA 4A3LI 2HQNA 3K9TA 4PGHA 1FX7A 3AG1H 3K4MA 3GTPJ 3P9CA 3HKZA 2QRDB 4HH4A 4LJZF 3S1QI 3O8GA 3V4GA 2PX9A 3GXOA 2FNAA 5B3SH 2J5PA 3HG9A 2KIFA 3Q3SA 1ITYA 2VPWA 2VBYA 4A3FJ 1QVFZ 2KDZA 2L9VA 1YOVB 5H2FC 3HOVJ 4LIVA 4A3CI 4BQQA 3WTVC 3S32A 2XGXA 2ELHA 3CC4I 3QQAA 3CQZI 2GA2A 4F55A 4JX4A 4XLCA 1FDIA 4G7OF 2D5VA 2LDUA 2DCEA 4CICA 2NNYA 4DK1A 1VQ61 2RVCA 1ZH1A 4UUSB 4A3EI 1MMGA 1KQSY 1ZELA 1JJ8C 1KGSA 5DD8A 4B47A 3VSLA 3FQMA 2ZCWA 3P7NA 5KAFC 5EJCA 4CXFA 2QM3A 2R5ZA 4NC8A 4EGYA 4C30A 2PLYA 3OYLA 2F4OA 3CCRI 2CYYA 3KEYA 3HBLA 1BR4A 3S2WA 3CD6I 3KIFA 5ILVA 1AKHB 2L7KA 2ME6A 4FCYA 4BY1I 2CQXA 2CV1A 2STWA 1F43A 2CW8A 5IT3A 4B3AA 1ZH5A 3DU6A 3PUFA 2VJIA 1K78B 3R6SA 3OOUA 2E60A 2QVOA 3CCQZ 1SFOI 4I01A 1Q862 1NG7A 3IUOA 1P9NA 5DCFA 2E1CA 3DEEA 2XF7A 2OZUA 1T8IA 1H0MA 1UFMA 3S17J 4HG2A 1BA5A 3CD6Z 3F8NA 4OINF 2OTJZ 5C4XJ 4F92B 4DBQA 1BOAA 3C2BA 1L1OC 3ECHA 3J7ZI 3G3ZA 4BQAA 3QRFF 3GZNB 3H3VK 5D5XB 3H5AA 1DPUA 1F4KA 4A3JI 2EZIA 3LSGA 1MH3A 4O3MA 1YIT1 2R93I 2BEOA 2JA6I 2VPZA 3L2RA 1B1BA 5D8KB 3K4LA 1VQKI 4IHXA 2E5ZA 5E8GA 3ZOBA 5ED4A 2R7RA 5EG0B 4C3IJ 1AU7A 5H6RA 5ICEA 3ZXSA 2QREB 3CF2A 1PVEA 3RZOI 3L2WA 1SVLA 2GIZA 3NDIA 2I10A 2B9SA 1I1GA 3OL4A 3GFJA 2Q2EB 2WTEA 2XAUA 1Y8QB 3S93A 3J81Z 2E2JJ 4BXXI 2HGCA 1K6YA 1J59A 3JAMb 2OCCH 4EQQA 1YJNZ 1FY7A 3TO9A 1IV8A 4M6VA 5FLVA 4BUPA 2OBPA 1WW9A 3FMQA 3E97A 2PMUA 2H8WA 1FDOA 2JIPA 4OOIA 3NWSA 3MKLA 4E70A 5JI6A 4CA0A 1W5SA 3BR5A 4YFNF 5FGMA 3FXOA 2V1UA 3CCLZ 3IRRA 4A3BI 4DBRA 2H8RA 4HF1A 4A3CJ 3ZQCA 2M8GX 4XLAA 3KE2A 4BACA 4NBAA 3OS2A 2IXSA 2PMZN 2RGVA 4AIHA 3CCS1 1MH4A 1ON2A 2W85A 2ELKA 3FKIJ 3TKYA 2L9RA 3J80f 2NVTI 2ZB9A 2Z16A 3GTMS 2QQBA 4PK4A 4ZYAA 5EEGA 5M5XJ 1QHHD 1H9GA 1XGMA 2DFEA 3CDHA 2E9HA 2Q0OA 3PSIA 3E6DA 1MDMB 1KD12 1GXQA 2V9PA 4BDYA 3I4MI 4IRIA 4B4CA 1B4AA 1Z05A 3M4OJ 4C2TA 2JK3A 5E3LA 1VQMZ 3FWEA 1HLVA 1BN5A 1X58A 4A3MI 3I4NI 1O4XA 3ZQFA 2OU2A 1IRZA 2BE5F 1YRNB 4BQOA 4E7IA 2KLOA 5DUKA 1FP1D 3CJNA 4N9IA 3TP3A 4WCGA 1U2WA 1YI21 4OIRF 2CQNA 1E0EA 3OMYA 4ENKA 5GAEJ 4XOPA 2H09A 3W3CA 3LSHA 1QVUA 1IGNA 2VQHA 2X9DA 4RB3C 1OMIA 1D3YA 3BJ6A 1KU3A 2R93J 4N9HA 3KX2A 1O7FA 1OCZH 2IS4A 1R6RA 1W7PB 2DA4A 4NHJA 2VN2A 1MW7A 3WGGA 2Z1DA 2HDWA 4Y52J 1Y0UA 2P6TA 2KIQA 2RQQA 2WA0A 1FBQA 2DFFA 3BR3A 1LVAA 1RR8C 3G71Z 3O8HA 1EF4A 1KU2A 4L9JA 5LGUA 1ZARA 3SDBA 2OPTA 4ZH4F 4HLYA 4Q47A 3I3LA 2DODA 3WODF 4F52A 3TOAA 5ICCA 5DUIA 4KN4X 2O9LA 1LPQA 1USSA 2GXBA 4AUXA 3CCRZ 2BOLA 5H20A 2DTZA 1FYKA 3E5UA 4Y13A 1NUIA 2R7OA 4CCLA 3GYHX 3OYKA 3LFUA 4XRSA 1H89C 1SIWA 3WE3A 3V42A 3FBNB 3MZHA 4EJTA 3QWUA 5A2QK 2A07F 5J1RA 1HW1A 1Y8CA 3G1OA 3J7AO 4A0YA 1RO4A 1M1K2 2K3PA 4WWCA 3OSFA 5LGTA 3OYCA 3WHBA 1RC9A 3I4MJ 1H8AC 5BPIA 4JQFA 3GTPI 3J81K 1K7AA 3ZPLA 5TRDA 4HW0A 2BVLA 3B6CA 2VJ5A 3ZMSA 2M4GA 2XROA 2M7AA 3SDGA 4M3GA 4IL6C 4BHCA 3C2HA 1R36A 2NVUB 4E7HA 2DPUA 1YJW1 4OIPF 1K8A1 3I58A 3RKQA 1HW5A 2EH3A 4AU7A 4ZZDA 2BBYA 1KYZA 2YPRA 5J6XA 3HB9A 2DN0A 3LAPA 1X1CA 2E7WA 2DE7A 2WC2A 3ZQHA 2JZYA 5IT9b 5FFZA 4XLPF 3WU1B 1PJRA 1SD6A 3M4OI 3J7A4 3HPHA 3I5UA 2ETHA 1YX3A 5GTIC 2ZBKA 1T08B 3CCJ1 4EM2A 3OYFA 3KZZA 1ODDA 4ANJA 4MO7A 4XLEA 2F5FA 5CVIA 1TNSA 2OAZA 5ILUA 3M9AA 5DCMB 4DZPA 2WV0A 3OSGA 1S72Z 1YJNI 4R1HA 1U5TC 1YHQZ 3DWLE 2KDOA 1LUJB 2WADA 5L3CA 1VQL1 1R7JA 4GFBA 1OPCA 2M9HA 2Q1ZB 2OTLI 1FOXA 4LOCA 1WJEA 4M9XA 4BHPA 3LQQA 3WTYC 2CSOA 3BG6A 2A5YB 1IDYA 3QPTA 5J40A 1V55H 3CCLI 1ZLKA 1VNDA 3PQJA 3GZ6A 2VUMJ 4AVPA 4ZDOA 1YE9A 4Q4ZF 3Q9SA 3NRVA 1P92A 3LOCA 2LYCA 4A93I 1HQCA 3CC7Z 2JIRA 2EIJH 3K7AI 4G7ZF 1CGPA 4IXAA 1Z6TA 4S0HB 2O4HA 1KC82 5F27A 4C9YA 4D5CA 4NB9A 1DDNA 2F5DA 1HSTA 3OIPA 2QUFA 5LRRA 3J80K 1VQOI 3JRFA 3CPWY 1ZRCA 1TFIA 2JA2A 3TQNA 3BDDA 1WQ2A 2M87A 1YJN1 4YIFA 2FMLA 3EPZA 2E2HI 2VI6A 3HOTA 3CCVZ 1F1ZA 1YUKA 2CV2A 2OTL1 2EIKH 3EUAA 2Q51A 2GTIA 3CCJZ 2E5NA 4ZTFA 2JPBA 3K2ZA 3CLQA 1WZNA 2A6TA 1MJBA 2QA4Z 4HOBA 1QYPA 2JVGA 2VKVA 4UV8A 3HOSA 4M71A 2HDDA 3BR1A 3ULQB 2XPVA 1XDUA 2IEKA 3FK6A 2HOTA 1A5JA 3S8PA 4E30A 1K83I 5CM2M 3G6E1 5CVVA 3E6CC 4I0BA 4CZZA 4IO9F 1SANA 2IP2A 3VOEA 2NVTJ 1NJI1 2W48A 3RQIA 1J7KA 1X3ZB 1AA7A 1LFPA 2IA1A 3ABTA 4LGWA 4RM2A 5C44J 3JRIA 2JR6A 2VKHA 4G6QA 1R58A 1MJ9A 3TDHB 1IG7A 1ONVA 1SC7A 3OYBA 3BP8A 2F4IA 5K5OA 2YS9A 4MTDA 4NQWA 5FLXZ 4N4NB 1NK2P 1NP6A 2LF7A 1GDTA 3CMAZ 4NC6A 3W6VA 2LBFB 2LTPA 2NS0A 1W7PA 1G3TA 1ZGWA 4PJLA 4DQ2A 3AAFA 2VOOA 2ESNA 1WPKA 2HOAA 1Z03A 1BOBA 1W4MA 4E33A 1OKRA 3RTRA 1R9TI 1XPXA 4NB8A 2NOGA 5F0CA 1JTXA 1YTYA 4Q48A 5LD2C 2K9QA 2A5WA 3LSPA 1VI0A 5C4JJ 1N75A 1UZCA 3OWTA 3F3XA 2GZWA 3LSRA 2NS7A 3MZLB 5K7ZA 4KIGA 4U87A 4LB5A 1IJWC 4MGRA 5FO5A 5C4XI 2ZMEA 5J8FA 2VBWA 3FDYA 1LVKA 1XN7A 3SXYA 2KPIA 1IN5A 4U0YA 2ZJPF 5K5QA 1PUFB 3S2HJ 2RBLA 3IKTA 2L4AA 2PMZA 2K02A 4ITVA 1ZREA 2M45A 3KP7A 3PNVA 3NH4A 2HKXA 4KITB 3T8RA 2MW8A 3U1KA 2ECBA 5BNGA 3BC8A 3CC2Z 4G12A 5J3LA 2ZJRF 3BCAA 1B8IB 3DEUA 3GWZA 3LSJA 3BOQA 4CSWA 3D0SA 5B66C 3FIWA 4KMUX 3HXLA 4DGWB 5JFRA 1VQ81 2PG4A 4U7DA 4M73A 1I1SA 4FISA 1IZ1A 3OYEA 1JGGA 1TZLA 2EIMH 3EUKL 3JTHA 4LMYA 3BG1B 1T38A 2GIVA 1JKRC 1IN6A 2ZC2A 4GGGA 4NBQA 1NH3A 1SMTA 2KZVA 1IC8A 1PUFA 3GEZA 1VQO1 4AM3A 3D9XA 2QGUA 5LHHA 4JBAA 5DS9A 3ZMTA 3TO7A 3K70D 3CDLA 2JA7J 5BS6A 2D45A 3BLYA 3G4S1 2A3SA 1G2HA 2XKPA 2Z3YA 4IX7A 4LK1F 4MHGA 1I3QJ 2E19A 4UVAA 1A31A 3HRMA 3EEDA 3CCR1 2EWNA 4I98B 2XGCA 3MKZA 4A0XA 1FC3A 3CLOA 1QZEA 2W1OA 1MIJA 3FXMA 4HAMA 2P5LC 4PDKA 4CH7A 5E20A 2NNNA 1OFCX 5L3FA 2DI3A 3V7CA 5IYDJ 5T64A 3HOXJ 4RGUA 5HS9A 3LA7A 3BTIA 1IAWA 1NTCA 1LNWA 1P7JA 2F5EA 2ZO4A 1K6OA 5F04A 1NK3P 5GTHC 3HOVI 4EVIA 5KAIC 1VZ0A 2X6XA 1XMKA 2CUJA 3NFZA 1YJ91 1T33A 2JQ7A 2G7UA 1DU0A 2MLGA 3S1QJ 2D2WA 2CV0A 2JRMA 4A3BJ 2JA7I 3K4NA 2K4JA 1XMAA 1FT9A 1ZLJA 2EFWA 2DDBA 4L5IA 1FTTA 5E3MA 1J75A 3OIQA 4ZZLA 2HQRA 4Z2YA 4YRVA 2NXNB 4BS9A 5L3GA 3F0CA 1LDDA 5FLXf 3K69A 5E1XA 4IQJA 4FT8A 1WSUA 3KYCB 1J09A 2LH9A 2ZXHA 3E5XA 2CQKA 1MBJA 2EV6A 3K1NA 5LHIA 1KQ8A 2H94A 2K9SA 1Q1VA 3I59B 4XBFA 1YHQI 4Y7NJ 1JJ6C 4BXXJ 2X6YA 3HOUI 4PCQA 3MFKA 3KEQA 2DW4A 3T8TA 2XF5A 5M3MJ 2Y0SA 5LGNA 1I6XA 4CCNA 3S14I 2H6CA 4XIDA 1Y1VS 2R92I 5HDGA 4BY7I 3KIHA 1WIIA 2OQGA 3K4CA 4M72A 4BJ6C 1RRJA 2FMYA 1X4OA 4CL1A 1LFUP 3KYDB 4OAZA 2WBMA 1TW3A 3ASOH 2ME0A 3DBRB 2O03A 4KT6A 1LDJA 2IA2A 1Q7Y2 2E7XA 3V8JA 2Q4ZA 3A01B 1G3YA 2LY2A 4U7BA 4HGYA 2JMWA 3ZMZA 2LY9A 3CUOA 3A01A 2AO9A 3I0TA 4P1WA 2GWRA 2JT1A 1FYLA 4MONA 2Y69H 1Y39A 1Y1WI 4JOMA 3QPHA 5FKMA 2XC7A 1QNTA 2DE5A 2XASA 4BEHB 1N77A 4IHWA 2KT0A 1R23A 1USPA 1D0ZA 3VFZA 3CCSI 4X0GA 1MBGA 3CCMI 4HF0A 4W1UA 1Z67A 1IUFA 3ECOA 1K8A2 3GZ5A 2QQ9A 3S1NI 1D1AA 1VQ6I 2FBIA 2GA1A 1P4WA 4BHBA 4KDPA 3OY9A 3L2VA 2NVQI 4JK1X 2JA6J 4BE0A 1VQ4Z 3C7JA 3CCVI 4LK0F 2BGCA 2E71A 1TQIA 2JUCA 2ZFUA 1PP7U 4L9NA 1BC7C 2BY0A 2YUSA 2VASA 4NBEA 3RCOA 2X1CA 3HOZI 4RMNA 1B8IA 4UVBA 4IHYA 2EILH 2Y0SN 2IGKA 1P4XA 2V1XA 3PQKA 3U21A 4HGZA 3GTLI 1KU7A 4ENNA 3GCMA 2FOKA 3GTGJ 4FE4A 3FXUA 2NAZA 3G71I 1Y56A 1MBEA 4I7HA 2IW5A 3HL2A 3IWFA 4TV7A 1ORKA 1YQAA 5GAGJ 4EATA 3CC4Z 1I50J 2LLKA 4S1TA 5DM6F 1MMNA 2UXXA 3HOXI 3E6MA 1YI2I 2K4BA 5CVRA 3HHGA 2MD0A 1Z3YA 4RVHA 4ZDPA 3J7YJ 3H3ZA 4MD7A 4OIOF 2MYSA 2PK7A 1VQM1 1XTAA 2K5CA 5EGOB 2EB7A 2KRCA 5EYRA 1SD7A 2P7VB 4YIRX 1S721 2LFUA 4RVDA 2ZSHB 4ENMA 5B1BH 3IX0A 4A3GI 2QKDA 5D5UB 3CUQB 4I99C 1YITI 1JKOC 5BPDA 4MFEA 4GDFA 1ETKA 2LRDA 4FX0A 2ZXJA 4NB5A 2Q8KA 1ZB9A 3ZN1A 4HEA2 1Y1VI 4EJOA 2KL4A 4ENJA 3FISA 4QTUA 5FRNA 3FMSA 3U1DA 1RPWA 1TT5B 3I9V2 2PJRA 3FXRA 2K9LA 3WE2A 3NH8A 3VMHA 2H6BA 2M6NA 4J19A 1R1VA 1Q861 1WVRA 1VQNZ 5FFXA 3CMMA 4W97A 1PP8F 4M74A 4PJ0C 5BQTA 2V45A 3HRSA 2I5UA 4MFDA 2DFIA 2RHBA 4RGXA 2IS2A 2HU9A 