2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mercuric transport protein periplasmic component
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
4E6KG 1Y56A 2HU9A
chains in the Genus database with same CATH superfamily
5BMZA 1UHMA 1JTXA 3ASNH 4HYEA 3E97A 3FXRA 2WAEA 4MRIA 3HOUJ 1TQIA 2QM3A 1N75A 1SAUA 2JK3A 3FXLA 3QYBA 4HX4A 3ABUA 1QF8A 1H8AC 4HV6A 1AA6A 1HKSA 3MMYB 1DPUA 2LNBA 4D0PA 3P5JA 4EJVA 2E60A 2VXDA 3NAUA 2JR6A 4QLCU 1VQL1 1ZN2A 2BW3B 1ZH5A 1DL6A 4DK1A 3KX2A 4OAZA 5BPDA 2JA7J 3VTNA 3CUQB 3PFIA 5K1YA 3TP0A 3G711 2KIMA 2DMPA 5BOXA 4ZYDA 1IN8A 2W03A 4AIKA 3H5NA 2MC3A 2H27A 1XGNA 1TQPA 2N8GA 3VPRA 4HDVA 2VUMI 4R8HA 1RNLA 1TQMA 1BI3A 2X6XA 3KEYA 2NS8A 1FIAA 1EH8A 2PMZN 4IRHA 4ESJA 1K79A 1VQ91 4RLFA 3O8HA 4E4HA 3GTKJ 4C3HJ 1B9MA 3HL2A 4A3JI 2FXAA 2L9VA 1XN7A 3LSJA 3ZQLA 5FLVA 5CQGA 2VKVA 3A0BC 2FNPA 2V6CA 3WTSC 2LKXA 2E2JI 1VNDA 5TISC 4A0YA 2G9WA 5B5EC 3NARA 3FXMA 2JSCA 4J19A 3PIPF 2DQRA 2ELHA 4I98B 4AYBA 3M3YJ 3CPWZ 2XKPA 1YJ91 1ML8A 3QYEA 4ZH4F 2AO9A 1MJ9A 2JUCA 4HDUA 2DOEA 3KP3A 1I50J 4B3XA 5H6QA 1J2XA 5CVIA 2QBYA 1HA8A 1ETXA 1MBJA 2DK8A 3I4MI 2WV1A 5IT9Z 1FBQA 1RZ4A 1P7JA 4RS8A 1SMTA 2VC1A 3J81b 3F3XA 3E5QA 3VODA 1FIPA 1KC82 2LBFA 2DBBA 2EBIA 2Q8KA 2XGXA 3G6EI 4YFNF 1SD6A 4HLXA 1VQMZ 4A0XA 2Y75A 1ZG3A 5CVUA 1J59A 3GTPI 3CCUZ 2W4SA 2XF5A 2VJ5A 2LLKA 3OW2Z 2ICWG 4BQQA 4MEYF 4G6DA 2RQQA 1V5EA 3C2BA 2FEZA 4BU2A 5CPRB 2UWMA 2EK5A 2Y9ZA 2WAQN 4RB0A 4BQAA 3BG1B 1XSDA 2FE3A 2A05A 1HKQA 5D5WB 5KCMA 1R49A 1NK3P 5JVTA 1IRZA 1SANA 1Q7Y1 3CJRB 2LY2A 1VQ4I 1F9NA 2JIRA 4AM3A 4MH4A 3KZYA 3K7AI 2CH0A 1W0UA 2QENA 3BROA 1QQIA 3GTGI 1OCRH 4IOCF 4CO8A 5HNHA 4Z2YA 3CUQC 1YHQI 2M30A 1BA5A 3GLLA 1TC3C 3LL7A 1BC7C 3CPWY 3RPQA 1TWCI 2HZDA 2OTJ1 4IHVA 1LVKA 1JUMA 4UVAA 4Y13A 3BR0A 4AIDA 3JAMf 2OTLI 1SIWA 2DMTA 3S8PA 3V8KA 2VJ4A 2X6OA 5EGOA 2JA2A 4KIFA 3HEFA 4FE7A 1I3QI 2M5WA 3GFJA 3HUGA 1P4XA 5DUKA 4A3LI 4XMYA 2ZKZA 3KP4A 3AL0B 1XC5A 3RQIA 2Z33A 4I2OA 3J80b 4CCKA 1Q812 1JTYA 1IGNA 2VUMJ 5IYDJ 1NK2P 2K3RA 3CD6I 1MD0A 4E7SA 3OYBA 2BV6A 2VPYA 4EV0A 4E2WA 4NBQA 3D9XA 1DP7P 3OW2Y 4AIJA 1IXSB 3IWFA 4HNUA 2P5LC 2LH9A 1PUEE 2CO5A 4KT5C 2LFUA 3VMIA 2K9MA 2V45A 2BY3A 4V2FA 3TDUC 4C9YA 2HVSA 5GPCA 2X6WA 1VQ7I 4M3DA 4D9JA 1W0TA 3N4MA 4XN3A 2KJCA 1FZPB 3GTOJ 4E7KA 3PSIA 2LTPA 3BR3A 2M3AA 1Y1WI 1XX5A 1RETA 2W57A 1P4WA 3BTCA 2L9SA 1MMGA 1VQLZ 2KL4A 1WQ2A 2GA1A 3TW6A 4CYCA 3VB2A 3DLLF 4A12A 4KN7X 4ZTFA 4DNCA 4GCVA 5J47A 3A02A 3TDHB 2KISA 1K8A1 3TP3A 1ZRFA 4BKXA 3G71Z 2GOMA 2XROA 1FP2A 3CJNA 1IZ1A 3GTLI 1MJAA 5E20A 3G4SI 4BBRI 3HSRA 3I07A 1YS7A 1I6XA 1Z3XA 5LRRA 3DTKA 3MKLA 2IT0A 2STTA 3CMA1 4PFOA 3RZOJ 3L2CA 4A93J 3L2QA 3KCCA 4I0AA 3L2VA 3F22A 3OIPA 4JX6A 1G3WA 4EMSA 3ISPA 3JTGA 4EM1A 1S7OA 1K4TA 2X0LA 4UXNA 2PX9A 4L9NA 2YADA 3OMYA 4WXDA 1K9M2 3X2QH 2P6SA 4LLLA 5M5XJ 3OYAA 2P6TA 4JOMA 1Q861 2JA6I 5CVVA 4BE1A 5A2Qb 5LBQA 3CCJI 4YFXF 5JI6A 1KZHA 2A5WA 4NC6A 1P2FA 1O3QA 1Y1VI 4L18B 3IKVA 3H92A 3S1RJ 2L0KA 5J40A 3K10A 3FISA 1VTNC 4TNUA 1V5GA 4MIMA 4F52A 5BS6A 3C2GA 3AL0C 5ICGA 2EIKH 3QU3A 2H8WA 1CQTA 1ETKA 3CO6C 4YIIA 1WGXA 1G59A 4MFEA 4XSXF 3A2KA 1JKPC 3OOPA 2LC2A 1YQAA 1BBYA 1KD12 2K5RA 4QPOA 2ESHA 5HNFA 4P1WA 3W6VA 4BL0B 2DE5A 1Z6RA 1KGSA 1U5TA 2X51A 2O3FA 5E1ZB 1WIIA 5E79C 1QBJA 1I1GA 3MKWB 1J0RA 1S5LC 2HYJA 2F4MA 2KI7B 3O8GA 2JA5J 3CCL1 2KIUA 2R7ZJ 3Q3SA 1JXSA 4BY7I 3QODA 3JAMK 2E1CA 4NUBA 1KYWA 1S72I 3K4LA 3SEQA 3QU6A 4GDFA 2MW8A 3GTMI 4C3JJ 2B0LA 1K731 2XC7A 3NH4A 3RPUD 4YFKF 1D0ZA 1SFXA 1B6AA 4LLGF 2A07F 3V7SA 3IV5A 2ISZA 4ZYAA 1FPQA 3WTZA 5E8GA 3ZGKA 1MDMB 3SZGA 3BG7A 2G2KA 2BY2A 4AC0A 2F4OB 4DZPA 3MZLB 3S14I 2KKOA 3S93A 2R92I 1RESA 2NNYA 4XKBA 2JMOA 2AYDA 3S1MI 3WU0A 2OTJZ 4E32A 3PNYA 1ETYA 2IGKA 2K02A 2QGUA 1BI1A 3F3PC 2HWVA 3K69A 1XGOA 2KIQA 5D6EA 3CCYA 2WC2A 3BR6A 3R60A 3CCS1 1OCZH 3IH4A 3WTUC 4AU7A 1MMAA 3O3KA 2KT0A 4EGZA 3GTLJ 4Q5SF 1R1TA 1YX3A 2EFQA 3FXUA 4B09A 4NOZA 4E6KG 3PFYA 5J3LA 3BQYA 3ZQHA 4BXXJ 2IBDA 1KQ0A 4XLPF 2QQ8A 3HGGA 1GLNA 3HRSA 3K1MA 1M902 2O61A 3WTTC 1RQFA 4NBEA 3NDJA 3CDLA 1F43A 4G8XA 3S32A 2DLLA 1QO0D 4G7OF 3RKXA 1MNMC 5D8LB 2NVQJ 2VKHA 1POGA 2FSWA 1X58A 1ZGJA 4ZDPA 2XSDC 2NYXA 2VOPA 4RB1A 1N78A 4HGZA 2JA6J 2W00A 5ILUA 2ZO4A 5KAIC 1TTYA 1YYVA 4XBFA 3U9GA 3J81Z 2ZNZA 2F4IA 2CUFA 2OZUA 2DT5A 3GX4X 4YELA 2JVGA 4BUPA 1A6IA 1BIBA 2I8DA 2KRCA 3GFLA 2P7CB 2VT2A 5H6RA 3FXQA 2LRDA 3Q9SA 2IS4A 4RS4A 1JHHA 5HDNA 2DYRH 4PJNA 3FQMA 4AWXB 1OISA 2CUEA 2D2WA 1QVGY 1UG2A 2VB6A 3S17J 2GXBA 4NQWA 2Q2EA 2LP0A 5J6XA 4U0VA 2K7LA 4RVDA 1QHHD 1JT6A 2DO7A 5C44I 5DD8A 2MABA 4XLFA 4HPQA 2VN2A 1YJN1 2GLOA 2X9DA 3CJQB 3W3CA 3BJOA 3CMAZ 3CO7C 1U8BA 2VXZA 3KEQA 2L9NA 1TWHI 2GQQA 1D5YA 4BY7J 4LG3A 1UCRA 3OYGA 5IP9J 5CLSA 2VQHA 4HQMA 5ILSA 1MBFA 2XAHA 2E7ZA 1X1AA 1YFHA 1K61A 2IA2A 1D1BA 4B43A 2DTZA 3E3VA 1GT0C 1R4NB 2WY8Q 1HSJA 2W82A 3KEOA 4DBRA 1RO2A 1YW9A 2D5VA 1R5ID 3BR5A 2AS5F 3BJ6A 3BG3A 1EV7A 2P81A 3LA2A 3OIOA 1IXRC 2YU9J 2L7MP 2BE5F 1U8RA 3MWMA 1ZB8A 3H1CA 4JK1X 5M5YJ 3GFIA 4U7BA 3BTIA 2RBLA 3J80Z 1VQKZ 2VE9A 1VQMI 1EH7A 3LWFA 3CCUI 4MD9A 3FM3A 4N9HA 4XNFA 2ZFWA 5K5OA 1T0FA 1UMQA 5HDGA 2XRLA 3DF8A 4EGYA 2M34A 4X1EA 4M72A 1HOMA 4N0BA 1EF4A 2M8EA 2DDAA 3H3VK 3CCV1 2OC6A 4RLQA 2Q51A 4AIHA 2L3DA 2OF7A 3TW7A 2AQEA 3ESWA 2WY7Q 3J7ZI 2F5FA 3CCLZ 4H4KC 3UKGA 2PK7A 1QZYA 1WH5A 2G7UA 4II3A 3EUAA 2KLOA 4IEJA 2LG4A 4M71A 1N2FA 3K4JA 3FXJA 3T4NB 2ZJ2A 2J5PA 5K5QA 4ITVA 2KHMA 3CC41 1HDDC 2IVMA 3JCUC 3KIHA 2QREB 2OQRA 3V42A 2IS2A 1IDYA 3KE2A 3MEXA 2DOFA 1PYVA 1V54H 1ZG5A 2OOYB 1HBXG 5BQTA 2PJRA 4E31A 5GP9A 2XGCA 1N8R1 5LEKA 5E17F 2VC0A 3BOQA 4PGGA 2CUJA 4IQJA 1GUUA 2FUG2 1FWZA 3R0AA 5GPAA 1WJDA 1WVRA 2NS0A 3H3ZA 4MD7A 5D1OB 2L9RA 1XSVA 1E3PA 5HDKA 2XF6A 1G3YA 1E3OC 1BM9A 3F3FC 3CCSZ 1XMXA 2OPTA 4RAFA 5CVJA 1A04A 2R3SA 5LHHA 5GAGJ 2HVRA 3CLQA 3ML6A 2AQFA 3K4NA 5DV5A 2OOXB 3HM5A 3F8CA 2ME0A 3A1YA 4L0ZB 5A2QZ 2CQ7A 2ETHA 3BC8A 3IUOA 1TT0A 2ECCA 3QPSA 3T1BA 3ZMDA 4OMYA 2JVHA 1FTZA 3TOBA 4MFDA 1I6HI 1ITYA 1K83I 1YIT1 2K3FA 4Y52I 2OAZA 5TJJA 5L3EA 3JRFA 3RYPA 2XASA 3DBHB 3DKXA 1RO4A 3RI4A 4HSTA 2ZJPF 2VJIA 4I02A 3CUQA 2F6CA 2ZXJA 2VBWA 2W7NA 1WSUA 1T8IA 5TGTA 2FA5A 1AU7A 2UUZA 1JWHC 1Z7LA 4L5EA 1O3RA 1OCCH 2MBFA 1A5JA 4HSRA 3OL3A 2JIMA 4N4OB 4PDKA 2V6EA 1UZCA 3KP6A 2QKLB 4F3QA 2UXXA 3GZNB 3S2DJ 3E6CC 3I56I 5LD2C 1VQ6I 2RVCA 2VLAA 2DK5A 4EJOA 4BACA 3IL2A 4G7HF 2COBA 2HQ5A 4CYDA 4FX4A 1MBGA 1B1BA 3W2AA 4KISA 1Y8RB 3ASOH 3OYMA 4HGYA 