2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
molecule keywords Mercuric transport protein periplasmic component
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
1Y56A 2HU9A 4E6KG
chains in the Genus database with same CATH superfamily
1R1VA 4TNUA 1SFEA 1WJEA 3S1RI 2W48A 1HDDC 3CQZJ 4C2MJ 1W5TA 3AG3H 4HA8A 2Y0SN 1QRYA 4UB8C 1K4SA 5LHHA 2X6XA 3K4JA 2W04A 1TWHI 5ICEA 2D1VA 5A2QZ 2PJPA 2HKOA 3E7LA 3VOEA 2OTJI 3CXCY 3IAS2 5T67A 4PSWA 2DMUA 1VTNC 1VQ6I 2QR1B 3JAMZ 1JJ6C 3CJQB 2XASA 1FEXA 1R9TI 3K1MA 5FFZA 3GTMJ 1XN7A 3ZQHA 1RO0A 2EGTA 2CWEA 2E1OA 3FBNB 2JS4A 4LB6B 5EF6A 1H89C 4MEYF 3CCMZ 1WCMJ 5GAEJ 2VBZA 1IV6A 3J80K 1U2WA 1DU0A 1YYVA 2NS7A 1JHFA 3GBGA 1WGXA 2Y69H 1UAAA 1XTAA 1P7IA 3J81Z 3L2CA 2JVGA 5KCMA 3KFWX 3MWMA 3REOA 3KP6A 5TISC 3J80Z 3OWTA 2NVQI 3KX2A 4E30A 1O3TA 2VQHA 3MZYA 3G6E1 2G2KA 2HR3A 1SAUA 4G12A 1QXFA 1LJ9A 1O7LA 4UVAA 2DA3A 1BA5A 1RUNA 3P7NA 5LFAA 2OOYB 1YIJZ 2QBYB 1WPKA 3LNQA 3S14I 4DW6A 4HDVA 4A5NA 4G7ZF 1ZARA 3CF2A 4MH4A 2MC4A 5D8KB 1E3PA 2HQAA 2KRFA 4A0XA 2BY1A 3RPUA 4EJTA 4A0ZA 4MTDA 1KU7A 3PO3J 3HOZJ 3VYRB 2ELHA 1OYIA 3OYJA 2M8GX 3LAPA 3BG0B 1YFHA 3F3FC 2XB0X 2BHZA 3OS2A 2DLLA 2YU9J 1U8RA 4XSZF 4ZC3A 5K1YA 1N25A 1EA3A 2FNPA 3NH5A 1BW5A 4H0EA 1N2FA 5D5WB 4A3DJ 3HB9A 1ZTRA 4HRIA 4KUMA 2HYGD 1HC8A 3AL0B 4LMYA 2W82A 1IAWA 3CCJI 1W7PB 4XOTA 1MBJA 2F5CA 1F5TA 4RMNA 1YJW1 2FMYA 2STTA 2R7DA 2QENA 4RAZA 1NK2P 2OTL1 2QVOA 1H9TA 2OOXB 3G71I 4WXCA 4NBBA 1T33A 3OYBA 1T56A 1LKXA 2MABA 3H0GI 4S0HB 2IBDA 3OYDA 4RLQA 1BN5A 2RVCA 4PGGA 2HVQA 2CV2A 3DTKA 3NQOA 2FXAA 3M07A 2QQBA 4L0YB 1O3SA 4J00A 3DV8A 4QIWN 2DQLA 3M9AA 4N4OB 1H88C 5B3SH 1IGNA 2RT9A 4LD5A 5LHGA 2HDCA 1R5ID 2JK3A 4NBAA 1R1TA 1TBXA 1ZG3A 3LSTA 2AKLA 3NFZA 1Y1VI 3LA2A 2MBFA 3FXQA 1DQUA 5ILVA 1TQIA 2DFIA 3LMMA 2ZNYA 3BZ6A 2X85A 1U5TA 4XK4A 2E2IJ 4BGDA 4EGZA 1T8IA 4HQEA 1WI3A 3IX0A 2L7ZA 1ETQA 3QPSA 4TV7A 5T6BA 2F48A 2FQ4A 2EB7A 4QPQA 2P4WA 1IRFA 3QQAA 5J47A 4ESJA 2O0YA 2H09A 2A07F 2GLOA 1K79A 2LC2A 4CICA 3S1MI 4F7ZA 2XB5A 5E8GA 1RETA 3LOCA 3GFJA 4V2GA 1Y1VJ 3WG7H 1KU9A 1TWAJ 2GXGA 3I4PA 1BR1A 3HOWI 4W1UA 2HOEA 2XAJA 3E6DA 4KIGA 2TRTA 1S72I 1K7AA 3IL2A 4EWCA 4XRFA 4ESFA 2P3YA 2COBA 2KI7B 1XPXA 3HGYA 3TEDA 2DDBA 2DA2A 2DFFA 3ZGKA 1K78B 1UZCA 3HPGA 4NHJA 4V19K 5FLXZ 1AHDP 2F5FA 4EATA 1XS9A 3E5UA 5DCMA 3GTQI 5J1UA 5E1WA 2HFHA 3GVAA 4XONA 1ZGWA 5DUIA 1Z02A 4J01A 4BQOA 2JR6A 1YW8A 2DDAA 5LBQA 4A3MI 3HOUI 3PNYA 2KT0A 1XGNA 2KRHA 3GKQA 1R49A 5FO5A 1YJ9Z 3FHNA 1I27A 2CQQA 3F8BA 5B5EC 3LSHA 3OL4A 5CVUA 4I6ZA 4ZYGA 1ZLKA 2KDZA 3TW7A 3I07A 1PFTA 2EA2A 1X1CA 3CCS1 3CLQA 3JTHA 1Z03A 1S5LC 2OTJZ 2DE7A 5BMZA 1G3WA 2KZVA 1D5YA 2KKOA 3S16I 3M1CA 3CCEZ 4A0YA 2L9NA 1W0UA 4JQFA 2YU9I 2BV6A 3MONA 3BCBA 3HHGA 2Z33A 1BW6A 1XGSA 3PO3I 1YJ9I 1U5TB 1VQ4I 1MJ9A 1A5JA 5DDGA 2G7HA 2COMA 3FMQA 3HKZA 2M34A 4KIBA 1ETYA 1K8A2 2IA2A 2X6YA 1I6XA 2NXNB 3B6AA 3QOPA 5J3LA 4B3AA 5E17F 3R60A 1R23A 3BY6A 2EFQA 2DA4A 3HM5A 1H0MA 3T8TA 2VT3A 5F0FA 4LLLA 3ULQB 4QPOA 1I3QJ 4RAGA 3FBIB 4HF2A 3WTZA 2Q4ZA 3RKQA 3A01A 1W4MA 2JTVA 3W2WA 2VONA 1ZLJA 1Q822 3DPUA 2O8XA 3BZKA 1BM9A 3HXLA 1FP2A 2VI6A 4BKXA 1E17A 2Y9ZA 2IA0A 3CCYA 2L7FP 3D2LA 2E1MB 5J6XA 3I59A 2O4HA 3IP4B 3GUDA 2MA3A 2K4JA 1SD6A 2IS6A 2FA5A 4XBFA 3S32A 3VYSB 4J19A 4BDYA 2KMUA 4LFUA 3M3YI 2WA0A 2ZXIA 1S6LA 2MYSA 4C9YA 1REPC 2CUZA 4A3FI 5CVIA 2O5RA 3EETA 1ORKA 2E1NA 1Z6TA 1QVTA 1K6YA 3F8NA 5F27A 3CC7I 2F4MA 2CGPA 1Z7UA 2CH0A 4Q5SF 2W03A 5FD6A 5J8CA 4BH9A 4UNOA 4PJMA 1FPQA 1BJAA 3IAM2 4D5FA 4ENMA 4B3XA 2PM9A 1WJBA 5FJ8J 2P8TA 3H3VJ 2HQNA 4L9NA 4OMYA 1VQ7Z 3W2VA 2CV1A 2ADUA 1EKEA 4BJ5C 2VQLA 1VQ7I 3CC21 3TDUC 1F4KA 3I9V2 1VQ81 4A6EA 2XAFA 1YITI 3RQ4A 4IHYA 4N9IA 3BJ6A 4F93B 5L3FA 1J7KA 1VQLI 1NP6A 3VTNA 2UUZA 4N9HA 1XG1A 3H9QA 1Z01A 5JHFA 4NBDA 3QU6A 4G6TB 3CCVZ 5C44I 1IXSB 4UXNA 2KIMA 2QSGX 1VQNZ 1W7PD 1BR2A 3KLOA 5CKTA 3GX4X 1ETVA 5F1JA 3DEUA 3M8EA 2FX0A 1W5CC 5A2Qb 2XGXA 3JAMf 1U6GA 2CFXA 2HPIA 1RNIA 3CJNA 3EPZA 4DZPA 2JA2A 5M5XJ 1JKRC 3U50C 3CPWZ 2Q2EB 3RZOI 1F9NA 3H5RA 4KJZA 1Y1VS 1VQ5Z 3E97A 2IAIA 1RIOH 1KD12 4XQFA 1D0ZA 2BE5F 3DU5A 4CZCA 1W36D 5CVVA 3LQQA 1ZAOA 2NVYI 4ZYEA 1YLFA 1V54H 2JA6I 1IXCA 3I4MI 2F5VA 2R7FA 4RVGA 1IUFA 5K5RA 2OBPA 3EYYA 3K4LA 3RZDJ 3DBLB 3MKYB 4IHXA 3K7AI 2AXTC 2W57A 2JRMA 1TW3A 5EJCA 3S1RJ 2CO5A 3GCFA 3QRFF 3HOYJ 1XGMA 3WHCA 3F8CA 4WCGA 2QYOA 2ZJ2A 3ZQFA 4A93I 3S1QI 2HNHA 3Q0WA 4DIQA 3MZLB 5DV5A 3KPHA 3HOXJ 1P92A 5GAHJ 3WODF 3CD6I 2JRTA 1SEUA 4BBRI 3V4GA 5FROA 3MN2A 5DS9A 1S7AA 1XD7A 2Y9YA 1IO2A 2KP6A 1G2HA 4XLHA 4WWCA 2YPRA 1G59A 1B4AA 3VWBA 5CQEA 1D8JA 3RZDI 1U78A 3GFMA 2RKHA 1LVKA 3G1LA 4YIRX 1XX5A 1LQ1A 2ZAEB 3OV8A 3DPLC 3CCSZ 3R0AA 1P9NA 2XF6A 1IRXA 2PQ8A 4UVBA 1B9MA 1AKHB 1TT5B 2DJIA 1XGOA 3H3UA 3TO7A 4CYCA 2Q0OA 2R7OA 4F55A 5FKMA 5JVTA 3KYLA 2IS1A 3IWZA 3FHZA 4M6VA 3CUQA 1FOKA 1ERDA 4Y7NI 1RESA 4AYBN 2XSJC 3ECOA 1YJN1 4M6YA 4E33A 4UHTA 1FBQA 3J81K 2Z9OA 4XNFA 3KP7A 4YELA 4A3BI 3FM5A 3K70C 2JMWA 3CCQI 1PUFB 3BR5A 1MNEA 2DMTA 5KAIC 2JPCA 4N0BA 3MKZA 3FXLA 1NK3P 2HS5A 3CC71 2OD5A 2R0QC 3AFHA 3ZRGA 4NC8A 3VSLA 5HLGA 3GF2A 3G6EI 3MKWB 3TDHB 4ZZLA 3L7WA 2PMZA 4HYEA 2CW8A 1ON2A 1JT6A 3MKLA 1JJ2Z 3PQKA 1J75A 1MMDA 2EZKA 3O2PE 4ON0A 2V1DA 1APLC 1ZGJA 3FKJA 4RB1A 3K9TA 4NNJA 1XCBA 2NNYA 3CDIA 3I53A 2Q8KA 4FISA 1WJAA 2L7MP 4NB9A 5LHIA 3PQJA 2G7UA 1VQ9I 1ETXA 1KU2A 1J2XA 3IUOA 1XSXA 3MCZA 2N8GA 2XV4S 2RDPA 5IYCJ 1VQN1 5FLXK 3T5XA 4L9TA 2OU2A 2HI3A 4MFEA 2GU2A 2R6MA 2FU4A 2TCTA 1WRJA 5HVQC 4NDLA 4XRSA 3EERA 2K3RA 1RO2A 4A3FJ 4M3FA 4F3QA 3L1PA 3H5AA 2UXNA 4CCMA 2QQAA 4NOZA 4I98B 2IEKA 3RIRA 1D3YA 2WY8Q 4HOBA 1T0FC 3FM3A 3I58A 2A5WA 3WHBA 2GXBA 3WTYC 5D6FA 1BIBA 4A3BJ 4HDUA 1S9HA 3ZR8X 1DGWY 4MEXF 1DGRM 2JPBA 2W25A 3B02A 3AL0C 3EDPA 3O3KA 1WQ2A 3HGGA 3FIWA 3K6GA 1KQ9A 3BG6A 4DZJA 3BR1A 2NVUB 2OJED 2OZKA 3LSRA 1FY7A 4GCVA 2QGUA 3K4KA 1TT0A 3MMYB 3HKZN 2XAHA 2K27A 3F9KA 3BTJA 2KLOA 1GHCA 2XPVA 5CYVA 3H3ZA 4MGRA 2ZMEB 2VPWA 3WE2A 1P4XA 2Z5UA 3VB2A 1Y0NA 2CG4A 1UJ8A 3CCQ1 2TDXA 1Z3XA 5E1XA 2CRGA 2QZ8A 3F3XA 4G7HF 3FMRA 2BW3A 4L9VA 3RPUD 2PMHA 1MZBA 4XOPA 2CFOA 1JKOC 2GA1A 4MONA 3QYBA 3BG9A 3G711 4RVHA 2BEOA 3S1QJ 3NEUA 4AIHA 3HOYI 2KPMA 2QM3A 4BNCA 5ICFA 2DE6A 5LGTA 1AKHA 1YJNZ 2MD0A 3EUKL 1QVFZ 3H35A 4AIJA 2OF7A 3CMYA 3ZQIA 3G2BA 3F23A 3RKXA 1YIJ1 4CHUA 3ZPLA 3F6OA 1XMAA 2OCEA 4RGUA 4A3EJ 2K02A 1RZ4A 2JA6J 3I4MJ 4KT5C 4OAZA 4U0WA 1GV2A 4ASNA 4Y52J 3UNGC 2LH9A 4S04A 2H85A 2MH9A 5DD4A 3ERED 4ZTJA 2GIVA 1YJ91 5FKOA 4IJAA 4HG2A 4A3LJ 2CSOA 2LVSA 3S3NA 1YUAA 4I2OA 3U9GA 3IKVA 1K9M2 1OCOH 2LYCA 5CLSA 3HTUA 2WBMA 4LGWA 1G3SA 3ABTA 1SD4A 5T64A 3S2HI 2XRLA 3GZ5A 1HKQA 3CXCZ 1I1GA 4NC6A 3HOWJ 2LY2A 5E20A 1I6HI 4FTHA 2YR2A 5HLTA 2M7BA 1WH7A 1JUSA 1OCTC 4XLPF 2X4HA 1OCRH 1DPUA 1YQAA 3DWLE 3QAHA 1NJI1 1MJAA 2JWTA 2YX4A 2OCCH 2M4KA 5HLHA 4E6KG 3K4BA 4ITVA 1JXSA 2FRHA 3BP8A 3P9CA 2ZMEA 5F04A 2CMPA 3VB9A 5K5OA 2W1OA 5EEGA 2DMNA 1ITYA 2HVRA 1FP1D 2VJ5A 4ZH4F 3ELKA 2IGNA 3HRSA 3A02A 3CESA 4YRVA 2PMUA 4L0ZB 3M4OJ 3Q0UA 2CUJA 2JIMA 2VJJA 4OU0A 5E8IA 1HW2A 4DYQA 2DT6A 4E4HA 4PCQA 2P7CB 1SMTA 2VN2A 2Z16A 2DMQA 3F72A 2R3SA 1HW5A 2JSPA 3DCFA 3KP3A 1JKQC 2O61A 1K61A 2JIOA 1VQL1 3KP4A 1BOBA 1T08B 4AWXB 5ED4A 3HSEA 3PIOF 1U5TC 2PI0A 4HLYA 4QTTA 3S17I 3K2ZA 2EH3A 1WWXA 4A3GJ 4NC7A 4HF1A 2M2EA 2O6GE 3DLLF 5DM6F 3MAJA 3CC2I 1NG7A 4BS9A 1IN8A 4C30A 3TP0A 3FKII 4B8XA 1XDSA 1WFXA 3BLYA 2K9LA 3H0DA 2ID6A 3Q9SA 3JSPA 2E35A 1P7JA 1GUUA 1LEAA 4JX5A 3JRCA 3F22A 2EIKH 2V9KA 2Y48A 3EUHC 2WV1A 2DPDA 2KIFA 3IV5A 2FJ1A 3S3MA 4A3DI 3HOTA 1I3QI 1VZ0A 2KISA 2WAQN 2EJRA 4GO1A 1Y8CA 4P5OA 1YG2A 4RA2A 3T4NB 2IVMA 4F52A 2R7ZJ 1WI9A 4OAYA 1U9NA 3GXOA 1ZH5A 4EJWA 2X0LA 2OPTA 2LSOA 1VQKI 1MBFA 4LLGF 3GO5A 2DO7A 2JN6A 2GOXB 4KIFA 4CCOA 1R4NB 2H6BA 2JA7J 1MH4A 3HOZI 3FZVA 3QP6A 4BY1J 1U9OA 2E2JJ 3BR2A 2DK5A 1Y1WJ 2CUFA 2X1DA 3G4SI 2JA7I 4M9SA 1BI2A 3CC4I 2RV8A 2DQRA 3IKTA 3ONQA 1G3YA 4JX6A 2DA5A 4I01A 3PUFA 2HOSA 4RGSA 5B1BH 1KD11 3PM1A 5BPIA 2ZSIB 1VQ61 3WTTC 5EG0A 1OJLA 4Z2YA 5BPDA 2GTHA 1MMNA 4BEHB 4EJOA 2LY1A 1F43A 5D1PA 1W2BY 3F3PC 2FBIA 2EPFA 4XLEA 2X51A 3DBHB 3N4MA 2VBWA 2P28A 1YRNA 2FSWA 1XDUA 3KZYA 4JK1X 2NS8A 5KNLA 1LVAA 1A35A 2HTSA 4C3JJ 1PYVA 4C3HJ 5H20A 2FOKA 2L9VA 2OZUA 5D8LB 4ZDLA 1AOYA 3GTQJ 2Z1DA 2BBYA 3CCRZ 4YEJA 3HRUA 4YIFA 3JRFA 5L3BA 1YS7A 4IXAA 5L3CA 2HVSA 2KZGA 1IV8A 3CCLZ 2Y0MA 1CF7A 2CJJA 4HBLA 2QWWA 2RGVA 2P6TA 3Q5FA 1TWHJ 2R7UA 4A3EI 1Q861 1Q811 3A4CA 2V1NA 3GZNB 3G6EZ 4FASD 2Q51A 1ONVA 4HV5A 5CPRB 2MG4A 3JAMK 1IJWC 3CQZI 2Y75A 1MMAA 1VQ4Z 1FBSA 1MGTA 2Z2SB 4CCKA 2F4MB 3S2DJ 2M30A 2NRAC 3X2QH 3BG3A 1LFUP 1KQSY 3W6KB 4Z6YA 4M3BA 3E5XA 4LK1F 1YJNI 2L54A 2HXIA 1Y8RB 5B1AH 1FOXA 4IZZA 3PNVA 2EZHA 3LL7A 4G8XA 4QTUA 1YTYA 2VC1A 4O6JA 4MIMA 2M0MA 5TJJA 3GTJJ 1R36A 4BQNA 1Z7LA 2CQKA 1IDYA 2VQGA 2NVTJ 3TO9A 2GTIA 4XSXF 2L7KA 1CGPA 1I6HJ 3JR9A 3EUAA 4B09A 4DOZA 1HSTA 3C2GA 1UG2A 4BYYA 3LUSA 2DAOA 3JRAA 3DFGA 4FX0A 4I02A 2LBFB 3ABMH 3WTVC 4WXDA 2M45A 1UMQA 1HA8A 3ASOH 4E7JA 1S7OA 3CUQB 4FCYA 2JMOA 4G7OF 1J5YA 1RKWA 1W7PA 2HYFA 3VEPA 1TWCI 1IW7F 3BJOA 1HW1A 3WTXC 2LEXA 2ISZA 1IZ1A 2FBKA 1YHQ1 2VJIA 1PUFA 2A3SA 2LF7A 2X1CA 4U0YA 2DMPA 1S72Z 2R92I 4HZFA 