3HUGA 1ZG1A 2XF6A 2P5KA 2MA3A 1EV7A 2HWVA 4LITA 4E7KA 4BYYA 3H3UA 4RDUA 1EH6A 4A5NA 4MTEA 3IH2A 3CUQC 1ML8A 2CGPA 1ZG5A 3SFIA 3CP2A 3KPHA 2Y31A 4GO1A 3JCUC 1S72I 2GM4A 1T98A 4C2MJ 5J4VA 3R0AA 1ZN2A 1IF1A 1YJWI 3S2HI 1K4TA 2COMA 5IP9I 4MLOA 1MD0A 4Y52I 1KQ0A 4XOTA 2TRTA 4EGZA 4IHVA 3E3VA 5FD6A 1YX5A 1REPC 3K7AJ 3ZMVA 2L9SA 3BR6A 4A93J 4M9ZA 2MD5A 3KP5A 3VODA 2JA8J 2VJJA 2NVYI 2LKSA 1LJ9A 2KP6A 4KNYA 3JAMf 3IL2A 5FLXK 1XGOA 3PO3I 1HDDC 3P9IA 2LP0A 4IRHA 4A69C 4E2ZA 3F72A 4AVZA 1RR7A 5TGTA 4ON0A 2BV6A 2ZXWH 4UV9A 1FIAA 3QAHA 5E1ZB 2PJPA 4HDVA 2J5OA 3M8JA 2HOEA 5LEKA 2PQ8A 2HZDA 3QWLA 1DPRA 3ZQGA 2DT5A 1ZKGA 3UNGC 2KMUA 4N0BA 1ZAOA 3RQ4A 4E6KG 4KYWA 2VPYA 2X0LA 1TT0A 2VQLA 3F6VA 2FD5A 4UB8C 2ELJA 1F5TA 1SFKA 1JI8A 2LY1A 4HF2A 3KIOA 3M3YI 2EPFA 3IP4B 1VLAA 2BHZA 2OC6A 4A6DA 2HEOA 1F9NA 3CQZJ 4Y17A 2KZGA 2LEXA 2KRFA 1VQLZ 1JT6A 2JVHA 3CMEZ 3JW4A 1M902 2DE6A 2BHYA 3A0HC 4RVGA 2HNHA 2YX7A 2RIQA 4CCJA 2K3FA 4FHTA 5F1JA 2VE9A 1W36C 1RLYA 1U6GA 2OOYB 3HOUJ 1MMDA 2CRGA 3BG5A 2LKPA 2WAQN 1VQ4I 4HLXA 1HKQA 4D9JA 4KISA 3J81b 2W57A 1D5VA 1TWGJ 4UXNA 3L2CA 1ON1A 2IPQX 2MC3A 2FQ3A 2X1EA 2DA5A 2X85A 3OS0A 4MH4A 5HVQC 4ESBA 3T5XA 2VODA 1GUUA 1R5HA 1X4PA 2QBYB 1Q811 2DA1A 2B7EA 1XD7A 2L2OA 3FM3A 3M8EA 3S1NJ 3VWBA 1YJ9Z 3CDIA 3A0BC 4B8XA 5FRMA 1TWFI 3ERED 4HRIA 1TWHJ 3IWZA 1OCCH 4HBLA 1YS7A 3CJRB 1EH7A 2JSCA 2KRHA 1XGNA 4WXHA 1BJAA 1D1CA 1ZHFA 3HPGA 3LAJA 2HPMA 4OMYA 3RZOJ 2EQRA 4RAZA 1UCRA 4UVCA 2DDAA 3LWFA 1PYVA 4Y3OA 2R0QC 3D2LA 3L1PA 2KI7B 2XIGA 2ECCA 5IOYA 3GCFA 4QWQA 2VL8A 1FPQA 3WTXC 3F6OA 2WAEA 2AS5F 1WJAA 5EZGA 2NVYJ 2W03A 2P8TA 3IKVA 4PJJA 2QLZA 3TBIA 3R0JA 4RGSA 1S29A 1Z77A 3RYPA 4R79A 3SZPA 5E8IA 2VKDA 4EJUA 1WKMA 2JRTA 4RBOA 2ICWG 2VE8A 4ZDLA 3HTSB 3F8CA 2EFOA 2DJNA 1IRGA 2MH2A 2AXLA 2WAQA 5JLXA 1AA6A 2GXAA 1EH8A 3GTOI 1YW7A 2V3VA 1X3WB 4JX6A 3S1RI 5J1UA 1QPMA 1QVTA 3O2PE 1LQ1A 4XX2A 3JRCA 4B1RA 2L7ZA 5K5RA 3G2BA 5IP7I 5K7HA 2VB6A 2DA7A 2ZNYA 5L3EA 3CCE1 1K731 1WJ5A 2R7DA 3IAS2 4KT5C 3SZTA 1JWHC 4RLQA 2RN7A 2VXZA 3BG3A 4BXUA 1RO0A 2PM9A 4KIBA 1TLHB 4IF4A 3I56I 1G59A 4LB6B 3RDIA 2MABA 1OCRH 4IRGA 3RKYA 3OYJA 3EUHA 1XSDA 1RUNA 1UMQA 1H9TA 1WCMJ 2JWTA 2O3FA 4MEXF 4CDGA 2V8JA 4BBSI 1KYWA 2HVRA 4UUTA 3EYYA 1X2NA 2P0WA 3W6JB 5GADJ 3JRHA
chains in the Genus database with same CATH topology
1RNIA 2R6MA 5D1PA 2K3RA 2VQCA 1AA7A 1LFPA 3BG7A 2CW7A 2JR6A 3FKJA 4RM2A 3VMGA 1VQ8Z 1I6HI 2VKHA 3E0JB 2RT9A 4BU2A 1MNDA 2R7UA 4NBBA 2HVQA 4Y4RA 3TDHB 3CC41 3GTKI 3S2DI 5KCMA 4NQWB 2WY8Q 3OYBA 3FQQA 2F4IA 5HOOA 3VYRB 1NP6A 1N2FA 3MONA 4N4NB 2VJ4A 1LQLA 3EUHC 3CMAZ 5A2Qf 3AKZA 2BW3B 2LBFB 4HNTA 1DP3A 2V4JC 2GOXB 4PJLA 3ZR8X 2YU9I 1W36D 4FETA 1KRLA 4XORA 3P5JB 5LL6f 1Z03A 1BOBA 4E33A 2M4KA 2DT6A 4PFOA 4E2XA 3RTRA 4E2YA 3CC21 4A3II 2NVXI 1R9TI 4NB8A 1VQ41 1X3ZA 1P9QC 4AYBA 2L9NA 3LSIA 1X1BA 4X6AI 5LD2C 2L5QA 1QVFY 1FMVA 2A5WA 2HF1A 2OOXB 4E31A 3FKII 1N75A 3OWTA 2ZAEB 3KYLA 3MZLB 1RQFA 2E2JI 3BCBA 4PSXA 3CPWZ 2AQEA 4U87A 5CQEA 3U50C 2GU2A 4MRIA 3H9QA 4NBFA 5C4XI 1NJI2 3FDYA 3D5RC 1LVKA 2KPIA 3H3VJ 2RBLA 3K10A 1TWAI 1TWCI 2PMZA 1G8XA 3AL0B 2UV1A 4ITVA 1KONA 3DKYA 1VQ91 4HPQA 2QLVB 3CC71 3PNVA 1V5FA 3NH4A 4YEJA 4NOZA 2JS4A 4ZC3A 4KITB 4PJNA 3PFYA 4XN3A 1WCMI 2O53A 5CPRB 1Q821 2V1NA 3CCQ1 2JA8I 1WJBA 3BC8A 3VSKA 4RS4A 3CC2Z 2FUG2 2W82A 3BCAA 1X3WA 4XMYA 4II3A 3S15I 3DLAA 5CKTA 4CSWA 2IS1A 4FASD 2OUMA 3HXLA 2AQFA 4DGWB 4HNUA 1VQ81 2JMOA 2R7VA 2VUGA 2IGMA 4PSWA 3OYEA 1PFTA 2RPRA 1QVFZ 2R7ZI 4B3XA 1TZLA 1DGRM 3CP8A 3EUKL 3BG1B 4XL9A 3DTKA 2CUZA 3W2WA 4QPOA 4DOZA 3MD2A 3NWTA 3L2UA 1EA3A 3OYGA 3H5RA 2XDVA 3IAM2 3N05A 2R7SA 2EGTA 2KZVA 3H0GI 3MZKB 4PJMA 2QEXZ 1Q7Y1 1HA8A 1TWGI 3S3MA 1VQO1 3ONQA 2KPMA 5KNLA 4A3KI 2OV7A 2NOJB 3K70D 3OL3A 3E1SA 4BQNA 3BLYA 2JUBA 3G4S1 3VDXA 4MD9A 2M3AA 3S3OA 4IX7A 2H85A 2IGNA 3CCR1 3EEDA 1TWHI 3S17I 1MMAA 4F91B 2DXIA 1RO2A 3I551 1YIJ1 3MKZA 3HOZI 2VXDA 3NH5A 2E2II 1Z3XA 4DJAA 2W1OA 4J00A 3DPLC 4IKFA 2VUMI 4CH7A 2W00A 5T6BA 3DTEA 3VMIA 4A3LI 5LFAA 1X1AA 1D0YA 5T64A 3H35A 4PUSA 4YELA 1I50I 3K4MA 3QOEA 1Z01A 1ERDA 4DQYB 3K4KA 3HKZA 2QRDB 3BG0B 2B63I 4HH4A 3S1QI 2DJIA 1IRXA 2E1MB 2V8IA 3HOVI 4A3FI 1N8R2 5AN9F 2DT7B 1VZ0A 2X6XA 2CUJA 3HG9A 4DIQA 4F3QA 3NFZA 5T67A 1YJ91 3EERA 3CXCY 3GTJI 4BE1A 4LIVA 4A3CI 4BQQA 2CV0A 3QYBA 3S32A 5FROA 3K4NA 3AL0C 2F4MA 1QU3A 2JA7I 3CQZI 4F55A 4CCOA 4B44A 1YI2Z 4NFRA 3OIQA 4XLCA 2AKLA 2M0MA 4YRVA 2M48A 4BS9A 2DCEA 4DK1A 5FLXf 1VQ61 4BJTA 3F9KA 3DU5A 4E7ZA 4IQJA 1V5GA 1J09A 5HLTA 1D1BA 1MMGA 1ZH1A 2LH9A 2ZXHA 1ZELA 4A3EI 1KQSY 3QYFA 2G2KA 2LOOA 3H0DA 4B47A 3K70C 3F3PC 1VQK1 2BW3A 3VSLA 2X6YA 3FQMA 3HOUI 2XF5A 4NC8A 2Y0SA 4C30A 2PJRB 3OYLA 1T95A 2CH0A 4E32A 4CCNA 2GTHA 3S14I 2F4OA 1QVGY 1Y1VS 1VQ5Z 2R92I 3GTMI 3KEYA 1U0JA 3GKQA 4BY7I 3KIHA 1WIIA 1BR4A 3PUBA 3K4CA 4BJ6C 2QKMB 3KIFA 1X4OA 2L7KA 1N78A 4CL1A 3HC7A 4BY1I 4OAZA 4XKWA 2WBMA 2CV1A 4RVFA 2CW8A 3J7AY 3VTNA 3DU6A 4KT6A 2VJIA 2R7TA 3OOUA 3DKXA 1LDKB 2E60A 1W2BZ 1X1DA 5HNHA 3CCQZ 1Q7Y2 4BGDA 2HQAA 2Q4ZA 1SFOI 1WJFA 1NG7A 2LY2A 4U7BA 1Q862 4HGYA 1OLTA 3IUOA 2OZKA 1P9NA 3M1CA 5A2Qb 1VQ6Z 3PO2I 1SAUA 1Y6IA 3DEEA 2XF7A 3RPUD 3K4BA 4E4HA 2R4GA 4HG2A 4P1WA 3CD6Z 4MONA 3LMMA 4BXFA 2OTJZ 1Y1WI 3H9GA 1VQPZ 4JOMA 4NC7A 4DBQA 2X1DA 4F92B 2XC7A 2DE5A 3CCEZ 4BEHB 1L1OC 1N77A 2KHMA 2UUZA 2V9KA 4XQFA 3AFHA 3H5AA 1USPA 1D0ZA 1W2BY 2QRCB 4A3JI 4X0GA 4Y7NI 3LSGA 2WB1A 1YIT1 4MD8A 2LBFA 1K8A2 3S1NI 2R93I 4C2UA 1D1AA 2JA6I 3A1YA 3PSFA 3L2RA 3K4LA 5IT9f 3ZRGA 1VQ71 3OY9A 3L2VA 2E5ZA 2YADA 1NG6A 2NVQI 2R7RA 4XN0A 3PNYA 3SYTA 4BE0A 1VQ4Z 3LL7A 4B43A 4BJ5C 2ZFUA 3J81f 4F93B 3ZXSA 2QREB 2VASA 3CF2A 3RCOA 2X1CA 4NBEA 4RMNA 3I561 4CZCA 4II2A 4XONA 3VYTB 4GRIA 3ZGKA 3I56Z 3RZOI 3L2WA 2IGKA 3NDIA 2VIXA 2V7FA 3U21A 4HGZA 1UAAA 1K9M2 3GTLI 1DL6A 5C3EI 3OL4A 2Q2EB 2V6EA 2XAUA 1Q822 3S93A 4BXXI 1Y56A 1YJNZ 1K6YA 4KJZA 3HL2A 3JAMb 1OR7C 3SEZA 1UG0A 4BUPA 3CC4Z 4EATA 4S1TA 1WW9A 2K9MA 1MMNA 2QKLB 3HOXI 1YITZ 3OW2Y 2MD0A 4XNFA 3OS1A 1Z3YA 3F3FC 4RVHA 4ZDPA 3NWSA 3CXCZ 2QEX1 2V26A 4MXUA 3A4CA 4MD7A 2MYSA 4CA0A 2PK7A 1VQM1 3K6GA 4HSRA 2K5CA 4BE2A 2VF1A 4DBRA 2KRCA 3CCLZ 4A3BI 1S721 2O5RA 2W04A 2PM9A 2LFUA 4RVDA 2ZSHB 4XLAA 4BACA 3T4NB 4NBAA 3OS2A 3IX0A 2IXSA 2QKDA 4A3GI 3CCS1 4D1QA 4NUBA 2I3CA 2JUGA 3NDJA 3FHNA 2LIYA 5C4JI 2LC2A 4NBGA 5C44I 2LRDA 3J80f 5D1OB 2NVTI 2Z16A 1ZB9A 4XLHA 3GTMS 4PK4A 4HEA2 4ZYAA 1Y1VI 2KL4A 4QTUA 3PNTA 3MKYB 5FRNA 3ZQQA 4A3DI 1QHHD 3I9V2 1QHGA 2PJRA 2K9LA 3PSIA 1S7MA 1WJDA 2E9HA 3NH8A 3VMHA 2RNGA 1KD12 2M6NA 1Z7LA 1Q861 2JA5I 1VQ51 3CMA1 4BDYA 3I4MI 1VQNZ 3CMMA 4C2TA 2IS6A 3G711 1Z02A 1VQMZ 4NNJA 1I3QI 4A3MI 3I4NI 1ZB8A 2RHBA 1YJWZ 2R7WA 3DPUA 3QYEA 2IS2A 3I07A 2HU9A 2CS3A 4BL0B 2XF6A 2LREA 4CCKA 4BQOA 3OYHA 4E7IA 2KLOA 4LITA 4E7KA 3K4JA 4LIUA 3LUSA 1YI21 3OYNA 3CD61 1E0EA 1WFXA 1DQUA 3OMYA 3W2AA 1ML8A 5FLMI 4XOPA 3W3CA 3IFUA 3I55Z 1YIJZ 3CP2A 3LSHA 1KC81 2VQHA 4XR6A 4RV9A 2R7QA 3KX2A 1Q812 2J6AA 2DOAA 3DQVC 3S2HI 3PJRA 2IS4A 4ZTJA 1R6RA 1QF8A 4MLOA 5IP9I 1FMWA 4Y52I 2HPIA 2WAFA 4XOTA 1MW7A 2Z1DA 2RREA 2LG4A 1YX5A 2HDWA 1T0FC 2QR1B 2L9SA 2RQQA 2WA0A 1VQ7Z 4TNUA 1JJ2Z 2VJJA 2NVYI 2MFZA 4J01A 3W2VA 3G71Z 2F6CA 2KP6A 1X0TA 5HNFA 3JAMf 3SDBA 2R7XA 4XLFA 3CCU1 3PO3I 3I3LA 1WJCA 4F52A 3CCM1 2E1MC 1M1K1 4E2ZA 4AVZA 3CCRZ 2BOLA 2VQGA 4H4KC 5TGTA 4BBRI 1UELB 4BDZA 1NUIA 3LSKA 2R7OA 4CCLA 3Q87A 1V5EA 3OYKA 3LFUA 5KHDA 2HVSA 2VLAA 4B48A 1S9HA 3FBNB 3V42A 4XKCA 1N8R1 3M8JA 3QWUA 3VYUB 3CCV1 2P28A 3PO3S 2HZDA 2P3YA 1RO4A 3VB9A 1M1K2 3DPTA 2K3PA 3RSNA 4IZZA 1NJI1 2ZSIB 3OYCA 2QA41 3UNGC 2KMUA 3RQ4A 4E6KG 1QVGZ 2CMPA 3SZGA 3LSMA 3PL8A 4JQFA 