1ZTRA 3DWLE 3DPTA 2MD5A 1YJW1 3R4KA 3JRIA 4KITB 3VYSB 2CRGA 2L02A 1T38A 4ON0A 3MQ0A 2A6HF 1LQ1A 4QTTA 2IEKA 3BJAA 2JA7I 1YJNZ 2V9PA 5LFAA 4KMFA 4BNCA 5DTDA 1MW7A 3OYIA 3O2PE 1MJBA 1IC8A 4XKVA 4LK0F 2H6CA 5AIQA 2WTEA 4WXHA 4EJWA 1DPRA 4O6JA 1LPQA 5HVQC 5D5UB 1G4DA 1MMDA 2V1UA 2M87A 4CHUA 3PO2I 2DT7B 2V26A 3U21A 2V1DA 3GO5A 4A3MJ 1I39A 1GV5A 2XKOA 1X3WB 1YW7A 2DODA 1XCVA 3BZCA 3HSEA 1YIJI 2I3CA 5JHFA 2LKSA 3V8JA 3HRUA 4K2EA 4A3FJ 5LGNA 1Z91A 2RN7A 3ZMZA 3BT9A 3WHBA 3H35A 3K4CA 9ANTA 2RREA 3TO6A 5AIPA 1Y39A 4OU0A 3M3YI 5F64A 3E5XA 4L5JA 3N05A 4PFPA 1B9NA 3L09A 2NVUB 1I50I 2A69F 4HW0A 1VQ81 4CZZA 1J7KA 2ACJA 1HKTA 1KQ9A 2XV4S 2IXSA 3V4GA 2LF7A 3CLOA 1S29A 3CC7I 4UNOA 4P9UA 1OCOH 2CV1A 2R7VA 3BTLA 3CCVZ 4XR6A 2IJLA 3I5UA 3LQRA 1S7EA 2CV2A 1P9NA 2YPRA 3ABLH 1ETQA 3QPHA 1D5VA 2MA3A 3I551 3TKYA 3G1OA 4QIWN 3K70C 3QWUA 1Q811 2CMPA 3WTYC 3WE3A 5FJ8J 1USPB 2GA2A 3LA7A 1Z05A 3ELKA 2K4JA 1MBEA 2OZ6A 4CICA 2JIPA 3MN2A 1OYYA 4RVGA 3LFKA 3K9TA 4A3DJ 1VQ51 4KJZA 5GADJ 4F93B 4F91B 3WGIA 1Y8CA 1IRXA 1BJAA 3CCM1 2EZKA 1IN6A 3KYCB 1TWFJ 2ZXIA 3PQJA 2Z16A 1E3HA 4GYIA 3B02A 1QZEA 4HEA2 2R7TA 3EETA 4BJTA 3ZP5A 2D1VA 2Y0SA 3VYUB 4A3CJ 5L3CA 2HI3A 4O3MA 4J01A 3S1NI 4LIVA 5JLWA 2PMZA 1Z01A 4M9XA 1P9QC 1GDTA 4MTEA 1SEUA 3HOWJ 3NH5A 1VQP1 2M1BA 2W1OA 3S16I 4CCOA 1FEXA 1ETOA 4ABZA 1JGGA 3WODF 3FX3A 2PLYA 2YSRA 3A01B 2LOOA 2A61A 3TOAA 4EQQA 5FFXA 3EDPA 4A5MA 3HOXJ 3IF8A 2K9SA 1IN4A 4XK4A 1L3LA 5BPIA 4BJ5C 3JAMb 2E5NA 1X4PA 2VPZA 4ZYEA 1XCBA 4AVPA 3OL4A 3QP6A 1T0FC 4ENKA 1OYIA 4N9IA 2V9VA 3HZJA 3T0YA 5E8IA 4HOBA 1NJI2 1MKMA 4XIDA 4E2XA 2X1CA 2LEXA 3PO2J 3HG9A 3JTHA 5DD4A 1JJ2Y 3CME1 3E6MA 4FHTA 3GCFA 1QHGA 2ELKA 4FISA 1LKXA 2ADUA 2JS4A 3CCR1 2WWYA 1D1AA 4NBAA 5DCMB 1FOKA 3RSNA 1R9TJ 3DTEA 2QVOA 4KICA 3CDHA 3NH8A 3L2UA 2NVTJ 2XGDA 3RZDJ 1TT5B 2K40A 1MH3A 5HOOA 2DA5A 4IHYA 1VQNZ 3M9AA 2WAQA 1B72B 2BXZA 1ZKGA 2TDXA 2R5ZB 3SYTA 2M0MA 3GTOI 3VEPA 2QEX1 2NOJB 1W1WE 1YJWZ 4IO9F 3G73A 1ON1A 2QSFX 3E6BA 4BY1I 2GM4A 3ZMUA 4BEHB 5F1RA 2JUGA 2DT6A 2DA1A 1TNTA 4LIUA 2W24A 2L7ZA 3F0CA 3CUOA 3TO7A 4F55A 4II2A 1VLAA 3CCQ1 2KP6A 2GBYA 2FBHA 1DGRM 1HF0A 5HS9A 3DBLB 3C2HA 2ID6A 1BR2A 5K7FA 3JR9A 2CFXA 4LITA 2MC4A 1X1DA 1U2WA 4OIOF 3ZMVA 3ECHA 4HG2A 2R7OA 3Q0UA 2KRFA 2LFBA 1W4MA 5ICCA 2MG4A 1VQKI 1IRGA 3RZOI 2X4HA 4A93I 3G1MA 3VYTB 5D8KB 1GVJA 3HPGA 4NC7A 3N97A 2HZTA 2L7KA 2NS7A 4S04A 4IZZA 5FKKA 3OR2C 2FRHA 4I99C 3UR3C 3SHFA 3EERA 3KZZA 1IN7A 1SAXA 4KNYA 4HV5A 2VKDA 4JQFA 3IRRA 2E19A 4IPAA 5GTIC 1R00A 1R4MB 5J1YA 4HLYA 2JQ7A 3NWSA 1YO5C 3S1NJ 3GUDA 2FNAA 1T39A 4M3BA 1BR1A 2LK2A 4G94A 4GRIA 3S16J 3F6VA 1J9IA 3LUSA 1JI8A 3S1RI 4OAYA 2BZTA 3PNVA 4XL9A 1BI0A 4AYBN 4D5CA 1VQ8Z 3CCJ1 3SEZA 3DKYA 1LDKB 2V8JA 1YIOA 4E7ZA 1MDMA 1A31A 3I54A 2F48A 1W7PB 5FFZA 2F4OA 1XD7A 4ZYGA 3M4OI 3GVAA 4NBGA 3ZMTA 2PI0A 2XVCA 5FKLA 4NB5A 3BPXA 4QTRA 2GIZA 2IP2A 1MSEC 3P7NA 2EIJH 3QOEA 2R93I 5FKMA 1M901 2JA5I 2R7ZI 1KU7A 1WZ2A 4BQOA 4E2YA 1RPWA 1VQ5Z 2L54A 4KFCA 1I5ZA 3ZXSA 1PP7U 1M1EB 1ETVA 3NDIA 2XAGA 3CCMZ 3F8BA 3RQ4A 2E71A 4E2ZA 1P92A 3FBIB 2HTSA 3JRBA 1HW5A 2H6BA 1K7AA 2DFFA 5C4XJ 5AN9F 5HODA 3S3NA 2VBZA 4UUVA 3GFMA 1MBKA 2K9LA 3H3UA 1Z21A 1H9GA 1NH3A 1B4AA 3FHNA 1USSA 2KQRA 3JRAA 2CV0A 1VQPZ 2O7OA 3I3LA 3RJPA 2P5KA 3ZN1A 1BIAA 1IN5A 1IV8A 2BYVE 2DU9A 4H0EA 3QRFF 3D6WA 4BY1J 4NB9A 1X3ZB 2IGMA 4Z6YA 4M6XA 1ULYA 3J7A4 4LK1F 3I4PA 2H94A 1XG1A 1BOBA 2QF7A 2KZGA 1TW2A 2OU2A 4A6DA 1LE8B 3CESA 2AKLA 1HDPA 3LFUA 4EM2A 1T56A 4CH7A 1EH6A 3MFKA 4ZZDA 3LMMA 4I01A 2W25A 5J8FA 5HLHA 5L3DA 2OCEA 1IV6A 5E3LA 2EH3A 2EQRA 4CCNA 2EV5A 3H9QA 4BXXI 4C30A 1Z77A 5T6BA 2V8KA 3I4NJ 2A6TA 2MD0A 2Z99A 1YW8A 2JN6A 3R6SA 3SFZA 3WE2A 1X19A 1FBSA 4DJAA 3CMEZ 2L5QA 4XLCA 4D7NA 3CCRZ 1LDJA 3G1LA 3GZ5A 4MHGA 1K78B 3WG7H 2NVQI 4A6EA 4TV7A 5LHGA 1VQ9I 2UV1A 1SFEA 2ZSIB 3RKQA 2EGTA 3H36A 2Z3YA 3JREA 4NBFA 3EUHA 3ONQA 1GXQA 1Q1HA 2HOEA 1ZR2A 4MEXF 1Q16A 4IQ4A 1YG2A 3ULQB 1YJ9Z 2WAFA 1APLC 3JRDA 2QA4I 1M1K2 1R5HA 1QPIA 3KIOA 2KIFA 1ZR4A 2QEXZ 3T8TA 2H8RA 4LG0B 3DBRB 2A3SA 3F9KA 4HA8A 3SFIA 2KPMA 2E2IJ 2PJPA 4DOZA 2F2EA 4HH4A 3RKYA 1RIOH 3WTVC 2O03A 3S17I 2HKXA 2DA4A 3DXJF 2O53A 3DP7A 3UNGC 1W36D 3M4OJ 4YIFA 1V4RA 2M4KA 3GYHX 4MXUA 3G6E1 2D1HA 2E1MB 3IR7A 2R93J 3A03A 3PNTA 4KT6A 2BJOA 4OIRF 1QGPA 2FD5A 2OBPA 3K70D 3IH2A 4NC8A 5IP9I 1NHAA 4G7ZF 2A5YB 2EFNA 5FROA 1PDNC 1JGSA 1S7MA 3GW2A 4JX5A 4U7DA 3OY9A 3OYHA 4DIQA 3OR1C 2P28A 2HPMA 1VQ41 4L9VA 2DMUA 3L7WA 5F0HA 4XLEA 3CTAA 2XDVA 5F27A 1WCMJ 2QUFA 3CCVI 1YI2I 3JAMZ 4DGLA 2DI3A 2YU9I 1LFBA 4PJJA 4MD8A 2MH9A 2ECBA 5M3MJ 4EJUA 3QOPA 4RVHA 3F8FA 2VIXA 1YHQ1 1RR7A 4L5IA 3CQZJ 5EZHA 2VL8A 2NVYJ 2O8XA 1QVGZ 4G6TB 1DDNA 5H2FC 4Y33A 2KZVA 1OCPA 3S3MA 1U9OA 3CCJZ 1OKRA 1E2XA 4Y3OA 2BGCA 4R1HA 2FOWA 2OTL1 3H0GI 3HXLA 3SZPA 1MH4A 3HGYA 1VQO1 4GO1A 3DV8A 3F72A 5L3BA 2QQAA 2HXIA 4BE0A 5ILVA 3BPVA 2BHZA 2JT1A 1JKRC 4IHTA 1FMVA 2DJNA 3KETA 2V3VA 2YS9A 4DW6A 1QVTA 5D1OA 4IOAF 2LYCA 4LGWA 2Z2SB 4ZYHA 2LSOA 3GLXA 3I71A 4D7MA 4S0HB 4MO7A 2TRTA 5TRDA 3J7AY 1FSEA 3HOZJ 1FC3A 2F5CA 1AWCA 1F5TA 3GWZA 1V5FA 3FK7A 2VPRA 2R5YB 4MGRA 3RYRA 2G0EA 3QWLA 4L9TA 3MZ8A 2D45A 2DJIA 3MKYB 3D5LA 4QTUA 1VQ71 2XRNA 1IO2A 1X4OA 2X48A 2LREA 1T33A 2LY1A 3W2VA 2L2OA 2IRFG 3HPHA 1R1UA 1VZ0A 2LF8A 4C2UA 2RAEA 2K9QA 1W5SA 3HHGA 2FX0A 1SFUA 3B6CA 1HQCA 3IWZA 4AVZA 1XS9A 2E1MC 4Q48A 2RPRA 1V3FA 2JZYA 1KU2A 3K2AA 2WADA 2V9KA 4IHXA 2LR8A 4XOPA 3IRQA 4EWCA 2MYSA 5FLXf 3EQLF 5FRNA 1MZBA 2H1KA 2O4HA 2Z5UA 4L0YB 3OYNA 1J09A 4D1QA 4A3BJ 4PJMA 2Y2ZA 4KDPA 4RVFA 1W2BZ 3CDIA 1VQNI 2E1NA 3OSFA 2LIYA 2VPLA 4RAZA 2M7BA 3ABKH 5HLIA 1V55H 1Z3YA 2HDWA 2V8IA 1YJWI 2WB1N 3CC21 2VODA 3PUBA 4OINF 3RTRA 4HF1A 4CSWA 2V79A 3VDXA 3TEDA 3B73A 4A3IJ 1HLVA 4HNTA 2CQKA 5IOZA 3D1NI 5LGUA 1HCRA 2BEOA 2HF1A 1U0JA 1HSTA 1T6SA 2RV8A 3JW4A 3S2DI 2HS5A 5K7ZA 3OYEA 2K85A 4UUTA 4KIBA 3LSPA 3K1NA 5IP7J 4X6AI 2K4BA 2EZIA 5CKTA 1D8KA 4LB6B 1FSHA 1EJ9A 3D2LA 3TQNA 4EVIA 4E33A 1X3WA 1KONA 3GZ6A 5CQEA 2E34A 4I0BA 5B1BH 3W6KB 2QKDA 3H0GJ 4I6ZA 2FOKA 4RGXA 3OYDA 2AXLA 4ENNA 3CCE1 1Q862 4B8XA 3CMMA 4HZFA 4RGRA 3R61A 2STWA 2W85A 3FM5A 1TZLA 2HR3A 4WX9A 3ZCOA 2ID3A 2RT9A 2NRAC 4I09A 4CCJA 1S721 5KHDA 1RNIA 1WWXA 4EJTA 4PSWA 3BCAA 3KP5A 1W2BY 3SXYA 3LQQA 2F5EA 2RNJA 4C2TA 3S2WA 1ONVA 2FBKA 3I0TA 5GTHC 4A3MI 1JHFA 1AHDP 1I3AA 5EDNA 1JKOC 2O0YA 2VONA 2K5CA 4E7IA 1BL0A 1USPA 2R7SA 4IL6C 3GBGA 3CF2A 1SD5A 2EFPA 3K1PA 4A3FI 3U2RA 1YHQZ 3GEZA 4L9JA 5CYVA 