2FE3A 1V5FA 2Q2EA 4B47A 3L2RA 4O3MA 4U7DA 3NAUA 2L9RA 3C2BA 3OOPA 2E7XA 2HQ5A 3COAC 1EF4A 4HPQA 3F0CA 4HNUA 2KIUA 1VQP1 2OZ6A 3CC7Z 5LRRA 5LRSA 1FYMA 2ZB9A 2DA6A 3G1OA 1WSUA 1XB4A 1FC3A 1YOVB 3CMA1 1MNMC 1IN6A 4IHTA 3S8PA 5ERIA 3CCRI 2VBYA 4IEJA 3HJEA 5AONA 1YE9A 1SVMA 3PFIA 1GXPA 2BVMA 2BOLA 3ISPA 2DOEA 4M73A 4ETSA 2R93I 4CCLA 1X58A 3OYAA 3IRRA 1MW7A 2A69F 5EG0B 1LNWA 1JWHC 2OQGA 3AKZA 1TLHB 2JUCA 2XVCA 1YJWI 3GTLI 2WADA 1X4OA 5F6FA 3RKYA 2GWRA 1OR7C 1Z3YA 3HG9A 4CUGA 3HYIA 2DBBA 2F6CA 2DA7A 5F0CA 2NOGA 4PJNA 1WJCA 3FXOA 3QWLA 3OYLA 3N05A 1YW7A 2D2WA 1B72A 4RVDA 3I561 5HDNA 1BOAA 3KP2A 1PDNC 2ESHA 3G71Z 2E7ZA 1OKRA 1N75A 2QLZA 4X6AI 3J80f 5M3MJ 4OIQF 1FBUA 1S7EA 3OYGA 2E19A 2IGOA 3MZKB 3JTGA 1V5EA 1ZB8A 3ZQLA 4MTEA 2HYJA 1VQMI 1TWGJ 2PN6A 4XM3A 3A03A 3TE5B 4V2FA 4B44A 4MNUA 2QLVB 1PP8F 5FLVA 2ZXJA 5IT9b 5E3OA 2ME6A 3OYFA 2R7QA 2VQCA 1TWFI 1X1DA 3ML6A 4YIIA 3TMOA 1M1K2 1QO0D 1RRJA 4RGRA 3GTPJ 4E31A 3H3VK 3HRMA 5KAFC 3NH8A 3HUGA 4X1EA 1B59A 4PFOA 1IN4A 5CJ9A 2XF5A 2CQNA 2M48A 2YX7A 2B0LA 1X3UA 4E2ZA 4ENJA 2QA41 2XKOA 3MVPA 4KN7X 3CC2Z 3V7CA 3FISA 1A6QA 2LD5A 3CCU1 2VOOA 4HNTA 1K9M1 3HOXI 4IVNA 2WC2A 1FYKA 1D0YA 5KK1A 2XGDA 1R00A 3FDYA 3H9JA 5IT3A 4M72A 5EEHA 4A3JI 2W24A 1JGSA 1H9GA 2R7WA 2VLAA 5HS8A 3R6SA 2M6NA 1B8IA 3L2VA 3ZMDA 3JW4A 1FZPB 1LDDA 3I55I 4KT6A 1BBYA 1EV7A 1QZZA 3VMHA 4LOCA 2M0CA 4XKVA 4JX4A 3OYNA 3UKGA 1MBKA 3ZOBA 1M1K1 2E34A 1VQ8Z 1W36C 2Y2ZA 4A3KJ 1M902 1HSJA 2NVYJ 4NB5A 5K5QA 2R5YB 1LFPA 3I59B 5IP7I 3J80b 1W1WE 4FT8A 4XKBA 1H8AC 1TFIA 1TWCJ 1QBJA 2GAUA 3HBLA 2V26A 3QPLA 3ASNH 4EM2A 2HQRA 2W84A 4ZTFA 4RLFA 4C2TA 1QHHD 4A6DA 3CCSI 2HXOA 3Q0VA 3PIPF 2KHMA 2AQFA 2IXSA 4U87A 2EIJH 1IF1A 2EINH 4NH1C 1FIPA 4GFBA 4IPAA 2NAPA 1VQMZ 4RM3A 4DNCA 3QYFA 2GA2A 2XPWA 1L3LA 4RS8A 1N77A 5ICCA 3CCUZ 4NB8A 1HDPA 4LB5A 2ISYA 2ZSHB 3L2WA 3GTJI 3Q9VA 3P5JA 2OAZA 4A3JJ 2YU3A 1QQIA 1XSVA 2M5WA 3E0JB 2VBXA 2ICWG 2VPRA 2A61A 3OR1C 1B1BA 3SZGA 2GM4A 1QU3A 1YITZ 4YG2F 3KP5A 2DT7B 2JA5I 1G3TA 4OOIA 4E32A 4C3IJ 2H8WA 2M87A 2VXDA 1MBHA 4PGHA 1X1PA 1BR4A 2AHQA 2MLKA 3I3LA 4HQMA 1QPMA 3ZP5A 3N97A 1T2KA 4IHWA 1A31A 1JJ8C 5EGOB 1D0XA 2ZFWA 3PNTA 2V79A 1RNLA 2XGCA 2F2EA 4IF4A 1P9QC 6PAXA 1IUYA 2OTJ1 5FB2A 1VQKZ 1V4RA 3I54A 4MHGA 1TWFJ 3IRQA 2EV0A 3O8HA 5HNHA 2VIXA 3K70D 3AAFA 3CZ6A 1LB2A 4ZZDA 3AG4H 2HF1A 1OQYA 2LFBA 3CLOA 1M901 4CDGA 3WTWC 1X3ZA 1VQNI 3SFZA 3V8LA 3GCMA 3W6JB 5FD5A 2QRCB 5GP9A 3WE3A 3G1MA 2DCEA 2MLGA 2B63I 3ZN0A 1R58A 2M7AA 4ZYAA 1LDKB 3CP2A 3OW2Z 3LSKA 1IDZA 1ZB9A 3CCE1 2X6WA 4FQGA 2EILH 1X2NA 2WAQA 4I0BA 2ETHA 2JUBA 1IC8A 3CMAZ 4A3CJ 3GFIA 4M9XA 3NDJA 2YUSA 4FHTA 4KNYA 4UUSA 2NVXJ 4HSTA 2DTZA 1VQK1 3MZHA 3BOQA 2VF1A 3W2AA 3ZXSA 4AYBA 3D0SA 4U0VA 2QKMB 3J7YJ 2BJOA 5IYBJ 1YX5A 3EQLF 2NOJB 2ZJPF 1SIWA 2ELKA 1HCRA 2BYVE 2LDUA 2M4GA 4L5JA 2AS5F 3GTLJ 1KA8A 1R4MB 4OINF 2ID3A 4R8HA 1MKMA 2DYSH 3CDHA 4GRIA 1QPIA 1AA7A 2PJRA 1Y39A 3FXMA 2ESNA 4A69C 4CYDA 3DTEA 2LOOA 2VJ4A 1HKSA 4P9FA 2M9HA 4BY1I 1W2BZ 4GGGA 2BW3B 2RBLA 1ZR2A 1Z6RA 2ELJA 3OR2C 1B8IB 2K9QA 2DODA 3R4KA 5J4YA 2JIRA 3F21A 4KDPA 2NS0A 3WTSC 4C2UA 3H36A 3CCJ1 2R7ZI 3CDLA 1WJ2A 3SDBA 2ZC2A 3I551 2E1MC 2R5ZA 1K8A1 1OYWA 2RQQA 4HW0A 5GAGJ 2X1EA 1QGPA 4BHPA 4XIDA 1ETOA 1GXQA 3OOUA 5IP6A 1K78A 3LSPA 2PX9A 1VQ9Z 2P6SA 4BUPA 3S2WA 2L4AA 2R7TA 4KYWA 3CF5F 2R92J 2HZTA 3PJRA 3CJRB 2R7VA 2IV2X 1ZQ3P 2PEXA 3BTCA 4G6DA 3FKIJ 1Q7Y1 3OMYA 4PJLA 4BY7I 4M3EA 4EQQA 5L3GA 2AO9A 3LA3A 2CUEA 3T0YA 1B6AA 3FXKA 4A3GI 2F4OA 1R5GA 5M3FJ 1R5HA 2EFOA 4E2XA 1E3OC 3H0GJ 2RPRA 2QUFA 1LDJA 3L00A 1KQSZ 1X3WB 3HZJA 3BPXA 5A2QK 1ETWA 4BBSJ 1GDTA 3HUGB 3E6BA 3JRDA 2WWYA 1KRLA 1FLIA 3S1MJ 1NTCA 4BJ6C 2L5QA 2V8IA 2R7XA 4KMFA 4XKCA 2DK8A 1DU6A 2PJRB 4X0GA 4LIVA 3CCVI 1USTA 3L2QA 3SFIA 1N8R1 3J7AO 4QTRA 1BJZA 1O4XA 2CW7A 3SYTA 2BXYA 2FOWA 2DOAA 2RNJA 4D1QA 1YI21 3MFKA 2LRDA 3PL8A 2EA4A 2CYYA 2XKPA 5CVRA 3GTGJ 3FQQA 5IY5H 4MD8A 3MEXA 1VQ6Z 4GYGA 1FT9A 3CUOA 2G9WA 1FOYA 3M8FA 3KCCA 4JYKA 3G3ZA 1ENHA 3WG9A 5IYDJ 1Z67A 2IZ4A 5JVGF 1YRNB 3TQNA 2VXZA 2K9NA 5F08A 4Y13A 4XICA 1B72B 5K7HA 1ACIA 2XAUA 2D1HA 1USPB 1XMKA 2XAQA 1HKTA 4XKWA 3JSOA 1ZREA 1WW9A 2V1UA 1Q7Y2 1N8R2 1GT0C 5JLWA 1X0TA 1DPRA 4IRHA 5D1OA 1WJDA 1MD0A 4F92B 4G9YA 2JIQA 3CMAI 4PUSA 1MSFC 2Y31A 3CCM1 2W4SA 3IHUA 2K5RA 2RHBA 2V3VA 1SAXA 1JTXA 4P1WA 1Y56A 2C6YA 3GTGI 1ODDA 1QNTA 5DEQA 1SVLA 3GTMS 3IH2A 3DF8A 5FLXb 1XCVA 1X2MA 2WB1N 3WU0A 4AVPA 3I71A 4HX8A 2L3DA 4CXFA 1FYLA 2EFNA 5F64A 1S29A 1KQ8A 3E3VA 3J7ZI 1IG7A 3DQVC 1ETKA 1E3HA 2QBYA 1YHQI 1N78A 2FF4A 4WXHA 5JLXA 2IS4A 3AG2H 5AIPA 2CS3A 4DK1A 2QRDB 5AN9F 2A5YB 1KONA 2E2II 4MQ9F 1P4AA 2QCOA 1D1CA 3VPRA 2V6CA 1FIAA 1T6SA 2EZLA 2OC6A 4HX4A 2VL8A 2EQRA 4XORA 4Q47A 1VQOZ 2V9VA 1FSHA 1WVRA 2W7NA 1VQLZ 3HSRA 2HOAA 4OMZA 5H6QA 2Z3YA 3FX3A 1C0WA 4NBGA 1NG6A 4HGZA 2XDVA 3GTKI 3CMEI 2VC0A 4IOAF 2PG4A 5E3LA 3J81f 2NVQJ 3O6BB 2DE5A 3FXRA 3JREA 2MH2A 4O5VA 2IGMA 4H4KC 5LD2C 3BR3A 1AWCA 5FKNA 4L5IA 1WZ2A 3ZCOA 4DBRA 4BY7J 3CCUI 2NVXI 1QHGA 3TP3A 4RAYA 4BHCA 3KE2A 5LLQA 1HF0A 1RO4A 1OPCA 2KPIA 3CCJZ 1PVEA 3LQRA 3TDZC 1X1AA 1ZG1A 1KYZA 5DCMB 4EV0A 3OL3A 3ZQGA 4DQ2A 1Z05A 3HOSA 5LGNA 3RI4A 2NYXA 2A6TA 4NUBA 5JHUA 3KETA 4MRIA 3GTMI 4ANJA 1NUIA 4I76A 3IH4A 2P81A 5FLXf 3BQZA 4UUVA 4HH4A 2XRNA 1P6RA 4XRSG 2ZO4A 1ZH1A 1WIIA 3K1PA 1WJ5A 1Q821 4RAFA 3U1DA 2ZJQF 1JKPC 5E3NA 2BHYA 4DQYB 3M4OI 5EEAA 3QYEA 1R1UA 2LNBA 2LTPA 1UB9A 5KVRA 1K83I 3BG1B 1T39A 3J7A4 2EV5A 5BQTA 3QP5A 2OQRA 4N4NB 1I3AA 2E5ZA 3RJPA 3LSJA 5DD8A 3K4MA 1R6RA 2GBYA 4GXOA 1R71A 4LG3A 2M8EA 2IZ3A 3GEZA 2VOPA 2R5ZB 2L01A 2M1BA 5GTIC 2HDDA 1DL6A 3BR0A 4YFNF 4IHSA 3M1EA 5ICGA 2QF7A 3ZQQA 1YIT1 4KFCA 4XR6A 2E1CA 2K4BA 2R5YA 3TO6A 5IOYA 4BACA 2LBFA 4UUTA 3W3CA 1AU7A 1Z21A 2WV0A 1RC9A 3JAMb 3CC41 3H9GA 2RC4A 1WCMI 3LSGA 4I09A 2YSRA 4E7KA 4ESBA 1DP3A 1RLYA 3DPTA 2B63J 1MIJA 2BY2A 2L9SA 1TC3C 3LSIA 4D0PA 4Y3OA 2LKPA 4DGWB 3PO3S 2I8DA 4A5MA 3QPTA 1YI2Z 2GOMA 5IP7J 2QKLB 4G6QA 1QYPA 2MD5A 4NBHA 4Y52I 1JUPA 3LA7A 5JI6A 4EJVA 4LLNA 3RSNA 3IFUA 3KEYA 4S05A 4A3KI 2LK2A 1VQPI 1D1BA 2ZKZA 4IL6C 1VQ51 4HV6A 4E7LA 4MD7A 5DTDA 4AIKA 4BHBA 4XL9A 4HSRA 1JT0A 3FXJA 3P5JB 3HIFA 3E5QA 1KQ0A 4RB0A 5FRMA 1FMVA 2EV6A 1RR7A 5FKKA 5FLMI 4CCNA 3ZQ7A 3CO6C 4W97A 4MO7A 5DUKA 2V45A 1YO5C 3E6CC 2LMDA 1OCPA 4WF2A 2LP0A 1BIAA 3BG7A 1G4DA 1GLNA 3K7AJ 3KEOA 1SANA 3TOAA 4ENNA 5CQGA 4I0AA 5B66C 5J1YA 2E71A 1U3EM 3ROUA 4Y4RA 3OYMA 1D1AA 1Z77A 3PFYA 4PJJA 1OLTA 4II3A 4KITB 2IP2A 1J59A 2CQ7A 3QODA 4XN0A 3DU6A 2QA4Z 4Q48A 4OWRB 1Q1HA 4EMSA 1WHUA 4UVCA 1TQPA 5JFRA 2E9HA 1VQ91 2L4MA 3SEQA 5F0HA 4RDUA 4NBEA 5ILUA 1BI3A 3WGIA 2JVHA 4IRGA 2A05A 4QLCU 4M6XA 2P7VB 2K7LA 2L0KA 1UHSA 3HPHA 4NQWB 4P9UA 1Z1DA 1KC81 1SD5A 1Z0XA 3KEQA 2KJCA 3CMMA 3HHHA 2CU7A 4BXFA 3VYUB 2E2HI 1KC82 2X9DA 3BTLA 3HSFA 2KRCA 1OCZH 3VFZA 3H92A 3K0LA 2F4OB 1G6NA 4E7ZA 1OCCH 1RKTA 4BDZA 3GW2A 3E1SA 4M9ZA 3HOVJ 2ZFUA 2A68F 3KZIC 3PUBA 1OISA 1X3WA 3K69A 2BY0A 2VKVA 4HF0A 3IR7A 1MMGA 2DOFA 2EFPA 1P4WA 3VODA 4D5CA 4RB3C 4AUXA 3B6CA 4BXUA 2QSHX 2KL4A 1KYWA 1CF7B 4NBFA 5IP9I 2NAZA 3OS1A 4D7NA 5IT9f 1ZN2A 2PFBA 5LEJA 2L02A 1ULYA 4PJ0C 5ILSA 1ZYRF 4JP0A 1U0JA 2KDOA 5GTHC 1MH3A 2EK5A 3ESWA 4CL1A 5IT9K 2JT1A 4LK0F 5D4RA 4D7MA 2AXLA 3GFLA 2O3FA 4K2EA 4RVFA 1SFXA 2VASA 3GTPI 1ML8A 2FEZA 3A1YA 2B9SA 1JTYA 4PFPA 2P0WA 3GLXA 1I5ZA 5J40A 3U2RA 5C4JI 4LITA 2H6CA 3OW2Y 3DLAA 4BAYA 1TWGI 1LFBA 5HODA 3A0BC 2HU9A 4EJUA 3MD2A 3LFKA 2R4GA 1MDMA 4LJZF 1YUKA 2UXXA 3HTSB 5HDKA 4WK8F 1ZRFA 1FX7A 3SXYA 2E2HJ 2CV0A 1LUJB 2QSFX 5D1OB 4XRMA 4B48A 2STWA 1JUMA 2JUGA 2FD5A 5IT9Z 1W5SA 1JGGA 2HZDA 3OYEA 3S1NI 2Q1ZB 4XMYA 3I4NI 3GZ6A 3U21A 2VUMI 1DDNA 3H5NA 1I1SA 3M7GA 1UHWA 3GTKJ 1UFMA 1UCRA 1VQ5I 2V4JC 4DBQA 3TBIA 3BG5A 1WH5A 2W00A 3FK7A 1AA6A 3BZCA 2XF7A 5EYRA 3TL4X 5DM7F 4XLFA 3TKYA 1TL8A 2WY7Q 5E79C 3PSIA 2IGKA 4BE0A 2R93J 2XUBA 1RUOA 2UV1A 1A6IA 4OIOF 3HEFA 1QVUA 2QEXZ 3S16J 3ABUA 4PDKA 3GTOI 5HOOA 2MFZA 2VE9A 4Y15A 1L0OC 1BL0A 1VQO1 3I64A 2V1XA 4ZJZA 2JIPA 4A3IJ 2IJLA 1QVGZ 1T0FA 2K40A 2ZXWH 3CUQC 3O8GA 2OTLI 5L3DA 2J5PA 2V9PA 3K4NA 5E1ZB 1JHHA 3V7RA 2IPQX 2EFWA 2UWMA 1Q862 4NBCA 4E70A 3P9KA 4XN3A 3T1BA 2H94A 3G73A 1ZR4A 2HPMA 3OSFA 1HLVA 4KMUX 1XMXA 5J1RA 4CYCB 4UY8I 1XC5A 1FOWA 3BQYA 2O7OA 3VYTB 1SFOJ 3CCV1 4MQVA 3ZMUA 1K731 1VQ71 1V3FA 1R22A 5FGMA 3FMSA 3KLNA 2BXZA 1VQ41 3NWSA 3R0JA 2DPUA 1G8XA 3OS0A 1VLAA 4BL0B 4CGZA 3ZMVA 2OA4A 1Y0UA 3M8JA 1WZNA 3CD61 1TW2A 3OSGA 3EEDA 3P9IA 1O57A 3C1DA 4Q4ZF 2D45A 1ON1A 3VSKA 3BROA 1XSDA 4R1HA 3ABKH 2V8KA 1TP4A 3FQMA 1EH7A 3LAJA 3A2KA 3IWFA 4UUSB 1YW9A 5GPAA 4F91B 3V7SA 2Y30A 2XSDC 3RCOA 1Q1VA 1ZRDA 3TOBA 2A6HF 4Y33A 2V6EA 5FKLA 5DYMA 3DP7A 4P55A 1I50I 2RIQA 1I39A 4B4CA 1HQCA 1PP7U 3GYHX 3NDIA 2H1KA 1K732 4MLOA 3SZPA 2PBIA 3SDGA 2LF8A 1FMWA 2V7FA 4PZJA 4BU2A 4RBOA 3IF8A 2I10A 1USSA 3ERMA 2LY9A 1E0EA 1X1BA 1Y1WI 1SVOA 2E2JI 1FDOA 1KZHA 3MZ8A 2R7RA 3RTRA 4M74A 4AU7A 1J9IA 1BC7C 4FE7A 1YIJI 5LL6f 4AC0A 1QA6A 2XPUA 3RYRA 2EIMH 4HLXA 3RDIA 2GZWA 2ZCWA 3KIOA 1Y6IA 1OYYA 1SFKA 4CZZA 3PO2I 2DI3A 3BCAA 2IT0A 5IPAA 3CCQZ 1A04A 1YI2I 3I56Z 2DXIA 2E7WA 1GVDA 4FETA 2Z99A 3EYIA 3TGNA 5GADJ 3CO7C 2MSYA 3M3YJ 5D5VB 1NHAA 1OMIA 3LSMA 3ZMZA 