3OYIA 3GTPI 1TT0A 2VQLA 1VQ9Z 3OR2C 3CCUZ 2V8KA 2X51A 2BVLA 2ELJA 1SFKA 2VJ5A 2LY1A 2M4GA 1JI8A 2M7AA 3M3YI 2WY7Q 3IP4B 1JJ2Y 2IZ4A 1VLAA 2W4SA 4OAYA 3C2HA 2OC6A 1KD11 4E7HA 4DGLA 1YJW1 1LKXA 3UR3C 1K732 1K8A1 1VQLZ 2GOMA 2Z2SB 3HUGB 4AU7A 2JVHA 3G6EZ 3CMEZ 2I8DA 1M902 3GTGI 2DE6A 1X1CA 4RVGA 2HNHA 2DE7A 2RIQA 4CCJA 3S1MI 1W36C 1RLYA 3D6WA 3TE5B 4PFPA 4EWCA 1PJRA 1Z21A 3D5SC 1MMDA 2OOYB 3M4OI 3J7A4 3HPHA 1YX3A 3VYSB 3OR1C 3MKWB 4E7LA 4NBDA 1VQP1 4RM3A 4D9JA 4KISA 3J81b 3HOYI 3CCJ1 4HSTA 2OTLZ 3OYFA 2X6WA 2X1EA 2X85A 3CJQB 4XLEA 4ANJA 4CUGA 3OS0A 3MMYB 5HVQC 2IZ3A 4MH4A 4QTTA 3QODA 1X4PA 5D1OA 3CESA 3SEQA 1Q811 4E7SA 2MC4A 4N4OB 2L2OA 1BR2A 1YJ9Z 3VWBA 1TWFI 1S72Z 4XM3A 4ZJZA 5FRMA 4RLFA 4HRIA 1YHQZ 3DWLE 1M901 1YHQ1 2KDOA 2IGOA 2WADA 3C2GA 3OYDA 3CJRB 2UWMA 4NH1C 1VQL1 2KRHA 2XSJC 4XKBA 3H5NA 2HPMA 3D9XA 1D1CA 2M7BA 2Q1ZB 3HPGA 3OW2Z 2F5VA 1WJEA 2VPLA 3BG6A 4Y3OA 1PYVA 2OTJ1 4Y33A 2KI7B 3A2KA 3GCFA 4E2WA 2VL8A 3FBIB 1VQN1 3GBGA 1USPB 2WAEA 1X19A 1WJAA 4ZDOA 1YE9A 2JSPA 3ZCOA 4IQ4A 3HOWI 2LYCA 4A93I 3CC7Z 2BVMA 3K7AI 1GLNA 2W03A 3G4SZ 4NBCA 1D0XA 3J80b 4PJJA 4CCMA 3TBIA 3OYAA 3DTIA 1K9M1 5CQGA 3RZDI 4G6TB 4R79A 2CFOA 2O4HA 2VKDA 1KC82 3CCSZ 4ZDLA 4C9YA 3CCMZ 3S3NA 3ESWA 1YUAA 4NB9A 2WAQA 3OIPA 3CPWY 3GTOI 2W7NA 2JA2A 1TFIA 3S1RI 1VQKZ 4XX2A 1YJN1 4QPQA 5IP7I 4P5OA 3G2BA 3GTQI 2BJOA 3EPZA 2VB6A 2E2HI 4OWRB 3HOTA 5JHFA 3CCE1 1K731 3IF8A 3CCVZ 1DGWY 1WJ5A 1YUKA 3IAS2 2CV2A 1JWHC 4NBHA 2OTL1 3EUAA 3CCJZ 4RLQA 2GTIA 2Q51A 2VXZA 5FLXb 2E5NA 3L2QA 4ZTFA 4BEHA 1RO0A 3OYMA 2A6TA 1G59A 2KQRA 4E7JA 2K5RA 2MABA 2QA4Z 3OYJA 1VQOZ 1KQSZ 1MNEA 1QYPA 4XKVA 2JVGA 3HOSA 5IT9b 2JNYA 3TMOA 2V8JA 3D5LA 3S16I 3H9JA 3CCL1 4BBSI 3G6E1 3CZ6A 3S8PA 2HVRA 1K83I 4E30A 5CM2M 3CME1 2ZXIA 2P0WA 3TL4X 1BR1A 4LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HU9 A;  4E6K G;  1Y56 A; 
#chains in the Genus database with same CATH topology
 2K3R A;  1I6H I;  3K2A A;  1U8R A;  4FE7 A;  2H27 A;  2RT9 A;  2LMD A;  2R7U A;  4Y4R A;  3KLO A;  1RKW A;  1WH5 A;  1WH7 A;  1YIO A;  2ID3 A;  4NQW B;  2WY8 Q;  5E3N A;  3S2D J;  2HYG D;  3JRG A;  5CVJ A;  3MON A;  2VJ4 A;  5A2Q f;  2RNJ A;  2MH9 A;  1QRY A;  2BZT A;  2GOX B;  3RPU A;  3ZR8 X;  5GPA A;  2YU9 I;  1WHU A;  4KIF A;  1KRL A;  3MWM A;  4XOR A;  3EET A;  1JXS A;  2PMH A;  5LL6 f;  3I59 A;  1FEX A;  2FOW A;  2NVX I;  4A3I I;  3M7G A;  2VPR A;  5B1A H;  1SAX A;  1QVF Y;  2HF1 A;  2OF7 A;  5BOX A;  1L3L A;  4I09 A;  5LRS A;  3C18 A;  3V7S A;  2ZAE B;  3WG9 A;  3KYL A;  2QF7 A;  5IT9 Z;  3HGG A;  4PSX A;  5E1W A;  3CPW Z;  2E1O A;  4JP0 A;  5CQE A;  2GU2 A;  4V2F A;  3ERM A;  4MRI A;  1IXR C;  3BPX A;  3S1M J;  1Z1D A;  2DA2 A;  3G1L A;  1TWA I;  1TWC I;  2QQ8 A;  4ZYD A;  2E36 A;  5E17 F;  2QLV B;  1WWX A;  1Z7U A;  3H36 A;  4XN3 A;  5CPR B;  1G4D A;  3CCQ 1;  4M3E A;  1WJB A;  2RAE A;  3KCC A;  4KFC A;  3JSO A;  5JR3 A;  2XUB A;  4FAS D;  1RZ4 A;  5EG0 A;  1O3T A;  4LFU A;  2DK8 A;  1YRN A;  4UHT A;  3W6K B;  1YO5 C;  4PSW A;  1P4A A;  2RPR A;  4B3X A;  1DGR M;  2DOE A;  2IBD A;  4QPO A;  3L2U A;  1EA3 A;  4AIK A;  4HX8 A;  3Q0V A;  4O5V A;  3O3K A;  6PAX A;  2R7S A;  2EGT A;  3H0G I;  1TWA J;  1TWC J;  1HA8 A;  3S3M A;  3HSE A;  2KPM A;  1XCV A;  1MDM A;  2QQA A;  2DAO A;  2EZL A;  4G6D A;  2Y9Y A;  3EQL F;  2Y0M A;  1JUS A;  2NOJ B;  2JUB A;  3RZD J;  4IPA A;  3VDX A;  1BBY A;  4MD9 A;  2M3A A;  5BMZ A;  2H85 A;  1FOK A;  1R4M B;  2FU4 A;  2IGN A;  5D5V B;  5F08 A;  1BI0 A;  2DXI A;  3GVA A;  1FIP A;  3I64 A;  1TWF J;  4ESF A;  3NH5 A;  2OQR A;  1KU9 A;  3HYI A;  2E2I I;  1ZQ3 P;  3DF8 A;  1QQI A;  4LG0 B;  4BNC A;  2HOS A;  4IKF A;  3T1B A;  1HSJ A;  1R49 A;  3AG3 H;  2W00 A;  1WGX A;  3DTE A;  3FXJ A;  3VMI A;  5FB2 A;  5LFA A;  1IRF A;  1D0Y A;  1V54 H;  1EKE A;  3H35 A;  3EDP A;  2HQ5 A;  4PUS A;  4YEL A;  1I50 I;  1Z01 A;  1ERD A;  4DQY B;  3BG0 B;  1XG1 A;  2B63 I;  4DZJ A;  3HTU A;  1IRX A;  3LQR A;  2V8I A;  3KET A;  1O3S A;  4A3F I;  4DIQ A;  3MZ8 A;  1ZG3 A;  1S6L A;  1WRJ A;  2H1L A;  3GTJ I;  4GYI A;  1HBX G;  1HF0 A;  1QU3 A;  3IV5 A;  3IH3 A;  2F4M A;  2XGE A;  3CO6 C;  2HXI A;  2VBZ A;  3TDZ C;  4B44 A;  4CCO A;  4NFR A;  1YI2 Z;  4P9U A;  2M0M A;  2M8E A;  3D1N I;  3N97 A;  3QPS A;  3B02 A;  1X1P A;  1I39 A;  3DU5 A;  3F9K A;  2DMT A;  2ISY A;  1V5G A;  4E7Z A;  3WTS C;  3GTQ I;  1D1B A;  4ZYH A;  3QYF A;  2AHQ A;  4Z6Y A;  3WTW C;  1BIA A;  2RQP A;  1HCR A;  4KA4 A;  3ABM H;  3BQZ A;  1VQK 1;  2BW3 A;  2VC0 A;  5C3E J;  2CJJ A;  5HLH A;  1ETV A;  2DYR H;  2CH0 A;  2GTH A;  4BKX A;  1VFC A;  1QVG Y;  3GTM I;  3GKQ A;  1U0J A;  3PUB A;  2QKM B;  4QSH A;  3HSF A;  1N78 A;  2OTJ I;  4IJA A;  5EDN A;  2LSO A;  3JRA A;  1LDK B;  4I0A A;  1X1D A;  4XIC A;  3BZK A;  2ZJ2 A;  4BGD A;  1VQN I;  4IOA F;  1WJF A;  2BY3 A;  3PO2 I;  5A2Q b;  2UZK A;  1SAU A;  2LNB A;  1ETQ A;  3K4B A;  5IPA A;  2R4G A;  2X4H A;  1LB2 A;  2JIM A;  2X48 A;  3MEX A;  4XLN F;  2K86 A;  2E34 A;  4BXF A;  4YFK F;  5J47 A;  5HDN A;  4NC7 A;  2X1D A;  3CCE Z;  3GFL A;  3RJP A;  5D5W B;  3FHZ A;  2V9K A;  5IP9 J;  5FJ8 J;  3ROU A;  2O6G E;  1W2B Y;  4Y7N I;  1I27 A;  2WB1 A;  4MQ9 F;  1Q16 A;  2F4O B;  1X3U A;  5IT9 f;  4A6E A;  2M2E A;  1JUM A;  2YAD A;  4G7H F;  3JTG A;  1S8N A;  3NAU A;  4F93 B;  4U0V A;  1Q1H A;  2L3D A;  1Y8R B;  4II2 A;  3VYT B;  4GRI A;  2NYX A;  4HNV A;  3I56 Z;  2ISZ A;  2Z33 A;  5HS7 A;  2K27 A;  2QBY A;  1K9M 2;  5C3E I;  2V6E A;  3TW7 A;  3H92 A;  1IXC A;  3ZN0 A;  1Z91 A;  3ABU A;  3DFG A;  1UG0 A;  4YII A;  2K9M A;  2QKL B;  3F21 A;  5DM7 F;  2XAQ A;  4XNF A;  3OS1 A;  2KIS A;  4V2G A;  3CXC Z;  2QEX 1;  1HXD A;  4EMS A;  3A4C A;  4M6Y A;  1P6R A;  4BH9 A;  2DO7 A;  2DQL A;  3K6G A;  3GTJ J;  2TDX A;  4A3G J;  3AG2 H;  1MSE C;  3PM1 A;  2O8X A;  4KN7 X;  4L9T A;  3T4N B;  5CYV A;  5IYB J;  2LVS A;  3I4P A;  5DEQ A;  3HKZ N;  2Y30 A;  4NUB A;  1XS9 A;  1MZB A;  3FHN A;  5C4J I;  1B6A A;  5JVG F;  3BTJ A;  4NBG A;  4P55 A;  1FSH A;  5D1O B;  4L0Z B;  4XLH A;  3DEW A;  3JAM Z;  4M6X A;  1G3S A;  1ENH A;  3FM5 A;  3HZJ A;  1SD5 A;  3ZQQ A;  3L00 A;  5DCM A;  1QHG A;  3GW2 A;  3RYR A;  1S7M A;  1WJD A;  1WI3 A;  5J4Y A;  2A6H F;  4C3J J;  2COB A;  2ACJ A;  2LR8 A;  2ID6 A;  4L9V A;  5ILS A;  1BM9 A;  9ANT A;  1Z02 A;  5TIS C;  1ZB8 A;  3P9K A;  5F1R A;  1JTY A;  3DPU A;  3QYE A;  2MGQ A;  3HOZ J;  3I07 A;  1IN8 A;  1TBX A;  2K7L A;  2LRE A;  2EZK A;  4CCK A;  1OQY A;  2F4M B;  3RKX A;  1HKS A;  3K4J A;  4LIU A;  4BBR J;  3LUS A;  2XAH A;  5K1Y A;  3CD6 1;  2WV1 A;  2QA4 I;  1WFX A;  1YG2 A;  1V3F A;  1K83 J;  5FLM I;  3I55 Z;  1YIJ Z;  1ZGA A;  3ZQI A;  4XR6 A;  4EEF G;  1VQM I;  2GAU A;  2R7Q A;  2DOA A;  3DQV C;  5GAH J;  4JYK A;  1LE8 A;  3Q5F A;  4Q5S F;  3Q0U A;  1ZYR F;  2CQ7 A;  2M30 A;  2W84 A;  1UB9 A;  1IN4 A;  1QF8 A;  2KIM A;  1FMW A;  4HX7 A;  5KK1 A;  2WAF A;  1HKT A;  4I2O A;  5IYC J;  1WZ2 A;  2LG4 A;  3JAM K;  4CHU A;  1T0F C;  3R61 A;  4LG0 A;  4U88 A;  3RPQ A;  2ZFW A;  1JJ2 Z;  1JUP A;  5TJJ A;  3GFM A;  2YX4 A;  3HRU A;  3SFZ A;  4XRM A;  2JN6 A;  2F6C A;  4M3D A;  1LEA A;  5HNF A;  4J01 A;  3ZMU A;  2STT A;  4OU0 A;  2Z9O A;  4X6A J;  1X0T A;  3S1R J;  4DW6 A;  2IV2 X;  5A2Q Z;  1M1K 1;  1ACI A;  1K78 A;  2D1H A;  1UJ8 A;  2VQG A;  4H4K C;  4P9F A;  5GPC A;  4UB6 C;  4UY8 I;  3BY6 A;  4BBR I;  2FEZ A;  4BDZ A;  1EJ9 A;  3Q87 A;  1V5E A;  4O6J A;  5KHD A;  2AXT C;  1S9H A;  1XDS A;  1N8R 1;  3VYU B;  4XRF A;  1GVJ A;  2NAP A;  1BW6 A;  