3M8FA 2J5OA 1D0XA 3LSKA 3DEWA 2L4MA 2GTHA 1TP4A 4UY8I 4AD9A 1ACIA 2NAZA 3WTWC 3E1SA 2P5VA 1WJ5A 3FQQA 3EUHC 4ESBA 5C3EJ 2ZMEB 1KYZA 4CGZA 5DM6F 2KPIA 4JP0A 3OS0A 3V7CA 1OYWA 1VQOZ 1MMSA 1X2NA 1G6NA 3M8JA 2IV2X 3AG1H 5K7HA 3GCMA 4CCLA 3LAPA 5FLMJ 1S3JA 1UELB 1XDUA 1Z03A 3H9GA 3A01A 4FCYA 5FLXK 2JUBA 3FMRA 2PBIA 1PVEA 2E9HA 1TBXA 2BHYA 1B59A 1F4KA 1XPXA 1BJZA 1WPKA 1TNSA 4LJZF 4A3DI 4A3GI 2M45A 4PJLA 2RQPA 1VQLI 1IW7F 2Y48A 3TO9A 3JRGA 3PSFA 2O9LA 4BXFA 4W1UA 2ZCWA 1TWFI 1O7FA 2DFIA 2JRMA 3FMQA 4U0YA 3G71I 4MQVA 4NFRA 4AUXA 5CJ9A 2B9SA 4A3CI 2XPUA 3KFWX 1FT9A 2EZLA 3HKZN 5DDGA 1B8IB 3BWGA 4X6AJ 1F36A 2KDZA 3HOWI 4RA2A 2CQQA 3F21A 5DCMA 3ZQCA 1WJ2A 2IZ4A 1W7PD 2E5ZA 5KNLA 1A6QA 3MCZA 3CMEI 4M3EA 3WGGA 4BJ6C 3JSPA 4CA0A 1Z1DA 3ABTA 2DN0A 1KQSZ 4HX8A 1YUAA 1JJ8C 4DYRA 1SD4A 4LLNA 1KC81 1B72A 3RKWA 2R5ZA 3HB9A 3S1QJ 4QWQA 1ZGAA 3KLOA 2XUBA 3REOA 2VKEA 2BBYA 3WG9A 4CXFA 3T5XA 3IKTA 4LOCA 1YJ9I 4BEHA 2O5RA 4V19K 2EV6A 5F0FA 4UVBA 5FKNA 3TMOA 5HLGA 2BY0A 4JX4A 2FJ1A 2NOGA 2M0CA 1PP8F 3CC2Z 2GXAA 4A0ZA 1IUYA 1HW1A 1FMWA 3ZQQA 4IF4A 2VASA 1XB4A 1RR8C 2H85A 1FYLA 1FJLA 2QRDB 1R9TI 1HC8A 3WHCA 1DGWY 1T08B 2IA1A 1X2MA 4DGWB 3CF5F 5EYRA 2NVTI 2E2HJ 3RZDI 2P0WA 1NTCA 2XPVA 1GV2A 3HJEA 2JA8J 2ZMEC 3EUKL 3NEUA 1VQM1 4NDLA 3G2BA 4C3IJ 2Y9YA 5B1AH 4IRIA 1LB2A 5IT3A 4G6QA 1ZRDA 1WFXA 2DFEA 1O57A 1S7AA 4EATA 1RRJA 3MZHA 2RGVA 2EA2A 3VSLA 5IT9f 5IP6A 2NNNA 1WJEA 2LY9A 2E35A 1G2HA 3HOYJ 4XQFA 3PO3J 2IA0A 3CCEZ 1G3SA 3OYJA 2VF1A 1Z6TA 2W48A 4XRSA 4CL1A 5AONA 2ZXWH 2HYGD 4DYQA 1SC7A 1KQSY 5EEHA 4B4CA 1BW6A 2VBXA 2IW5A 1JJ2Z 1S72Z 2IGOA 3FKIJ 1NG7A 4E30A 1SFOJ 4A3GJ 2IGNA 3CC4Z 4PJ0C 2OTJI 4S05A 2KFDA 1MIJA 1W7PA 2FU4A 1QZZA 2JWTA 3BCBA 3DLAA 3ZN0A 4BHCA 5FD6A 3L1PA 2XHKA 2CWEA 4X0GA 2Y0MA 1LJ9A 5CVRA 5C4JJ 4CDGA 2ZC2A 3G3ZA 5D5VB 1P4AA 5IY5H 4Q4ZF 3GTJJ 2QR1B 4LMYA 2VI6A 1D0YA 3B6AA 4FX0A 2CYYA 2GXGA 1E0EA 2XSJC 4ESFA 1Q822 4UVCA 4ZZLA 4B47A 1OR7A 2O6GE 1OQYA 2RKHA 4RMNA 3GKQA 2ZJRF 5EG0A 1ZYRF 4A3EJ 4ASNA 3L2WA 2QKMB 2YX4A 4MTDA 1UHWA 3VMGA 2RC4A 1A36A 1GVDA 4KN4X 4ETSA 4A3KJ 3AKZA 4RGUA 2YUSA 2XAUA 1OPCA 2M4GA 1S8NA 1ZRCA 2CUZA 1N8R2 3HOVJ 1TW3A 1X3ZA 3F8MA 3I9V2 4XM3A 4WK8F 4NBDA 1YITZ 3C7JA 3ZRGA 3DQVC 2DAOA 4BH9A 5F04A 1YTYA 5DYMA 4M73A 1FY7A 1FDIA 1LE8A 1H89C 5FD5A 4EEFG 3VWBA 2R4GA 5E18F 3E5UA 1K9M1 3PO3S 1X1CA 2ELJA 2EJRA 3SQNA 3PUFA 2EILH 5FGMA 1Z9CA 1NG6A 1TWGJ 4ZDOA 2F5DA 4UUSA 3U1DA 5EZGA 5F0CA 5M5WJ 5C4XI 5FO5A 1LFPA 2R7WA 3I561 1VQ61 3BR2A 1LUJB 4XLHA 4NBHA 4XN0A 2Y0SN 3CMAI 5FRMA 1M1K1 4NHJA 3BG6A 4RM3A 3AG2H 3Q87A 2P8TA 4P55A 1O4XA 1K78A 1CGPA 2A68F 4UV9A 3WU2C 4WXCA 1FOYA 1FNNA 4P96A 4NNJA 4Y7NJ 4WCGA 4IVNA 2JTVA 3Q5FA 4MNUA 3ZQ7A 3A0HC 1YRNB 1PJRA 2HOAA 2ZBKA 3PM1A 1KD11 1U9NA 3ZPLA 2HNHA 4F92B 3LAJA 3CP8A 2JIQA 3HOSA 1UHSA 1YX5A 4LG0A 1P7IA 4XX2A 3S15J 5H20A 5IT9K 3K6GA 3HBLA 4HF0A 1JE8A 3QYFA 4YRVA 4G12A 3MKZA 3BP8A 3I4NI 4B44A 1IG7A 3FIWA 4U88A 2B63J 2I5UA 2FBIA 2QQ9A 3DPUA 1JJ6C 1RUNA 5FKOA 3IX0A 1QVUA 2Q1ZB 3DU5A 2GZWA 1SMYF 2VT3A 3LA3A 2Q0OA 4OWRB 4ZDLA 4KA4A 1YIJ1 3M7GA 2Z9OA 3M1EA 1L1OC 2FQ4A 1Z67A 2MSYA 1YLFA 2IZ3A 1CF7B 1DU6A 4RAGA 4RBOA 2DMQA 2E7WA 1R22A 4F7ZA 1ZELA 3I59B 3CCLI 1S9HA 3KP2A 1I1SA 1SVMA 3W2WA 1Z7UA 1IAWA 2HU9A 3GTQI 2GWRA 1LDDA 3S2HJ 4KIGA 2E2II 3BQZA 1RLYA 3CC71 1EKEA 5BNGA 3J7AO 4PUSA 1D3YA 4BBSJ 4RGSA 3NFZA 1UG0A 4FASD 4MLOA 1WJCA 4B3AA 3NWTA 3I55Z 5EEAA 3KLNA 2DPUA 2IS6A 2XAFA 1ORKA 1ODDA 1IRFA 2R7XA 5JFRA 5E1XA 3BDDA 1ZB9A 3T8RA 5GAHJ 3HYIA 2WV0A 2EB7A 1DU0A 2VPWA 5B66C 2LVSA 3H5AA 2M2EA 2JIOA 2K27A 4FETA 3OS2A 2TCTA 3ZMSA 5J8CA 1K6YA 3E7LA 5EG0B 5JHUA 5EJCA 2JNYA 1MNDA 3CCSI 2FMYA 2ZNYA 1WCMI 1VQOI 2ISYA 2EV0A 2LDUA 4GGGA 2DE6A 2XB0X 1AKHB 3LOCA 2PQ8A 3U1KA 2O8KA 4RV9A 3MONA 2DW4A 2ZJQF 1JUSA 4BQNA 3CQZI 3FWEA 2BVMA 2NVYI 4C2MJ 3C18A 4CZCA 4ENJA 3L2RA 3GXOA 4A3JJ 2R5YA 5D1PA 1VFCA 2Z1DA 1WI9A 1VF9A 3OYLA 4OIPF 3P5JB 2R7QA 2E2JJ 4GYGA 4FTHA 5IOYA 2DA7A 4RM2A 2F5VA 1ZG1A 2VQLA 3KYDB 3HTSB 1MNEA 2X1DA 3IAM2 3DTIA 1FOXA 3DKWA 5JR3A 2GIVA 1KA8A 4W97A 3V8LA 4UUSB 2P7VB 3OSGA 2W04A 3BTJA 2HQRA 3BZ6A 3IFUA 3S3OA 4ZTJA 2L01A 4M6VA 3BG0B 1YOVB 2DQLA 4PSXA 4NH1C 3FBNB 1N77A 2DA2A 3DU6A 3I4MJ 3IH3A 3VMHA 3J81f 1XMKA 2CG4A 1UJ8A 4FQGA 3ERMA 3HOZI 2EZHA 2KJBA 1RI7A 4DYCA 1LEBA 3KP7A 3EYIA 3ROUA 2PFBA 4Y15A 1QU3A 1YJNI 3TGNA 3I56Z 1VQ6Z 1MMNA 2G7HA 2DTRA 3GTPJ 4LB5A 2FF4A 5F08A 5M3FJ 2VPXA 2PEXA 4UB8C 4CCMA 1L0OC 1TWAI 4E70A 3IC7A 1QYPA 3GTQJ 2CSOA 3H3VJ 1YS6A 3CC2I 1USTA 5LEJA 1OMIA 4YIRX 1RUOA 2ZSHB 3CCQZ 2QBYB 2CU7A 1FP1D 3K7AJ 5T64A 2M9HA 3VFZA 3GTGJ 1OR7C 5FLXb 4GFBA 1Y8QB 3PJRA 5LL6f 4A3BI 4PZJA 1LFUP 1XGSA 4IRGA 2LBFB 1VQK1 1O7LA 2COMA 4LFUA 3LSMA 3OWTA 4U87A 1TWCJ 1XDSA 2E1OA 2HDCA 2KMUA 4XLNF 2L7FP 3ZQIA 2EINH 1ETWA 3MZYA 2RDPA 4XRFA 5DM7F 1LQLA 2FQ3A 1R1VA 2Y69H 3M8EA 2IS1A 3AG4H 1K4SA 2YX7A 2PM9A 5CM2M 3JRHA 1WRJA 4XSZF 1YIJZ 3EEDA 1FTTA 1ENHA 3CCEI 1I3QJ 1R71A 4A3II 3ZQGA 3F6OA 4BDYA 3O6BB 4A3LJ 3J80f 1I27A 1WH7A 2AHQA 3KIFA 1QNTA 4ANJA 3Q9VA 4HBLA 3R0JA 4BS9A 3FDYA 2HOTA 5D5XB 1PFTA 4UHTA 1SFKA 1AOYA 2OQGA 2HFHA 2HKOA 4RAYA 1OJLA 4HAMA 2VJJA 5IP7I 4Y4RA 1QA6A 1FYMA 4MONA 1O3TA 3CC7Z 1G8XA 1BC8C 4E7HA 3CC4I 2RIQA 1Q7Y2 2H09A 4XLAA 2DDBA 2CQNA 4IHWA 3BLYA 2DOAA 1R6RA 2HGCA 5KAFC 3D5RC 2NXNB 2RNGA 5L3FA 3CP2A 1XMAA 3KPHA 1BR4A 1J75A 5EGOB 5KK1A 2DFHA 3K4BA 4QSHA 1Y1WJ 3FKJA 1OFCX 3HUGB 4HQEA 1G3TA 1RO0A 2BOLA 2XAQA 3VB9A 2R0QC 3CD61 5HLTA 3VYRB 5FB2A 4B1RA 2YR2A 2ZMEA 2H1LA 5DUIA 4YEJA 4DQYB 4P9FA 2PN6A 3ZQFA 1KU9A 2XAJA 2EPFA 1ZQ3P 1LVAA 2HTJA 2CJJA 4KYWA 3E0JB 2E36A 1H9TA 4E7LA 4BBRJ 2QSHX 2JMWA 2R7RA 2DXIA 2CQXA 1SD7A 3DFGA 1IXCA 3J81K 2WB1A 4I76A 4XORA 1DUXC 3MZKB 4XKCA 1TWAJ 1YITI 3HDDA 2ME6A 1KQ8A 2XGEA 1OLTA 3BY6A 1H88C 1T2KA 2PG4A 3FK6A 2DYSH 1KRLA 2L4AA 3M1CA 3OS1A 3COAC 1YUKA 4V2GA 3MAJA 3WGHA 5A2Qf 1D1CA 2MGQA 4OIQF 1WI3A 3ABMH 4FE4A 4IXAA 4BHBA 4CYCB 3K0LA 5C3EI 4UV8A 1PUFA 4U0WA 1B8IA 2UZKA 3G4S1 1Y1VJ 2HYFA 2QLZA 5FLMI 2AXTC 1IJWC 1OCTC 4Q47A 2JRTA 4RDUA 2VBYA 1ZLKA 3TDZC 5D4RA 3H0DA 3VSKA 4HF2A 1ZHFA 2QQBA 2I10A 1UFMA 1R23A 1LEAA 3RPUA 5J1UA 2HEOA 2HXOA 4PGHA 1Z02A 2MFZA 3AFHA 3DCFA 2BVLA 1K8A2 2NVXI 5JLXA 3HHHA 4WWCA 1XSXA 2QWWA 4DBQA 1GHCA 1TFIA 4M74A 3BG9A 1WZNA 1LNWA 1F1ZA 5JVGF 4HRIA 2IPQX 2QA41 4UB6C 2X1EA 4NBBA 2C6YA 1AA7A 1O3SA 2X85A 3HOTA 2GTIA 1NUIA 1Y6IA 1TL8A 3KZIC 3GTMJ 3J80K 3OYFA 4E7JA 2WA0A 3ERED 5LHIA 2OJED 3NRVA 3RIRA 4A2UA 2MH2A 3Q0WA 3TBIA 