4II2A 3CP8A 3JCUC 2K3FA 3ABLH 4AM3A 2PK7A 3KIFA 2X48A 2B7EA 3DXJF 3E6MA 2K5CA 3QWUA 1EH6A 2ECBA 4WX9A 1T98A 1Z91A 2RREA 4U88A 4IX7A 1S3JA 4DYRA 3OYKA 4EGYA 2HGCA 4BJTA 3H1CA 1TNTA 4B1RA 4RB2C 4ZYDA 1FJLA 1FTTA 2FQ3A 2HTJA 3OYIA 3K1NA 5F1RA 1ZELA 2K86A 5EZGA 2YS9A 3S17J 1MBGA 2LREA 3CJTB 5LEKA 1BC8C 3BPVA 2ACJA 1JI8A 4E2WA 1S8NA 4IOCF 4D9JA 2ZNZA 5DCFA 1E2XA 4KA4A 2VKHA 2XAGA 1GVJA 3HC7A 2A6EF 3FK6A 1MNDA 3SZTA 1WKMA 1VF9A 4BE2A 1SFUA 1RR8C 3CD6Z 2FUG2 4UV8A 1R7JA 5EZHA 2ME0A 5E18F 1ZG5A 4OIPF 1P2FA 3PSFA 2GQQA 2VUGA 3C3WA 2LKXA 1CQTA 3HL2A 4YFKF 4XX2A 5HLIA 2IW5A 3V8JA 3S14J 3R61A 4XLNF 1LEBA 2QEX1 3OYHA 2V8JA 2DFHA 2BVLA 1DUXC 5L3EA 1S721 1D8KA 2H1LA 1MBEA 3C18A 4ZYHA 5J4VA 2RN7A 1UHMA 1QF8A 2VODA 3U1KA 2HDWA 4ZDPA 3CME1 1QZEA 1Q812 3D5SC 3Q87A 3BT9A 3BC8A 1BI0A 3F8FA 5EGOA 3KYDB 3KZZA 1FWZA 5J8FA 3HOUJ 4A3MJ 1MDMB 4A3CI 2PMZN 3I5UA 3S2HJ 4HNVA 2ZBKA 5KHDA 4QWQA 2OV7A 1OR7A 4RM2A 3BR6A 3TW6A 2JQ7A 2P5VA 4A2UA 2VE8A 2CQXA 3K4CA 4XLCA 2ZXHA 1HOMA 3DKWA 2VPZA 4HAMA 3PO2J 3K2AA 4MD9A 4Y17A 5HS7A 5GPCA 3QPHA 5H6RA 4DYCA 3CMEZ 1YX3A 3CTAA 3FF5A 1DP7P 9ANTA 4NFRA 1IRZA 4M3GA 1NH3A 3HDDA 1S7MA 1TWAI 1RPWA 3K10A 3JRIA 3RQIA 4IKFA 2K85A 4E2YA 3G4SZ 2BY3A 2DW4A 5HS9A 2EBIA 1Q16A 3LFUA 1MMSA 4QSHA 3MQ0A 2DTRA 1YIOA 3QOEA 4HEA2 2G0EA 2JA5J 2LIYA 4A3II 2K3PA 2KQRA 1RI7A 5C3EI 1FNNA 2QQ8A 1LE8A 2OTLZ 5BOXA 1T95A 1I50J 5BNGA 2M3AA 1TNSA 1ZHFA 2I3CA 2AQEA 4MXUA 1X4PA 2JA8I 1Z9CA 1IXRC 1KU3A 3IC7A 2VPLA 4BBSI 4XLAA 3JRGA 4BEHA 2H8RA 4IO9F 3BWGA 4P96A 2MC3A 3D5LA 3DBRB 1JE8A 3W6VA 3NWTA 2RQPA 4E7IA 3S15I 2BGCA 4YFXF 2F5EA 2WAEA 1L1OC 2VUMJ 1ZGAA 4CCJA 5D6EA 3I4NJ 2E60A 5JR3A 1ZRCA 4A3LI 3S1NJ 2XHKA 5CM2M 2KIQA 1SFOI 2ECCA 4AVZA 2XIGA 4CSWA 2J6AA 4L5EA 1PJRA 1WJFA 2HWVA 3IH3A 4CO8A 3BDDA 2QREB 1PUEE 1U8BA 2JZYA 1HXDA 3NH4A 2E36A 3D6WA 3KYCB 2O53A 2VB6A 2JSCA 2KJBA 1FDIA 3WU2C 2EWNA 4U7BA 1K4TA 3T8RA 3B73A 2DN0A 4A12A 1O7FA 3C7JA 4RGXA 3JRBA 5M5WJ 1Y8QB 2LG4A 2W85A 4I99C 2QKDA 2OUMA 2ZJRF 3F6VA 2JNYA 5CVJA 3CCMI 1OFCX 3DKYA 4PSXA 4R79A 2XROA 1VQM1 3GTOJ 5FFXA 4IQJA 3LWFA 3VMIA 4PK4A 2VT2A 2HOTA 5C4XJ 2LR8A 1W0TA 2XGEA 1LE8B 4ABZA 1MJBA 3CCEI 4E7HA 4BXXJ 3WU1B 2DJNA 2KFDA 2IRFG 2FBHA 1JJ2Y 4JBAA 2P5KA 4M3DA 3I56I 1SMYF 1UG0A 1VNDA 1M1EB 3V8KA 3S93A 5K7ZA 2MW8A 3NARA 2BZTA 2WAFA 2HEOA 5TGTA 3GLLA 2GXAA 5IOZA 1KGSA 1O3RA 2R7SA 2J5OA 4ZDOA 2FMLA 2LKSA 3WGHA 4NBQA 1SD7A 5AIQA 1VQ8I 3Q3SA 1X3ZB 3HOVI 2MGQA 3V42A 2K9MA 3A01B 2I5UA 1T38A 2GIZA 4L18B 3L9FA 4LIUA 3I55Z 4CH7A 4X6AJ 3S3OA 3CCL1 2CW0F 1X19A 4EM1A 3D5RC 1TTYA 3FWEA 3ZMSA 4NQWA 1B9NA 4RS4A 4UB6C 4LG0B 2L2OA 2D5VA 3QU3A 1ZKGA 1FTZA 1USPA 5BS6A 2PLYA 4IRIA 3CCR1 2IA1A 3ZMTA 3BJAA 2F4IA 3OYCA 5HNFA 1VFCA 3VDXA 1J09A 5E3MA 5FRNA 1R9TJ 1TZLA 3ZQCA 2XC7A 2IS2A 4IQ4A 5M5YJ 5C4JJ 1IN7A 3VMGA 2QQ9A 2VPXA 2O9LA 2VPYA 4UV9A 1F1ZA 1FSEA 3DTIA 1RQFA 3F8MA 4EM0B 2P5LC 4KICA 3J7AY 4E7SA 3L2UA 3RPQA 4FX4A 3C2HA 3RYPA 4BQAA 2DA1A 2RNGA 3FXUA 3NRVA 2DFEA 1IRGA 2DT5A 3OIPA 4ENKA 5D4SA 4EEFG 2JJ7A 2LFUA 2YADA 3L09A 3JRHA 4BXXI 2NNNA 4BQQA 2RAEA 1EJ9A 5C4XI 2Y0SA 3CC4Z 3SJMA 1D5VA 3ESWB 3DEEA 3KIHA 4JOMA 4L9JA 5IP9J 1V55H 4OIRF 3OIOA 2ZMEC 4RV9A 4A93J 4IHVA 2DYRH 2EZIA 4CA0A 1TQMA 3I0TA 1BI1A 4AD9A 4AIDA 4EVIA 1V5GA 1VI0A 4KN4X 3A0HC 3OY9A 2AYDA 3RKWA 2WB1A 4DJAA 2VKDA 2FNAA 5TRDA 1UELB 3SQNA 1K6OA 2F5DA 1EH8A 3BTIA 3ZN1A 2VKEA 3GMEA 1O3QA 5LGUA 2QEXI 4I7HA 1VQOI 1A36A 1VQPZ 3DEWA 4M71A 3DKXA 2QA4I 4Y7NJ 1IN5A 3D9XA 4MFDA 1MSEC 1LQLA 1YJWZ 2X6OA 3GWZA 3RZOJ 3G4S1 4GDFA 3J81b 5A2Qf 3WGGA 2K9SA 2O03A 3S15J 5EDNA 1SC7A 1POGA 1YHQZ 1ZK8A 2E5NA 2H27A 4FE4A 5C44J 4G94A 4LG0A 4HGYA 2DU9A 3ECHA 3HRTA 2JA8J 1GV5A 2NVTI 4HX7A 1LPQA 1QZYA 3CPWY 2HKXA 1STZA 4GYIA 4DGLA 1NJI2 3UR3C 1HBXG 3EUHA 2UZKA 1QVFY 5HDGA 3WTUC 1F36A 2LLKA 4BBRJ 2WTEA 5K7FA 1QVGY 5H2FC 4BE1A 3SEZA 4B43A 5C3EJ 5FLMJ 5D5UB 2O8KA 4KISA 3SHFA 1YS6A 1J0RA 3CCLI 3AG1H 3D1NI 3S2DI 4S1TA 3OIQA 1K83J 5D5XB
chains in the Genus database with same CATH topology
2HZDA 3OYEA 1BR4A 1WJEA 3BG6A 3I3LA 4TNUA 2Q1ZB 3S1RI 3S1NI 4XMYA 2OZKA 3I4NI 3U21A 1D0XA 1TT0A 3K4KA 3PNTA 2VUMI 3MMYB 3H5NA 1P9QC 2X6XA 3K4JA 2OTJ1 1TWHI 1VQKZ 2V4JC 3F9KA 4DBQA 2KLOA 3TBIA 2W00A 3CXCY 3IAS2 5T67A 4PSWA 5HNHA 3K70D 2VIXA 2XF7A 3TL4X 2QR1B 3CZ6A 4XLFA 2WY7Q 3CJQB 2HF1A 1M901 3PSIA 2IGKA 1X3ZA 1R9TI 4BE0A 2QRCB 3CCQ1 2UV1A 1RO0A 2EGTA 2DCEA 3FBNB 1Z3XA 2JS4A 2B63I 2M7AA 4ZYAA 1LDKB 3CP2A 2BW3A 3CCMZ 3RPUD 3LSKA 3OW2Z 1ZB9A 3CCE1 2QEXZ 2X6WA 4XOPA 2CFOA 2WAQA 3GTOI 4MONA 3QYBA 5HOOA 2JUBA 2MFZA 3G711 4RVHA 3CMAZ 1VQO1 4ZJZA 3NDJA 3GBGA 1UAAA 1QVGZ 4HSTA 1VQK1 3HOYI 2KPMA 2DE6A 2VF1A 3W2AA 2JVGA 5KCMA 3ZXSA 4AYBA 1YJNZ 3K4NA 2MD0A 3EUKL 1QVFZ 3H35A 2QKMB 3OWTA 2UWMA 1Q862 3KX2A 2NVQI 4NBCA 3G2BA 4E30A 4XN3A 2VQHA 2BJOA 3G6E1 1YX5A 1YIJ1 2G2KA 2NOJB 2HPMA 1SAUA 2M4GA 4OAZA 5LFAA 2OOYB 1YIJZ 3S14I 2PJRA 4GRIA 1AA7A 3VYTB 3UNGC 2LH9A 4MH4A 3CF2A 2H85A 2MC4A 3CCV1 1K731 1VQ71 2HQAA 4ZTJA 1VQ41 1YJ91 3DTEA 3NWSA 1G8XA 3OS0A 2LOOA 2VJ4A 4HG2A 4BL0B 1VLAA 4BY1I 3S3NA 1YUAA 3M8JA 2RBLA 2BW3B 3VYRB 1W2BZ 3CD61 3OYJA 3BG0B 3EEDA 3F3FC 1K9M2 2LYCA 3OS2A 2ELJA 3OR2C 3VSKA 2WBMA 2V8KA 3FQMA 4ZC3A 4C2UA 3A2KA 5T64A 2R7ZI 3CXCZ 3CCJ1 3S2HI 1EA3A 3SDBA 1I6HI 2LY2A 4F91B 3NH5A 5HLTA 2E1MC 3RCOA 1N2FA 3I551 1K8A1 2RQQA 2M7BA 4HRIA 2X1EA 3AL0B 2W82A 4Y33A 2V6EA 4XOTA 3DWLE 3OOUA 1I50I 2RIQA 1YJW1 4RMNA 1NJI1 1VQ9Z 2M4KA 4BUPA 4E6KG 3K4BA 2OTL1 4ITVA 2R7TA 3NDIA 3PJRA 2OOXB 3CJRB 2R7VA 1K732 4MLOA 2CMPA 3VB9A 1Q7Y1 4NBBA 3OMYA 2W1OA 4PJLA 3OYBA 4BY7I 1FMWA 1LKXA 2V7FA 4BU2A 2HVRA 2MABA 2VJ5A 3IF8A 1E0EA 1X1BA 1Y1WI 3OYDA 2IGNA 4RLQA 4A3GI 2CV2A 2HVQA 2E2JI 3CESA 4YRVA 2F4OA 2R7RA 1VQNZ 3DTKA 2CUJA 2VJJA 3RTRA 2W04A 4E4HA 2DT6A 4AU7A 4J00A 4N4OB 2Z16A 2RPRA 5LL6f 2RT9A 3CCSZ 2JSPA 1KQSZ 4NBAA 2AKLA 3NFZA 1VQL1 1BOBA 1Y6IA 4QTTA 3S17I 1SFKA 3PO2I 3CCQZ 3BCAA 1Y1VI 1DQUA 3I56Z 4NC7A 2DXIA 3GTKI 3HUGB 1KRLA 3LMMA 4FETA 3VMHA 2X85A 4BGDA 1NG7A 4BS9A 3LSMA 4BJ6C 2L5QA 2V8IA 3IX0A 4C30A 2R7XA 4II2A 3FKII 3CP8A 5T6BA 4XKCA 3BLYA 1WFXA 2K9LA 4QPQA 3H0DA 2PK7A 4E2XA 3KIFA 3QWUA 2K5CA 2PJRB 4X0GA 4LIVA 2RREA 4IX7A 3L2QA 3OYKA 1N8R1 2V9KA 4BJTA 2LC2A 3S1MI 2CW7A 3EUHC 3SYTA 1YI21 4D1QA 2DOAA 2LRDA 3PL8A 3FQQA 3OYIA 3S3MA 1ZELA 3HOTA 1I3QI 4MD8A 1VZ0A 4A3DI 1VQ6Z 1BR1A 4P5OA 3T4NB 3HOWI 2LREA 4F52A 4OAYA 1JI8A 4E2WA 4D9JA 4EWCA 2IZ4A 2P3YA 2KI7B 3H0GI 2GOXB 2VKHA 2VXZA 4CCOA 3ZGKA 2XAUA 3HC7A 3HPGA 1MNDA 3OIQA 4BE2A 1USPB 3CD6Z 3HOZI 2FUG2 4XKWA 1WW9A 4EATA 2X1DA 3PSFA 1Q7Y2 1N8R2 3GTQI 1X0TA 2VUGA 2JA7I 5D1OA 3HL2A 1WJDA 4XONA 4XX2A 3ONQA 4F92B 2QEX1 4PUSA 3OYHA 2V8JA 1Z02A 4J01A 4BQOA 2JR6A 2W4SA 2BVLA 3CCM1 1S721 1KD11 2K5RA 2ZSIB 2RHBA 4A3MI 1VQ61 3PNYA 3HOUI 4P1WA 1Y56A 2KRHA 2GTHA 1QF8A 1MMNA 3GKQA 2HDWA 4BEHB 4ZDPA 2LY1A 3CME1 3GTGI 3GTMS 1YJ9Z 3FHNA 5D1PA 1Q812 1W2BY 3D5SC 3F3PC 3Q87A 3BC8A 3LSHA 3OL4A 4XLEA 2X51A 5FLXb 2P28A 3I07A 3DQVC 1PFTA 4A3CI 1X1CA 3CCS1 1Z03A 2OTJZ 2DE7A 1N78A 2KZVA 5KNLA 2IS4A 3S16I 3M1CA 1PYVA 2CS3A 5KHDA 3CCEZ 4DK1A 2L9NA 2OV7A 4JQFA 2QRDB 3MONA 4ZDLA 5AN9F 3BCBA 2YU9I 1KONA 2E2II 4RM2A 2Z1DA 1D1CA 3CCRZ 3PO3I 4YEJA 2OC6A 3K4CA 2VL8A 4XLCA 2ZXHA 4XORA 4MD9A 1VQOZ 2HVSA 3HKZA 2W7NA 3CMEZ 1K8A2 3CCLZ 1VQLZ 1YX3A 2X6YA 4NFRA 2R7UA 4A3EI 4NBGA 1NG6A 4HGZA 2XDVA 1Q811 3A4CA 2V1NA 1Q861 1S7MA 1TWAI 4QPOA 3G6EZ 4FASD 3K10A 4IKFA 4E2YA 3G4SZ 3FBIB 2Q51A 3J81f 2DE5A 5CPRB 2Q4ZA 3CQZI 3W2WA 1MMAA 2IGMA 3DPUA 4H4KC 3LFUA 4CCKA 2Z2SB 5LD2C 1Q822 1VQ4Z 3ZCOA 4DBRA 3QOEA 4HEA2 2NVXI 3HXLA 1QHGA 2LIYA 4A3II 1KQSY 2K3PA 2KQRA 5C3EI 1RO4A 2E1MB 2KPIA 3CCJZ 2O4HA 3IP4B 4IZZA 1X1AA 1TWFI 2OTLZ 3PNVA 1T95A 2IS6A 3LL7A 3OL3A 3S32A 3VYSB 4QTUA 2M3AA 4BDYA 2KMUA 2M0MA 3M3YI 3HOSA 2WA0A 2MYSA 2ZXIA 4BQNA 4C9YA 2A6TA 1Z7LA 2CUZA 4NUBA 4MRIA 4A3FI 3GTMI 4ANJA 2I3CA 2AQEA 2VQGA 1NUIA 4MXUA 2O5RA 1X4PA 2JA8I 2VPLA 4BBSI 2GTIA 4XLAA 2L7KA 4BEHA 1K6YA 5FLXf 3EUAA 3D5LA 4DOZA 3C2GA 2F4MA 3LUSA 4HH4A 3NWTA 1ZH1A 2LBFB 4E7IA 1WIIA 2CH0A 1WJ5A 1HA8A 1Q821 4E7JA 2W03A 3S15I 2WAEA 1L1OC 4PJMA 4CCJA 2JMOA 4DQYB 3IAM2 3M4OI 3QYEA 2E60A 4A3LI 4B3XA 2PM9A 1TWCI 1WJBA 3H3VJ 5CM2M 1K83I 3BG1B 3W2VA 1VQ7Z 1SFOI 3J7A4 2CV1A 4AVZA 4BJ5C 2VQLA 4CSWA 2J6AA 4N4NB 1YHQ1 1PJRA 1WJFA 2E5ZA 2VJIA 3CC21 2X1CA 2QREB 1S72Z 3I9V2 1VQ81 2R92I 3NH4A 3D6WA 1V5FA 1R6RA 3K4MA 4B47A 3L2RA 4LG3A 2O53A 2VB6A 2IZ3A 3RQ4A 4U7BA 4HPQA 4HNUA 1VQP1 4F93B 1NP6A 3VTNA 3CC7Z 2UUZA 2LG4A 2QKDA 1DL6A 3H9QA 1Z01A 3ZQQA 2OUMA 5JHFA 1YIT1 2JNYA 4NBDA 4XR6A 3DKYA 4G6TB 4PSXA 4R79A 1VQM1 3CCVZ 3CMA1 5C44I 4BACA 2LBFA 3S8PA 3W3CA 4IQJA 1Z21A 3VMIA 4PK4A 1YE9A 3JAMb 3CC41 3H9GA 1BR2A 2BVMA 5CKTA 3LSGA 2BOLA 4E7KA 1WCMI 4E7HA 1DP3A 1RLYA 3DPTA 5A2Qb 3JAMf 2L9SA 2HPIA 3LSIA 1RNIA 3EPZA 3CPWZ 2JA2A 4CCLA 4Y3OA 3OYAA 3U50C 2Q2EB 1MW7A 1JJ2Y 2R93I 3H5RA 4KJZA 4DGWB 1Y1VS 2I8DA 3PO3S 1YI2Z 1UG0A 2GOMA 1VQ5Z 1JWHC 1KD12 3S93A 2QKLB 4XQFA 1QYPA 4Y52I 4NBHA 1D0ZA 1W36D 3DU5A 4CZCA 3AKZA 2WAFA 5TGTA 3GTLI 2WADA 2NVYI 3RSNA 3IFUA 3KEYA 3I4MI 2JA6I 4A3KI 1X4OA 1D1BA 2F5VA 4RVGA 1OR7C 1Z3YA 2R7SA 1VQ51 3HG9A 3K4LA 4CUGA 4ZDOA 3MKYB 4E7LA 4MD7A 2F6CA 3K7AI 4PJNA 1WJCA 4XL9A 