5D4R A;  4CGZ A;  2P28 A;  3PO3 S;  2OJE D;  4GXO A;  5FKN A;  3JRB A;  1BC8 C;  3VB9 A;  3KP4 A;  1K4S A;  2L4M A;  4KMF A;  4IZZ A;  3BPV A;  1E3O C;  3G6E I;  5EEH A;  1I3A A;  2DOF A;  5J1Y A;  5KVR A;  2QA4 1;  1E17 A;  3LA2 A;  1QVG Z;  2CMP A;  3LSM A;  1IN7 A;  2DQR A;  3PL8 A;  4WXC A;  3B73 A;  1J0R A;  2VC1 A;  2X51 A;  2EA4 A;  1IW7 F;  2QWW A;  3I53 A;  3JSP A;  2WY7 Q;  3KP3 A;  4OAY A;  1KD1 1;  4DGL A;  1RES A;  4F7Z A;  3UR3 C;  3ZP5 A;  3PIO F;  1K73 2;  2EFP A;  2E2I J;  2GOM A;  2QYO A;  3G6E Z;  3ML6 A;  5AON A;  2P7C B;  1QZY A;  1DU6 A;  2FF4 A;  2EV5 A;  3BT9 A;  3ISP A;  1SVO A;  2QCO A;  3KZI C;  3K1P A;  1B72 B;  4EWC A;  4PFP A;  1ZTR A;  3D5S C;  3BZC A;  1I6H J;  2HR3 A;  5FD5 A;  2R5Y A;  3MKW B;  3SHF A;  4E7L A;  4NBD A;  1T6S A;  4RM3 A;  1VQP 1;  5EEA A;  3G1M A;  3COA C;  3L7W A;  4GYG A;  4EM0 B;  4HST A;  2OTL Z;  5ERI A;  4A3D J;  2VT2 A;  3CJQ B;  4DYQ A;  3MMY B;  3B6A A;  3TGN A;  5IT9 K;  1AWC A;  2CWE A;  3TED A;  5D1O A;  3SEQ A;  2YU9 J;  3FXQ A;  2PBI A;  5E3O A;  3CF5 F;  3C2G A;  4WF2 A;  2UWM A;  4NH1 C;  2KJB A;  1POG A;  2HYF A;  2XSJ C;  3H5N A;  3OW2 Z;  3WTZ A;  3MAJ A;  2F5V A;  3G73 A;  1J9I A;  3WGI A;  2VPL A;  2P6S A;  1ETY A;  3BR0 A;  4AID A;  2OTJ 1;  3L9F A;  4Y33 A;  1A36 A;  2E2H J;  3IR7 A;  2NRA C;  3A2K A;  5HDK A;  4E2W A;  3IC7 A;  1OCP A;  1USP B;  4BAY A;  1X19 A;  2JSP A;  2L02 A;  2A61 A;  2XB5 A;  2CG4 A;  1TTY A;  2FNP A;  1HOM A;  3G4S Z;  2KJC A;  3CCY A;  4NBC A;  1D0X A;  2DMP A;  3SQN A;  3J80 b;  2HXO A;  4CCM A;  3OYA A;  1VQP I;  3RZD I;  3FX3 A;  4A3M J;  3I4N J;  2CFO A;  1MJA A;  1XMX A;  3PO2 J;  3ESW A;  3KP2 A;  2A6E F;  5D8L B;  1W1W E;  1LFB A;  2EBI A;  5IP7 J;  1N25 A;  1VQK Z;  1TC3 C;  1RNL A;  4P5O A;  3E6B A;  2BJO A;  2CUE A;  1TP4 A;  4X1E A;  4AWX B;  2CQQ A;  4OWR B;  5JHF A;  2PEX A;  1DGW Y;  5EZH A;  3REO A;  1U8B A;  4NBH A;  3S1M I;  5AIP A;  2P81 A;  3O6B B;  2OZ6 A;  5FLX b;  2K5R A;  3OYM A;  2KQR A;  4E7J A;  3LST A;  1HDP A;  4RA2 A;  5CVU A;  1VQO Z;  2Z99 A;  5IY5 H;  2O0Y A;  1W5T A;  4RS8 A;  1R00 A;  2JNY A;  1W0T A;  3A02 A;  1SEU A;  2QZ8 A;  4WX9 A;  1SFO J;  3S16 I;  3H9J A;  1JT0 A;  3UKG A;  3CJT B;  1O3R A;  4AIJ A;  1BJZ A;  2DTR A;  1BR1 A;  4LG3 A;  4BBS J;  1RNI A;  4IHT A;  2CW7 A;  3FKJ A;  3GFI A;  4BU2 A;  2CUF A;  1U5T A;  4NBB A;  2HVQ A;  1OYW A;  3S14 J;  2HTJ A;  5J8C A;  3FQQ A;  4WXD A;  3NEU A;  3GTK J;  1N2F A;  1L0O C;  1SFX A;  1LQL A;  3EUH C;  3WTU C;  1IUY A;  1UHM A;  3FXK A;  1SVM A;  1B9N A;  2BW3 B;  4HNT A;  3AKZ A;  2XPU A;  4HQE A;  2FSW A;  2B63 J;  2HTS A;  2FBH A;  3HM5 A;  1W36 D;  2XGD A;  3X2Q H;  4LLL A;  3V7R A;  4E2X A;  3M3Y J;  3CC2 1;  4G8X A;  2V1D A;  2Y48 A;  4AYB A;  2L9N A;  1X1B A;  3S16 J;  2L7M P;  1FMV A;  4E31 A;  3FKI I;  1JHH A;  1S7A A;  2E2J I;  5M5W J;  1S3J A;  2AQE A;  2AYD A;  3N4M A;  3U50 C;  1A6I A;  3CTA A;  3H9Q A;  1IV6 A;  1UHW A;  2MLK A;  3OV8 A;  1PUE E;  3HRT A;  5E79 C;  3H3V J;  2LFB A;  5AIQ A;  1P2F A;  3AL0 B;  4HX4 A;  1VQ9 1;  1WI9 A;  1Z6R A;  1R1U A;  4G94 A;  3U9G A;  3I55 I;  1YIJ I;  4NOZ A;  1FBS A;  4NDL A;  3F23 A;  1D5Y A;  3FF5 A;  1WCM I;  2NS8 A;  1B9M A;  1YYV A;  1ETW A;  2GBY A;  2O53 A;  2V1N A;  2JA8 I;  2G0E A;  3QP5 A;  4RS4 A;  2W82 A;  4HZF A;  4DYC A;  1X3W A;  3S15 I;  5CKT A;  1M1E B;  2Y75 A;  2IS1 A;  2FBK A;  3P5J A;  3GX4 X;  2EA2 A;  2JMO A;  1DP7 P;  2R7V A;  2VUG A;  1R4N B;  4LD5 A;  2IGM A;  1FLI A;  1VQ7 I;  2W25 A;  4I6Z A;  1JKP C;  1PFT A;  3R60 A;  5FKO A;  3DTK A;  2CUZ A;  3ELK A;  3WU2 C;  2A05 A;  3MD2 A;  3I71 A;  4DOZ A;  2JJ7 A;  2K40 A;  3FK7 A;  1BW5 A;  3N05 A;  2R5Y B;  1Q7Y 1;  3MZK B;  1E3H A;  4PJM A;  1TWG I;  3BTC A;  2MBF A;  1B72 A;  1QGP A;  2EIN H;  2Q2E A;  5IOZ A;  3AG4 H;  3WU0 A;  3TP0 A;  3FXL A;  2EJR A;  2A68 F;  1I5Z A;  1R5I D;  1A35 A;  1ZK8 A;  1YFH A;  2FE3 A;  5JVT A;  4XSX F;  5LEJ A;  5CLS A;  2R3S A;  5H6Q A;  1TWH I;  4F91 B;  3I55 1;  3QPL A;  1YIJ 1;  4G9Y A;  2VXD A;  1Z3X A;  5LLQ A;  4B09 A;  4S05 A;  3ESW B;  4J00 A;  2DK5 A;  3KZY A;  3CC7 I;  4L0Y B;  1FZP B;  1W0U A;  2VUM I;  5T6B A;  4AYB N;  2V79 A;  3ABL H;  1X1A A;  4M9S A;  5DV5 A;  3QOE A;  3GF2 A;  3TDU C;  3K4K A;  4ABZ A;  1PDN C;  2DBB A;  3U2R A;  3DCF A;  5K7F A;  1TQM A;  4BY7 J;  3TOB A;  2DJI A;  2E1M B;  2M1B A;  1XX5 A;  2ZKZ A;  3RIR A;  1RUO A;  5AN9 F;  2DT7 B;  2O7O A;  5T67 A;  4A2U A;  4F3Q A;  3EER A;  3CXC Y;  4BE1 A;  2O61 A;  2RKH A;  1CQT A;  3QYB A;  5FRO A;  3AL0 C;  2K85 A;  1AHD P;  4CO8 A;  4CYD A;  4D7N A;  1V4R A;  4XK4 A;  2AKL A;  3KLN A;  1RI7 A;  2FJ1 A;  2M48 A;  3VB2 A;  3CCJ I;  1Y1V J;  4BJT A;  4DNC A;  1G3W A;  2KFD A;  3HDD A;  5HLT A;  4ZYE A;  1R71 A;  1O7L A;  1XB4 A;  2OCE A;  2G2K A;  2LOO A;  3LFK A;  4EM1 A;  3H0D A;  1CF7 B;  1Y0N A;  3E7L A;  3K70 C;  1BIB A;  2XB0 X;  3F3P C;  4A12 A;  4RB2 C;  2L7F P;  4S04 A;  4E32 A;  2PJR B;  1T95 A;  4A0Z A;  1VQ5 Z;  3T0Y A;  2L54 A;  4A3K J;  3HSR A;  4UUS A;  3HC7 A;  4XKW A;  1H88 C;  2JTV A;  4K2E A;  2EK5 A;  4RVF A;  1QXF A;  4MIM A;  1X2M A;  2EFQ A;  3J7A Y;  3VTN A;  1O57 A;  2JPC A;  2E1N A;  1GXP A;  2R7T A;  3F22 A;  3DKX A;  1W2B Z;  2HS5 A;  2KIU A;  4HYE A;  5HNH A;  3WGH A;  2HQA A;  2VKE A;  1ZRD A;  1OLT A;  1J5Y A;  2OZK A;  1VQ6 Z;  3M1C A;  2QEX I;  1F36 A;  1Y6I A;  3RPU D;  5E18 F;  5DYM A;  1U78 A;  3DP7 A;  4E4H A;  2EV0 A;  3LMM A;  3H9G A;  1VQP Z;  3GME A;  1Y1W J;  3GLX A;  1GHC A;  3RI4 A;  2KHM A;  2UUZ A;  3BQY A;  1FOY A;  4XQF A;  3AFH A;  3A03 A;  4OIQ F;  3VPR A;  2QRC B;  2C6Y A;  4IOC F;  2XPW A;  2LBF A;  3KFW X;  4MD8 A;  4C2U A;  2DLL A;  3A1Y A;  3PSF A;  2XRL A;  3ZRG A;  4U0W A;  1VQ7 1;  4M3F A;  1NG6 A;  4IHS A;  3BZ6 A;  4XN0 A;  3PNY A;  3SYT A;  2F5C A;  1T2K A;  3LL7 A;  4B43 A;  4BJ5 C;  5F6F A;  5HLI A;  3J81 f;  3R4K A;  3I56 1;  4CZC A;  3ZGK A;  4XON A;  4ESJ A;  3I54 A;  4HA8 A;  3DXJ F;  2VIX A;  3H1C A;  2V7F A;  1UAA A;  1DL6 A;  1SFE A;  1ZR2 A;  1Q82 2;  1S7O A;  3ZQ7 A;  1TNT A;  4LLG F;  4WK8 F;  3DBL B;  4KJZ A;  3WTT C;  2L01 A;  1OR7 C;  1DUX C;  3SEZ A;  2LF8 A;  4OMZ A;  3HGY A;  1YIT Z;  3BR2 A;  1J2X A;  3OW2 Y;  3F3F C;  4HQM A;  2V26 A;  1K61 A;  2JIO A;  4MXU A;  3ZMD A;  1B59 A;  2BXY A;  5F0H A;  4C3H J;  3MVP A;  3F8F A;  4HSR A;  3BTL A;  4BE2 A;  2VF1 A;  3IRQ A;  4ZYG A;  2O5R A;  1OCT C;  4EJW A;  1E2X A;  2W04 A;  1GVD A;  2DYS H;  1MNM C;  1VF9 A;  1S7E A;  2CFX A;  2ZNZ A;  1KA8 A;  4D1Q A;  2JUG A;  2I3C A;  3NDJ A;  2LIY A;  3CUQ A;  3L09 A;  2OD5 A;  2LC2 A;  5C44 I;  3PIP F;  3M07 A;  4A3E J;  2IRF G;  4A3L J;  1ZR4 A;  1MGT A;  3PNT A;  3MKY B;  4A3D I;  2TCT A;  3VEP A;  2HFH A;  2RNG A;  4ASN A;  2JA5 I;  1Z7L A;  3CMA 1;  1SMY F;  1VQ5 1;  4H0E A;  1GV5 A;  4AD9 A;  1MBK A;  1XC5 A;  1Z9C A;  1W5C C;  3QU6 A;  1C0W A;  2B0L A;  2IS6 A;  3G71 1;  2QEN A;  1MBF A;  4NNJ A;  1I3Q I;  5FKK A;  2GQQ A;  2R7W A;  1O3Q A;  2E7Z A;  1YJW Z;  1MMS A;  1E3P A;  2CS3 A;  4BL0 B;  4FX4 A;  3V8L A;  4LLN A;  2DFH A;  3C3W A;  3OYH A;  1R5G A;  2PFB A;  1P7I A;  1Z0X A;  3OYN A;  3W2A A;  1DQU A;  4KIC A;  3IFU A;  3JRD A;  1KC8 1;  2FX0 A;  4RV9 A;  4FQG A;  1Q81 2;  2J6A A;  2FA5 A;  5D6F A;  3TO6 A;  3PJR A;  3PFI A;  4XSZ F;  4ZTJ A;  4RB1 A;  2ESH A;  2XSD C;  2HPI A;  1TW2 A;  3F8M A;  2A69 F;  5F64 A;  2RRE A;  1IXS B;  2BYV E;  2DA3 A;  1VQ8 I;  2DMU A;  3M8F A;  2QR1 B;  