2CS3A 3PQKA 2OCCH 2K9NA 5IPAA 2HPIA 4RB2C 3I53A 5E1WA 2QYOA 2R6MA 3HRMA 2JJ7A 3G6EZ 2V1XA 3S14J 2KRHA 4A69C 3MD2A 3S1QI 2R92J 1QPMA 1VI0A 1U5TB 4QPQA 1JT0A 4M6YA 2NAPA 2P4WA 1Y56A 1D8JA 3S1MJ 1IUFA 2F4MB 2OZKA 2QCOA 1Q1VA 2OUMA 3W6JB 2LD5A 4NB8A 1VQ8I 1ZH1A 2ZXHA 2EWNA 2M6NA 3FF5A 3LSHA 2DPDA 3DEEA 5ED4A 3L9FA 1VQ4Z 2CFOA 5DS9A 2HDDA 3BG5A 1SVLA 3NQOA 1YI21 3WTXC 4JBAA 3QP5A 1Y1VS 3HC7A 3I55I 4I7HA 1U78A 4RB3C 1TLHB 3EYYA 4P5OA 2E2HI 1T95A 5DCFA 5EF6A 4BAYA 1BI2A 1Q821 1U6GA 2GOXB 3C3WA 2JA8I 3GMEA 3BR1A 3PIOF 3HSFA 2HVQA 1N25A 4IHSA 3TE5B 3P9IA 1P6RA 3K4KA 1T98A 3LSGA 5E3NA 4S1TA 1QVFZ 2X6YA 3FXOA 1VQ5I 2Q4ZA 2HQNA 4XICA 1S6LA 3HRTA 4KMUX 1K732 2OTLZ 1WW9A 2V4JC 3H5RA 3CCMI 3A4CA 3I64A 2LKPA 2VQGA 5L3GA 5IT9b 1WHUA 2P3YA 3QQAA 3HOYI 3PO3I 4IX7A 5T67A 3HKZA 2PMHA 1K6OA 2WBMA 2QSGX 2XF7A 3FMSA 5HS8A 3PL8A 3JSOA 1WJFA 4BGDA 5B3SH 2DE7A 4XRSG 3FHZA 1QXFA 6PAXA 3OOUA 1MBHA 4IJAA 4DQ2A 3EPZA 5KVRA 5ERIA 3CD6Z 5A2QK 1VQPI 1HXDA 1NJI1 3U50C 2JPBA 2GU2A 3GTMS 2M8GX 3FKII 3C1DA 1GXPA 2K86A 1SFOI 4ENMA 1Y0NA 3OV8A 4YG2F 1RKWA 5C44J 2R7FA 2MLKA 3HOXI 2NVXJ 3F8NA 1ZAOA 3ECOA 5F1JA 1DP3A 3ZR8X 3SDBA 2EFWA 1VQ7Z 4XKWA 4O5VA 5C4JI 2JSPA 3RDIA 1J5YA 2DCEA 2E7XA 5FLXZ 2BY1A 1TWHJ 5E3MA 1UAAA 3SJMA 2CW8A 3GTJI 1WJBA 2OV7A 5DEQA 2A6EF 2VOOA 1R36A 1PUFB 4JYKA 2RHBA 2VUGA 4BXUA 4XONA 3E6DA 2DMNA 1U3EM 2BW3A 2OA4A 4R79A 5EEGA 2K3PA 1IF1A 4BHPA 2HOSA 1KU3A 4B48A 4GXOA 3DPLC 1U5TC 3OIQA 4ZJZA 4A3EI 3RCOA 3GF2A 2CW7A 5E3OA 1SVOA 3CCRI 1QVFY 1X1BA 2M48A 3WU1B 1ZREA 4NQWB 2Q2EB 1EA3A 5J4YA 1JKQC 3G4SZ 2JPCA 5LGTA 2B7EA 4A3KI 5D6FA 1Y0UA 1A35A 1WKMA 2XIGA 4OMZA 5J4VA 3SZTA 2W84A 1VQN1 3FXKA 1XGMA 3HOVI 3HOUI 2GAUA 4EM0B 2ZB9A 3OYCA 4Y17A 3MVPA 2QEXI 2EIMH 3I58A 1YRNA 4CUGA 1C0WA 3V7RA 1MSFC 3HIFA 2Y31A 1VQ9Z 4M9SA 1MGTA 4G9YA 2V7FA 3CZ6A 1BN5A 3CMYA 3CCQI 3IHUA 2M7AA 3LSIA 2XB5A 4PCQA 1TWGI 2Y30A 3Q0VA 4M3GA 2HQAA 5HS7A 3F23A 2QA4Z 3IP4B 3H9JA 4MQ9F 3CXCZ 4D5FA 4XRMA 1FLIA 2VQCA 3OYKA 4WF2A 1X1PA 2J6AA 3CCU1 2IAIA 3M07A 1JUPA 1ERDA 1HW2A 3QPLA 1WJAA 2QRCB 3AAFA 2V1NA 1X3UA 2ZFUA 4PK4A 5F6FA 3GTKI 1FX7A 3P9KA 1DQUA 2BXYA 4BDZA 1IDZA 1STZA 5IYBJ 2YU3A 2CGPA 1X0TA 4DZJA 3D0SA 4A5NA 1CF7A 4Y7NI 3TL4X 1Z0XA 4NBCA 1YE9A 4M3FA 3I59A 1H0MA 1FDOA 1NP6A 3BZKA 4ZC3A 5ICEA 5IYCJ 5LLQA 4OOIA 3S15I 2PMUA 4J00A 3SDGA 3ESWB 1REPC 2EFOA 2DA6A 3QAHA 5ICFA 1XTAA 3K2ZA 5J1RA 1W36C 2B63I 3DEUA 3VOEA 3D5SC 1FOWA 1W5CC 1YI2Z 2UXNA 2FMLA 3FZVA 3J7YJ 2R7UA 2QZ8A 3LNQA 4KUMA 4M9ZA 1W5TA 4BYYA 5K5RA 1FYKA 2ZAEB 4HNVA 1RC9A 1ZARA 2XPWA 1ON2A 2CW0F 1I6HJ 1K83J 1R58A 2R7DA 2PJRB 4Y52J 4LD5A 2EA4A 1RKTA 4IKFA 1R7JA 1ZLJA 3CJTB 2OD5A 3ZOBA 3LSRA 1BW5A 3CXCY 5GAEJ 1BOAA 4XOTA 1FBUA 3QPTA 4HX7A 2KDOA 1E17A 2QLVB 3AG3H 1ZK8A 3S2HI 3P9CA 4N4NB 2LMDA 3L00A 3HTUA 3IAS2 3K4MA 4BE2A 4FT8A 1QRYA 5D4SA 1R5GA 5LRSA 1ZGWA 4BBSI 1UB9A 2DA3A 2ESNA 3LSTA 1AKHA 2MLGA 3JRCA 2VE8A 3KYLA
chains in the Genus database with same CATH topology
4BQNA 2HVRA 3J7AY 3CQZI 2AQFA 3K4NA 2OOXB 2BVMA 2WAEA 2NVYI 4MRIA 4CZCA 1V5FA 3A1YA 3L2RA 5D1PA 3BC8A 3IUOA 1N75A 1SAUA 1TT0A 2Z1DA 3QYBA 2DJIA 3MKYB 3D5LA 1QF8A 4QTUA 2JVHA 3MMYB 3OYLA 1VQ71 1X4OA 3P5JB 2LREA 2E60A 2VXDA 1K83I 2JR6A 2LY1A 2R7QA 3W2VA 2L2OA 1YIT1 3HPHA 1VQL1 4Y52I 1VZ0A 4C2UA 2BW3B 4RM2A 2F5VA 3DKXA 1RO4A 4DK1A 1DL6A 2VQLA 3KX2A 4OAZA 4HSTA 1MNEA 2VJIA 2X1DA 3IAM2 3VTNA 3DTIA 2F6CA 2W7NA 5TGTA 3G711 2UUZA 4AVZA 1JWHC 1Z7LA 2W04A 2E1MC 1I6HI 2RPRA 2W03A 4HSRA 2WADA 3H5NA 3OL3A 2V9KA 3S3OA 4ZTJA 3IFUA 4XOPA 3BG0B 4N4OB 2V6EA 4EWCA 2MYSA 4PSXA 4NH1C 3FBNB 5FLXf 1N77A 2VUMI 3DU6A 4F3QA 2QKLB 5FRNA 2X6XA 3KEYA 2O4HA 5LD2C 3VMHA 3J81f 2VLAA 4BACA 3HOZI 4RLFA 4E4HA 3OYNA 1J09A 4D1QA 4A3JI 3HL2A 4PJMA 3W2AA 4KISA 3OYMA 4HGYA 4RVFA 1W2BZ 3DWLE 3DPTA 5CQGA 1QU3A 1YJW1 2LIYA 3I56Z 1VQ6Z 4KITB 2VPLA 2M7BA 1MMNA 3VYSB 2E2JI 1Z3YA 2HDWA 2V8IA 4QTTA 3CC21 3PUBA 3RTRA 2JA7I 1YJNZ 4CCMA 1TWAI 5LFAA 4AYBA 4CSWA 1QYPA 3CPWZ 1YJ91 3VDXA 1MW7A 3OYIA 1ML8A 3H3VJ 3QYEA 4HNTA 4XKVA 4B3XA 2HF1A 1U0JA 2ZSHB 3CCQZ 1HA8A 5T64A 5HVQC 1MMDA 1OR7C 3I4MI 5FLXb 3S2DI 3PO2I 3OYEA 2DT7B 2V26A 3PJRA 3U21A 4X6AI 5LL6f 5CKTA 3J81b 4A3BI 1KC82 1VQK1 2LBFB 2LBFA 4E33A 1X3WA 1KONA 3LSMA 3OWTA 4U87A 5CQEA 2I3CA 2QKDA 5JHFA 2KMUA 1VQMZ 3GTPI 3CCUZ 1LQLA 2W4SA 2XF5A 2VJ5A 3OW2Z 3OYDA 3CCE1 1Q862 4BQQA 2IS1A 2RQQA 1V5EA 5CM2M 3CMMA 3H35A 3K4CA 2RREA 5CPRB 4BU2A 2UWMA 2PM9A 1YIJZ 3M3YI 3BG1B 3EEDA 5KCMA 4A3II 4BDYA 3J80f 3N05A 4PFPA 1TZLA 1Q7Y1 3CJRB 3ZCOA 2RT9A 2LY2A 1I50I 4CCJA 1VQ81 1S721 5KHDA 1RNIA 3KIFA 4MH4A 3K7AI 2IXSA 2CH0A 4PSWA 3BCAA 4ANJA 4BS9A 2R7VA 1W2BY 3FDYA 2CV1A 1PFTA 3CCVZ 4XR6A 3GTGI 1SFKA 4C2TA 2CV2A 1P9NA 5HNHA 3I551 4A3MI 2VJJA 5IP7I 4Y4RA 4MONA 3K70C 3QWUA 3CC7Z 1G8XA 1Q811 2CMPA 3LL7A 4E7HA 2K5CA 4E7IA 1USPA 1USPB 3CPWY 2R7SA 2RIQA 1TWCI 3GBGA 2HZDA 3CF2A 1Q7Y2 4XLAA 2OTJ1 1LVKA 3BLYA 2DOAA 4A3FI 1YHQZ 1R6RA 4RVGA 3JAMf 1VQ51 4KJZA 3D5RC 1D0XA 3LSKA 2RNGA 4F93B 3S8PA 3CP2A 4F91B 1BR4A 1IRXA 2VJ4A 2GTHA 3CCM1 2JA2A 3K4BA 3FKJA 1I3QI 2ZXIA 3HUGB 2Z16A 1RO0A 2BOLA 3VB9A 4A3LI 4XMYA 3E1SA 4HEA2 2R7TA 3AL0B 1WJ5A 3FQQA 5HLTA 1Q812 3VYRB 3J80b 3EUHC 4BJTA 4CCKA 3CD61 2Y0SA 3VYUB 4YEJA 4DQYB 2KPIA 3OS0A 4J01A 2K3RA 1VQOZ 4LIVA 4E7SA 3OYBA 2PMZA 1Z01A 3S1NI 4E2WA 1P9QC 3M8JA 3D9XA 3NH5A 3OW2Y 1VQP1 2W1OA 3S16I 4CCOA 4CCLA 3E0JB 4HNUA 1UELB 4E7LA 1Z03A 3H9GA 2LH9A 1QVFY 2LFUA 2LOOA 3VMIA 2K9MA 2JUBA 2E9HA 2R7RA 2DXIA 4C9YA 2HVSA 2X6WA 2WB1A 4XORA 3IF8A 3MZKB 4A3DI 4A3GI 4XKCA 4PJLA 4D9JA 4BJ5C 4XN3A 3JAMb 2E5NA 4E7KA 1X4PA 3PSIA 3PSFA 4BXFA 1OLTA 2M3AA 1Y1WI 1TWFI 3OL4A 1KRLA 2L9SA 3M1CA 3OS1A 1MMGA 1T0FC 1YUKA 2KL4A 5A2Qf 4NFRA 1D1CA 1VQLZ 1M1K1 5C3EI 4A3CI 1NJI2 4E2XA 2X1CA 4ZTFA 3HG9A 1JJ2Y 3G4S1 1K8A1 3TDHB 3CME1 3GCFA 1QHGA 3G71Z 2JS4A 1LKXA 2GOMA 3CCR1 3HOWI 1D1AA 4NBAA 3GTLI 3RSNA 2IZ4A 5FLMI 2E5ZA 3DTEA 5KNLA 4BBRI 3I07A 1Z3XA 3DTKA 4BJ6C 3NH8A 3L2UA 3CMA1 4PFOA 3VSKA 3H0DA 4CA0A 3L2QA 5HOOA 3L2VA 1KQSZ 3OIPA 1YUAA 1VQNZ 1VQ91 2WAQA 1Z02A 1KC81 1K8A2 2MFZA 3AFHA 2M0MA 2BVLA 3SYTA 2NVXI 3GTOI 2YADA 3OMYA 2QEX1 1K9M2 2NOJB 1YJWZ 4BY1I 4DBQA 4BEHB 4BEHA 3OYAA 2JUGA 2DT6A 1TFIA 2O5RA 4JOMA 1Q861 4LIUA 2JA6I 3TMOA 4HRIA 2QA41 4F55A 2X1EA 4II2A 4BE1A 1VLAA 4NBBA 5A2Qb 3CC2Z 1AA7A 3CCQ1 2KP6A 2X85A 3HOTA 1FMWA 1DGRM 2A5WA 1NUIA 1Y6IA 1Y1VI 2GTIA 3C2HA 3ZQQA 1BR2A 2VASA 3OYFA 4LITA 2WA0A 2MC4A 4E7JA 1X1DA 2H85A 2QRDB 1R9TI 1DGWY 3K10A 4HG2A 