4HSRA 3OYLA 3GCFA 3HOVI 3P5JB 3N05A 3V42A 2K9MA 5FRMA 1FMVA 4RVDA 3I561 4LIUA 3I55Z 4CH7A 4A93I 3S1QI 2HNHA 3S3OA 5FLMI 3CCL1 4CCNA 1X19A 4DIQA 3MZLB 3G71Z 3D5RC 1N75A 4X6AI 3J80f 3OYGA 4RS4A 4BBRI 2IGOA 2L2OA 5FROA 3MZKB 1USPA 1V5EA 1ZB8A 3CCR1 2F4IA 3BG7A 3OYCA 5HNFA 3VDXA 1J09A 2KP6A 1GLNA 4XLHA 4XM3A 1G59A 5FRNA 2IS2A 1TZLA 3TE5B 2XC7A 3VWBA 4IQ4A 5CQEA 5CQGA 4B44A 2QLVB 3RZDI 5IT9b 1LVKA 4Y4RA 3OYMA 1D1AA 2ZAEB 3VMGA 3OYFA 3PFYA 2R7QA 3DPLC 2VQCA 1OLTA 3DTIA 4PJJA 1X1DA 1RQFA 1P9NA 4II3A 2XF6A 1IRXA 4KITB 3TMOA 3J7AY 4E7SA 1M1K2 3QODA 3L2UA 4XN0A 2DJIA 3C2HA 3DU6A 4E31A 2QA4Z 4OWRB 2R7OA 2RNGA 4F55A 3KYLA 3NH8A 2IS1A 2E9HA 3OIPA 1VQ91 3SEQA 2LFUA 4NBEA 1ERDA 2JVHA 4PFOA 2M48A 2XF5A 2YADA 4Y7NI 2XSJC 1YJN1 4E2ZA 4E33A 4BXXI 3HPHA 4NQWB 4BQQA 2QA41 3CC2Z 5C4XI 2Y0SA 1KC81 3CC4Z 3CCU1 4XNFA 3DEEA 3CMMA 4HNTA 3KIHA 4BXFA 4JOMA 3VYUB 4YELA 1K9M1 3HOXI 1KC82 2E2HI 4A3BI 2KRCA 3K70C 4RV9A 1D0YA 3FDYA 3H9JA 4A3JI 4CA0A 4E7ZA 1MNEA 3MKZA 2R7WA 4BDZA 2VLAA 3CC71 3E1SA 2M6NA 3L2VA 3AFHA 1V5GA 2ZFUA 3ZRGA 4NC8A 3VSLA 3PUBA 3OY9A 4KT6A 1X3WA 2WB1A 3MKWB 4DJAA 3TDHB 2VKDA 1MMGA 4XKVA 3OYNA 1UELB 1M1K1 2KL4A 2PMZA 4NBFA 5IP9I 1W36C 2CW8A 1VQ8Z 1M902 3OS1A 5IT9f 1JJ2Z 1LFPA 1MMDA 5IP7I 1VQPZ 3J80b 3FKJA 4XKBA 3DKXA 4NNJA 1U0JA 2KDOA 1TFIA 4CL1A 3D9XA 2V26A 3ESWA 1LQLA 1YJWZ 1WJAA 4ZTFA 3G4S1 3J81b 4RLFA 4C2TA 1QHHD 4NB9A 5A2Qf 3IUOA 4RVFA 2VASA 3GTPI 1ML8A 2KHMA 1VQN1 2AQFA 2IXSA 3A1YA 4U87A 1YHQZ 2E5NA 4NH1C 4PFPA 1VQMZ 4RM3A 3QYFA 2P0WA 2GU2A 4HGYA 5C4JI 3RZOI 2R6MA 4LITA 1N77A 3CCUZ 3DLAA 3OW2Y 3EERA 5HVQC 4NB8A 3CPWY 2NVTI 2K3RA 1RO2A 1TWGI 4DGLA 1NJI2 3UR3C 4F3QA 2HU9A 2ZSHB 3H5AA 3MD2A 4CCMA 3L2WA 4NOZA 3GTJI 1QVFY 2R4GA 1YUKA 1QVGY 2WY8Q 4BE1A 1T0FC 3SEZA 2A5WA 3E0JB 4B43A 1QU3A 3OR1C 1S9HA 3SZGA 2CV0A 1YITZ 4KISA 5D1OB 3ZR8X 1DGWY 2DT7B 1DGRM 4B48A 3AL0C 4E32A 2JA5I 3S2DI 4S1TA 2JUGA 2VXDA 3K6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y56 A;  2HU9 A;  4E6K G; 
#chains in the Genus database with same CATH topology
 1R1V A;  4TNU A;  1SFE A;  1WJE A;  3S1R I;  2W48 A;  1HDD C;  3CQZ J;  4C2M J;  1W5T A;  3AG3 H;  4HA8 A;  2Y0S N;  1QRY A;  4UB8 C;  1K4S A;  5LHH A;  2X6X A;  3K4J A;  2W04 A;  1TWH I;  5ICE A;  2D1V A;  5A2Q Z;  2PJP A;  2HKO A;  3E7L A;  3VOE A;  2OTJ I;  3CXC Y;  3IAS 2;  5T67 A;  4PSW A;  2DMU A;  1VTN C;  1VQ6 I;  2QR1 B;  3JAM Z;  1JJ6 C;  3CJQ B;  2XAS A;  1FEX A;  1R9T I;  3K1M A;  5FFZ A;  3GTM J;  1XN7 A;  3ZQH A;  1RO0 A;  2EGT A;  2CWE A;  2E1O A;  3FBN B;  2JS4 A;  4LB6 B;  5EF6 A;  1H89 C;  4MEY F;  3CCM Z;  1WCM J;  5GAE J;  2VBZ A;  1IV6 A;  3J80 K;  1U2W A;  1DU0 A;  1YYV A;  2NS7 A;  1JHF A;  3GBG A;  1WGX A;  2Y69 H;  1UAA A;  1XTA A;  1P7I A;  3J81 Z;  3L2C A;  2JVG A;  5KCM A;  3KFW X;  3MWM A;  3REO A;  3KP6 A;  5TIS C;  3J80 Z;  3OWT A;  2NVQ I;  3KX2 A;  4E30 A;  1O3T A;  2VQH A;  3MZY A;  3G6E 1;  2G2K A;  2HR3 A;  1SAU A;  4G12 A;  1QXF A;  1LJ9 A;  1O7L A;  4UVA A;  2DA3 A;  1BA5 A;  1RUN A;  3P7N A;  5LFA A;  2OOY B;  1YIJ Z;  2QBY B;  1WPK A;  3LNQ A;  3S14 I;  4DW6 A;  4HDV A;  4A5N A;  4G7Z F;  1ZAR A;  3CF2 A;  4MH4 A;  2MC4 A;  5D8K B;  1E3P A;  2HQA A;  2KRF A;  4A0X A;  2BY1 A;  3RPU A;  4EJT A;  4A0Z A;  4MTD A;  1KU7 A;  3PO3 J;  3HOZ J;  3VYR B;  2ELH A;  1OYI A;  3OYJ A;  2M8G X;  3LAP A;  3BG0 B;  1YFH A;  3F3F C;  2XB0 X;  2BHZ A;  3OS2 A;  2DLL A;  2YU9 J;  1U8R A;  4XSZ F;  4ZC3 A;  5K1Y A;  1N25 A;  1EA3 A;  2FNP A;  3NH5 A;  1BW5 A;  4H0E A;  1N2F A;  5D5W B;  4A3D J;  3HB9 A;  1ZTR A;  4HRI A;  4KUM A;  2HYG D;  1HC8 A;  3AL0 B;  4LMY A;  2W82 A;  1IAW A;  3CCJ I;  1W7P B;  4XOT A;  1MBJ A;  2F5C A;  1F5T A;  4RMN A;  1YJW 1;  2FMY A;  2STT A;  2R7D A;  2QEN A;  4RAZ A;  1NK2 P;  2OTL 1;  2QVO A;  1H9T A;  2OOX B;  3G71 I;  4WXC A;  4NBB A;  1T33 A;  3OYB A;  1T56 A;  1LKX A;  2MAB A;  3H0G I;  4S0H B;  2IBD A;  3OYD A;  4RLQ A;  1BN5 A;  2RVC A;  4PGG A;  2HVQ A;  2CV2 A;  3DTK A;  3NQO A;  2FXA A;  3M07 A;  2QQB A;  4L0Y B;  1O3S A;  4J00 A;  3DV8 A;  4QIW N;  2DQL A;  3M9A A;  4N4O B;  1H88 C;  5B3S H;  1IGN A;  2RT9 A;  4LD5 A;  5LHG A;  2HDC A;  1R5I D;  2JK3 A;  4NBA A;  1R1T A;  1TBX A;  1ZG3 A;  3LST A;  2AKL A;  3NFZ A;  1Y1V I;  3LA2 A;  2MBF A;  3FXQ A;  1DQU A;  5ILV A;  1TQI A;  2DFI A;  3LMM A;  2ZNY A;  3BZ6 A;  2X85 A;  1U5T A;  4XK4 A;  2E2I J;  4BGD A;  4EGZ A;  1T8I A;  4HQE A;  1WI3 A;  3IX0 A;  2L7Z A;  1ETQ A;  3QPS A;  4TV7 A;  5T6B A;  2F48 A;  2FQ4 A;  2EB7 A;  4QPQ A;  2P4W A;  1IRF A;  3QQA A;  5J47 A;  4ESJ A;  2O0Y A;  2H09 A;  2A07 F;  2GLO A;  1K79 A;  2LC2 A;  4CIC A;  3S1M I;  4F7Z A;  2XB5 A;  5E8G A;  1RET A;  3LOC A;  3GFJ A;  4V2G A;  1Y1V J;  3WG7 H;  1KU9 A;  1TWA J;  2GXG A;  3I4P A;  1BR1 A;  3HOW I;  4W1U A;  2HOE A;  2XAJ A;  3E6D A;  4KIG A;  2TRT A;  1S72 I;  1K7A A;  3IL2 A;  4EWC A;  4XRF A;  4ESF A;  2P3Y A;  2COB A;  2KI7 B;  1XPX A;  3HGY A;  3TED A;  2DDB A;  2DA2 A;  2DFF A;  3ZGK A;  1K78 B;  1UZC A;  3HPG A;  4NHJ A;  4V19 K;  5FLX Z;  1AHD P;  2F5F A;  4EAT A;  1XS9 A;  3E5U A;  5DCM A;  3GTQ I;  5J1U A;  5E1W A;  2HFH A;  3GVA A;  4XON A;  1ZGW A;  5DUI A;  1Z02 A;  4J01 A;  4BQO A;  2JR6 A;  1YW8 A;  2DDA A;  5LBQ A;  4A3M I;  3HOU I;  3PNY A;  2KT0 A;  1XGN A;  2KRH A;  3GKQ A;  1R49 A;  5FO5 A;  1YJ9 Z;  3FHN A;  1I27 A;  2CQQ A;  3F8B A;  5B5E C;  3LSH A;  3OL4 A;  5CVU A;  4I6Z A;  4ZYG A;  1ZLK A;  2KDZ A;  3TW7 A;  3I07 A;  1PFT A;  2EA2 A;  1X1C A;  3CCS 1;  3CLQ A;  3JTH A;  1Z03 A;  1S5L C;  2OTJ Z;  2DE7 A;  5BMZ A;  1G3W A;  2KZV A;  1D5Y A;  2KKO A;  3S16 I;  3M1C A;  3CCE Z;  4A0Y A;  2L9N A;  1W0U A;  4JQF A;  2YU9 I;  2BV6 A;  3MON A;  3BCB A;  3HHG A;  2Z33 A;  1BW6 A;  1XGS A;  3PO3 I;  1YJ9 I;  1U5T B;  1VQ4 I;  1MJ9 A;  1A5J A;  5DDG A;  2G7H A;  2COM A;  3FMQ A;  3HKZ A;  2M34 A;  4KIB A;  1ETY A;  1K8A 2;  2IA2 A;  2X6Y A;  1I6X A;  2NXN B;  3B6A A;  3QOP A;  5J3L A;  4B3A A;  5E17 F;  3R60 A;  1R23 A;  3BY6 A;  2EFQ A;  2DA4 A;  3HM5 A;  1H0M A;  3T8T A;  2VT3 A;  5F0F A;  4LLL A;  3ULQ B;  4QPO A;  1I3Q J;  4RAG A;  3FBI B;  4HF2 A;  3WTZ A;  2Q4Z A;  3RKQ A;  3A01 A;  1W4M A;  2JTV A;  3W2W A;  2VON A;  1ZLJ A;  1Q82 2;  3DPU A;  2O8X A;  3BZK A;  1BM9 A;  3HXL A;  1FP2 A;  2VI6 A;  4BKX A;  1E17 A;  2Y9Z A;  2IA0 A;  3CCY A;  2L7F P;  3D2L A;  2E1M B;  5J6X A;  3I59 A;  2O4H A;  3IP4 B;  3GUD A;  2MA3 A;  2K4J A;  1SD6 A;  2IS6 A;  2FA5 A;  4XBF A;  3S32 A;  3VYS B;  4J19 A;  4BDY A;  2KMU A;  4LFU A;  3M3Y I;  2WA0 A;  2ZXI A;  1S6L A;  2MYS A;  4C9Y A;  1REP C;  2CUZ A;  4A3F I;  5CVI A;  2O5R A;  3EET A;  1ORK A;  2E1N A;  1Z6T A;  1QVT A;  1K6Y A;  3F8N A;  5F27 A;  3CC7 I;  2F4M A;  2CGP A;  1Z7U A;  2CH0 A;  4Q5S F;  2W03 A;  5FD6 A;  5J8C A;  4BH9 A;  4UNO A;  4PJM A;  1FPQ A;  1BJA A;  3IAM 2;  4D5F A;  4ENM A;  4B3X A;  2PM9 A;  1WJB A;  5FJ8 J;  2P8T A;  3H3V J;  2HQN A;  4L9N A;  4OMY A;  1VQ7 Z;  3W2V A;  2CV1 A;  2ADU A;  1EKE A;  4BJ5 C;  2VQL A;  1VQ7 I;  3CC2 1;  3TDU C;  1F4K A;  3I9V 2;  1VQ8 1;  4A6E A;  2XAF A;  1YIT I;  3RQ4 A;  4IHY A;  4N9I A;  3BJ6 A;  4F93 B;  5L3F A;  1J7K A;  1VQL I;  1NP6 A;  3VTN A;  2UUZ A;  4N9H A;  1XG1 A;  3H9Q A;  1Z01 A;  5JHF A;  4NBD A;  3QU6 A;  4G6T B;  3CCV Z;  5C44 I;  1IXS B;  4UXN A;  2KIM A;  2QSG X;  1VQN Z;  1W7P D;  1BR2 A;  3KLO A;  5CKT A;  3GX4 X;  1ETV A;  5F1J A;  3DEU A;  3M8E A;  2FX0 A;  1W5C C;  5A2Q b;  2XGX A;  3JAM f;  1U6G A;  2CFX A;  2HPI A;  1RNI A;  3CJN A;  3EPZ A;  4DZP A;  2JA2 A;  5M5X J;  1JKR C;  3U50 C;  3CPW Z;  2Q2E B;  3RZO I;  1F9N A;  3H5R A;  4KJZ A;  1Y1V S;  1VQ5 Z;  3E97 A;  2IAI A;  1RIO H;  1KD1 2;  4XQF A;  1D0Z A;  2BE5 F;  3DU5 A;  4CZC A;  1W36 D;  5CVV A;  3LQQ A;  1ZAO A;  2NVY I;  4ZYE A;  1YLF A;  1V54 H;  2JA6 I;  1IXC A;  3I4M I;  2F5V A;  2R7F A;  4RVG A;  1IUF A;  5K5R A;  2OBP A;  3EYY A;  3K4L A;  3RZD J;  3DBL B;  3MKY B;  4IHX A;  3K7A I;  2AXT C;  2W57 A;  2JRM A;  1TW3 A;  5EJC A;  3S1R J;  2CO5 A;  3GCF A;  3QRF F;  3HOY J;  1XGM A;  3WHC A;  3F8C A;  4WCG A;  2QYO A;  2ZJ2 A;  3ZQF A;  4A93 I;  3S1Q I;  2HNH A;  3Q0W A;  4DIQ A;  3MZL B;  5DV5 A;  3KPH A;  3HOX J;  1P92 A;  5GAH J;  3WOD F;  3CD6 I;  2JRT A;  1SEU A;  4BBR I;  3V4G A;  5FRO A;  3MN2 A;  5DS9 A;  1S7A A;  1XD7 A;  2Y9Y A;  1IO2 A;  2KP6 A;  1G2H A;  4XLH A;  4WWC A;  2YPR A;  1G59 A;  1B4A A;  3VWB A;  5CQE A;  1D8J A;  3RZD I;  1U78 A;  3GFM A;  2RKH A;  1LVK A;  3G1L A;  4YIR X;  1XX5 A;  1LQ1 A;  2ZAE B;  3OV8 A;  3DPL C;  3CCS Z;  3R0A A;  1P9N A;  2XF6 A;  1IRX A;  2PQ8 A;  4UVB A;  1B9M A;  1AKH B;  1TT5 B;  2DJI A;  1XGO A;  3H3U A;  3TO7 A;  4CYC A;  2Q0O A;  2R7O A;  4F55 A;  5FKM A;  5JVT A;  3KYL A;  2IS1 A;  3IWZ A;  3FHZ A;  4M6V A;  3CUQ A;  1FOK A;  1ERD A;  4Y7N I;  1RES A;  4AYB N;  2XSJ C;  3ECO A;  1YJN 1;  4M6Y A;  4E33 A;  4UHT A;  1FBQ A;  3J81 K;  2Z9O A;  4XNF A;  3KP7 A;  4YEL A;  4A3B I;  3FM5 A;  3K70 C;  2JMW A;  3CCQ I;  1PUF B;  3BR5 A;  1MNE A;  2DMT A;  5KAI