1OCO H;  1VQ7 Z;  4UUV A;  4TNU A;  2MFZ A;  2VT3 A;  3W2V A;  3CCU 1;  2EFN A;  2R7X A;  4XLF A;  2HI3 A;  3GTQ J;  1WJC A;  2YR2 A;  4MEY F;  3PO3 J;  3CCM 1;  2E1M C;  1ETX A;  2BXZ A;  4HDU A;  1ULY A;  5L3D A;  1TQP A;  2KKO A;  2R7F A;  3RKW A;  1UEL B;  4YG2 F;  2R7Z J;  3ZQL A;  3LSK A;  2DMQ A;  5GP9 A;  2HVS A;  2VLA A;  2M5W A;  4B48 A;  3GTM J;  4XKC A;  3GLL A;  4UNO A;  2L0K A;  5EF6 A;  2R92 J;  3CCV 1;  4I02 A;  2P3Y A;  1HW2 A;  1VQL I;  5JHU A;  3DPT A;  3FMR A;  3RSN A;  1T0F A;  1OIS A;  2DMN A;  2ZSI B;  3CME I;  1U9N A;  2W24 A;  4RAG A;  1D8J A;  5CJ9 A;  3HOW J;  3F8B A;  3SZG A;  4HV6 A;  2JA5 J;  3OYI A;  1VQ9 Z;  3OR2 C;  3CCU Z;  2V8K A;  3GO5 A;  2PI0 A;  2NVX J;  3DKW A;  1FJL A;  1U5T B;  3WG7 H;  3IHU A;  5ICG A;  3NQO A;  1GV2 A;  1JKQ C;  2IZ4 A;  2W4S A;  1JJ2 Y;  2VOP A;  1LKX A;  3HEF A;  4PZJ A;  1MSF C;  2Z2S B;  3HUG B;  3K0L A;  3BG9 A;  2I8D A;  3KP6 A;  1TL8 A;  3GTG I;  3V8K A;  1BI2 A;  2OA4 A;  1D8K A;  2Y2Z A;  4A5M A;  3Q0W A;  5LBQ A;  1JE8 A;  2VPX A;  1YJ9 I;  3CCU I;  3D6W A;  3TE5 B;  5FKL A;  1SFU A;  4JX5 A;  1Z21 A;  4ETS A;  5L3B A;  1R1T A;  3OR1 C;  3TW6 A;  3VYS B;  3E5Q A;  3HOY I;  1OYY A;  2QSG X;  2IA0 A;  4FTH A;  2X6W A;  2N8G A;  2NVQ J;  4CUG A;  2IZ3 A;  4GCV A;  4QTT A;  2DPD A;  3QOD A;  1KZH A;  3CES A;  4E7S A;  2MC4 A;  2V6C A;  4N4O B;  1BR2 A;  2FQ4 A;  4IEJ A;  4XM3 A;  4ZJZ A;  3QU3 A;  4RLF A;  1M90 1;  1YHQ 1;  1U9O A;  1KQ9 A;  4RGR A;  2IGO A;  2LK2 A;  3CMA I;  3OYD A;  3EYI A;  1FYM A;  5D6E A;  1VQ5 I;  3GTL J;  2F2E A;  4XKB A;  4PGG A;  2M7B A;  4M3B A;  3K1M A;  4I76 A;  5DTD A;  5IP6 A;  2HZT A;  3M1E A;  1R22 A;  1A6Q A;  3BRO A;  1YW9 A;  1QO0 D;  2QSF X;  3FBI B;  1VQN 1;  1S5L C;  3GBG A;  4XRS G;  3ABK H;  4KUM A;  1MBH A;  1ZRF A;  3ZCO A;  3NAR A;  4IQ4 A;  3HIF A;  1QBJ A;  3HOW I;  4A3J J;  3FZV A;  2YU3 A;  2BVM A;  1GLN A;  1RIO H;  2RDP A;  1LEB A;  4RAF A;  2BY2 A;  3JRE A;  3DTI A;  2LD5 A;  1FTZ A;  5CQG A;  1K9M 1;  1ZGJ A;  1RKT A;  4G6T B;  2IJL A;  2P5V A;  3CCS Z;  3CCM Z;  3S3N A;  1N8R 2;  1YUA A;  2GXG A;  5FLM J;  2W7N A;  1XSX A;  3GTO J;  3KEO A;  1AKH A;  2CU7 A;  1YS6 A;  4QPQ A;  5B5E C;  3MZY A;  3CC2 I;  1APL C;  2IVM A;  4CYC A;  1U3E M;  1GT0 C;  1FBU A;  3IF8 A;  2RC4 A;  2R5Z B;  1FOW A;  1FNN A;  2V9V A;  1LE8 B;  1AOY A;  1OYI A;  3L2Q A;  1FSE A;  4BEH A;  2Z5U A;  2XAJ A;  2LKX A;  4Y15 A;  3OIO A;  3J80 Z;  1KQS Z;  1MNE A;  2XHK A;  4XKV A;  1RET A;  1K79 A;  2ZME B;  5DD4 A;  2M0C A;  3TMO A;  4D5F A;  4L5J A;  2P4W A;  3D5L A;  5HOD A;  1QA6 A;  1XCB A;  3CCL 1;  2JIQ A;  1R9T J;  3CME 1;  3CZ6 A;  1OR7 A;  2XKO A;  1NHA A;  5HS8 A;  4R8H A;  3CMY A;  2MSY A;  2ZXI A;  4RAY A;  2YSR A;  4IVN A;  4P96 A;  2ADU A;  3TL4 X;  3OYG A;  3QP6 A;  5D1P A;  2R6M A;  2VQC A;  1FWZ A;  3BG7 A;  4YFX F;  3HOY J;  1VQ8 Z;  1UHS A;  3VMG A;  2CO5 A;  3E0J B;  3DBH B;  1MND A;  2FXA A;  3GTK I;  3CC4 1;  3DLL F;  1UG2 A;  1XSV A;  3S2D I;  3C1D A;  3CCQ I;  5KCM A;  1IDZ A;  1FP2 A;  5HOO A;  2MG4 A;  3VYR B;  1QZZ A;  2XAF A;  2CW0 F;  1DP3 A;  1SD4 A;  2V4J C;  1W7P D;  1QPI A;  4MNU A;  3JR9 A;  4FET A;  4CYC B;  2VON A;  3P5J B;  4QIW N;  5JLW A;  1CF7 A;  2M4K A;  1MKM A;  2DT6 A;  4PFO A;  3CCE I;  4A3I J;  1T39 A;  4E2Y A;  3Q9V A;  2ZME C;  4L5E A;  1G6N A;  4HV5 A;  1VQ4 1;  1X3Z A;  1P9Q C;  5D4S A;  5F0F A;  3LSI A;  4X6A I;  1T56 A;  2L5Q A;  2OOX B;  3LA3 A;  3SJM A;  2D1V A;  4DYR A;  4L18 B;  1RQF A;  3BCB A;  2BY1 A;  1STZ A;  3G4S I;  1BL0 A;  1JGS A;  2G7H A;  4NBF A;  1NJI 2;  1A04 A;  3D5R C;  2K9N A;  1JHF A;  2HDC A;  2IAI A;  3K10 A;  3MQ0 A;  2EZH A;  1G8X A;  3H0G J;  2UV1 A;  1KON A;  3DKY A;  4AC0 A;  3LNQ A;  4QTR A;  2GLO A;  1WJ2 A;  4HPQ A;  5DDG A;  4MQV A;  3CC7 1;  1V5F A;  3WHC A;  4YEJ A;  2JS4 A;  4ZC3 A;  2F48 A;  4V19 K;  4PJN A;  3PFY A;  1Q82 1;  3VSK A;  2FUG 2;  2XV4 S;  1VTN C;  4XMY A;  4II3 A;  1BI3 A;  3BJA A;  3DLA A;  2G9W A;  1UST A;  4RB0 A;  2OUM A;  4HNU A;  2AQF A;  1IO2 A;  3BWG A;  3MCZ A;  3S15 J;  5M5Y J;  3ASN H;  1OJL A;  5EGO A;  2R7Z I;  2E35 A;  3CP8 A;  2UXN A;  2Y9Z A;  4XL9 A;  3W2W A;  2FRH A;  3NWT A;  3QOP A;  5ICF A;  3MN2 A;  4D7M A;  3HJE A;  2M34 A;  3H5R A;  2XDV A;  3OOP A;  1BI1 A;  1YLF A;  3IAM 2;  5M3F J;  1YW8 A;  2XAG A;  2QEX Z;  1XGS A;  2ZJQ F;  2QSH X;  3CO7 C;  4BY1 J;  3ONQ A;  5HLG A;  5KNL A;  2WWY A;  1ETO A;  2X6O A;  4A3K I;  2OV7 A;  3IH4 A;  3OL3 A;  3BJO A;  3E1S A;  4BQN A;  2PN6 A;  2RV8 A;  2HYJ A;  2XVC A;  4EV0 A;  3S3O A;  4D0P A;  2DA6 A;  3GUD A;  2WB1 N;  4QLC U;  3S17 I;  4EJV A;  1MMA A;  1RO2 A;  2XRN A;  4DJA A;  1VQ9 I;  3HHH A;  2HKO A;  5LHG A;  3DPL C;  3DV8 A;  2O8K A;  2DU9 A;  1HC8 A;  2IT0 A;  2VBX A;  2H1K A;  4A3L I;  2HQN A;  3K9T A;  4PGH A;  1FX7 A;  3AG1 H;  3K4M A;  3GTP J;  3P9C A;  3HKZ A;  2QRD B;  4HH4 A;  4LJZ F;  3S1Q I;  3O8G A;  3V4G A;  2PX9 A;  3GXO A;  2FNA A;  5B3S H;  2J5P A;  3HG9 A;  2KIF A;  3Q3S A;  1ITY A;  2VPW A;  2VBY A;  4A3F J;  1QVF Z;  2KDZ A;  2L9V A;  1YOV B;  5H2F C;  3HOV J;  4LIV A;  4A3C I;  4BQQ A;  3WTV C;  3S32 A;  2XGX A;  2ELH A;  3CC4 I;  3QQA A;  3CQZ I;  2GA2 A;  4F55 A;  4JX4 A;  4XLC A;  1FDI A;  4G7O F;  2D5V A;  2LDU A;  2DCE A;  4CIC A;  2NNY A;  4DK1 A;  1VQ6 1;  2RVC A;  1ZH1 A;  4UUS B;  4A3E I;  1MMG A;  1KQS Y;  1ZEL A;  1JJ8 C;  1KGS A;  5DD8 A;  4B47 A;  3VSL A;  3FQM A;  2ZCW A;  3P7N A;  5KAF C;  5EJC A;  4CXF A;  2QM3 A;  2R5Z A;  4NC8 A;  4EGY A;  4C30 A;  2PLY A;  3OYL A;  2F4O A;  3CCR I;  2CYY A;  3KEY A;  3HBL A;  1BR4 A;  3S2W A;  3CD6 I;  3KIF A;  5ILV A;  1AKH B;  2L7K A;  2ME6 A;  4FCY A;  4BY1 I;  2CQX A;  2CV1 A;  2STW A;  1F43 A;  2CW8 A;  5IT3 A;  4B3A A;  1ZH5 A;  3DU6 A;  3PUF A;  2VJI A;  1K78 B;  3R6S A;  3OOU A;  2E60 A;  2QVO A;  3CCQ Z;  1SFO I;  4I01 A;  1Q86 2;  1NG7 A;  3IUO A;  1P9N A;  5DCF A;  2E1C A;  3DEE A;  2XF7 A;  2OZU A;  1T8I A;  1H0M A;  1UFM A;  3S17 J;  4HG2 A;  1BA5 A;  3CD6 Z;  3F8N A;  4OIN F;  2OTJ Z;  5C4X J;  4F92 B;  4DBQ A;  1BOA A;  3C2B A;  1L1O C;  3ECH A;  3J7Z I;  3G3Z A;  4BQA A;  3QRF F;  3GZN B;  3H3V K;  5D5X B;  3H5A A;  1DPU A;  1F4K A;  4A3J I;  2EZI A;  3LSG A;  1MH3 A;  4O3M A;  1YIT 1;  2R93 I;  2BEO A;  2JA6 I;  2VPZ A;  3L2R A;  1B1B A;  5D8K B;  3K4L A;  1VQK I;  4IHX A;  2E5Z A;  5E8G A;  3ZOB A;  5ED4 A;  2R7R A;  5EG0 B;  4C3I J;  1AU7 A;  5H6R A;  5ICE A;  3ZXS A;  2QRE B;  3CF2 A;  1PVE A;  3RZO I;  3L2W A;  1SVL A;  2GIZ A;  3NDI A;  2I10 A;  2B9S A;  1I1G A;  3OL4 A;  3GFJ A;  2Q2E B;  2WTE A;  2XAU A;  1Y8Q B;  3S93 A;  3J81 Z;  2E2J J;  4BXX I;  2HGC A;  1K6Y A;  1J59 A;  3JAM b;  2OCC H;  4EQQ A;  1YJN Z;  1FY7 A;  3TO9 A;  1IV8 A;  4M6V A;  5FLV A;  4BUP A;  2OBP A;  1WW9 A;  3FMQ A;  3E97 A;  2PMU A;  2H8W A;  1FDO A;  2JIP A;  4OOI A;  3NWS A;  3MKL A;  4E70 A;  5JI6 A;  4CA0 A;  1W5S A;  3BR5 A;  4YFN F;  5FGM A;  3FXO A;  2V1U A;  3CCL Z;  3IRR A;  4A3B I;  4DBR A;  2H8R A;  4HF1 A;  4A3C J;  3ZQC A;  2M8G X;  4XLA A;  3KE2 A;  4BAC A;  4NBA A;  3OS2 A;  2IXS A;  2PMZ N;  2RGV A;  4AIH A;  3CCS 1;  1MH4 A;  1ON2 A;  2W85 A;  2ELK A;  3FKI J;  3TKY A;  2L9R A;  3J80 f;  2NVT I;  2ZB9 A;  2Z16 A;  3GTM S;  2QQB A;  4PK4 A;  4ZYA A;  5EEG A;  5M5X J;  1QHH D;  1H9G A;  1XGM A;  2DFE A;  3CDH A;  2E9H A;  2Q0O A;  3PSI A;  3E6D A;  1MDM B;  1KD1 2;  1GXQ A;  2V9P A;  4BDY A;  3I4M I;  4IRI A;  4B4C A;  1B4A A;  1Z05 