2R7OA 4DGWB 4TNUA 1V5GA 4F52A 3TBIA 3C2GA 2CS3A 3AL0C 2NVTI 3RZOI 3RZDI 2P0WA 4A93I 2HPIA 3VYTB 3EUKL 1G59A 3HPGA 4NC7A 3A2KA 2R6MA 3G6EZ 3G2BA 1VQM1 2LC2A 2L7KA 1KD12 2K5RA 4QPOA 5HNFA 2KRHA 4P1WA 4IZZA 3MD2A 4BL0B 2DE5A 3S1QI 3OR2C 4QPQA 3UR3C 1WFXA 2X51A 1WIIA 3EERA 4EATA 2VKDA 1Y56A 5IT9f 3VSLA 4JQFA 3MKWB 2KI7B 2F4MA 2OZKA 1WJEA 3CCL1 2OUMA 4XQFA 3QODA 3CCEZ 3NWSA 4BY7I 3OYJA 4NUBA 4NB8A 2VF1A 1ZH1A 2ZXHA 3K4LA 2M6NA 3LSHA 4CL1A 3SEQA 3DEEA 1VQ4Z 1BR1A 4GRIA 2CFOA 1KQSY 3GTMI 3LUSA 1K731 2XC7A 1JI8A 3NH4A 3RPUD 3S1RI 1YI21 4OAYA 1D0ZA 3PNVA 4XL9A 1Y1VS 3HC7A 1VQ8Z 1JJ2Z 1S72Z 3CCJ1 2IGOA 4P5OA 1NG7A 4ZYAA 1T95A 3SEZA 1Q821 3DKYA 4E30A 1LDKB 2E2HI 2GOXB 2V8JA 3ZGKA 4E7ZA 2JA8I 2IGNA 3SZGA 3BG7A 2G2KA 3CC4Z 3BCBA 2HVQA 3DLAA 2F4OA 3MZLB 3TE5B 3M4OI 3S14I 3K4KA 3LSGA 3S93A 4NBGA 4S1TA 1QVFZ 2X6YA 2R92I 4X0GA 2Q4ZA 4XKBA 2JMOA 2R93I 1K732 3QOEA 3S1MI 2OTLZ 1WW9A 2V4JC 3H5RA 3PNYA 2IGKA 3A4CA 4E32A 2OTJZ 2VQGA 1M901 3F3PC 2JA5I 2QR1B 2R7ZI 5IT9b 1D0YA 2P3YA 3HOYI 3PO3I 4BQOA 4E2YA 4IX7A 1E0EA 3HKZA 2XSJC 5T67A 1VQ5Z 2WBMA 1Q822 2XF7A 4B47A 3PL8A 3ZXSA 1WJFA 3CCS1 4BGDA 3CCMZ 3NDIA 2DE7A 4RMNA 3RQ4A 4AU7A 1MMAA 3OOUA 4NOZA 4E2ZA 3GKQA 1YX3A 3FBIB 3EPZA 4E6KG 3L2WA 3PFYA 3CD6Z 2QKMB 5AN9F 3S3NA 1NJI1 1GLNA 3U50C 2GU2A 3GTMS 3FKII 1M902 2K9LA 3VMGA 1RQFA 1Z21A 4NBEA 3NDJA 1SFOI 3FHNA 3S32A 2KQRA 2CV0A 3HOXI 1VQPZ 3AKZA 3I3LA 2XAUA 2M4GA 2VKHA 2CUZA 1N8R2 1DP3A 3ZR8X 3SDBA 4ZDPA 3D6WA 4NB9A 1VQ7Z 1N78A 4XKWA 1X3ZA 4HGZA 5C4JI 2JSPA 3I9V2 4XM3A 2DCEA 2IGMA 4NBDA 3ZRGA 1YITZ 2W00A 1UAAA 3GTJI 2CW8A 3J7A4 1WJBA 2OV7A 3DQVC 3MONA 1BOBA 2F4IA 2RHBA 2VUGA 4XONA 2AKLA 3CESA 4YELA 2BW3A 2JVGA 2R4GA 3LFUA 2I8DA 2KRCA 4BUPA 4CH7A 4R79A 1K9M1 2K3PA 1X1CA 2ELJA 3LMMA 3PO3S 4B48A 1NG6A 2LRDA 3DPLC 2IS4A 4ZDOA 4RS4A 4CCNA 3OIQA 4ZJZA 4A3EI 3RCOA 5C4XI 3H9QA 4BXXI 2CW7A 4C30A 4PJNA 3FQMA 5T6BA 1LFPA 1X1BA 2M48A 2V8KA 2A6TA 2VB6A 2R7WA 1QVGY 4NQWB 2MD0A 2Q2EB 3I561 1VQ61 1EA3A 3G4SZ 4XLHA 4NBHA 4XN0A 1X19A 4DJAA 5FRMA 3CMEZ 4A3KI 4RVDA 1QHHD 2L5QA 3BG6A 4RM3A 5C44I 3Q87A 4XLCA 3CCRZ 2MABA 4XLFA 4HPQA 2NVQI 1YJN1 1VQN1 3HOVI 3CJQB 3W3CA 3HOUI 2UV1A 3CMAZ 2ZSIB 4NNJA 2EGTA 2VXZA 3OYCA 2L9NA 1TWHI 4NBFA 4LG3A 3OYGA 3ONQA 2VQHA 1PJRA 4CUGA 1KD11 4IQ4A 1X1AA 1VQ9Z 1YJ9Z 2WAFA 2V7FA 2HNHA 4F92B 1M1K2 1D1BA 3CP8A 3CZ6A 3HOSA 4B43A 2QEXZ 1YX5A 2M7AA 2WY8Q 3LSIA 4XX2A 2W82A 3F9KA 3K6GA 1TWGI 4DBRA 2KPMA 1RO2A 3QYFA 4YRVA 4DOZA 2HQAA 3VWBA 4HH4A 2QA4Z 3MKZA 3IP4B 3H9JA 3I4NI 3S17I 4B44A 3CXCZ 1ZB8A 2VQCA 3OYKA 2J6AA 2O53A 3CCU1 3DPUA 3IX0A 3UNGC 4U7BA 1W36D 1ERDA 2QRCB 2Q1ZB 1WJAA 2RBLA 1VQKZ 3DU5A 2M4KA 2V1NA 4MXUA 3G6E1 2ZFUA 4OWRB 4ZDLA 4PK4A 2E1MB 1YIJ1 3PNTA 4MD9A 3GTKI 4KT6A 2BJOA 1DQUA 4XNFA 1L1OC 4BDZA 4Y7NI 2IZ3A 1X0TA 3K70D 4NC8A 5IP9I 3TL4X 4NBCA 1YE9A 1ZELA 5FROA 1NP6A 4ZC3A 1S7MA 1S9HA 3CCV1 2OC6A 2P28A 3W2WA 3OY9A 4RLQA 4DIQA 3OR1C 3OYHA 2HPMA 2Q51A 1VQ41 3S15I 4J00A 2AQEA 2HU9A 2WY7Q 3ESWA 3CCSZ 3GTQI 4XLEA 2XDVA 2E2II 3CCLZ 4H4KC 1RLYA 3CC71 2PK7A 4PUSA 4DGLA 2YU9I 4II3A 3EUAA 4PJJA 3NFZA 4MD8A 1UG0A 4FASD 1W36C 4MLOA 4RVHA 1WJCA 2KLOA 2B63I 2LG4A 3NWTA 1N2FA 3I55Z 2VIXA 3K4JA 1YHQ1 3D5SC 2IS6A 3T4NB 2VL8A 1QVGZ 4G6TB 4ITVA 1YI2Z 2KHMA 4Y33A 3CC41 2R7UA 2R7XA 2KZVA 3KIHA 2QREB 3S3MA 1ZB9A 3V42A 2ZAEB 3CCJZ 2IS2A 4Y3OA 1PYVA 3H5AA 2OTL1 2OOYB 4E31A 2PJRB 2PJRA 3H0GI 3HXLA 4IKFA 4FETA 1N8R1 3OS2A 3CXCY 1VQO1 1K6YA 2CUJA 4XOTA 4IQJA 4BE0A 2JNYA 1MNDA 2FUG2 2KDOA 2QLVB 1FMVA 3S2HI 1WCMI 1WJDA 4N4NB 4MD7A 5D1OB 4BE2A 3IAS2 3K4MA 2DE6A 5D1OA 2LYCA 2Z2SB 4BBSI 2XF6A 4RV9A 3KYLA 3F3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6K G;  1Y56 A;  2HU9 A; 
#chains in the Genus database with same CATH topology
 5BMZ A;  1UHM A;  1JTX A;  3ASN H;  4HYE A;  3E97 A;  3FXR A;  2WAE A;  4MRI A;  3HOU J;  1TQI A;  2QM3 A;  1N75 A;  1SAU A;  2JK3 A;  3FXL A;  3QYB A;  4HX4 A;  3ABU A;  1QF8 A;  1H8A C;  4HV6 A;  1AA6 A;  1HKS A;  3MMY B;  1DPU A;  2LNB A;  4D0P A;  3P5J A;  4EJV A;  2E60 A;  2VXD A;  3NAU A;  2JR6 A;  4QLC U;  1VQL 1;  1ZN2 A;  2BW3 B;  1ZH5 A;  1DL6 A;  4DK1 A;  3KX2 A;  4OAZ A;  5BPD A;  2JA7 J;  3VTN A;  3CUQ B;  3PFI A;  5K1Y A;  3TP0 A;  3G71 1;  2KIM A;  2DMP A;  5BOX A;  4ZYD A;  1IN8 A;  2W03 A;  4AIK A;  3H5N A;  2MC3 A;  2H27 A;  1XGN A;  1TQP A;  2N8G A;  3VPR A;  4HDV A;  2VUM I;  4R8H A;  1RNL A;  1TQM A;  1BI3 A;  2X6X A;  3KEY A;  2NS8 A;  1FIA A;  1EH8 A;  2PMZ N;  4IRH A;  4ESJ A;  1K79 A;  1VQ9 1;  4RLF A;  3O8H A;  4E4H A;  3GTK J;  4C3H J;  1B9M A;  3HL2 A;  4A3J I;  2FXA A;  2L9V A;  1XN7 A;  3LSJ A;  3ZQL A;  5FLV A;  5CQG A;  2VKV A;  3A0B C;  2FNP A;  2V6C A;  3WTS C;  2LKX A;  2E2J I;  1VND A;  5TIS C;  4A0Y A;  2G9W A;  5B5E C;  3NAR A;  3FXM A;  2JSC A;  4J19 A;  3PIP F;  2DQR A;  2ELH A;  4I98 B;  4AYB A;  3M3Y J;  3CPW Z;  2XKP A;  1YJ9 1;  1ML8 A;  3QYE A;  4ZH4 F;  2AO9 A;  1MJ9 A;  2JUC A;  4HDU A;  2DOE A;  3KP3 A;  1I50 J;  4B3X A;  5H6Q A;  1J2X A;  5CVI A;  2QBY A;  1HA8 A;  1ETX A;  1MBJ A;  2DK8 A;  3I4M I;  2WV1 A;  5IT9 Z;  1FBQ A;  1RZ4 A;  1P7J A;  4RS8 A;  1SMT A;  2VC1 A;  3J81 b;  3F3X A;  3E5Q A;  3VOD A;  1FIP A;  1KC8 2;  2LBF A;  2DBB A;  2EBI A;  2Q8K A;  2XGX A;  3G6E I;  4YFN F;  1SD6 A;  4HLX A;  1VQM Z;  4A0X A;  2Y75 A;  1ZG3 A;  5CVU A;  1J59 A;  3GTP I;  3CCU Z;  2W4S A;  2XF5 A;  2VJ5 A;  2LLK A;  3OW2 Z;  2ICW G;  4BQQ A;  4MEY F;  4G6D A;  2RQQ A;  1V5E A;  3C2B A;  2FEZ A;  4BU2 A;  5CPR B;  2UWM A;  2EK5 A;  2Y9Z A;  2WAQ N;  4RB0 A;  4BQA A;  3BG1 B;  1XSD A;  2FE3 A;  2A05 A;  1HKQ A;  5D5W B;  5KCM A;  1R49 A;  1NK3 P;  5JVT A;  1IRZ A;  1SAN A;  1Q7Y 1;  3CJR B;  2LY2 A;  1VQ4 I;  1F9N A;  2JIR A;  4AM3 A;  4MH4 A;  3KZY A;  3K7A I;  2CH0 A;  1W0U A;  2QEN A;  3BRO A;  1QQI A;  3GTG I;  1OCR H;  4IOC F;  4CO8 A;  5HNH A;  4Z2Y A;  3CUQ C;  1YHQ I;  2M30 A;  1BA5 A;  3GLL A;  1TC3 C;  3LL7 A;  1BC7 C;  3CPW Y;  3RPQ A;  1TWC I;  2HZD A;  2OTJ 1;  4IHV A;  1LVK A;  1JUM A;  4UVA A;  4Y13 A;  3BR0 A;  4AID A;  3JAM f;  2OTL I;  1SIW A;  2DMT A;  3S8P A;  3V8K A;  2VJ4 A;  2X6O A;  5EGO A;  2JA2 A;  4KIF A;  3HEF A;  4FE7 A;  1I3Q I;  2M5W A;  3GFJ A;  3HUG A;  1P4X A;  5DUK A;  4A3L I;  4XMY A;  2ZKZ A;  3KP4 A;  3AL0 B;  1XC5 A;  3RQI A;  2Z33 A;  4I2O A;  3J80 b;  4CCK A;  1Q81 2;  1JTY A;  1IGN A;  2VUM J;  5IYD J;  1NK2 P;  2K3R A;  3CD6 