C;  2JPC A;  4N0B A;  3MKZ A;  3FXL A;  1NK3 P;  2HS5 A;  3CC7 1;  2OD5 A;  2R0Q C;  3AFH A;  3ZRG A;  4NC8 A;  3VSL A;  5HLG A;  3GF2 A;  3G6E I;  3MKW B;  3TDH B;  4ZZL A;  3L7W A;  2PMZ A;  4HYE A;  2CW8 A;  1ON2 A;  1JT6 A;  3MKL A;  1JJ2 Z;  3PQK A;  1J75 A;  1MMD A;  2EZK A;  3O2P E;  4ON0 A;  2V1D A;  1APL C;  1ZGJ A;  3FKJ A;  4RB1 A;  3K9T A;  4NNJ A;  1XCB A;  2NNY A;  3CDI A;  3I53 A;  2Q8K A;  4FIS A;  1WJA A;  2L7M P;  4NB9 A;  5LHI A;  3PQJ A;  2G7U A;  1VQ9 I;  1ETX A;  1KU2 A;  1J2X A;  3IUO A;  1XSX A;  3MCZ A;  2N8G A;  2XV4 S;  2RDP A;  5IYC J;  1VQN 1;  5FLX K;  3T5X A;  4L9T A;  2OU2 A;  2HI3 A;  4MFE A;  2GU2 A;  2R6M A;  2FU4 A;  2TCT A;  1WRJ A;  5HVQ C;  4NDL A;  4XRS A;  3EER A;  2K3R A;  1RO2 A;  4A3F J;  4M3F A;  4F3Q A;  3L1P A;  3H5A A;  2UXN A;  4CCM A;  2QQA A;  4NOZ A;  4I98 B;  2IEK A;  3RIR A;  1D3Y A;  2WY8 Q;  4HOB A;  1T0F C;  3FM3 A;  3I58 A;  2A5W A;  3WHB A;  2GXB A;  3WTY C;  5D6F A;  1BIB A;  4A3B J;  4HDU A;  1S9H A;  3ZR8 X;  1DGW Y;  4MEX F;  1DGR M;  2JPB A;  2W25 A;  3B02 A;  3AL0 C;  3EDP A;  3O3K A;  1WQ2 A;  3HGG A;  3FIW A;  3K6G A;  1KQ9 A;  3BG6 A;  4DZJ A;  3BR1 A;  2NVU B;  2OJE D;  2OZK A;  3LSR A;  1FY7 A;  4GCV A;  2QGU A;  3K4K A;  1TT0 A;  3MMY B;  3HKZ N;  2XAH A;  2K27 A;  3F9K A;  3BTJ A;  2KLO A;  1GHC A;  2XPV A;  5CYV A;  3H3Z A;  4MGR A;  2ZME B;  2VPW A;  3WE2 A;  1P4X A;  2Z5U A;  3VB2 A;  1Y0N A;  2CG4 A;  1UJ8 A;  3CCQ 1;  2TDX A;  1Z3X A;  5E1X A;  2CRG A;  2QZ8 A;  3F3X A;  4G7H F;  3FMR A;  2BW3 A;  4L9V A;  3RPU D;  2PMH A;  1MZB A;  4XOP A;  2CFO A;  1JKO C;  2GA1 A;  4MON A;  3QYB A;  3BG9 A;  3G71 1;  4RVH A;  2BEO A;  3S1Q J;  3NEU A;  4AIH A;  3HOY I;  2KPM A;  2QM3 A;  4BNC A;  5ICF A;  2DE6 A;  5LGT A;  1AKH A;  1YJN Z;  2MD0 A;  3EUK L;  1QVF Z;  3H35 A;  4AIJ A;  2OF7 A;  3CMY A;  3ZQI A;  3G2B A;  3F23 A;  3RKX A;  1YIJ 1;  4CHU A;  3ZPL A;  3F6O A;  1XMA A;  2OCE A;  4RGU A;  4A3E J;  2K02 A;  1RZ4 A;  2JA6 J;  3I4M J;  4KT5 C;  4OAZ A;  4U0W A;  1GV2 A;  4ASN A;  4Y52 J;  3UNG C;  2LH9 A;  4S04 A;  2H85 A;  2MH9 A;  5DD4 A;  3ERE D;  4ZTJ A;  2GIV A;  1YJ9 1;  5FKO A;  4IJA A;  4HG2 A;  4A3L J;  2CSO A;  2LVS A;  3S3N A;  1YUA A;  4I2O A;  3U9G A;  3IKV A;  1K9M 2;  1OCO H;  2LYC A;  5CLS A;  3HTU A;  2WBM A;  4LGW A;  1G3S A;  3ABT A;  1SD4 A;  5T64 A;  3S2H I;  2XRL A;  3GZ5 A;  1HKQ A;  3CXC Z;  1I1G A;  4NC6 A;  3HOW J;  2LY2 A;  5E20 A;  1I6H I;  4FTH A;  2YR2 A;  5HLT A;  2M7B A;  1WH7 A;  1JUS A;  1OCT C;  4XLP F;  2X4H A;  1OCR H;  1DPU A;  1YQA A;  3DWL E;  3QAH A;  1NJI 1;  1MJA A;  2JWT A;  2YX4 A;  2OCC H;  2M4K A;  5HLH A;  4E6K G;  3K4B A;  4ITV A;  1JXS A;  2FRH A;  3BP8 A;  3P9C A;  2ZME A;  5F04 A;  2CMP A;  3VB9 A;  5K5O A;  2W1O A;  5EEG A;  2DMN A;  1ITY A;  2HVR A;  1FP1 D;  2VJ5 A;  4ZH4 F;  3ELK A;  2IGN A;  3HRS A;  3A02 A;  3CES A;  4YRV A;  2PMU A;  4L0Z B;  3M4O J;  3Q0U A;  2CUJ A;  2JIM A;  2VJJ A;  4OU0 A;  5E8I A;  1HW2 A;  4DYQ A;  2DT6 A;  4E4H A;  4PCQ A;  2P7C B;  1SMT A;  2VN2 A;  2Z16 A;  2DMQ A;  3F72 A;  2R3S A;  1HW5 A;  2JSP A;  3DCF A;  3KP3 A;  1JKQ C;  2O61 A;  1K61 A;  2JIO A;  1VQL 1;  3KP4 A;  1BOB A;  1T08 B;  4AWX B;  5ED4 A;  3HSE A;  3PIO F;  1U5T C;  2PI0 A;  4HLY A;  4QTT A;  3S17 I;  3K2Z A;  2EH3 A;  1WWX A;  4A3G J;  4NC7 A;  4HF1 A;  2M2E A;  2O6G E;  3DLL F;  5DM6 F;  3MAJ A;  3CC2 I;  1NG7 A;  4BS9 A;  1IN8 A;  4C30 A;  3TP0 A;  3FKI I;  4B8X A;  1XDS A;  1WFX A;  3BLY A;  2K9L A;  3H0D A;  2ID6 A;  3Q9S A;  3JSP A;  2E35 A;  1P7J A;  1GUU A;  1LEA A;  4JX5 A;  3JRC A;  3F22 A;  2EIK H;  2V9K A;  2Y48 A;  3EUH C;  2WV1 A;  2DPD A;  2KIF A;  3IV5 A;  2FJ1 A;  3S3M A;  4A3D I;  3HOT A;  1I3Q I;  1VZ0 A;  2KIS A;  2WAQ N;  2EJR A;  4GO1 A;  1Y8C A;  4P5O A;  1YG2 A;  4RA2 A;  3T4N B;  2IVM A;  4F52 A;  2R7Z J;  1WI9 A;  4OAY A;  1U9N A;  3GXO A;  1ZH5 A;  4EJW A;  2X0L A;  2OPT A;  2LSO A;  1VQK I;  1MBF A;  4LLG F;  3GO5 A;  2DO7 A;  2JN6 A;  2GOX B;  4KIF A;  4CCO A;  1R4N B;  2H6B A;  2JA7 J;  1MH4 A;  3HOZ I;  3FZV A;  3QP6 A;  4BY1 J;  1U9O A;  2E2J J;  3BR2 A;  2DK5 A;  1Y1W J;  2CUF A;  2X1D A;  3G4S I;  2JA7 I;  4M9S A;  1BI2 A;  3CC4 I;  2RV8 A;  2DQR A;  3IKT A;  3ONQ A;  1G3Y A;  4JX6 A;  2DA5 A;  4I01 A;  3PUF A;  2HOS A;  4RGS A;  5B1B H;  1KD1 1;  3PM1 A;  5BPI A;  2ZSI B;  1VQ6 1;  3WTT C;  5EG0 A;  1OJL A;  4Z2Y A;  5BPD A;  2GTH A;  1MMN A;  4BEH B;  4EJO A;  2LY1 A;  1F43 A;  5D1P A;  1W2B Y;  3F3P C;  2FBI A;  2EPF A;  4XLE A;  2X51 A;  3DBH B;  3N4M A;  2VBW A;  2P28 A;  1YRN A;  2FSW A;  1XDU A;  3KZY A;  4JK1 X;  2NS8 A;  5KNL A;  1LVA A;  1A35 A;  2HTS A;  4C3J J;  1PYV A;  4C3H J;  5H20 A;  2FOK A;  2L9V A;  2OZU A;  5D8L B;  4ZDL A;  1AOY A;  3GTQ J;  2Z1D A;  2BBY A;  3CCR Z;  4YEJ A;  3HRU A;  4YIF A;  3JRF A;  5L3B A;  1YS7 A;  4IXA A;  5L3C A;  2HVS A;  2KZG A;  1IV8 A;  3CCL Z;  2Y0M A;  1CF7 A;  2CJJ A;  4HBL A;  2QWW A;  2RGV A;  2P6T A;  3Q5F A;  1TWH J;  2R7U A;  4A3E I;  1Q86 1;  1Q81 1;  3A4C A;  2V1N A;  3GZN B;  3G6E Z;  4FAS D;  2Q51 A;  1ONV A;  4HV5 A;  5CPR B;  2MG4 A;  3JAM K;  1IJW C;  3CQZ I;  2Y75 A;  1MMA A;  1VQ4 Z;  1FBS A;  1MGT A;  2Z2S B;  4CCK A;  2F4M B;  3S2D J;  2M30 A;  2NRA C;  3X2Q H;  3BG3 A;  1LFU P;  1KQS Y;  3W6K B;  4Z6Y A;  4M3B A;  3E5X A;  4LK1 F;  1YJN I;  2L54 A;  2HXI A;  1Y8R B;  5B1A H;  1FOX A;  4IZZ A;  3PNV A;  2EZH A;  3LL7 A;  4G8X A;  4QTU A;  1YTY A;  2VC1 A;  4O6J A;  4MIM A;  2M0M A;  5TJJ A;  3GTJ J;  1R36 A;  4BQN A;  1Z7L A;  2CQK A;  1IDY A;  2VQG A;  2NVT J;  3TO9 A;  2GTI A;  4XSX F;  2L7K A;  1CGP A;  1I6H J;  3JR9 A;  3EUA A;  4B09 A;  4DOZ A;  1HST A;  3C2G A;  1UG2 A;  4BYY A;  3LUS A;  2DAO A;  3JRA A;  3DFG A;  4FX0 A;  4I02 A;  2LBF B;  3ABM H;  3WTV C;  4WXD A;  2M45 A;  1UMQ A;  1HA8 A;  3ASO H;  4E7J A;  1S7O A;  3CUQ B;  4FCY A;  2JMO A;  4G7O F;  1J5Y A;  1RKW A;  1W7P A;  2HYF A;  3VEP A;  1TWC I;  1IW7 F;  3BJO A;  1HW1 A;  3WTX C;  2LEX A;  2ISZ A;  1IZ1 A;  2FBK A;  1YHQ 1;  2VJI A;  1PUF A;  2A3S A;  2LF7 A;  2X1C A;  4U0Y A;  2DMP A;  1S72 Z;  2R92 I;  4HZF A;  2FE3 A;  1V5F A;  2Q2E A;  4B47 A;  3L2R A;  4O3M A;  4U7D A;  3NAU A;  2L9R A;  3C2B A;  3OOP A;  2E7X A;  2HQ5 A;  3COA C;  1EF4 A;  4HPQ A;  3F0C A;  4HNU A;  2KIU A;  1VQP 1;  2OZ6 A;  3CC7 Z;  5LRR A;  5LRS A;  1FYM A;  2ZB9 A;  2DA6 A;  3G1O A;  1WSU A;  1XB4 A;  1FC3 A;  1YOV B;  3CMA 1;  1MNM C;  1IN6 A;  4IHT A;  3S8P A;  5ERI A;  3CCR I;  2VBY A;  4IEJ A;  3HJE A;  5AON A;  1YE9 A;  1SVM A;  3PFI A;  1GXP A;  2BVM A;  2BOL A;  3ISP A;  2DOE A;  4M73 A;  4ETS A;  2R93 I;  4CCL A;  1X58 A;  3OYA A;  3IRR A;  1MW7 A;  2A69 F;  5EG0 B;  1LNW A;  1JWH C;  2OQG A;  3AKZ A;  1TLH B;  2JUC A;  2XVC A;  1YJW I;  3GTL I;  2WAD A;  1X4O A;  5F6F A;  3RKY A;  2GWR A;  1OR7 C;  1Z3Y A;  3HG9 A;  4CUG A;  3HYI A;  2DBB A;  2F6C A;  2DA7 A;  5F0C A;  2NOG A;  4PJN A;  1WJC A;  3FXO A;  3QWL A;  3OYL A;  3N05 A;  1YW7 A;  2D2W A;  1B72 A;  4RVD A;  3I56 1;  5HDN A;  1BOA A;  3KP2 A;  1PDN C;  2ESH A;  3G71 Z;  2E7Z A;  1OKR A;  1N75 A;  2QLZ A;  4X6A I;  3J80 f;  5M3M J;  4OIQ F;  1FBU A;  1S7E A;  3OYG A;  2E19 A;  2IGO A;  3MZK B;  3JTG A;  1V5E A;  1ZB8 A;  3ZQL A;  4MTE A;  2HYJ A;  1VQM I;  1TWG J;  2PN6 A;  4XM3 A;  3A03 A;  3TE5 B;  4V2F A;  4B44 A;  4MNU A;  2QLV B;  1PP8 F;  5FLV A;  2ZXJ A;  5IT9 b;  5E3O A;  2ME6 A;  3OYF A;  2R7Q A;  2VQC A;  1TWF I;  1X1D A;  3ML6 A;  4YII A;  3TMO A;  1M1K 2;  1QO0 D;  1RRJ A;  4RGR A;  3GTP J;  4E31 A;  3H3V K;  3HRM A;  5KAF C;  3NH8 A;  3HUG A;  4X1E A;  1B59 A;  4PFO A;  1IN4 A;  5CJ9 A;  2XF5 A;  2CQN A;  2M48 A;  2YX7 A;  2B0L A;  1X3U A;  4E2Z A;  4ENJ A;  2QA4 1;  2XKO A;  3MVP A;  4KN7 X;  3CC2 Z;  3V7C A;  3FIS A;  1A6Q A;  2LD5 A;  3CCU 1;  2VOO A;  4HNT A;  1K9M 1;  3HOX I;  4IVN A;  2WC2 A;  1FYK A;  1D0Y A;  5KK1 A;  2XGD A;  1R00 A;  3FDY A;  3H9J A;  5IT3 A;  4M72 A;  5EEH A;  4A3J I;  2W24 A;  1JGS A;  1H9G A;  2R7W A;  2VLA A;  5HS8 A;  3R6S A;  2M6N A;  1B8I A;  3L2V A;  3ZMD A;  3JW4 A;  1FZP B;  1LDD A;  3I55 I;  4KT6 A;  1BBY A;  1EV7 A;  1QZZ A;  3VMH A;  4LOC A;  2M0C A;  4XKV A;  4JX4 A;  3OYN A;  3UKG A;  1MBK A;  3ZOB A;  1M1K 1;  2E34 A;  1VQ8 Z;  1W36 C;  2Y2Z A;  4A3K J;  1M90 2;  1HSJ A;  2NVY J;  4NB5 A;  5K5Q A;  2R5Y B;  1LFP A;  3I59 B;  5IP7 I;  3J80 b;  1W1W E;  4FT8 A;  4XKB A;  1H8A C;  1TFI A;  1TWC J;  1QBJ A;  2GAU A;  3HBL A;  2V26 A;  3QPL A;  3ASN H;  4EM2 A;  2HQR A;  2W84 A;  4ZTF A;  4RLF A;  4C2T A;  1QHH D;  4A6D A;  3CCS I;  2HXO A;  3Q0V A;  3PIP F;  2KHM A;  2AQF A;  2IXS A;  4U87 A;  2EIJ H;  1IF1 A;  2EIN H;  4NH1 C;  1FIP A;  4GFB A;  4IPA A;  2NAP A;  1VQM Z;  4RM3 A;  4DNC A;  3QYF A;  2GA2 A;  2XPW A;  1L3L A;  4RS8 A;  1N77 A;  5ICC A;  3CCU Z;  4NB8 A;  1HDP A;  4LB5 A;  2ISY A;  2ZSH B;  3L2W A;  3GTJ I;  3Q9V A;  3P5J A;  2OAZ A;  4A3J J;  2YU3 A;  1QQI A;  1XSV A;  2M5W A;  3E0J B;  2VBX A;  2ICW G;  2VPR A;  