A;  3M4O J;  4C2T A;  2JK3 A;  5E3L A;  1VQM Z;  3FWE A;  1HLV A;  1BN5 A;  1X58 A;  4A3M I;  3I4N I;  1O4X A;  3ZQF A;  2OU2 A;  1IRZ A;  2BE5 F;  1YRN B;  4BQO A;  4E7I A;  2KLO A;  5DUK A;  1FP1 D;  3CJN A;  4N9I A;  3TP3 A;  4WCG A;  1U2W A;  1YI2 1;  4OIR F;  2CQN A;  1E0E A;  3OMY A;  4ENK A;  5GAE J;  4XOP A;  2H09 A;  3W3C A;  3LSH A;  1QVU A;  1IGN A;  2VQH A;  2X9D A;  4RB3 C;  1OMI A;  1D3Y A;  3BJ6 A;  1KU3 A;  2R93 J;  4N9H A;  3KX2 A;  1O7F A;  1OCZ H;  2IS4 A;  1R6R A;  1W7P B;  2DA4 A;  4NHJ A;  2VN2 A;  1MW7 A;  3WGG A;  2Z1D A;  2HDW A;  4Y52 J;  1Y0U A;  2P6T A;  2KIQ A;  2RQQ A;  2WA0 A;  1FBQ A;  2DFF A;  3BR3 A;  1LVA A;  1RR8 C;  3G71 Z;  3O8H A;  1EF4 A;  1KU2 A;  4L9J A;  5LGU A;  1ZAR A;  3SDB A;  2OPT A;  4ZH4 F;  4HLY A;  4Q47 A;  3I3L A;  2DOD A;  3WOD F;  4F52 A;  3TOA A;  5ICC A;  5DUI A;  4KN4 X;  2O9L A;  1LPQ A;  1USS A;  2GXB A;  4AUX A;  3CCR Z;  2BOL A;  5H20 A;  2DTZ A;  1FYK A;  3E5U A;  4Y13 A;  1NUI A;  2R7O A;  4CCL A;  3GYH X;  3OYK A;  3LFU A;  4XRS A;  1H89 C;  1SIW A;  3WE3 A;  3V42 A;  3FBN B;  3MZH A;  4EJT A;  3QWU A;  5A2Q K;  2A07 F;  5J1R A;  1HW1 A;  1Y8C A;  3G1O A;  3J7A O;  4A0Y A;  1RO4 A;  1M1K 2;  2K3P A;  4WWC A;  3OSF A;  5LGT A;  3OYC A;  3WHB A;  1RC9 A;  3I4M J;  1H8A C;  5BPI A;  4JQF A;  3GTP I;  3J81 K;  1K7A A;  3ZPL A;  5TRD A;  4HW0 A;  2BVL A;  3B6C A;  2VJ5 A;  3ZMS A;  2M4G A;  2XRO A;  2M7A A;  3SDG A;  4M3G A;  4IL6 C;  4BHC A;  3C2H A;  1R36 A;  2NVU B;  4E7H A;  2DPU A;  1YJW 1;  4OIP F;  1K8A 1;  3I58 A;  3RKQ A;  1HW5 A;  2EH3 A;  4AU7 A;  4ZZD A;  2BBY A;  1KYZ A;  2YPR A;  5J6X A;  3HB9 A;  2DN0 A;  3LAP A;  1X1C A;  2E7W A;  2DE7 A;  2WC2 A;  3ZQH A;  2JZY A;  5IT9 b;  5FFZ A;  4XLP F;  3WU1 B;  1PJR A;  1SD6 A;  3M4O I;  3J7A 4;  3HPH A;  3I5U A;  2ETH A;  1YX3 A;  5GTI C;  2ZBK A;  1T08 B;  3CCJ 1;  4EM2 A;  3OYF A;  3KZZ A;  1ODD A;  4ANJ A;  4MO7 A;  4XLE A;  2F5F A;  5CVI A;  1TNS A;  2OAZ A;  5ILU A;  3M9A A;  5DCM B;  4DZP A;  2WV0 A;  3OSG A;  1S72 Z;  1YJN I;  4R1H A;  1U5T C;  1YHQ Z;  3DWL E;  2KDO A;  1LUJ B;  2WAD A;  5L3C A;  1VQL 1;  1R7J A;  4GFB A;  1OPC A;  2M9H A;  2Q1Z B;  2OTL I;  1FOX A;  4LOC A;  1WJE A;  4M9X A;  4BHP A;  3LQQ A;  3WTY C;  2CSO A;  3BG6 A;  2A5Y B;  1IDY A;  3QPT A;  5J40 A;  1V55 H;  3CCL I;  1ZLK A;  1VND A;  3PQJ A;  3GZ6 A;  2VUM J;  4AVP A;  4ZDO A;  1YE9 A;  4Q4Z F;  3Q9S A;  3NRV A;  1P92 A;  3LOC A;  2LYC A;  4A93 I;  1HQC A;  3CC7 Z;  2JIR A;  2EIJ H;  3K7A I;  4G7Z F;  1CGP A;  4IXA A;  1Z6T A;  4S0H B;  2O4H A;  1KC8 2;  5F27 A;  4C9Y A;  4D5C A;  4NB9 A;  1DDN A;  2F5D A;  1HST A;  3OIP A;  2QUF A;  5LRR A;  3J80 K;  1VQO I;  3JRF A;  3CPW Y;  1ZRC A;  1TFI A;  2JA2 A;  3TQN A;  3BDD A;  1WQ2 A;  2M87 A;  1YJN 1;  4YIF A;  2FML A;  3EPZ A;  2E2H I;  2VI6 A;  3HOT A;  3CCV Z;  1F1Z A;  1YUK A;  2CV2 A;  2OTL 1;  2EIK H;  3EUA A;  2Q51 A;  2GTI A;  3CCJ Z;  2E5N A;  4ZTF A;  2JPB A;  3K2Z A;  3CLQ A;  1WZN A;  2A6T A;  1MJB A;  2QA4 Z;  4HOB A;  1QYP A;  2JVG A;  2VKV A;  4UV8 A;  3HOS A;  4M71 A;  2HDD A;  3BR1 A;  3ULQ B;  2XPV A;  1XDU A;  2IEK A;  3FK6 A;  2HOT A;  1A5J A;  3S8P A;  4E30 A;  1K83 I;  5CM2 M;  3G6E 1;  5CVV A;  3E6C C;  4I0B A;  4CZZ A;  4IO9 F;  1SAN A;  2IP2 A;  3VOE A;  2NVT J;  1NJI 1;  2W48 A;  3RQI A;  1J7K A;  1X3Z B;  1AA7 A;  1LFP A;  2IA1 A;  3ABT A;  4LGW A;  4RM2 A;  5C44 J;  3JRI A;  2JR6 A;  2VKH A;  4G6Q A;  1R58 A;  1MJ9 A;  3TDH B;  1IG7 A;  1ONV A;  1SC7 A;  3OYB A;  3BP8 A;  2F4I A;  5K5O A;  2YS9 A;  4MTD A;  4NQW A;  5FLX Z;  4N4N B;  1NK2 P;  1NP6 A;  2LF7 A;  1GDT A;  3CMA Z;  4NC6 A;  3W6V A;  2LBF B;  2LTP A;  2NS0 A;  1W7P A;  1G3T A;  1ZGW A;  4PJL A;  4DQ2 A;  3AAF A;  2VOO A;  2ESN A;  1WPK A;  2HOA A;  1Z03 A;  1BOB A;  1W4M A;  4E33 A;  1OKR A;  3RTR A;  1R9T I;  1XPX A;  4NB8 A;  2NOG A;  5F0C A;  1JTX A;  1YTY A;  4Q48 A;  5LD2 C;  2K9Q A;  2A5W A;  3LSP A;  1VI0 A;  5C4J J;  1N75 A;  1UZC A;  3OWT A;  3F3X A;  2GZW A;  3LSR A;  2NS7 A;  3MZL B;  5K7Z A;  4KIG A;  4U87 A;  4LB5 A;  1IJW C;  4MGR A;  5FO5 A;  5C4X I;  2ZME A;  5J8F A;  2VBW A;  3FDY A;  1LVK A;  1XN7 A;  3SXY A;  2KPI A;  1IN5 A;  4U0Y A;  2ZJP F;  5K5Q A;  1PUF B;  3S2H J;  2RBL A;  3IKT A;  2L4A A;  2PMZ A;  2K02 A;  4ITV A;  1ZRE A;  2M45 A;  3KP7 A;  3PNV A;  3NH4 A;  2HKX A;  4KIT B;  3T8R A;  2MW8 A;  3U1K A;  2ECB A;  5BNG A;  3BC8 A;  3CC2 Z;  4G12 A;  5J3L A;  2ZJR F;  3BCA A;  1B8I B;  3DEU A;  3GWZ A;  3LSJ A;  3BOQ A;  4CSW A;  3D0S A;  5B66 C;  3FIW A;  4KMU X;  3HXL A;  4DGW B;  5JFR A;  1VQ8 1;  2PG4 A;  4U7D A;  4M73 A;  1I1S A;  4FIS A;  1IZ1 A;  3OYE A;  1JGG A;  1TZL A;  2EIM H;  3EUK L;  3JTH A;  4LMY A;  3BG1 B;  1T38 A;  2GIV A;  1JKR C;  1IN6 A;  2ZC2 A;  4GGG A;  4NBQ A;  1NH3 A;  1SMT A;  2KZV A;  1IC8 A;  1PUF A;  3GEZ A;  1VQO 1;  4AM3 A;  3D9X A;  2QGU A;  5LHH A;  4JBA A;  5DS9 A;  3ZMT A;  3TO7 A;  3K70 D;  3CDL A;  2JA7 J;  5BS6 A;  2D45 A;  3BLY A;  3G4S 1;  2A3S A;  1G2H A;  2XKP A;  2Z3Y A;  4IX7 A;  4LK1 F;  4MHG A;  1I3Q J;  2E19 A;  4UVA A;  1A31 A;  3HRM A;  3EED A;  3CCR 1;  2EWN A;  4I98 B;  2XGC A;  3MKZ A;  4A0X A;  1FC3 A;  3CLO A;  1QZE A;  2W1O A;  1MIJ A;  3FXM A;  4HAM A;  2P5L C;  4PDK A;  4CH7 A;  5E20 A;  2NNN A;  1OFC X;  5L3F A;  2DI3 A;  3V7C A;  5IYD J;  5T64 A;  3HOX J;  4RGU A;  5HS9 A;  3LA7 A;  3BTI A;  1IAW A;  1NTC A;  1LNW A;  1P7J A;  2F5E A;  2ZO4 A;  1K6O A;  5F04 A;  1NK3 P;  5GTH C;  3HOV I;  4EVI A;  5KAI C;  1VZ0 A;  2X6X A;  1XMK A;  2CUJ A;  3NFZ A;  1YJ9 1;  1T33 A;  2JQ7 A;  2G7U A;  1DU0 A;  2MLG A;  3S1Q J;  2D2W A;  2CV0 A;  2JRM A;  4A3B J;  2JA7 I;  3K4N A;  2K4J A;  1XMA A;  1FT9 A;  1ZLJ A;  2EFW A;  2DDB A;  4L5I A;  1FTT A;  5E3M A;  1J75 A;  3OIQ A;  4ZZL A;  2HQR A;  4Z2Y A;  4YRV A;  2NXN B;  4BS9 A;  5L3G A;  3F0C A;  1LDD A;  5FLX f;  3K69 A;  5E1X A;  4IQJ A;  4FT8 A;  1WSU A;  3KYC B;  1J09 A;  2LH9 A;  2ZXH A;  3E5X A;  2CQK A;  1MBJ A;  2EV6 A;  3K1N A;  5LHI A;  1KQ8 A;  2H94 A;  2K9S A;  1Q1V A;  3I59 B;  4XBF A;  1YHQ I;  4Y7N J;  1JJ6 C;  4BXX J;  2X6Y A;  3HOU I;  4PCQ A;  3MFK A;  3KEQ A;  2DW4 A;  3T8T A;  2XF5 A;  5M3M J;  2Y0S A;  5LGN A;  1I6X A;  4CCN A;  3S14 I;  2H6C A;  4XID A;  1Y1V S;  2R92 I;  5HDG A;  4BY7 I;  3KIH A;  1WII A;  2OQG A;  3K4C A;  4M72 A;  4BJ6 C;  1RRJ A;  2FMY A;  1X4O A;  4CL1 A;  1LFU P;  3KYD B;  4OAZ A;  2WBM A;  1TW3 A;  3ASO H;  2ME0 A;  3DBR B;  2O03 A;  4KT6 A;  1LDJ A;  2IA2 A;  1Q7Y 2;  2E7X A;  3V8J A;  2Q4Z A;  3A01 B;  1G3Y A;  2LY2 A;  4U7B A;  4HGY A;  2JMW A;  3ZMZ A;  2LY9 A;  3CUO A;  3A01 A;  2AO9 A;  3I0T A;  4P1W A;  2GWR A;  2JT1 A;  1FYL A;  4MON A;  2Y69 H;  1Y39 A;  1Y1W I;  4JOM A;  3QPH A;  5FKM A;  2XC7 A;  1QNT A;  2DE5 A;  2XAS A;  4BEH B;  1N77 A;  4IHW A;  2KT0 A;  1R23 A;  1USP A;  1D0Z A;  3VFZ A;  3CCS I;  4X0G A;  1MBG A;  3CCM I;  4HF0 A;  4W1U A;  1Z67 A;  1IUF A;  3ECO A;  1K8A 2;  3GZ5 A;  2QQ9 A;  3S1N I;  1D1A A;  1VQ6 I;  2FBI A;  2GA1 A;  1P4W A;  4BHB A;  4KDP A;  3OY9 A;  3L2V A;  2NVQ I;  4JK1 X;  2JA6 J;  4BE0 A;  1VQ4 Z;  3C7J A;  3CCV I;  4LK0 F;  2BGC A;  2E71 A;  1TQI A;  2JUC A;  2ZFU A;  1PP7 U;  4L9N A;  1BC7 C;  2BY0 A;  2YUS A;  2VAS A;  4NBE A;  3RCO A;  2X1C A;  3HOZ I;  4RMN A;  1B8I A;  4UVB A;  4IHY A;  2EIL H;  2Y0S N;  2IGK A;  1P4X A;  2V1X A;  3PQK A;  3U21 A;  4HGZ A;  3GTL I;  1KU7 A;  4ENN A;  3GCM A;  2FOK A;  3GTG J;  4FE4 A;  3FXU A;  