I;  1MD0 A;  4E7S A;  3OYB A;  2BV6 A;  2VPY A;  4EV0 A;  4E2W A;  4NBQ A;  3D9X A;  1DP7 P;  3OW2 Y;  4AIJ A;  1IXS B;  3IWF A;  4HNU A;  2P5L C;  2LH9 A;  1PUE E;  2CO5 A;  4KT5 C;  2LFU A;  3VMI A;  2K9M A;  2V45 A;  2BY3 A;  4V2F A;  3TDU C;  4C9Y A;  2HVS A;  5GPC A;  2X6W A;  1VQ7 I;  4M3D A;  4D9J A;  1W0T A;  3N4M A;  4XN3 A;  2KJC A;  1FZP B;  3GTO J;  4E7K A;  3PSI A;  2LTP A;  3BR3 A;  2M3A A;  1Y1W I;  1XX5 A;  1RET A;  2W57 A;  1P4W A;  3BTC A;  2L9S A;  1MMG A;  1VQL Z;  2KL4 A;  1WQ2 A;  2GA1 A;  3TW6 A;  4CYC A;  3VB2 A;  3DLL F;  4A12 A;  4KN7 X;  4ZTF A;  4DNC A;  4GCV A;  5J47 A;  3A02 A;  3TDH B;  2KIS A;  1K8A 1;  3TP3 A;  1ZRF A;  4BKX A;  3G71 Z;  2GOM A;  2XRO A;  1FP2 A;  3CJN A;  1IZ1 A;  3GTL I;  1MJA A;  5E20 A;  3G4S I;  4BBR I;  3HSR A;  3I07 A;  1YS7 A;  1I6X A;  1Z3X A;  5LRR A;  3DTK A;  3MKL A;  2IT0 A;  2STT A;  3CMA 1;  4PFO A;  3RZO J;  3L2C A;  4A93 J;  3L2Q A;  3KCC A;  4I0A A;  3L2V A;  3F22 A;  3OIP A;  4JX6 A;  1G3W A;  4EMS A;  3ISP A;  3JTG A;  4EM1 A;  1S7O A;  1K4T A;  2X0L A;  4UXN A;  2PX9 A;  4L9N A;  2YAD A;  3OMY A;  4WXD A;  1K9M 2;  3X2Q H;  2P6S A;  4LLL A;  5M5X J;  3OYA A;  2P6T A;  4JOM A;  1Q86 1;  2JA6 I;  5CVV A;  4BE1 A;  5A2Q b;  5LBQ A;  3CCJ I;  4YFX F;  5JI6 A;  1KZH A;  2A5W A;  4NC6 A;  1P2F A;  1O3Q A;  1Y1V I;  4L18 B;  3IKV A;  3H92 A;  3S1R J;  2L0K A;  5J40 A;  3K10 A;  3FIS A;  1VTN C;  4TNU A;  1V5G A;  4MIM A;  4F52 A;  5BS6 A;  3C2G A;  3AL0 C;  5ICG A;  2EIK H;  3QU3 A;  2H8W A;  1CQT A;  1ETK A;  3CO6 C;  4YII A;  1WGX A;  1G59 A;  4MFE A;  4XSX F;  3A2K A;  1JKP C;  3OOP A;  2LC2 A;  1YQA A;  1BBY A;  1KD1 2;  2K5R A;  4QPO A;  2ESH A;  5HNF A;  4P1W A;  3W6V A;  4BL0 B;  2DE5 A;  1Z6R A;  1KGS A;  1U5T A;  2X51 A;  2O3F A;  5E1Z B;  1WII A;  5E79 C;  1QBJ A;  1I1G A;  3MKW B;  1J0R A;  1S5L C;  2HYJ A;  2F4M A;  2KI7 B;  3O8G A;  2JA5 J;  3CCL 1;  2KIU A;  2R7Z J;  3Q3S A;  1JXS A;  4BY7 I;  3QOD A;  3JAM K;  2E1C A;  4NUB A;  1KYW A;  1S72 I;  3K4L A;  3SEQ A;  3QU6 A;  4GDF A;  2MW8 A;  3GTM I;  4C3J J;  2B0L A;  1K73 1;  2XC7 A;  3NH4 A;  3RPU D;  4YFK F;  1D0Z A;  1SFX A;  1B6A A;  4LLG F;  2A07 F;  3V7S A;  3IV5 A;  2ISZ A;  4ZYA A;  1FPQ A;  3WTZ A;  5E8G A;  3ZGK A;  1MDM B;  3SZG A;  3BG7 A;  2G2K A;  2BY2 A;  4AC0 A;  2F4O B;  4DZP A;  3MZL B;  3S14 I;  2KKO A;  3S93 A;  2R92 I;  1RES A;  2NNY A;  4XKB A;  2JMO A;  2AYD A;  3S1M I;  3WU0 A;  2OTJ Z;  4E32 A;  3PNY A;  1ETY A;  2IGK A;  2K02 A;  2QGU A;  1BI1 A;  3F3P C;  2HWV A;  3K69 A;  1XGO A;  2KIQ A;  5D6E A;  3CCY A;  2WC2 A;  3BR6 A;  3R60 A;  3CCS 1;  1OCZ H;  3IH4 A;  3WTU C;  4AU7 A;  1MMA A;  3O3K A;  2KT0 A;  4EGZ A;  3GTL J;  4Q5S F;  1R1T A;  1YX3 A;  2EFQ A;  3FXU A;  4B09 A;  4NOZ A;  4E6K G;  3PFY A;  5J3L A;  3BQY A;  3ZQH A;  4BXX J;  2IBD A;  1KQ0 A;  4XLP F;  2QQ8 A;  3HGG A;  1GLN A;  3HRS A;  3K1M A;  1M90 2;  2O61 A;  3WTT C;  1RQF A;  4NBE A;  3NDJ A;  3CDL A;  1F43 A;  4G8X A;  3S32 A;  2DLL A;  1QO0 D;  4G7O F;  3RKX A;  1MNM C;  5D8L B;  2NVQ J;  2VKH A;  1POG A;  2FSW A;  1X58 A;  1ZGJ A;  4ZDP A;  2XSD C;  2NYX A;  2VOP A;  4RB1 A;  1N78 A;  4HGZ A;  2JA6 J;  2W00 A;  5ILU A;  2ZO4 A;  5KAI C;  1TTY A;  1YYV A;  4XBF A;  3U9G A;  3J81 Z;  2ZNZ A;  2F4I A;  2CUF A;  2OZU A;  2DT5 A;  3GX4 X;  4YEL A;  2JVG A;  4BUP A;  1A6I A;  1BIB A;  2I8D A;  2KRC A;  3GFL A;  2P7C B;  2VT2 A;  5H6R A;  3FXQ A;  2LRD A;  3Q9S A;  2IS4 A;  4RS4 A;  1JHH A;  5HDN A;  2DYR H;  4PJN A;  3FQM A;  4AWX B;  1OIS A;  2CUE A;  2D2W A;  1QVG Y;  1UG2 A;  2VB6 A;  3S17 J;  2GXB A;  4NQW A;  2Q2E A;  2LP0 A;  5J6X A;  4U0V A;  2K7L A;  4RVD A;  1QHH D;  1JT6 A;  2DO7 A;  5C44 I;  5DD8 A;  2MAB A;  4XLF A;  4HPQ A;  2VN2 A;  1YJN 1;  2GLO A;  2X9D A;  3CJQ B;  3W3C A;  3BJO A;  3CMA Z;  3CO7 C;  1U8B A;  2VXZ A;  3KEQ A;  2L9N A;  1TWH I;  2GQQ A;  1D5Y A;  4BY7 J;  4LG3 A;  1UCR A;  3OYG A;  5IP9 J;  5CLS A;  2VQH A;  4HQM A;  5ILS A;  1MBF A;  2XAH A;  2E7Z A;  1X1A A;  1YFH A;  1K61 A;  2IA2 A;  1D1B A;  4B43 A;  2DTZ A;  3E3V A;  1GT0 C;  1R4N B;  2WY8 Q;  1HSJ A;  2W82 A;  3KEO A;  4DBR A;  1RO2 A;  1YW9 A;  2D5V A;  1R5I D;  3BR5 A;  2AS5 F;  3BJ6 A;  3BG3 A;  1EV7 A;  2P81 A;  3LA2 A;  3OIO A;  1IXR C;  2YU9 J;  2L7M P;  2BE5 F;  1U8R A;  3MWM A;  1ZB8 A;  3H1C A;  4JK1 X;  5M5Y J;  3GFI A;  4U7B A;  3BTI A;  2RBL A;  3J80 Z;  1VQK Z;  2VE9 A;  1VQM I;  1EH7 A;  3LWF A;  3CCU I;  4MD9 A;  3FM3 A;  4N9H A;  4XNF A;  2ZFW A;  5K5O A;  1T0F A;  1UMQ A;  5HDG A;  2XRL A;  3DF8 A;  4EGY A;  2M34 A;  4X1E A;  4M72 A;  1HOM A;  4N0B A;  1EF4 A;  2M8E A;  2DDA A;  3H3V K;  3CCV 1;  2OC6 A;  4RLQ A;  2Q51 A;  4AIH A;  2L3D A;  2OF7 A;  3TW7 A;  2AQE A;  3ESW A;  2WY7 Q;  3J7Z I;  2F5F A;  3CCL Z;  4H4K C;  3UKG A;  2PK7 A;  1QZY A;  1WH5 A;  2G7U A;  4II3 A;  3EUA A;  2KLO A;  4IEJ A;  2LG4 A;  4M71 A;  1N2F A;  3K4J A;  3FXJ A;  3T4N B;  2ZJ2 A;  2J5P A;  5K5Q A;  4ITV A;  2KHM A;  3CC4 1;  1HDD C;  2IVM A;  3JCU C;  3KIH A;  2QRE B;  2OQR A;  3V42 A;  2IS2 A;  1IDY A;  3KE2 A;  3MEX A;  2DOF A;  1PYV A;  1V54 H;  1ZG5 A;  2OOY B;  1HBX G;  5BQT A;  2PJR A;  4E31 A;  5GP9 A;  2XGC A;  1N8R 1;  5LEK A;  5E17 F;  2VC0 A;  3BOQ A;  4PGG A;  2CUJ A;  4IQJ A;  1GUU A;  2FUG 2;  1FWZ A;  3R0A A;  5GPA A;  1WJD A;  1WVR A;  2NS0 A;  3H3Z A;  4MD7 A;  5D1O B;  2L9R A;  1XSV A;  1E3P A;  5HDK A;  2XF6 A;  1G3Y A;  1E3O C;  1BM9 A;  3F3F C;  3CCS Z;  1XMX A;  2OPT A;  4RAF A;  5CVJ A;  1A04 A;  2R3S A;  5LHH A;  5GAG J;  2HVR A;  3CLQ A;  3ML6 A;  2AQF A;  3K4N A;  5DV5 A;  2OOX B;  3HM5 A;  3F8C A;  2ME0 A;  3A1Y A;  4L0Z B;  5A2Q Z;  2CQ7 A;  2ETH A;  3BC8 A;  3IUO A;  1TT0 A;  2ECC A;  3QPS A;  3T1B A;  3ZMD A;  4OMY A;  2JVH A;  1FTZ A;  3TOB A;  4MFD A;  1I6H I;  1ITY A;  1K83 I;  1YIT 1;  2K3F A;  4Y52 I;  2OAZ A;  5TJJ A;  5L3E A;  3JRF A;  3RYP A;  2XAS A;  3DBH B;  3DKX A;  1RO4 A;  3RI4 A;  4HST A;  2ZJP F;  2VJI A;  4I02 A;  3CUQ A;  2F6C A;  2ZXJ A;  2VBW A;  2W7N A;  1WSU A;  1T8I A;  5TGT A;  2FA5 A;  1AU7 A;  2UUZ A;  1JWH C;  1Z7L A;  4L5E A;  1O3R A;  1OCC H;  2MBF A;  1A5J A;  4HSR A;  3OL3 A;  2JIM A;  4N4O B;  4PDK A;  2V6E A;  1UZC A;  3KP6 A;  2QKL B;  4F3Q A;  2UXX A;  3GZN B;  3S2D J;  3E6C C;  3I56 I;  5LD2 C;  1VQ6 I;  2RVC A;  2VLA A;  