2A61 A;  3OR1 C;  1B1B A;  3SZG A;  2GM4 A;  1QU3 A;  1YIT Z;  4YG2 F;  3KP5 A;  2DT7 B;  2JA5 I;  1G3T A;  4OOI A;  4E32 A;  4C3I J;  2H8W A;  2M87 A;  2VXD A;  1MBH A;  4PGH A;  1X1P A;  1BR4 A;  2AHQ A;  2MLK A;  3I3L A;  4HQM A;  1QPM A;  3ZP5 A;  3N97 A;  1T2K A;  4IHW A;  1A31 A;  1JJ8 C;  5EGO B;  1D0X A;  2ZFW A;  3PNT A;  2V79 A;  1RNL A;  2XGC A;  2F2E A;  4IF4 A;  1P9Q C;  6PAX A;  1IUY A;  2OTJ 1;  5FB2 A;  1VQK Z;  1V4R A;  3I54 A;  4MHG A;  1TWF J;  3IRQ A;  2EV0 A;  3O8H A;  5HNH A;  2VIX A;  3K70 D;  3AAF A;  3CZ6 A;  1LB2 A;  4ZZD A;  3AG4 H;  2HF1 A;  1OQY A;  2LFB A;  3CLO A;  1M90 1;  4CDG A;  3WTW C;  1X3Z A;  1VQN I;  3SFZ A;  3V8L A;  3GCM A;  3W6J B;  5FD5 A;  2QRC B;  5GP9 A;  3WE3 A;  3G1M A;  2DCE A;  2MLG A;  2B63 I;  3ZN0 A;  1R58 A;  2M7A A;  4ZYA A;  1LDK B;  3CP2 A;  3OW2 Z;  3LSK A;  1IDZ A;  1ZB9 A;  3CCE 1;  2X6W A;  4FQG A;  2EIL H;  1X2N A;  2WAQ A;  4I0B A;  2ETH A;  2JUB A;  1IC8 A;  3CMA Z;  4A3C J;  3GFI A;  4M9X A;  3NDJ A;  2YUS A;  4FHT A;  4KNY A;  4UUS A;  2NVX J;  4HST A;  2DTZ A;  1VQK 1;  3MZH A;  3BOQ A;  2VF1 A;  3W2A A;  3ZXS A;  4AYB A;  3D0S A;  4U0V A;  2QKM B;  3J7Y J;  2BJO A;  5IYB J;  1YX5 A;  3EQL F;  2NOJ B;  2ZJP F;  1SIW A;  2ELK A;  1HCR A;  2BYV E;  2LDU A;  2M4G A;  4L5J A;  2AS5 F;  3GTL J;  1KA8 A;  1R4M B;  4OIN F;  2ID3 A;  4R8H A;  1MKM A;  2DYS H;  3CDH A;  4GRI A;  1QPI A;  1AA7 A;  2PJR A;  1Y39 A;  3FXM A;  2ESN A;  4A69 C;  4CYD A;  3DTE A;  2LOO A;  2VJ4 A;  1HKS A;  4P9F A;  2M9H A;  4BY1 I;  1W2B Z;  4GGG A;  2BW3 B;  2RBL A;  1ZR2 A;  1Z6R A;  2ELJ A;  3OR2 C;  1B8I B;  2K9Q A;  2DOD A;  3R4K A;  5J4Y A;  2JIR A;  3F21 A;  4KDP A;  2NS0 A;  3WTS C;  4C2U A;  3H36 A;  3CCJ 1;  2R7Z I;  3CDL A;  1WJ2 A;  3SDB A;  2ZC2 A;  3I55 1;  2E1M C;  2R5Z A;  1K8A 1;  1OYW A;  2RQQ A;  4HW0 A;  5GAG J;  2X1E A;  1QGP A;  4BHP A;  4XID A;  1ETO A;  1GXQ A;  3OOU A;  5IP6 A;  1K78 A;  3LSP A;  2PX9 A;  1VQ9 Z;  2P6S A;  4BUP A;  3S2W A;  2L4A A;  2R7T A;  4KYW A;  3CF5 F;  2R92 J;  2HZT A;  3PJR A;  3CJR B;  2R7V A;  2IV2 X;  1ZQ3 P;  2PEX A;  3BTC A;  4G6D A;  3FKI J;  1Q7Y 1;  3OMY A;  4PJL A;  4BY7 I;  4M3E A;  4EQQ A;  5L3G A;  2AO9 A;  3LA3 A;  2CUE A;  3T0Y A;  1B6A A;  3FXK A;  4A3G I;  2F4O A;  1R5G A;  5M3F J;  1R5H A;  2EFO A;  4E2X A;  1E3O C;  3H0G J;  2RPR A;  2QUF A;  1LDJ A;  3L00 A;  1KQS Z;  1X3W B;  3HZJ A;  3BPX A;  5A2Q K;  1ETW A;  4BBS J;  1GDT A;  3HUG B;  3E6B A;  3JRD A;  2WWY A;  1KRL A;  1FLI A;  3S1M J;  1NTC A;  4BJ6 C;  2L5Q A;  2V8I A;  2R7X A;  4KMF A;  4XKC A;  2DK8 A;  1DU6 A;  2PJR B;  4X0G A;  4LIV A;  3CCV I;  1UST A;  3L2Q A;  3SFI A;  1N8R 1;  3J7A O;  4QTR A;  1BJZ A;  1O4X A;  2CW7 A;  3SYT A;  2BXY A;  2FOW A;  2DOA A;  2RNJ A;  4D1Q A;  1YI2 1;  3MFK A;  2LRD A;  3PL8 A;  2EA4 A;  2CYY A;  2XKP A;  5CVR A;  3GTG J;  3FQQ A;  5IY5 H;  4MD8 A;  3MEX A;  1VQ6 Z;  4GYG A;  1FT9 A;  3CUO A;  2G9W A;  1FOY A;  3M8F A;  3KCC A;  4JYK A;  3G3Z A;  1ENH A;  3WG9 A;  5IYD J;  1Z67 A;  2IZ4 A;  5JVG F;  1YRN B;  3TQN A;  2VXZ A;  2K9N A;  5F08 A;  4Y13 A;  4XIC A;  1B72 B;  5K7H A;  1ACI A;  2XAU A;  2D1H A;  1USP B;  1XMK A;  2XAQ A;  1HKT A;  4XKW A;  3JSO A;  1ZRE A;  1WW9 A;  2V1U A;  1Q7Y 2;  1N8R 2;  1GT0 C;  5JLW A;  1X0T A;  1DPR A;  4IRH A;  5D1O A;  1WJD A;  1MD0 A;  4F92 B;  4G9Y A;  2JIQ A;  3CMA I;  4PUS A;  1MSF C;  2Y31 A;  3CCM 1;  2W4S A;  3IHU A;  2K5R A;  2RHB A;  2V3V A;  1SAX A;  1JTX A;  4P1W A;  1Y56 A;  2C6Y A;  3GTG I;  1ODD A;  1QNT A;  5DEQ A;  1SVL A;  3GTM S;  3IH2 A;  3DF8 A;  5FLX b;  1XCV A;  1X2M A;  2WB1 N;  3WU0 A;  4AVP A;  3I71 A;  4HX8 A;  2L3D A;  4CXF A;  1FYL A;  2EFN A;  5F64 A;  1S29 A;  1KQ8 A;  3E3V A;  3J7Z I;  1IG7 A;  3DQV C;  1ETK A;  1E3H A;  2QBY A;  1YHQ I;  1N78 A;  2FF4 A;  4WXH A;  5JLX A;  2IS4 A;  3AG2 H;  5AIP A;  2CS3 A;  4DK1 A;  2QRD B;  5AN9 F;  2A5Y B;  1KON A;  2E2I I;  4MQ9 F;  1P4A A;  2QCO A;  1D1C A;  3VPR A;  2V6C A;  1FIA A;  1T6S A;  2EZL A;  2OC6 A;  4HX4 A;  2VL8 A;  2EQR A;  4XOR A;  4Q47 A;  1VQO Z;  2V9V A;  1FSH A;  1WVR A;  2W7N A;  1VQL Z;  3HSR A;  2HOA A;  4OMZ A;  5H6Q A;  2Z3Y A;  3FX3 A;  1C0W A;  4NBG A;  1NG6 A;  4HGZ A;  2XDV A;  3GTK I;  3CME I;  2VC0 A;  4IOA F;  2PG4 A;  5E3L A;  3J81 f;  2NVQ J;  3O6B B;  2DE5 A;  3FXR A;  3JRE A;  2MH2 A;  4O5V A;  2IGM A;  4H4K C;  5LD2 C;  3BR3 A;  1AWC A;  5FKN A;  4L5I A;  1WZ2 A;  3ZCO A;  4DBR A;  4BY7 J;  3CCU I;  2NVX I;  1QHG A;  3TP3 A;  4RAY A;  4BHC A;  3KE2 A;  5LLQ A;  1HF0 A;  1RO4 A;  1OPC A;  2KPI A;  3CCJ Z;  1PVE A;  3LQR A;  3TDZ C;  1X1A A;  1ZG1 A;  1KYZ A;  5DCM B;  4EV0 A;  3OL3 A;  3ZQG A;  4DQ2 A;  1Z05 A;  3HOS A;  5LGN A;  3RI4 A;  2NYX A;  2A6T A;  4NUB A;  5JHU A;  3KET A;  4MRI A;  3GTM I;  4ANJ A;  1NUI A;  4I76 A;  3IH4 A;  2P81 A;  5FLX f;  3BQZ A;  4UUV A;  4HH4 A;  2XRN A;  1P6R A;  4XRS G;  2ZO4 A;  1ZH1 A;  1WII A;  3K1P A;  1WJ5 A;  1Q82 1;  4RAF A;  3U1D A;  2ZJQ F;  1JKP C;  5E3N A;  2BHY A;  4DQY B;  3M4O I;  5EEA A;  3QYE A;  1R1U A;  2LNB A;  2LTP A;  1UB9 A;  5KVR A;  1K83 I;  3BG1 B;  1T39 A;  3J7A 4;  2EV5 A;  5BQT A;  3QP5 A;  2OQR A;  4N4N B;  1I3A A;  2E5Z A;  3RJP A;  3LSJ A;  5DD8 A;  3K4M A;  1R6R A;  2GBY A;  4GXO A;  1R71 A;  4LG3 A;  2M8E A;  2IZ3 A;  3GEZ A;  2VOP A;  2R5Z B;  2L01 A;  2M1B A;  5GTI C;  2HDD A;  1DL6 A;  3BR0 A;  4YFN F;  4IHS A;  3M1E A;  5ICG A;  2QF7 A;  3ZQQ A;  1YIT 1;  4KFC A;  4XR6 A;  2E1C A;  2K4B A;  2R5Y A;  3TO6 A;  5IOY A;  4BAC A;  2LBF A;  4UUT A;  3W3C A;  1AU7 A;  1Z21 A;  2WV0 A;  1RC9 A;  3JAM b;  3CC4 1;  3H9G A;  2RC4 A;  1WCM I;  3LSG A;  4I09 A;  2YSR A;  4E7K A;  4ESB A;  1DP3 A;  1RLY A;  3DPT A;  2B63 J;  1MIJ A;  2BY2 A;  2L9S A;  1TC3 C;  3LSI A;  4D0P A;  4Y3O A;  2LKP A;  4DGW B;  3PO3 S;  2I8D A;  4A5M A;  3QPT A;  1YI2 Z;  2GOM A;  5IP7 J;  2QKL B;  4G6Q A;  1QYP A;  2MD5 A;  4NBH A;  4Y52 I;  1JUP A;  3LA7 A;  5JI6 A;  4EJV A;  4LLN A;  3RSN A;  3IFU A;  3KEY A;  4S05 A;  4A3K I;  2LK2 A;  1VQP I;  1D1B A;  2ZKZ A;  4IL6 C;  1VQ5 1;  4HV6 A;  4E7L A;  4MD7 A;  5DTD A;  4AIK A;  4BHB A;  4XL9 A;  4HSR A;  1JT0 A;  3FXJ A;  3P5J B;  3HIF A;  3E5Q A;  1KQ0 A;  4RB0 A;  5FRM A;  1FMV A;  2EV6 A;  1RR7 A;  5FKK A;  5FLM I;  4CCN A;  3ZQ7 A;  3CO6 C;  4W97 A;  4MO7 A;  5DUK A;  2V45 A;  1YO5 C;  3E6C C;  2LMD A;  1OCP A;  4WF2 A;  2LP0 A;  1BIA A;  3BG7 A;  1G4D A;  1GLN A;  3K7A J;  3KEO A;  1SAN A;  3TOA A;  4ENN A;  5CQG A;  4I0A A;  5B66 C;  5J1Y A;  2E71 A;  1U3E M;  3ROU A;  4Y4R A;  3OYM A;  1D1A A;  1Z77 A;  3PFY A;  4PJJ A;  1OLT A;  4II3 A;  4KIT B;  2IP2 A;  1J59 A;  2CQ7 A;  3QOD A;  4XN0 A;  3DU6 A;  2QA4 Z;  4Q48 A;  4OWR B;  1Q1H A;  4EMS A;  1WHU A;  4UVC A;  1TQP A;  5JFR A;  2E9H A;  1VQ9 1;  2L4M A;  3SEQ A;  5F0H A;  4RDU A;  4NBE A;  5ILU A;  1BI3 A;  3WGI A;  2JVH A;  4IRG A;  2A05 A;  4QLC U;  4M6X A;  2P7V B;  2K7L A;  2L0K A;  1UHS A;  3HPH A;  4NQW B;  4P9U A;  1Z1D A;  1KC8 1;  1SD5 A;  1Z0X A;  3KEQ A;  2KJC A;  3CMM A;  3HHH A;  2CU7 A;  4BXF A;  3VYU B;  2E2H I;  1KC8 2;  2X9D A;  3BTL A;  3HSF A;  2KRC A;  1OCZ H;  3VFZ A;  3H92 A;  3K0L A;  2F4O B;  1G6N A;  4E7Z A;  1OCC H;  1RKT A;  4BDZ A;  3GW2 A;  3E1S A;  4M9Z A;  3HOV J;  2ZFU A;  2A68 F;  3KZI C;  3PUB A;  1OIS A;  1X3W A;  3K69 A;  2BY0 A;  2VKV A;  4HF0 A;  3IR7 A;  1MMG A;  2DOF A;  2EFP A;  1P4W A;  3VOD A;  4D5C A;  4RB3 C;  4AUX A;  3B6C A;  4BXU A;  2QSH X;  2KL4 A;  1KYW A;  1CF7 B;  4NBF A;  5IP9 I;  2NAZ A;  3OS1 A;  4D7N A;  5IT9 f;  1ZN2 A;  2PFB A;  5LEJ A;  2L02 A;  1ULY A;  4PJ0 C;  5ILS A;  1ZYR F;  4JP0 A;  1U0J A;  2KDO A;  5GTH C;  1MH3 A;  2EK5 A;  3ESW A;  4CL1 A;  5IT9 K;  2JT1 A;  4LK0 F;  5D4R A;  4D7M A;  2AXL A;  3GFL A;  2O3F A;  4K2E A;  4RVF A;  1SFX A;  2VAS A;  3GTP I;  1ML8 A;  2FEZ A;  3A1Y A;  2B9S A;  1JTY A;  4PFP A;  2P0W A;  3GLX A;  1I5Z A;  5J40 A;  3U2R A;  5C4J I;  4LIT A;  2H6C A;  3OW2 Y;  3DLA A;  4BAY A;  1TWG I;  1LFB A;  5HOD A;  3A0B C;  2HU9 A;  4EJU A;  3MD2 A;  3LFK A;  2R4G A;  1MDM A;  4LJZ F;  1YUK A;  2UXX A;  3HTS B;  5HDK A;  4WK8 F;  1ZRF A;  1FX7 A;  3SXY A;  2E2H J;  2CV0 A;  1LUJ B;  2QSF X;  5D1O B;  4XRM A;  4B48 A;  2STW A;  1JUM A;  2JUG A;  2FD5 A;  5IT9 Z;  1W5S A;  1JGG A;  2HZD A;  3OYE A;  3S1N I;  2Q1Z B;  4XMY A;  3I4N I;  3GZ6 A;  3U21 A;  2VUM I;  1DDN A;  3H5N A;  1I1S A;  3M7G A;  1UHW A;  3GTK J;  1UFM A;  1UCR A;  1VQ5 I;  2V4J C;  4DBQ A;  3TBI A;  3BG5 A;  1WH5 A;  2W00 A;  3FK7 A;  1AA6 A;  3BZC A;  2XF7 A;  5EYR A;  3TL4 X;  5DM7 F;  4XLF A;  3TKY A;  1TL8 A;  2WY7 Q;  5E79 C;  3PSI A;  2IGK A;  4BE0 A;  2R93 J;  2XUB A;  1RUO A;  2UV1 A;  1A6I A;  4OIO F;  3HEF A;  1QVU A;  2QEX Z;  3S16 J;  3ABU A;  4PDK A;  3GTO I;  5HOO A;  2MFZ A;  2VE9 A;  4Y15 A;  1L0O C;  1BL0 A;  1VQO 1;  3I64 A;  2V1X A;  4ZJZ A;  2JIP A;  4A3I J;  2IJL A;  1QVG Z;  1T0F A;  2K40 A;  2ZXW H;  3CUQ C;  3O8G A;  2OTL I;  5L3D A;  2J5P A;  2V9P A;  3K4N