2NAZ A;  3G71 I;  1Y56 A;  1MBE A;  4I7H A;  2IW5 A;  3HL2 A;  3IWF A;  4TV7 A;  1ORK A;  1YQA A;  5GAG J;  4EAT A;  3CC4 Z;  1I50 J;  2LLK A;  4S1T A;  5DM6 F;  1MMN A;  2UXX A;  3HOX I;  3E6M A;  1YI2 I;  2K4B A;  5CVR A;  3HHG A;  2MD0 A;  1Z3Y A;  4RVH A;  4ZDP A;  3J7Y J;  3H3Z A;  4MD7 A;  4OIO F;  2MYS A;  2PK7 A;  1VQM 1;  1XTA A;  2K5C A;  5EGO B;  2EB7 A;  2KRC A;  5EYR A;  1SD7 A;  2P7V B;  4YIR X;  1S72 1;  2LFU A;  4RVD A;  2ZSH B;  4ENM A;  5B1B H;  3IX0 A;  4A3G I;  2QKD A;  5D5U B;  3CUQ B;  4I99 C;  1YIT I;  1JKO C;  5BPD A;  4MFE A;  4GDF A;  1ETK A;  2LRD A;  4FX0 A;  2ZXJ A;  4NB5 A;  2Q8K A;  1ZB9 A;  3ZN1 A;  4HEA 2;  1Y1V I;  4EJO A;  2KL4 A;  4ENJ A;  3FIS A;  4QTU A;  5FRN A;  3FMS A;  3U1D A;  1RPW A;  1TT5 B;  3I9V 2;  2PJR A;  3FXR A;  2K9L A;  3WE2 A;  3NH8 A;  3VMH A;  2H6B A;  2M6N A;  4J19 A;  1R1V A;  1Q86 1;  1WVR A;  1VQN Z;  5FFX A;  3CMM A;  4W97 A;  1PP8 F;  4M74 A;  4PJ0 C;  5BQT A;  2V45 A;  3HRS A;  2I5U A;  4MFD A;  2DFI A;  2RHB A;  4RGX A;  2IS2 A;  2HU9 A;  3HUG A;  1ZG1 A;  2XF6 A;  2P5K A;  2MA3 A;  1EV7 A;  2HWV A;  4LIT A;  4E7K A;  4BYY A;  3H3U A;  4RDU A;  1EH6 A;  4A5N A;  4MTE A;  3IH2 A;  3CUQ C;  1ML8 A;  2CGP A;  1ZG5 A;  3SFI A;  3CP2 A;  3KPH A;  2Y31 A;  4GO1 A;  3JCU C;  1S72 I;  2GM4 A;  1T98 A;  4C2M J;  5J4V A;  3R0A A;  1ZN2 A;  1IF1 A;  1YJW I;  3S2H I;  1K4T A;  2COM A;  5IP9 I;  4MLO A;  1MD0 A;  4Y52 I;  1KQ0 A;  4XOT A;  2TRT A;  4EGZ A;  4IHV A;  3E3V A;  5FD6 A;  1YX5 A;  1REP C;  3K7A J;  3ZMV A;  2L9S A;  3BR6 A;  4A93 J;  4M9Z A;  2MD5 A;  3KP5 A;  3VOD A;  2JA8 J;  2VJJ A;  2NVY I;  2LKS A;  1LJ9 A;  2KP6 A;  4KNY A;  3JAM f;  3IL2 A;  5FLX K;  1XGO A;  3PO3 I;  1HDD C;  3P9I A;  2LP0 A;  4IRH A;  4A69 C;  4E2Z A;  3F72 A;  4AVZ A;  1RR7 A;  5TGT A;  4ON0 A;  2BV6 A;  2ZXW H;  4UV9 A;  1FIA A;  3QAH A;  5E1Z B;  2PJP A;  4HDV A;  2J5O A;  3M8J A;  2HOE A;  5LEK A;  2PQ8 A;  2HZD A;  3QWL A;  1DPR A;  3ZQG A;  2DT5 A;  1ZKG A;  3UNG C;  2KMU A;  4N0B A;  1ZAO A;  3RQ4 A;  4E6K G;  4KYW A;  2VPY A;  2X0L A;  1TT0 A;  2VQL A;  3F6V A;  2FD5 A;  4UB8 C;  2ELJ A;  1F5T A;  1SFK A;  1JI8 A;  2LY1 A;  4HF2 A;  3KIO A;  3M3Y I;  2EPF A;  3IP4 B;  1VLA A;  2BHZ A;  2OC6 A;  4A6D A;  2HEO A;  1F9N A;  3CQZ J;  4Y17 A;  2KZG A;  2LEX A;  2KRF A;  1VQL Z;  1JT6 A;  2JVH A;  3CME Z;  3JW4 A;  1M90 2;  2DE6 A;  2BHY A;  3A0H C;  4RVG A;  2HNH A;  2YX7 A;  2RIQ A;  4CCJ A;  2K3F A;  4FHT A;  5F1J A;  2VE9 A;  1W36 C;  1RLY A;  1U6G A;  2OOY B;  3HOU J;  1MMD A;  2CRG A;  3BG5 A;  2LKP A;  2WAQ N;  1VQ4 I;  4HLX A;  1HKQ A;  4D9J A;  4KIS A;  3J81 b;  2W57 A;  1D5V A;  1TWG J;  4UXN A;  3L2C A;  1ON1 A;  2IPQ X;  2MC3 A;  2FQ3 A;  2X1E A;  2DA5 A;  2X85 A;  3OS0 A;  4MH4 A;  5HVQ C;  4ESB A;  3T5X A;  2VOD A;  1GUU A;  1R5H A;  1X4P A;  2QBY B;  1Q81 1;  2DA1 A;  2B7E A;  1XD7 A;  2L2O A;  3FM3 A;  3M8E A;  3S1N J;  3VWB A;  1YJ9 Z;  3CDI A;  3A0B C;  4B8X A;  5FRM A;  1TWF I;  3ERE D;  4HRI A;  1TWH J;  3IWZ A;  1OCC H;  4HBL A;  1YS7 A;  3CJR B;  1EH7 A;  2JSC A;  2KRH A;  1XGN A;  4WXH A;  1BJA A;  1D1C A;  1ZHF A;  3HPG A;  3LAJ A;  2HPM A;  4OMY A;  3RZO J;  2EQR A;  4RAZ A;  1UCR A;  4UVC A;  2DDA A;  3LWF A;  1PYV A;  4Y3O A;  2R0Q C;  3D2L A;  3L1P A;  2KI7 B;  2XIG A;  2ECC A;  5IOY A;  3GCF A;  4QWQ A;  2VL8 A;  1FPQ A;  3WTX C;  3F6O A;  2WAE A;  2AS5 F;  1WJA A;  5EZG A;  2NVY J;  2W03 A;  2P8T A;  3IKV A;  4PJJ A;  2QLZ A;  3TBI A;  3R0J A;  4RGS A;  1S29 A;  1Z77 A;  3RYP A;  4R79 A;  3SZP A;  5E8I A;  2VKD A;  4EJU A;  1WKM A;  2JRT A;  4RBO A;  2ICW G;  2VE8 A;  4ZDL A;  3HTS B;  3F8C A;  2EFO A;  2DJN A;  1IRG A;  2MH2 A;  2AXL A;  2WAQ A;  5JLX A;  1AA6 A;  2GXA A;  1EH8 A;  3GTO I;  1YW7 A;  2V3V A;  1X3W B;  4JX6 A;  3S1R I;  5J1U A;  1QPM A;  1QVT A;  3O2P E;  1LQ1 A;  4XX2 A;  3JRC A;  4B1R A;  2L7Z A;  5K5R A;  3G2B A;  5IP7 I;  5K7H A;  2VB6 A;  2DA7 A;  2ZNY A;  5L3E A;  3CCE 1;  1K73 1;  1WJ5 A;  2R7D A;  3IAS 2;  4KT5 C;  3SZT A;  1JWH C;  4RLQ A;  2RN7 A;  2VXZ A;  3BG3 A;  4BXU A;  1RO0 A;  2PM9 A;  4KIB A;  1TLH B;  4IF4 A;  3I56 I;  1G59 A;  4LB6 B;  3RDI A;  2MAB A;  1OCR H;  4IRG A;  3RKY A;  3OYJ A;  3EUH A;  1XSD A;  1RUN A;  1UMQ A;  1H9T A;  1WCM J;  2JWT A;  2O3F A;  4MEX F;  4CDG A;  2V8J A;  4BBS I;  1KYW A;  2HVR A;  4UUT A;  3EYY A;  1X2N A;  2P0W A;  3W6J B;  5GAD J;  3JRH A; 
#chains in the Genus database with same CATH homology
 1RNI A;  2R6M A;  5D1P A;  2K3R A;  2VQC A;  1AA7 A;  1LFP A;  3BG7 A;  2CW7 A;  2JR6 A;  3FKJ A;  4RM2 A;  3VMG A;  1VQ8 Z;  1I6H I;  2VKH A;  3E0J B;  2RT9 A;  4BU2 A;  1MND A;  2R7U A;  4NBB A;  2HVQ A;  4Y4R A;  3TDH B;  3CC4 1;  3GTK I;  3S2D I;  5KCM A;  4NQW B;  2WY8 Q;  3OYB A;  3FQQ A;  2F4I A;  5HOO A;  3VYR B;  1NP6 A;  1N2F A;  3MON A;  4N4N B;  2VJ4 A;  1LQL A;  3EUH C;  3CMA Z;  5A2Q f;  3AKZ A;  2BW3 B;  2LBF B;  4HNT A;  1DP3 A;  2V4J C;  2GOX B;  4PJL A;  3ZR8 X;  2YU9 I;  1W36 D;  4FET A;  1KRL A;  4XOR A;  3P5J B;  5LL6 f;  1Z03 A;  1BOB A;  4E33 A;  2M4K A;  2DT6 A;  4PFO A;  4E2X A;  3RTR A;  4E2Y A;  3CC2 1;  4A3I I;  2NVX I;  1R9T I;  4NB8 A;  1VQ4 1;  1X3Z A;  1P9Q C;  4AYB A;  2L9N A;  3LSI A;  1X1B A;  4X6A I;  5LD2 C;  2L5Q A;  1QVF Y;  1FMV A;  2A5W A;  2HF1 A;  2OOX B;  4E31 A;  3FKI I;  1N75 A;  3OWT A;  2ZAE B;  3KYL A;  3MZL B;  1RQF A;  2E2J I;  3BCB A;  4PSX A;  3CPW Z;  2AQE A;  4U87 A;  5CQE A;  3U50 C;  2GU2 A;  4MRI A;  3H9Q A;  4NBF A;  5C4X I;  1NJI 2;  3FDY A;  3D5R C;  1LVK A;  2KPI A;  3H3V J;  2RBL A;  3K10 A;  1TWA I;  1TWC I;  2PMZ A;  1G8X A;  3AL0 B;  2UV1 A;  4ITV A;  1KON A;  3DKY A;  1VQ9 1;  4HPQ A;  2QLV B;  3CC7 1;  3PNV A;  1V5F A;  3NH4 A;  4YEJ A;  4NOZ A;  2JS4 A;  4ZC3 A;  4KIT B;  4PJN A;  3PFY A;  4XN3 A;  1WCM I;  2O53 A;  5CPR B;  1Q82 1;  2V1N A;  3CCQ 1;  2JA8 I;  1WJB A;  3BC8 A;  3VSK A;  4RS4 A;  3CC2 Z;  2FUG 2;  2W82 A;  3BCA A;  1X3W A;  4XMY A;  4II3 A;  3S15 I;  3DLA A;  5CKT A;  4CSW A;  2IS1 A;  4FAS D;  2OUM A;  3HXL A;  2AQF A;  4DGW B;  4HNU A;  1VQ8 1;  2JMO A;  2R7V A;  2VUG A;  2IGM A;  4PSW A;  3OYE A;  1PFT A;  2RPR A;  1QVF Z;  2R7Z I;  4B3X A;  1TZL A;  1DGR M;  3CP8 A;  3EUK L;  3BG1 B;  4XL9 A;  3DTK A;  2CUZ A;  3W2W A;  4QPO A;  4DOZ A;  3MD2 A;  3NWT A;  3L2U A;  1EA3 A;  3OYG A;  3H5R A;  2XDV A;  3IAM 2;  3N05 A;  2R7S A;  2EGT A;  2KZV A;  3H0G I;  3MZK B;  4PJM A;  2QEX Z;  1Q7Y 1;  1HA8 A;  1TWG I;  3S3M A;  1VQO 1;  3ONQ A;  2KPM A;  5KNL A;  4A3K I;  2OV7 A;  2NOJ B;  3K70 D;  3OL3 A;  3E1S A;  4BQN A;  3BLY A;  2JUB A;  3G4S 1;  3VDX A;  4MD9 A;  2M3A A;  3S3O A;  4IX7 A;  2H85 A;  2IGN A;  3CCR 1;  3EED A;  1TWH I;  3S17 I;  1MMA A;  4F91 B;  2DXI A;  1RO2 A;  3I55 1;  1YIJ 1;  3MKZ A;  3HOZ I;  2VXD A;  3NH5 A;  2E2I I;  1Z3X A;  4DJA A;  2W1O A;  4J00 A;  3DPL C;  4IKF A;  2VUM I;  4CH7 A;  2W00 A;  5T6B A;  3DTE A;  3VMI A;  4A3L I;  5LFA A;  1X1A A;  1D0Y A;  5T64 A;  3H35 A;  4PUS A;  4YEL A;  1I50 I;  3K4M A;  3QOE A;  1Z01 A;  1ERD A;  4DQY B;  3K4K A;  3HKZ A;  2QRD B;  3BG0 B;  2B63 I;  4HH4 A;  3S1Q I;  2DJI A;  1IRX A;  2E1M B;  2V8I A;  3HOV I;  4A3F I;  1N8R 2;  5AN9 F;  2DT7 B;  1VZ0 A;  2X6X A;  2CUJ A;  3HG9 A;  4DIQ A;  4F3Q A;  3NFZ A;  5T67 A;  1YJ9 1;  3EER A;  3CXC Y;  3GTJ I;  4BE1 A;  4LIV A;  4A3C I;  4BQQ A;  2CV0 A;  3QYB A;  3S32 A;  5FRO A;  3K4N A;  3AL0 C;  2F4M A;  1QU3 A;  2JA7 I;  3CQZ I;  4F55 A;  4CCO A;  4B44 A;  1YI2 