2DK5 A;  4EJO A;  4BAC A;  3IL2 A;  4G7H F;  2COB A;  2HQ5 A;  4CYD A;  4FX4 A;  1MBG A;  1B1B A;  3W2A A;  4KIS A;  1Y8R B;  3ASO H;  3OYM A;  4HGY A;  1ZTR A;  3DWL E;  3DPT A;  2MD5 A;  1YJW 1;  3R4K A;  3JRI A;  4KIT B;  3VYS B;  2CRG A;  2L02 A;  1T38 A;  4ON0 A;  3MQ0 A;  2A6H F;  1LQ1 A;  4QTT A;  2IEK A;  3BJA A;  2JA7 I;  1YJN Z;  2V9P A;  5LFA A;  4KMF A;  4BNC A;  5DTD A;  1MW7 A;  3OYI A;  3O2P E;  1MJB A;  1IC8 A;  4XKV A;  4LK0 F;  2H6C A;  5AIQ A;  2WTE A;  4WXH A;  4EJW A;  1DPR A;  4O6J A;  1LPQ A;  5HVQ C;  5D5U B;  1G4D A;  1MMD A;  2V1U A;  2M87 A;  4CHU A;  3PO2 I;  2DT7 B;  2V26 A;  3U21 A;  2V1D A;  3GO5 A;  4A3M J;  1I39 A;  1GV5 A;  2XKO A;  1X3W B;  1YW7 A;  2DOD A;  1XCV A;  3BZC A;  3HSE A;  1YIJ I;  2I3C A;  5JHF A;  2LKS A;  3V8J A;  3HRU A;  4K2E A;  4A3F J;  5LGN A;  1Z91 A;  2RN7 A;  3ZMZ A;  3BT9 A;  3WHB A;  3H35 A;  3K4C A;  9ANT A;  2RRE A;  3TO6 A;  5AIP A;  1Y39 A;  4OU0 A;  3M3Y I;  5F64 A;  3E5X A;  4L5J A;  3N05 A;  4PFP A;  1B9N A;  3L09 A;  2NVU B;  1I50 I;  2A69 F;  4HW0 A;  1VQ8 1;  4CZZ A;  1J7K A;  2ACJ A;  1HKT A;  1KQ9 A;  2XV4 S;  2IXS A;  3V4G A;  2LF7 A;  3CLO A;  1S29 A;  3CC7 I;  4UNO A;  4P9U A;  1OCO H;  2CV1 A;  2R7V A;  3BTL A;  3CCV Z;  4XR6 A;  2IJL A;  3I5U A;  3LQR A;  1S7E A;  2CV2 A;  1P9N A;  2YPR A;  3ABL H;  1ETQ A;  3QPH A;  1D5V A;  2MA3 A;  3I55 1;  3TKY A;  3G1O A;  4QIW N;  3K70 C;  3QWU A;  1Q81 1;  2CMP A;  3WTY C;  3WE3 A;  5FJ8 J;  1USP B;  2GA2 A;  3LA7 A;  1Z05 A;  3ELK A;  2K4J A;  1MBE A;  2OZ6 A;  4CIC A;  2JIP A;  3MN2 A;  1OYY A;  4RVG A;  3LFK A;  3K9T A;  4A3D J;  1VQ5 1;  4KJZ A;  5GAD J;  4F93 B;  4F91 B;  3WGI A;  1Y8C A;  1IRX A;  1BJA A;  3CCM 1;  2EZK A;  1IN6 A;  3KYC B;  1TWF J;  2ZXI A;  3PQJ A;  2Z16 A;  1E3H A;  4GYI A;  3B02 A;  1QZE A;  4HEA 2;  2R7T A;  3EET A;  4BJT A;  3ZP5 A;  2D1V A;  2Y0S A;  3VYU B;  4A3C J;  5L3C A;  2HI3 A;  4O3M A;  4J01 A;  3S1N I;  4LIV A;  5JLW A;  2PMZ A;  1Z01 A;  4M9X A;  1P9Q C;  1GDT A;  4MTE A;  1SEU A;  3HOW J;  3NH5 A;  1VQP 1;  2M1B A;  2W1O A;  3S16 I;  4CCO A;  1FEX A;  1ETO A;  4ABZ A;  1JGG A;  3WOD F;  3FX3 A;  2PLY A;  2YSR A;  3A01 B;  2LOO A;  2A61 A;  3TOA A;  4EQQ A;  5FFX A;  3EDP A;  4A5M A;  3HOX J;  3IF8 A;  2K9S A;  1IN4 A;  4XK4 A;  1L3L A;  5BPI A;  4BJ5 C;  3JAM b;  2E5N A;  1X4P A;  2VPZ A;  4ZYE A;  1XCB A;  4AVP A;  3OL4 A;  3QP6 A;  1T0F C;  4ENK A;  1OYI A;  4N9I A;  2V9V A;  3HZJ A;  3T0Y A;  5E8I A;  4HOB A;  1NJI 2;  1MKM A;  4XID A;  4E2X A;  2X1C A;  2LEX A;  3PO2 J;  3HG9 A;  3JTH A;  5DD4 A;  1JJ2 Y;  3CME 1;  3E6M A;  4FHT A;  3GCF A;  1QHG A;  2ELK A;  4FIS A;  1LKX A;  2ADU A;  2JS4 A;  3CCR 1;  2WWY A;  1D1A A;  4NBA A;  5DCM B;  1FOK A;  3RSN A;  1R9T J;  3DTE A;  2QVO A;  4KIC A;  3CDH A;  3NH8 A;  3L2U A;  2NVT J;  2XGD A;  3RZD J;  1TT5 B;  2K40 A;  1MH3 A;  5HOO A;  2DA5 A;  4IHY A;  1VQN Z;  3M9A A;  2WAQ A;  1B72 B;  2BXZ A;  1ZKG A;  2TDX A;  2R5Z B;  3SYT A;  2M0M A;  3GTO I;  3VEP A;  2QEX 1;  2NOJ B;  1W1W E;  1YJW Z;  4IO9 F;  3G73 A;  1ON1 A;  2QSF X;  3E6B A;  4BY1 I;  2GM4 A;  3ZMU A;  4BEH B;  5F1R A;  2JUG A;  2DT6 A;  2DA1 A;  1TNT A;  4LIU A;  2W24 A;  2L7Z A;  3F0C A;  3CUO A;  3TO7 A;  4F55 A;  4II2 A;  1VLA A;  3CCQ 1;  2KP6 A;  2GBY A;  2FBH A;  1DGR M;  1HF0 A;  5HS9 A;  3DBL B;  3C2H A;  2ID6 A;  1BR2 A;  5K7F A;  3JR9 A;  2CFX A;  4LIT A;  2MC4 A;  1X1D A;  1U2W A;  4OIO F;  3ZMV A;  3ECH A;  4HG2 A;  2R7O A;  3Q0U A;  2KRF A;  2LFB A;  1W4M A;  5ICC A;  2MG4 A;  1VQK I;  1IRG A;  3RZO I;  2X4H A;  4A93 I;  3G1M A;  3VYT B;  5D8K B;  1GVJ A;  3HPG A;  4NC7 A;  3N97 A;  2HZT A;  2L7K A;  2NS7 A;  4S04 A;  4IZZ A;  5FKK A;  3OR2 C;  2FRH A;  4I99 C;  3UR3 C;  3SHF A;  3EER A;  3KZZ A;  1IN7 A;  1SAX A;  4KNY A;  4HV5 A;  2VKD A;  4JQF A;  3IRR A;  2E19 A;  4IPA A;  5GTI C;  1R00 A;  1R4M B;  5J1Y A;  4HLY A;  2JQ7 A;  3NWS A;  1YO5 C;  3S1N J;  3GUD A;  2FNA A;  1T39 A;  4M3B A;  1BR1 A;  2LK2 A;  4G94 A;  4GRI A;  3S16 J;  3F6V A;  1J9I A;  3LUS A;  1JI8 A;  3S1R I;  4OAY A;  2BZT A;  3PNV A;  4XL9 A;  1BI0 A;  4AYB N;  4D5C A;  1VQ8 Z;  3CCJ 1;  3SEZ A;  3DKY A;  1LDK B;  2V8J A;  1YIO A;  4E7Z A;  1MDM A;  1A31 A;  3I54 A;  2F48 A;  1W7P B;  5FFZ A;  2F4O A;  1XD7 A;  4ZYG A;  3M4O I;  3GVA A;  4NBG A;  3ZMT A;  2PI0 A;  2XVC A;  5FKL A;  4NB5 A;  3BPX A;  4QTR A;  2GIZ A;  2IP2 A;  1MSE C;  3P7N A;  2EIJ H;  3QOE A;  2R93 I;  5FKM A;  1M90 1;  2JA5 I;  2R7Z I;  1KU7 A;  1WZ2 A;  4BQO A;  4E2Y A;  1RPW A;  1VQ5 Z;  2L54 A;  4KFC A;  1I5Z A;  3ZXS A;  1PP7 U;  1M1E B;  1ETV A;  3NDI A;  2XAG A;  3CCM Z;  3F8B A;  3RQ4 A;  2E71 A;  4E2Z A;  1P92 A;  3FBI B;  2HTS A;  3JRB A;  1HW5 A;  2H6B A;  1K7A A;  2DFF A;  5C4X J;  5AN9 F;  5HOD A;  3S3N A;  2VBZ A;  4UUV A;  3GFM A;  1MBK A;  2K9L A;  3H3U A;  1Z21 A;  1H9G A;  1NH3 A;  1B4A A;  3FHN A;  1USS A;  2KQR A;  3JRA A;  2CV0 A;  1VQP Z;  2O7O A;  3I3L A;  3RJP A;  2P5K A;  3ZN1 A;  1BIA A;  1IN5 A;  1IV8 A;  2BYV E;  2DU9 A;  4H0E A;  3QRF F;  3D6W A;  4BY1 J;  4NB9 A;  1X3Z B;  2IGM A;  4Z6Y A;  4M6X A;  1ULY A;  3J7A 4;  4LK1 F;  3I4P A;  2H94 A;  1XG1 A;  1BOB A;  2QF7 A;  2KZG A;  1TW2 A;  2OU2 A;  4A6D A;  1LE8 B;  3CES A;  2AKL A;  1HDP A;  3LFU A;  4EM2 A;  1T56 A;  4CH7 A;  1EH6 A;  3MFK A;  4ZZD A;  3LMM A;  4I01 A;  2W25 A;  5J8F A;  5HLH A;  5L3D A;  2OCE A;  1IV6 A;  5E3L A;  2EH3 A;  2EQR A;  4CCN A;  2EV5 A;  3H9Q A;  4BXX I;  4C30 A;  1Z77 A;  5T6B A;  2V8K A;  3I4N J;  2A6T A;  2MD0 A;  2Z99 A;  1YW8 A;  2JN6 A;  3R6S A;  3SFZ A;  3WE2 A;  1X19 A;  1FBS A;  4DJA A;  3CME Z;  2L5Q A;  4XLC A;  4D7N A;  3CCR Z;  1LDJ A;  3G1L A;  3GZ5 A;  4MHG A;  1K78 B;  3WG7 H;  2NVQ I;  4A6E A;  4TV7 A;  5LHG A;  1VQ9 I;  2UV1 A;  1SFE A;  2ZSI B;  3RKQ A;  2EGT A;  3H36 A;  2Z3Y A;  3JRE A;  4NBF A;  3EUH A;  3ONQ A;  1GXQ A;  1Q1H A;  2HOE A;  1ZR2 A;  4MEX F;  1Q16 A;  4IQ4 A;  1YG2 A;  3ULQ B;  1YJ9 Z;  2WAF A;  1APL C;  3JRD A;  2QA4 I;  1M1K 2;  1R5H A;  1QPI A;  3KIO A;  2KIF A;  1ZR4 A;  2QEX Z;  3T8T A;  2H8R A;  4LG0 B;  3DBR B;  2A3S A;  3F9K A;  4HA8 A;  3SFI A;  2KPM A;  2E2I J;  2PJP A;  4DOZ A;  2F2E A;  4HH4 A;  3RKY A;  1RIO H;  3WTV C;  2O03 A;  3S17 I;  2HKX A;  2DA4 A;  3DXJ F;  2O53 A;  3DP7 A;  3UNG C;  1W36 D;  3M4O J;  4YIF