A;  5E1Z B;  1JHH A;  3V7R A;  2IPQ X;  2EFW A;  2UWM A;  1Q86 2;  4NBC A;  4E70 A;  3P9K A;  4XN3 A;  3T1B A;  2H94 A;  3G73 A;  1ZR4 A;  2HPM A;  3OSF A;  1HLV A;  4KMU X;  1XMX A;  5J1R A;  4CYC B;  4UY8 I;  1XC5 A;  1FOW A;  3BQY A;  2O7O A;  3VYT B;  1SFO J;  3CCV 1;  4MQV A;  3ZMU A;  1K73 1;  1VQ7 1;  1V3F A;  1R22 A;  5FGM A;  3FMS A;  3KLN A;  2BXZ A;  1VQ4 1;  3NWS A;  3R0J A;  2DPU A;  1G8X A;  3OS0 A;  1VLA A;  4BL0 B;  4CGZ A;  3ZMV A;  2OA4 A;  1Y0U A;  3M8J A;  1WZN A;  3CD6 1;  1TW2 A;  3OSG A;  3EED A;  3P9I A;  1O57 A;  3C1D A;  4Q4Z F;  2D45 A;  1ON1 A;  3VSK A;  3BRO A;  1XSD A;  4R1H A;  3ABK H;  2V8K A;  1TP4 A;  3FQM A;  1EH7 A;  3LAJ A;  3A2K A;  3IWF A;  4UUS B;  1YW9 A;  5GPA A;  4F91 B;  3V7S A;  2Y30 A;  2XSD C;  3RCO A;  1Q1V A;  1ZRD A;  3TOB A;  2A6H F;  4Y33 A;  2V6E A;  5FKL A;  5DYM A;  3DP7 A;  4P55 A;  1I50 I;  2RIQ A;  1I39 A;  4B4C A;  1HQC A;  1PP7 U;  3GYH X;  3NDI A;  2H1K A;  1K73 2;  4MLO A;  3SZP A;  2PBI A;  3SDG A;  2LF8 A;  1FMW A;  2V7F A;  4PZJ A;  4BU2 A;  4RBO A;  3IF8 A;  2I10 A;  1USS A;  3ERM A;  2LY9 A;  1E0E A;  1X1B A;  1Y1W I;  1SVO A;  2E2J I;  1FDO A;  1KZH A;  3MZ8 A;  2R7R A;  3RTR A;  4M74 A;  4AU7 A;  1J9I A;  1BC7 C;  4FE7 A;  1YIJ I;  5LL6 f;  4AC0 A;  1QA6 A;  2XPU A;  3RYR A;  2EIM H;  4HLX A;  3RDI A;  2GZW A;  2ZCW A;  3KIO A;  1Y6I A;  1OYY A;  1SFK A;  4CZZ A;  3PO2 I;  2DI3 A;  3BCA A;  2IT0 A;  5IPA A;  3CCQ Z;  1A04 A;  1YI2 I;  3I56 Z;  2DXI A;  2E7W A;  1GVD A;  4FET A;  2Z99 A;  3EYI A;  3TGN A;  5GAD J;  3CO7 C;  2MSY A;  3M3Y J;  5D5V B;  1NHA A;  1OMI A;  3LSM A;  3ZMZ A;  4II2 A;  3CP8 A;  3JCU C;  2K3F A;  3ABL H;  4AM3 A;  2PK7 A;  3KIF A;  2X48 A;  2B7E A;  3DXJ F;  3E6M A;  2K5C A;  3QWU A;  1EH6 A;  2ECB A;  4WX9 A;  1T98 A;  1Z91 A;  2RRE A;  4U88 A;  4IX7 A;  1S3J A;  4DYR A;  3OYK A;  4EGY A;  2HGC A;  4BJT A;  3H1C A;  1TNT A;  4B1R A;  4RB2 C;  4ZYD A;  1FJL A;  1FTT A;  2FQ3 A;  2HTJ A;  3OYI A;  3K1N A;  5F1R A;  1ZEL A;  2K86 A;  5EZG A;  2YS9 A;  3S17 J;  1MBG A;  2LRE A;  3CJT B;  5LEK A;  1BC8 C;  3BPV A;  2ACJ A;  1JI8 A;  4E2W A;  1S8N A;  4IOC F;  4D9J A;  2ZNZ A;  5DCF A;  1E2X A;  4KA4 A;  2VKH A;  2XAG A;  1GVJ A;  3HC7 A;  2A6E F;  3FK6 A;  1MND A;  3SZT A;  1WKM A;  1VF9 A;  4BE2 A;  1SFU A;  1RR8 C;  3CD6 Z;  2FUG 2;  4UV8 A;  1R7J A;  5EZH A;  2ME0 A;  5E18 F;  1ZG5 A;  4OIP F;  1P2F A;  3PSF A;  2GQQ A;  2VUG A;  3C3W A;  2LKX A;  1CQT A;  3HL2 A;  4YFK F;  4XX2 A;  5HLI A;  2IW5 A;  3V8J A;  3S14 J;  3R61 A;  4XLN F;  1LEB A;  2QEX 1;  3OYH A;  2V8J A;  2DFH A;  2BVL A;  1DUX C;  5L3E A;  1S72 1;  1D8K A;  2H1L A;  1MBE A;  3C18 A;  4ZYH A;  5J4V A;  2RN7 A;  1UHM A;  1QF8 A;  2VOD A;  3U1K A;  2HDW A;  4ZDP A;  3CME 1;  1QZE A;  1Q81 2;  3D5S C;  3Q87 A;  3BT9 A;  3BC8 A;  1BI0 A;  3F8F A;  5EGO A;  3KYD B;  3KZZ A;  1FWZ A;  5J8F A;  3HOU J;  4A3M J;  1MDM B;  4A3C I;  2PMZ N;  3I5U A;  3S2H J;  4HNV A;  2ZBK A;  5KHD A;  4QWQ A;  2OV7 A;  1OR7 A;  4RM2 A;  3BR6 A;  3TW6 A;  2JQ7 A;  2P5V A;  4A2U A;  2VE8 A;  2CQX A;  3K4C A;  4XLC A;  2ZXH A;  1HOM A;  3DKW A;  2VPZ A;  4HAM A;  3PO2 J;  3K2A A;  4MD9 A;  4Y17 A;  5HS7 A;  5GPC A;  3QPH A;  5H6R A;  4DYC A;  3CME Z;  1YX3 A;  3CTA A;  3FF5 A;  1DP7 P;  9ANT A;  4NFR A;  1IRZ A;  4M3G A;  1NH3 A;  3HDD A;  1S7M A;  1TWA I;  1RPW A;  3K10 A;  3JRI A;  3RQI A;  4IKF A;  2K85 A;  4E2Y A;  3G4S Z;  2BY3 A;  2DW4 A;  5HS9 A;  2EBI A;  1Q16 A;  3LFU A;  1MMS A;  4QSH A;  3MQ0 A;  2DTR A;  1YIO A;  3QOE A;  4HEA 2;  2G0E A;  2JA5 J;  2LIY A;  4A3I I;  2K3P A;  2KQR A;  1RI7 A;  5C3E I;  1FNN A;  2QQ8 A;  1LE8 A;  2OTL Z;  5BOX A;  1T95 A;  1I50 J;  5BNG A;  2M3A A;  1TNS A;  1ZHF A;  2I3C A;  2AQE A;  4MXU A;  1X4P A;  2JA8 I;  1Z9C A;  1IXR C;  1KU3 A;  3IC7 A;  2VPL A;  4BBS I;  4XLA A;  3JRG A;  4BEH A;  2H8R A;  4IO9 F;  3BWG A;  4P96 A;  2MC3 A;  3D5L A;  3DBR B;  1JE8 A;  3W6V A;  3NWT A;  2RQP A;  4E7I A;  3S15 I;  2BGC A;  4YFX F;  2F5E A;  2WAE A;  1L1O C;  2VUM J;  1ZGA A;  4CCJ A;  5D6E A;  3I4N J;  2E60 A;  5JR3 A;  1ZRC A;  4A3L I;  3S1N J;  2XHK A;  5CM2 M;  2KIQ A;  1SFO I;  2ECC A;  4AVZ A;  2XIG A;  4CSW A;  2J6A A;  4L5E A;  1PJR A;  1WJF A;  2HWV A;  3IH3 A;  4CO8 A;  3BDD A;  2QRE B;  1PUE E;  1U8B A;  2JZY A;  1HXD A;  3NH4 A;  2E36 A;  3D6W A;  3KYC B;  2O53 A;  2VB6 A;  2JSC A;  2KJB A;  1FDI A;  3WU2 C;  2EWN A;  4U7B A;  1K4T A;  3T8R A;  3B73 A;  2DN0 A;  4A12 A;  1O7F A;  3C7J A;  4RGX A;  3JRB A;  5M5W J;  1Y8Q B;  2LG4 A;  2W85 A;  4I99 C;  2QKD A;  2OUM A;  2ZJR F;  3F6V A;  2JNY A;  5CVJ A;  3CCM I;  1OFC X;  3DKY A;  4PSX A;  4R79 A;  2XRO A;  1VQM 1;  3GTO J;  5FFX A;  4IQJ A;  3LWF A;  3VMI A;  4PK4 A;  2VT2 A;  2HOT A;  5C4X J;  2LR8 A;  1W0T A;  2XGE A;  1LE8 B;  4ABZ A;  1MJB A;  3CCE I;  4E7H A;  4BXX J;  3WU1 B;  2DJN A;  2KFD A;  2IRF G;  2FBH A;  1JJ2 Y;  4JBA A;  2P5K A;  4M3D A;  3I56 I;  1SMY F;  1UG0 A;  1VND A;  1M1E B;  3V8K A;  3S93 A;  5K7Z A;  2MW8 A;  3NAR A;  2BZT A;  2WAF A;  2HEO A;  5TGT A;  3GLL A;  2GXA A;  5IOZ A;  1KGS A;  1O3R A;  2R7S A;  2J5O A;  4ZDO A;  2FML A;  2LKS A;  3WGH A;  4NBQ A;  1SD7 A;  5AIQ A;  1VQ8 I;  3Q3S A;  1X3Z B;  3HOV I;  2MGQ A;  3V42 A;  2K9M A;  3A01 B;  2I5U A;  1T38 A;  2GIZ A;  4L18 B;  3L9F A;  4LIU A;  3I55 Z;  4CH7 A;  4X6A J;  3S3O A;  3CCL 1;  2CW0 F;  1X19 A;  4EM1 A;  3D5R C;  1TTY A;  3FWE A;  3ZMS A;  4NQW A;  1B9N A;  4RS4 A;  4UB6 C;  4LG0 B;  2L2O A;  2D5V A;  3QU3 A;  1ZKG A;  1FTZ A;  1USP A;  5BS6 A;  2PLY A;  4IRI A;  3CCR 1;  2IA1 A;  3ZMT A;  3BJA A;  2F4I A;  3OYC A;  5HNF A;  1VFC A;  3VDX A;  1J09 A;  5E3M A;  5FRN A;  1R9T J;  1TZL A;  3ZQC A;  2XC7 A;  2IS2 A;  4IQ4 A;  5M5Y J;  5C4J J;  1IN7 A;  3VMG A;  2QQ9 A;  2VPX A;  2O9L A;  2VPY A;  4UV9 A;  1F1Z A;  1FSE A;  3DTI A;  1RQF A;  3F8M A;  4EM0 B;  2P5L C;  4KIC A;  3J7A Y;  4E7S A;  3L2U A;  3RPQ A;  4FX4 A;  3C2H A;  3RYP A;  4BQA A;  2DA1 A;  2RNG A;  3FXU A;  3NRV A;  2DFE A;  1IRG A;  2DT5 A;  3OIP A;  4ENK A;  5D4S A;  4EEF G;  2JJ7 A;  2LFU A;  2YAD A;  3L09 A;  3JRH A;  4BXX I;  2NNN A;  4BQQ A;  2RAE A;  1EJ9 A;  5C4X I;  2Y0S A;  3CC4 Z;  3SJM A;  1D5V A;  3ESW B;  3DEE A;  3KIH A;  4JOM A;  4L9J A;  5IP9 J;  1V55 H;  4OIR F;  3OIO A;  2ZME C;  4RV9 A;  4A93 J;  4IHV A;  2DYR H;  2EZI A;  4CA0 A;  1TQM A;  3I0T A;  1BI1 A;  4AD9 A;  4AID A;  4EVI A;  1V5G A;  1VI0 A;  4KN4 X;  3A0H C;  3OY9 A;  2AYD A;  3RKW A;  2WB1 A;  4DJA A;  2VKD A;  2FNA A;  5TRD A;  1UEL B;  3SQN A;  1K6O A;  2F5D A;  1EH8 A;  3BTI A;  3ZN1 A;  2VKE A;  3GME A;  1O3Q A;  5LGU A;  2QEX I;  4I7H A;  1VQO I;  1A36 A;  1VQP Z;  3DEW A;  4M71 A;  3DKX A;  2QA4 I;  4Y7N J;  1IN5 A;  3D9X A;  4MFD A;  1MSE C;  1LQL A;  1YJW Z;  2X6O A;  3GWZ A;  3RZO J;  3G4S 1;  4GDF A;  3J81 b;  5A2Q f;  3WGG A;  2K9S A;  2O03 A;  3S15 J;  5EDN A;  1SC7 A;  1POG A;  1YHQ Z;  1ZK8 A;  2E5N A;  2H27 A;  4FE4 A;  5C44 J;  4G94 A;  4LG0 A;  4HGY A;  2DU9 A;  3ECH A;  3HRT A;  2JA8 J;  1GV5 A;  2NVT I;  4HX7 A;  1LPQ A;  1QZY A;  3CPW Y;  2HKX A;  1STZ A;  4GYI A;  4DGL A;  1NJI 2;  3UR3 C;  1HBX G;  3EUH A;  2UZK A;  1QVF Y;  5HDG A;  3WTU C;  1F36 A;  2LLK A;  4BBR J;  2WTE A;  5K7F A;  1QVG Y;  5H2F C;  4BE1 A;  3SEZ A;  4B43 A;  5C3E J;  5FLM J;  5D5U B;  2O8K A;  4KIS A;  3SHF A;  1YS6 A;  1J0R A;  3CCL I;  3AG1 H;  3D1N I;  3S2D I;  4S1T A;  3OIQ A;  1K83 J;  5D5X B; 
#chains in the Genus database with same CATH homology
 2HZD A;  3OYE A;  1BR4 A;  1WJE A;  3BG6 A;  3I3L A;  4TNU A;  2Q1Z B;  3S1R I;  3S1N I;  4XMY A;  2OZK A;  3I4N I;  3U21 A;  1D0X A;  1TT0 A;  3K4K A;  3PNT A;  2VUM I;  3MMY B;  3H5N A;  1P9Q C;  2X6X A;  3K4J A;  2OTJ 1;  1TWH I;  1VQK Z;  2V4J C;  3F9K A;  4DBQ A;  2KLO A;  3TBI A;  2W00 A;  3CXC Y;  3IAS 2;  5T67 A;  4PSW A;  5HNH A;  3K70 D;  2VIX A;  2XF7 A;  3TL4 X;  2QR1 B;  3CZ6 A;  4XLF A;  2WY7 Q;  3CJQ B;  2HF1 A;  1M90 1;  3PSI A;  2IGK A;  1X3Z A;  1R9T I;  4BE0 A;  2QRC B;  3CCQ 1;  2UV1 A;  1RO0 A;  2EGT A;  2DCE A;  3FBN B;  1Z3X A;  2JS4 A;  2B63 I;  2M7A A;  4ZYA A;  1LDK B;  3CP2 A;  2BW3 A;  3CCM Z;  3RPU D;  3LSK A;  3OW2 Z;  1ZB9 A;  3CCE 1;  2QEX Z;  2X6W A;  4XOP A;  2CFO A;  2WAQ A;  3GTO I;  4MON A;  3QYB A;  5HOO A;  2JUB A;  2MFZ A;  3G71 1;  4RVH A;  3CMA Z;  1VQO 1;  4ZJZ A;  3NDJ A;  3GBG A;  1UAA A;  1QVG Z;  4HST A;  1VQK 1;  3HOY I;  2KPM A;  2DE6 A;  2VF1 A;  3W2A A;  2JVG A;  5KCM A;  3ZXS A;  4AYB A;  1YJN Z;  3K4N A;  2MD0 A;  3EUK L;  1QVF Z;  3H35 A;  2QKM B;  3OWT A;  2UWM A;  1Q86 2;  3KX2 A;  2NVQ I;  4NBC A;  3G2B A;  4E30 A;  4XN3 A;  2VQH A;  2BJO A;  3G6E 1;  1YX5 A;  1YIJ 1;  2G2K A;  2NOJ B;  2HPM A;  1SAU A;  2M4G A;  4OAZ A;  5LFA A;  2OOY B;  1YIJ Z;  3S14 I;  2PJR A;  4GRI A;  1AA7 A;  3VYT B;  3UNG C;  2LH9 A;  4MH4 A;  3CF2 A;  2H85 A;  2MC4 A;  3CCV 1;  1K73 1;  1VQ7 1;  2HQA A;  4ZTJ A;  1VQ4 1;  1YJ9 1;  3DTE A;  3NWS A;  1G8X A;  3OS0 A;  2LOO A;  2VJ4 A;  