Z;  4NFR A;  3OIQ A;  4XLC A;  2AKL A;  2M0M A;  4YRV A;  2M48 A;  4BS9 A;  2DCE A;  4DK1 A;  5FLX f;  1VQ6 1;  4BJT A;  3F9K A;  3DU5 A;  4E7Z A;  4IQJ A;  1V5G A;  1J09 A;  5HLT A;  1D1B A;  1MMG A;  1ZH1 A;  2LH9 A;  2ZXH A;  1ZEL A;  4A3E I;  1KQS Y;  3QYF A;  2G2K A;  2LOO A;  3H0D A;  4B47 A;  3K70 C;  3F3P C;  1VQK 1;  2BW3 A;  3VSL A;  2X6Y A;  3FQM A;  3HOU I;  2XF5 A;  4NC8 A;  2Y0S A;  4C30 A;  2PJR B;  3OYL A;  1T95 A;  2CH0 A;  4E32 A;  4CCN A;  2GTH A;  3S14 I;  2F4O A;  1QVG Y;  1Y1V S;  1VQ5 Z;  2R92 I;  3GTM I;  3KEY A;  1U0J A;  3GKQ A;  4BY7 I;  3KIH A;  1WII A;  1BR4 A;  3PUB A;  3K4C A;  4BJ6 C;  2QKM B;  3KIF A;  1X4O A;  2L7K A;  1N78 A;  4CL1 A;  3HC7 A;  4BY1 I;  4OAZ A;  4XKW A;  2WBM A;  2CV1 A;  4RVF A;  2CW8 A;  3J7A Y;  3VTN A;  3DU6 A;  4KT6 A;  2VJI A;  2R7T A;  3OOU A;  3DKX A;  1LDK B;  2E60 A;  1W2B Z;  1X1D A;  5HNH A;  3CCQ Z;  1Q7Y 2;  4BGD A;  2HQA A;  2Q4Z A;  1SFO I;  1WJF A;  1NG7 A;  2LY2 A;  4U7B A;  1Q86 2;  4HGY A;  1OLT A;  3IUO A;  2OZK A;  1P9N A;  3M1C A;  5A2Q b;  1VQ6 Z;  3PO2 I;  1SAU A;  1Y6I A;  3DEE A;  2XF7 A;  3RPU D;  3K4B A;  4E4H A;  2R4G A;  4HG2 A;  4P1W A;  3CD6 Z;  4MON A;  3LMM A;  4BXF A;  2OTJ Z;  1Y1W I;  3H9G A;  1VQP Z;  4JOM A;  4NC7 A;  4DBQ A;  2X1D A;  4F92 B;  2XC7 A;  2DE5 A;  3CCE Z;  4BEH B;  1L1O C;  1N77 A;  2KHM A;  2UUZ A;  2V9K A;  4XQF A;  3AFH A;  3H5A A;  1USP A;  1D0Z A;  1W2B Y;  2QRC B;  4A3J I;  4X0G A;  4Y7N I;  3LSG A;  2WB1 A;  1YIT 1;  4MD8 A;  2LBF A;  1K8A 2;  3S1N I;  2R93 I;  4C2U A;  1D1A A;  2JA6 I;  3A1Y A;  3PSF A;  3L2R A;  3K4L A;  5IT9 f;  3ZRG A;  1VQ7 1;  3OY9 A;  3L2V A;  2E5Z A;  2YAD A;  1NG6 A;  2NVQ I;  2R7R A;  4XN0 A;  3PNY A;  3SYT A;  4BE0 A;  1VQ4 Z;  3LL7 A;  4B43 A;  4BJ5 C;  2ZFU A;  3J81 f;  4F93 B;  3ZXS A;  2QRE B;  2VAS A;  3CF2 A;  3RCO A;  2X1C A;  4NBE A;  4RMN A;  3I56 1;  4CZC A;  4II2 A;  4XON A;  3VYT B;  4GRI A;  3ZGK A;  3I56 Z;  3RZO I;  3L2W A;  2IGK A;  3NDI A;  2VIX A;  2V7F A;  3U21 A;  4HGZ A;  1UAA A;  1K9M 2;  3GTL I;  1DL6 A;  5C3E I;  3OL4 A;  2Q2E B;  2V6E A;  2XAU A;  1Q82 2;  3S93 A;  4BXX I;  1Y56 A;  1YJN Z;  1K6Y A;  4KJZ A;  3HL2 A;  3JAM b;  1OR7 C;  3SEZ A;  1UG0 A;  4BUP A;  3CC4 Z;  4EAT A;  4S1T A;  1WW9 A;  2K9M A;  1MMN A;  2QKL B;  3HOX I;  1YIT Z;  3OW2 Y;  2MD0 A;  4XNF A;  3OS1 A;  1Z3Y A;  3F3F C;  4RVH A;  4ZDP A;  3NWS A;  3CXC Z;  2QEX 1;  2V26 A;  4MXU A;  3A4C A;  4MD7 A;  2MYS A;  4CA0 A;  2PK7 A;  1VQM 1;  3K6G A;  4HSR A;  2K5C A;  4BE2 A;  2VF1 A;  4DBR A;  2KRC A;  3CCL Z;  4A3B I;  1S72 1;  2O5R A;  2W04 A;  2PM9 A;  2LFU A;  4RVD A;  2ZSH B;  4XLA A;  4BAC A;  3T4N B;  4NBA A;  3OS2 A;  3IX0 A;  2IXS A;  2QKD A;  4A3G I;  3CCS 1;  4D1Q A;  4NUB A;  2I3C A;  2JUG A;  3NDJ A;  3FHN A;  2LIY A;  5C4J I;  2LC2 A;  4NBG A;  5C44 I;  2LRD A;  3J80 f;  5D1O B;  2NVT I;  2Z16 A;  1ZB9 A;  4XLH A;  3GTM S;  4PK4 A;  4HEA 2;  4ZYA A;  1Y1V I;  2KL4 A;  4QTU A;  3PNT A;  3MKY B;  5FRN A;  3ZQQ A;  4A3D I;  1QHH D;  3I9V 2;  1QHG A;  2PJR A;  2K9L A;  3PSI A;  1S7M A;  1WJD A;  2E9H A;  3NH8 A;  3VMH A;  2RNG A;  1KD1 2;  2M6N A;  1Z7L A;  1Q86 1;  2JA5 I;  1VQ5 1;  3CMA 1;  4BDY A;  3I4M I;  1VQN Z;  3CMM A;  4C2T A;  2IS6 A;  3G71 1;  1Z02 A;  1VQM Z;  4NNJ A;  1I3Q I;  4A3M I;  3I4N I;  1ZB8 A;  2RHB A;  1YJW Z;  2R7W A;  3DPU A;  3QYE A;  2IS2 A;  3I07 A;  2HU9 A;  2CS3 A;  4BL0 B;  2XF6 A;  2LRE A;  4CCK A;  4BQO A;  3OYH A;  4E7I A;  2KLO A;  4LIT A;  4E7K A;  3K4J A;  4LIU A;  3LUS A;  1YI2 1;  3OYN A;  3CD6 1;  1E0E A;  1WFX A;  1DQU A;  3OMY A;  3W2A A;  1ML8 A;  5FLM I;  4XOP A;  3W3C A;  3IFU A;  3I55 Z;  1YIJ Z;  3CP2 A;  3LSH A;  1KC8 1;  2VQH A;  4XR6 A;  4RV9 A;  2R7Q A;  3KX2 A;  1Q81 2;  2J6A A;  2DOA A;  3DQV C;  3S2H I;  3PJR A;  2IS4 A;  4ZTJ A;  1R6R A;  1QF8 A;  4MLO A;  5IP9 I;  1FMW A;  4Y52 I;  2HPI A;  2WAF A;  4XOT A;  1MW7 A;  2Z1D A;  2RRE A;  2LG4 A;  1YX5 A;  2HDW A;  1T0F C;  2QR1 B;  2L9S A;  2RQQ A;  2WA0 A;  1VQ7 Z;  4TNU A;  1JJ2 Z;  2VJJ A;  2NVY I;  2MFZ A;  4J01 A;  3W2V A;  3G71 Z;  2F6C A;  2KP6 A;  1X0T A;  5HNF A;  3JAM f;  3SDB A;  2R7X A;  4XLF A;  3CCU 1;  3PO3 I;  3I3L A;  1WJC A;  4F52 A;  3CCM 1;  2E1M C;  1M1K 1;  4E2Z A;  4AVZ A;  3CCR Z;  2BOL A;  2VQG A;  4H4K C;  5TGT A;  4BBR I;  1UEL B;  4BDZ A;  1NUI A;  3LSK A;  2R7O A;  4CCL A;  3Q87 A;  1V5E A;  3OYK A;  3LFU A;  5KHD A;  2HVS A;  2VLA A;  4B48 A;  1S9H A;  3FBN B;  3V42 A;  4XKC A;  1N8R 1;  3M8J A;  3QWU A;  3VYU B;  3CCV 1;  2P28 A;  3PO3 S;  2HZD A;  2P3Y A;  1RO4 A;  3VB9 A;  1M1K 2;  3DPT A;  2K3P A;  3RSN A;  4IZZ A;  1NJI 1;  2ZSI B;  3OYC A;  2QA4 1;  3UNG C;  2KMU A;  3RQ4 A;  4E6K G;  1QVG Z;  2CMP A;  3SZG A;  3LSM A;  3PL8 A;  4JQF A;  3OYI A;  3GTP I;  1TT0 A;  2VQL A;  1VQ9 Z;  3OR2 C;  3CCU Z;  2V8K A;  2X51 A;  2BVL A;  2ELJ A;  1SFK A;  2VJ5 A;  2LY1 A;  2M4G A;  1JI8 A;  2M7A A;  3M3Y I;  2WY7 Q;  3IP4 B;  1JJ2 Y;  2IZ4 A;  1VLA A;  2W4S A;  4OAY A;  3C2H A;  2OC6 A;  1KD1 1;  4E7H A;  4DGL A;  1YJW 1;  1LKX A;  3UR3 C;  1K73 2;  1K8A 1;  1VQL Z;  2GOM A;  2Z2S B;  3HUG B;  4AU7 A;  2JVH A;  3G6E Z;  3CME Z;  2I8D A;  1M90 2;  3GTG I;  2DE6 A;  1X1C A;  4RVG A;  2HNH A;  2DE7 A;  2RIQ A;  4CCJ A;  3S1M I;  1W36 C;  1RLY A;  3D6W A;  3TE5 B;  4PFP A;  4EWC A;  1PJR A;  1Z21 A;  3D5S C;  1MMD A;  2OOY B;  3M4O I;  3J7A 4;  3HPH A;  1YX3 A;  3VYS B;  3OR1 C;  3MKW B;  4E7L A;  4NBD A;  1VQP 1;  4RM3 A;  4D9J A;  4KIS A;  3J81 b;  3HOY I;  3CCJ 1;  4HST A;  2OTL Z;  3OYF A;  2X6W A;  2X1E A;  2X85 A;  3CJQ B;  4XLE A;  4ANJ A;  4CUG A;  3OS0 A;  3MMY B;  5HVQ C;  2IZ3 A;  4MH4 A;  4QTT A;  3QOD A;  1X4P A;  5D1O A;  3CES A;  3SEQ A;  1Q81 1;  4E7S A;  2MC4 A;  4N4O B;  2L2O A;  1BR2 A;  1YJ9 Z;  3VWB A;  1TWF I;  1S72 Z;  4XM3 A;  4ZJZ A;  5FRM A;  4RLF A;  4HRI A;  1YHQ Z;  3DWL E;  1M90 1;  1YHQ 1;  2KDO A;  2IGO A;  2WAD A;  3C2G A;  3OYD A;  3CJR B;  2UWM A;  4NH1 C;  1VQL 1;  2KRH A;  2XSJ C;  4XKB A;  3H5N A;  2HPM A;  3D9X A;  1D1C A;  2M7B A;  2Q1Z B;  3HPG A;  3OW2 Z;  2F5V A;  1WJE A;  2VPL A;  3BG6 A;  4Y3O A;  1PYV A;  2OTJ 1;  4Y33 A;  2KI7 B;  3A2K A;  3GCF A;  4E2W A;  2VL8 A;  3FBI B;  1VQN 1;  3GBG A;  1USP B;  2WAE A;  1X19 A;  1WJA A;  4ZDO A;  1YE9 A;  2JSP A;  3ZCO A;  4IQ4 A;  3HOW I;  2LYC A;  4A93 I;  3CC7 Z;  2BVM A;  3K7A I;  1GLN A;  2W03 A;  3G4S Z;  4NBC A;  1D0X A;  3J80 b;  4PJJ A;  4CCM A;  3TBI A;  3OYA A;  3DTI A;  1K9M 1;  5CQG A;  3RZD I;  4G6T B;  4R79 A;  2CFO A;  2O4H A;  2VKD A;  1KC8 2;  3CCS Z;  4ZDL A;  4C9Y A;  3CCM Z;  3S3N A;  3ESW A;  1YUA A;  4NB9 A;  2WAQ A;  3OIP A;  3CPW Y;  3GTO I;  2W7N A;  2JA2 A;  1TFI A;  3S1R I;  1VQK Z;  4XX2 A;  1YJN 1;  4QPQ A;  5IP7 I;  4P5O A;  3G2B A;  3GTQ I;  2BJO A;  3EPZ A;  2VB6 A;  2E2H I;  4OWR B;  3HOT A;  5JHF A;  3CCE 1;  1K73 1;  3IF8 A;  3CCV Z;  1DGW Y;  1WJ5 A;  1YUK A;  3IAS 2;  2CV2 A;  1JWH C;  4NBH A;  2OTL 1;  3EUA A;  3CCJ Z;  4RLQ A;  2GTI A;  2Q51 A;  2VXZ A;  5FLX b;  2E5N A;  3L2Q A;  4ZTF A;  4BEH A;  1RO0 A;  3OYM A;  2A6T A;  1G59 A;  2KQR A;  4E7J A;  2K5R A;  2MAB A;  2QA4 Z;  3OYJ A;  1VQO Z;  1KQS Z;  1MNE A;  1QYP A;  4XKV A;  2JVG A;  3HOS A;  5IT9 b;  2JNY A;  3TMO A;  2V8J A;  3D5L A;  3S16 I;  3H9J A;  3CCL 1;  4BBS I;  3G6E 1;  3CZ6 A;  3S8P A;  2HVR A;  1K83 I;  4E30 A;  5CM2 M;  3CME 1;  2ZXI A;  2P0W A;  3TL4 X;  1BR1 A;  4LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...