4HG2 A;  4BL0 B;  1VLA A;  4BY1 I;  3S3N A;  1YUA A;  3M8J A;  2RBL A;  2BW3 B;  3VYR B;  1W2B Z;  3CD6 1;  3OYJ A;  3BG0 B;  3EED A;  3F3F C;  1K9M 2;  2LYC A;  3OS2 A;  2ELJ A;  3OR2 C;  3VSK A;  2WBM A;  2V8K A;  3FQM A;  4ZC3 A;  4C2U A;  3A2K A;  5T64 A;  2R7Z I;  3CXC Z;  3CCJ 1;  3S2H I;  1EA3 A;  3SDB A;  1I6H I;  2LY2 A;  4F91 B;  3NH5 A;  5HLT A;  2E1M C;  3RCO A;  1N2F A;  3I55 1;  1K8A 1;  2RQQ A;  2M7B A;  4HRI A;  2X1E A;  3AL0 B;  2W82 A;  4Y33 A;  2V6E A;  4XOT A;  3DWL E;  3OOU A;  1I50 I;  2RIQ A;  1YJW 1;  4RMN A;  1NJI 1;  1VQ9 Z;  2M4K A;  4BUP A;  4E6K G;  3K4B A;  2OTL 1;  4ITV A;  2R7T A;  3NDI A;  3PJR A;  2OOX B;  3CJR B;  2R7V A;  1K73 2;  4MLO A;  2CMP A;  3VB9 A;  1Q7Y 1;  4NBB A;  3OMY A;  2W1O A;  4PJL A;  3OYB A;  4BY7 I;  1FMW A;  1LKX A;  2V7F A;  4BU2 A;  2HVR A;  2MAB A;  2VJ5 A;  3IF8 A;  1E0E A;  1X1B A;  1Y1W I;  3OYD A;  2IGN A;  4RLQ A;  4A3G I;  2CV2 A;  2HVQ A;  2E2J I;  3CES A;  4YRV A;  2F4O A;  2R7R A;  1VQN Z;  3DTK A;  2CUJ A;  2VJJ A;  3RTR A;  2W04 A;  4E4H A;  2DT6 A;  4AU7 A;  4J00 A;  4N4O B;  2Z16 A;  2RPR A;  5LL6 f;  2RT9 A;  3CCS Z;  2JSP A;  1KQS Z;  4NBA A;  2AKL A;  3NFZ A;  1VQL 1;  1BOB A;  1Y6I A;  4QTT A;  3S17 I;  1SFK A;  3PO2 I;  3CCQ Z;  3BCA A;  1Y1V I;  1DQU A;  3I56 Z;  4NC7 A;  2DXI A;  3GTK I;  3HUG B;  1KRL A;  3LMM A;  4FET A;  3VMH A;  2X85 A;  4BGD A;  1NG7 A;  4BS9 A;  3LSM A;  4BJ6 C;  2L5Q A;  2V8I A;  3IX0 A;  4C30 A;  2R7X A;  4II2 A;  3FKI I;  3CP8 A;  5T6B A;  4XKC A;  3BLY A;  1WFX A;  2K9L A;  4QPQ A;  3H0D A;  2PK7 A;  4E2X A;  3KIF A;  3QWU A;  2K5C A;  2PJR B;  4X0G A;  4LIV A;  2RRE A;  4IX7 A;  3L2Q A;  3OYK A;  1N8R 1;  2V9K A;  4BJT A;  2LC2 A;  3S1M I;  2CW7 A;  3EUH C;  3SYT A;  1YI2 1;  4D1Q A;  2DOA A;  2LRD A;  3PL8 A;  3FQQ A;  3OYI A;  3S3M A;  1ZEL A;  3HOT A;  1I3Q I;  4MD8 A;  1VZ0 A;  4A3D I;  1VQ6 Z;  1BR1 A;  4P5O A;  3T4N B;  3HOW I;  2LRE A;  4F52 A;  4OAY A;  1JI8 A;  4E2W A;  4D9J A;  4EWC A;  2IZ4 A;  2P3Y A;  2KI7 B;  3H0G I;  2GOX B;  2VKH A;  2VXZ A;  4CCO A;  3ZGK A;  2XAU A;  3HC7 A;  3HPG A;  1MND A;  3OIQ A;  4BE2 A;  1USP B;  3CD6 Z;  3HOZ I;  2FUG 2;  4XKW A;  1WW9 A;  4EAT A;  2X1D A;  3PSF A;  1Q7Y 2;  1N8R 2;  3GTQ I;  1X0T A;  2VUG A;  2JA7 I;  5D1O A;  3HL2 A;  1WJD A;  4XON A;  4XX2 A;  3ONQ A;  4F92 B;  2QEX 1;  4PUS A;  3OYH A;  2V8J A;  1Z02 A;  4J01 A;  4BQO A;  2JR6 A;  2W4S A;  2BVL A;  3CCM 1;  1S72 1;  1KD1 1;  2K5R A;  2ZSI B;  2RHB A;  4A3M I;  1VQ6 1;  3PNY A;  3HOU I;  4P1W A;  1Y56 A;  2KRH A;  2GTH A;  1QF8 A;  1MMN A;  3GKQ A;  2HDW A;  4BEH B;  4ZDP A;  2LY1 A;  3CME 1;  3GTG I;  3GTM S;  1YJ9 Z;  3FHN A;  5D1P A;  1Q81 2;  1W2B Y;  3D5S C;  3F3P C;  3Q87 A;  3BC8 A;  3LSH A;  3OL4 A;  4XLE A;  2X51 A;  5FLX b;  2P28 A;  3I07 A;  3DQV C;  1PFT A;  4A3C I;  1X1C A;  3CCS 1;  1Z03 A;  2OTJ Z;  2DE7 A;  1N78 A;  2KZV A;  5KNL A;  2IS4 A;  3S16 I;  3M1C A;  1PYV A;  2CS3 A;  5KHD A;  3CCE Z;  4DK1 A;  2L9N A;  2OV7 A;  4JQF A;  2QRD B;  3MON A;  4ZDL A;  5AN9 F;  3BCB A;  2YU9 I;  1KON A;  2E2I I;  4RM2 A;  2Z1D A;  1D1C A;  3CCR Z;  3PO3 I;  4YEJ A;  2OC6 A;  3K4C A;  2VL8 A;  4XLC A;  2ZXH A;  4XOR A;  4MD9 A;  1VQO Z;  2HVS A;  3HKZ A;  2W7N A;  3CME Z;  1K8A 2;  3CCL Z;  1VQL Z;  1YX3 A;  2X6Y A;  4NFR A;  2R7U A;  4A3E I;  4NBG A;  1NG6 A;  4HGZ A;  2XDV A;  1Q81 1;  3A4C A;  2V1N A;  1Q86 1;  1S7M A;  1TWA I;  4QPO A;  3G6E Z;  4FAS D;  3K10 A;  4IKF A;  4E2Y A;  3G4S Z;  3FBI B;  2Q51 A;  3J81 f;  2DE5 A;  5CPR B;  2Q4Z A;  3CQZ I;  3W2W A;  1MMA A;  2IGM A;  3DPU A;  4H4K C;  3LFU A;  4CCK A;  2Z2S B;  5LD2 C;  1Q82 2;  1VQ4 Z;  3ZCO A;  4DBR A;  3QOE A;  4HEA 2;  2NVX I;  3HXL A;  1QHG A;  2LIY A;  4A3I I;  1KQS Y;  2K3P A;  2KQR A;  5C3E I;  1RO4 A;  2E1M B;  2KPI A;  3CCJ Z;  2O4H A;  3IP4 B;  4IZZ A;  1X1A A;  1TWF I;  2OTL Z;  3PNV A;  1T95 A;  2IS6 A;  3LL7 A;  3OL3 A;  3S32 A;  3VYS B;  4QTU A;  2M3A A;  4BDY A;  2KMU A;  2M0M A;  3M3Y I;  3HOS A;  2WA0 A;  2MYS A;  2ZXI A;  4BQN A;  4C9Y A;  2A6T A;  1Z7L A;  2CUZ A;  4NUB A;  4MRI A;  4A3F I;  3GTM I;  4ANJ A;  2I3C A;  2AQE A;  2VQG A;  1NUI A;  4MXU A;  2O5R A;  1X4P A;  2JA8 I;  2VPL A;  4BBS I;  2GTI A;  4XLA A;  2L7K A;  4BEH A;  1K6Y A;  5FLX f;  3EUA A;  3D5L A;  4DOZ A;  3C2G A;  2F4M A;  3LUS A;  4HH4 A;  3NWT A;  1ZH1 A;  2LBF B;  4E7I A;  1WII A;  2CH0 A;  1WJ5 A;  1HA8 A;  1Q82 1;  4E7J A;  2W03 A;  3S15 I;  2WAE A;  1L1O C;  4PJM A;  4CCJ A;  2JMO A;  4DQY B;  3IAM 2;  3M4O I;  3QYE A;  2E60 A;  4A3L I;  4B3X A;  2PM9 A;  1TWC I;  1WJB A;  3H3V J;  5CM2 M;  1K83 I;  3BG1 B;  3W2V A;  1VQ7 Z;  1SFO I;  3J7A 4;  2CV1 A;  4AVZ A;  4BJ5 C;  2VQL A;  4CSW A;  2J6A A;  4N4N B;  1YHQ 1;  1PJR A;  1WJF A;  2E5Z A;  2VJI A;  3CC2 1;  2X1C A;  2QRE B;  1S72 Z;  3I9V 2;  1VQ8 1;  2R92 I;  3NH4 A;  3D6W A;  1V5F A;  1R6R A;  3K4M A;  4B47 A;  3L2R A;  4LG3 A;  2O53 A;  2VB6 A;  2IZ3 A;  3RQ4 A;  4U7B A;  4HPQ A;  4HNU A;  1VQP 1;  4F93 B;  1NP6 A;  3VTN A;  3CC7 Z;  2UUZ A;  2LG4 A;  2QKD A;  1DL6 A;  3H9Q A;  1Z01 A;  3ZQQ A;  2OUM A;  5JHF A;  1YIT 1;  2JNY A;  4NBD A;  4XR6 A;  3DKY A;  4G6T B;  4PSX A;  4R79 A;  1VQM 1;  3CCV Z;  3CMA 1;  5C44 I;  4BAC A;  2LBF A;  3S8P A;  3W3C A;  4IQJ A;  1Z21 A;  3VMI A;  4PK4 A;  1YE9 A;  3JAM b;  3CC4 1;  3H9G A;  1BR2 A;  2BVM A;  5CKT A;  3LSG A;  2BOL A;  4E7K A;  1WCM I;  4E7H A;  1DP3 A;  1RLY A;  3DPT A;  5A2Q b;  3JAM f;  2L9S A;  2HPI A;  3LSI A;  1RNI A;  3EPZ A;  3CPW Z;  2JA2 A;  4CCL A;  4Y3O A;  3OYA A;  3U50 C;  2Q2E B;  1MW7 A;  1JJ2 Y;  2R93 I;  3H5R A;  4KJZ A;  4DGW B;  1Y1V S;  2I8D A;  3PO3 S;  1YI2 Z;  1UG0 A;  2GOM A;  1VQ5 Z;  1JWH C;  1KD1 2;  3S93 A;  2QKL B;  4XQF A;  1QYP A;  4Y52 I;  4NBH A;  1D0Z A;  1W36 D;  3DU5 A;  4CZC A;  3AKZ A;  2WAF A;  5TGT A;  3GTL I;  2WAD A;  2NVY I;  3RSN A;  3IFU A;  3KEY A;  3I4M I;  2JA6 I;  4A3K I;  1X4O A;  1D1B A;  2F5V A;  4RVG A;  1OR7 C;  1Z3Y A;  2R7S A;  1VQ5 1;  3HG9 A;  3K4L A;  4CUG A;  4ZDO A;  3MKY B;  4E7L A;  4MD7 A;  2F6C A;  3K7A I;  4PJN A;  1WJC A;  4XL9 A;  4HSR A;  3OYL A;  3GCF A;  3HOV I;  3P5J B;  3N05 A;  3V42 A;  2K9M A;  5FRM A;  1FMV A;  4RVD A;  3I56 1;  4LIU A;  3I55 Z;  4CH7 A;  4A93 I;  3S1Q I;  2HNH A;  3S3O A;  5FLM I;  3CCL 1;  4CCN A;  1X19 A;  4DIQ A;  3MZL B;  3G71 Z;  3D5R C;  1N75 A;  4X6A I;  3J80 f;  3OYG A;  4RS4 A;  4BBR I;  2IGO A;  2L2O A;  5FRO A;  3MZK B;  1USP A;  1V5E A;  1ZB8 A;  3CCR 1;  2F4I A;  3BG7 A;  3OYC A;  5HNF A;  3VDX A;  1J09 A;  2KP6 A;  1GLN A;  4XLH A;  4XM3 A;  1G59 A;  5FRN A;  2IS2 A;  1TZL A;  3TE5 B;  2XC7 A;  3VWB A;  4IQ4 A;  5CQE A;  5CQG A;  4B44 A;  2QLV B;  3RZD I;  5IT9 b;  1LVK A;  4Y4R A;  3OYM A;  1D1A A;  2ZAE B;  3VMG A;  3OYF A;  3PFY A;  2R7Q A;  3DPL C;  2VQC A;  1OLT A;  3DTI A;  4PJJ A;  1X1D A;  1RQF A;  1P9N A;  4II3 A;  2XF6 A;  1IRX A;  4KIT B;  3TMO A;  3J7A Y;  4E7S A;  1M1K 2;  3QOD A;  3L2U A;  4XN0 A;  2DJI A;  3C2H A;  3DU6 A;  4E31 A;  2QA4 Z;  4OWR B;  2R7O A;  2RNG A;  4F55 A;  3KYL A;  3NH8 A;  2IS1 A;  2E9H A;  3OIP A;  1VQ9 1;  3SEQ A;  2LFU A;  4NBE A;  1ERD A;  2JVH A;  4PFO A;  2M48 A;  2XF5 A;  2YAD A;  4Y7N I;  2XSJ C;  1YJN 1;  4E2Z A;  4E33 A;  4BXX I;  3HPH A;  4NQW B;  4BQQ A;  2QA4 1;  3CC2 Z;  5C4X I;  2Y0S A;  1KC8 1;  3CC4 Z;  3CCU 1;  4XNF A;  3DEE A;  3CMM A;  4HNT A;  3KIH A;  4BXF A;  4JOM A;  3VYU B;  4YEL A;  1K9M 1;  3HOX I;  1KC8 2;  2E2H I;  4A3B I;  2KRC A;  3K70 C;  4RV9 A;  1D0Y A;  3FDY A;  3H9J A;  4A3J I;  4CA0 A;  4E7Z A;  1MNE A;  3MKZ A;  2R7W A;  4BDZ A;  2VLA A;  3CC7 1;  3E1S A;  2M6N A;  3L2V A;  3AFH A;  1V5G A;  2ZFU A;  3ZRG A;  4NC8 A;  3VSL A;  3PUB A;  3OY9 A;  4KT6 A;  1X3W A;  2WB1 A;  3MKW B;  4DJA A;  3TDH B;  2VKD A;  1MMG A;  4XKV A;  3OYN A;  1UEL B;  1M1K 1;  2KL4 A;  2PMZ A;  4NBF A;  5IP9 I;  1W36 C;  2CW8 A;  1VQ8 Z;  1M90 2;  3OS1 A;  5IT9 f;  1JJ2 Z;  1LFP A;  1MMD A;  5IP7 I;  1VQP Z;  3J80 b;  3FKJ A;  4XKB A;  3DKX A;  4NNJ A;  1U0J A;  2KDO A;  1TFI A;  4CL1 A;  3D9X A;  2V26 A;  3ESW A;  1LQL A;  1YJW Z;  1WJA A;  4ZTF A;  3G4S 1;  3J81 b;  4RLF A;  4C2T A;  1QHH D;  4NB9 A;  5A2Q f;  3IUO A;  4RVF A;  2VAS A;  3GTP I;  1ML8 A;  2KHM A;  1VQN 1;  2AQF A;  2IXS A;  3A1Y A;  4U87 A;  1YHQ Z;  2E5N A;  4NH1 C;  4PFP A;  1VQM Z;  4RM3 A;  3QYF A;  2P0W A;  2GU2 A;  4HGY A;  5C4J I;  3RZO I;  2R6M A;  4LIT A;  1N77 A;  3CCU Z;  3DLA A;  3OW2 Y;  3EER A;  5HVQ C;  4NB8 A;  3CPW Y;  2NVT I;  2K3R A;  1RO2 A;  1TWG I;  4DGL A;  1NJI 2;  3UR3 C;  4F3Q A;  2HU9 A;  2ZSH B;  3H5A A;  3MD2 A;  4CCM A;  3L2W A;  4NOZ A;  3GTJ I;  1QVF Y;  2R4G A;  1YUK A;  1QVG Y;  2WY8 Q;  4BE1 A;  1T0F C;  3SEZ A;  2A5W A;  3E0J B;  4B43 A;  1QU3 A;  3OR1 C;  1S9H A;  3SZG A;  2CV0 A;  1YIT Z;  4KIS A;  5D1O B;  3ZR8 X;  1DGW Y;  2DT7 B;  1DGR M;  4B48 A;  3AL0 C;  4E32 A;  2JA5 I;  3S2D I;  4S1T A;  2JUG A;  2VXD A;  3K6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...