A;  1V4R A;  2M4K A;  3GYH X;  4MXU A;  3G6E 1;  2D1H A;  2E1M B;  3IR7 A;  2R93 J;  3A03 A;  3PNT A;  4KT6 A;  2BJO A;  4OIR F;  1QGP A;  2FD5 A;  2OBP A;  3K70 D;  3IH2 A;  4NC8 A;  5IP9 I;  1NHA A;  4G7Z F;  2A5Y B;  2EFN A;  5FRO A;  1PDN C;  1JGS A;  1S7M A;  3GW2 A;  4JX5 A;  4U7D A;  3OY9 A;  3OYH A;  4DIQ A;  3OR1 C;  2P28 A;  2HPM A;  1VQ4 1;  4L9V A;  2DMU A;  3L7W A;  5F0H A;  4XLE A;  3CTA A;  2XDV A;  5F27 A;  1WCM J;  2QUF A;  3CCV I;  1YI2 I;  3JAM Z;  4DGL A;  2DI3 A;  2YU9 I;  1LFB A;  4PJJ A;  4MD8 A;  2MH9 A;  2ECB A;  5M3M J;  4EJU A;  3QOP A;  4RVH A;  3F8F A;  2VIX A;  1YHQ 1;  1RR7 A;  4L5I A;  3CQZ J;  5EZH A;  2VL8 A;  2NVY J;  2O8X A;  1QVG Z;  4G6T B;  1DDN A;  5H2F C;  4Y33 A;  2KZV A;  1OCP A;  3S3M A;  1U9O A;  3CCJ Z;  1OKR A;  1E2X A;  4Y3O A;  2BGC A;  4R1H A;  2FOW A;  2OTL 1;  3H0G I;  3HXL A;  3SZP A;  1MH4 A;  3HGY A;  1VQO 1;  4GO1 A;  3DV8 A;  3F72 A;  5L3B A;  2QQA A;  2HXI A;  4BE0 A;  5ILV A;  3BPV A;  2BHZ A;  2JT1 A;  1JKR C;  4IHT A;  1FMV A;  2DJN A;  3KET A;  2V3V A;  2YS9 A;  4DW6 A;  1QVT A;  5D1O A;  4IOA F;  2LYC A;  4LGW A;  2Z2S B;  4ZYH A;  2LSO A;  3GLX A;  3I71 A;  4D7M A;  4S0H B;  4MO7 A;  2TRT A;  5TRD A;  3J7A Y;  1FSE A;  3HOZ J;  1FC3 A;  2F5C A;  1AWC A;  1F5T A;  3GWZ A;  1V5F A;  3FK7 A;  2VPR A;  2R5Y B;  4MGR A;  3RYR A;  2G0E A;  3QWL A;  4L9T A;  3MZ8 A;  2D45 A;  2DJI A;  3MKY B;  3D5L A;  4QTU A;  1VQ7 1;  2XRN A;  1IO2 A;  1X4O A;  2X48 A;  2LRE A;  1T33 A;  2LY1 A;  3W2V A;  2L2O A;  2IRF G;  3HPH A;  1R1U A;  1VZ0 A;  2LF8 A;  4C2U A;  2RAE A;  2K9Q A;  1W5S A;  3HHG A;  2FX0 A;  1SFU A;  3B6C A;  1HQC A;  3IWZ A;  4AVZ A;  1XS9 A;  2E1M C;  4Q48 A;  2RPR A;  1V3F A;  2JZY A;  1KU2 A;  3K2A A;  2WAD A;  2V9K A;  4IHX A;  2LR8 A;  4XOP A;  3IRQ A;  4EWC A;  2MYS A;  5FLX f;  3EQL F;  5FRN A;  1MZB A;  2H1K A;  2O4H A;  2Z5U A;  4L0Y B;  3OYN A;  1J09 A;  4D1Q A;  4A3B J;  4PJM A;  2Y2Z A;  4KDP A;  4RVF A;  1W2B Z;  3CDI A;  1VQN I;  2E1N A;  3OSF A;  2LIY A;  2VPL A;  4RAZ A;  2M7B A;  3ABK H;  5HLI A;  1V55 H;  1Z3Y A;  2HDW A;  2V8I A;  1YJW I;  2WB1 N;  3CC2 1;  2VOD A;  3PUB A;  4OIN F;  3RTR A;  4HF1 A;  4CSW A;  2V79 A;  3VDX A;  3TED A;  3B73 A;  4A3I J;  1HLV A;  4HNT A;  2CQK A;  5IOZ A;  3D1N I;  5LGU A;  1HCR A;  2BEO A;  2HF1 A;  1U0J A;  1HST A;  1T6S A;  2RV8 A;  3JW4 A;  3S2D I;  2HS5 A;  5K7Z A;  3OYE A;  2K85 A;  4UUT A;  4KIB A;  3LSP A;  3K1N A;  5IP7 J;  4X6A I;  2K4B A;  2EZI A;  5CKT A;  1D8K A;  4LB6 B;  1FSH A;  1EJ9 A;  3D2L A;  3TQN A;  4EVI A;  4E33 A;  1X3W A;  1KON A;  3GZ6 A;  5CQE A;  2E34 A;  4I0B A;  5B1B H;  3W6K B;  2QKD A;  3H0G J;  4I6Z A;  2FOK A;  4RGX A;  3OYD A;  2AXL A;  4ENN A;  3CCE 1;  1Q86 2;  4B8X A;  3CMM A;  4HZF A;  4RGR A;  3R61 A;  2STW A;  2W85 A;  3FM5 A;  1TZL A;  2HR3 A;  4WX9 A;  3ZCO A;  2ID3 A;  2RT9 A;  2NRA C;  4I09 A;  4CCJ A;  1S72 1;  5KHD A;  1RNI A;  1WWX A;  4EJT A;  4PSW A;  3BCA A;  3KP5 A;  1W2B Y;  3SXY A;  3LQQ A;  2F5E A;  2RNJ A;  4C2T A;  3S2W A;  1ONV A;  2FBK A;  3I0T A;  5GTH C;  4A3M I;  1JHF A;  1AHD P;  1I3A A;  5EDN A;  1JKO C;  2O0Y A;  2VON A;  2K5C A;  4E7I A;  1BL0 A;  1USP A;  2R7S A;  4IL6 C;  3GBG A;  3CF2 A;  1SD5 A;  2EFP A;  3K1P A;  4A3F I;  3U2R A;  1YHQ Z;  3GEZ A;  4L9J A;  5CYV A;  3M8F A;  2J5O A;  1D0X A;  3LSK A;  3DEW A;  2L4M A;  2GTH A;  1TP4 A;  4UY8 I;  4AD9 A;  1ACI A;  2NAZ A;  3WTW C;  3E1S A;  2P5V A;  1WJ5 A;  3FQQ A;  3EUH C;  4ESB A;  5C3E J;  2ZME B;  1KYZ A;  4CGZ A;  5DM6 F;  2KPI A;  4JP0 A;  3OS0 A;  3V7C A;  1OYW A;  1VQO Z;  1MMS A;  1X2N A;  1G6N A;  3M8J A;  2IV2 X;  3AG1 H;  5K7H A;  3GCM A;  4CCL A;  3LAP A;  5FLM J;  1S3J A;  1UEL B;  1XDU A;  1Z03 A;  3H9G A;  3A01 A;  4FCY A;  5FLX K;  2JUB A;  3FMR A;  2PBI A;  1PVE A;  2E9H A;  1TBX A;  2BHY A;  1B59 A;  1F4K A;  1XPX A;  1BJZ A;  1WPK A;  1TNS A;  4LJZ F;  4A3D I;  4A3G I;  2M45 A;  4PJL A;  2RQP A;  1VQL I;  1IW7 F;  2Y48 A;  3TO9 A;  3JRG A;  3PSF A;  2O9L A;  4BXF A;  4W1U A;  2ZCW A;  1TWF I;  1O7F A;  2DFI A;  2JRM A;  3FMQ A;  4U0Y A;  3G71 I;  4MQV A;  4NFR A;  4AUX A;  5CJ9 A;  2B9S A;  4A3C I;  2XPU A;  3KFW X;  1FT9 A;  2EZL A;  3HKZ N;  5DDG A;  1B8I B;  3BWG A;  4X6A J;  1F36 A;  2KDZ A;  3HOW I;  4RA2 A;  2CQQ A;  3F21 A;  5DCM A;  3ZQC A;  1WJ2 A;  2IZ4 A;  1W7P D;  2E5Z A;  5KNL A;  1A6Q A;  3MCZ A;  3CME I;  4M3E A;  3WGG A;  4BJ6 C;  3JSP A;  4CA0 A;  1Z1D A;  3ABT A;  2DN0 A;  1KQS Z;  4HX8 A;  1YUA A;  1JJ8 C;  4DYR A;  1SD4 A;  4LLN A;  1KC8 1;  1B72 A;  3RKW A;  2R5Z A;  3HB9 A;  3S1Q J;  4QWQ A;  1ZGA A;  3KLO A;  2XUB A;  3REO A;  2VKE A;  2BBY A;  3WG9 A;  4CXF A;  3T5X A;  3IKT A;  4LOC A;  1YJ9 I;  4BEH A;  2O5R A;  4V19 K;  2EV6 A;  5F0F A;  4UVB A;  5FKN A;  3TMO A;  5HLG A;  2BY0 A;  4JX4 A;  2FJ1 A;  2NOG A;  2M0C A;  1PP8 F;  3CC2 Z;  2GXA A;  4A0Z A;  1IUY A;  1HW1 A;  1FMW A;  3ZQQ A;  4IF4 A;  2VAS A;  1XB4 A;  1RR8 C;  2H85 A;  1FYL A;  1FJL A;  2QRD B;  1R9T I;  1HC8 A;  3WHC A;  1DGW Y;  1T08 B;  2IA1 A;  1X2M A;  4DGW B;  3CF5 F;  5EYR A;  2NVT I;  2E2H J;  3RZD I;  2P0W A;  1NTC A;  2XPV A;  1GV2 A;  3HJE A;  2JA8 J;  2ZME C;  3EUK L;  3NEU A;  1VQM 1;  4NDL A;  3G2B A;  4C3I J;  2Y9Y A;  5B1A H;  4IRI A;  1LB2 A;  5IT3 A;  4G6Q A;  1ZRD A;  1WFX A;  2DFE A;  1O57 A;  1S7A A;  4EAT A;  1RRJ A;  3MZH A;  2RGV A;  2EA2 A;  3VSL A;  5IT9 f;  5IP6 A;  2NNN A;  1WJE A;  2LY9 A;  2E35 A;  1G2H A;  3HOY J;  4XQF A;  3PO3 J;  2IA0 A;  3CCE Z;  1G3S A;  3OYJ A;  2VF1 A;  1Z6T A;  2W48 A;  4XRS A;  4CL1 A;  5AON A;  2ZXW H;  2HYG D;  4DYQ A;  1SC7 A;  1KQS Y;  5EEH A;  4B4C A;  1BW6 A;  2VBX A;  2IW5 A;  1JJ2 Z;  1S72 Z;  2IGO A;  3FKI J;  1NG7 A;  4E30 A;  1SFO J;  4A3G J;  2IGN A;  3CC4 Z;  4PJ0 C;  2OTJ I;  4S05 A;  2KFD A;  1MIJ A;  1W7P A;  2FU4 A;  1QZZ A;  2JWT A;  3BCB A;  3DLA A;  3ZN0 A;  4BHC A;  5FD6 A;  3L1P A;  2XHK A;  2CWE A;  4X0G A;  2Y0M A;  1LJ9 A;  5CVR A;  5C4J J;  4CDG A;  2ZC2 A;  3G3Z A;  5D5V B;  1P4A A;  5IY5 H;  4Q4Z F;  3GTJ J;  2QR1 B;  4LMY A;  2VI6 A;  1D0Y A;  3B6A A;  4FX0 A;  2CYY A;  2GXG A;  1E0E A;  2XSJ C;  4ESF A;  1Q82 2;  4UVC A;  4ZZL A;  4B47 A;  1OR7 A;  2O6G E;  1OQY A;  2RKH A;  4RMN A;  3GKQ A;  2ZJR F;  5EG0 A;  1ZYR F;  4A3E J;  4ASN A;  3L2W A;  2QKM B;  2YX4 A;  4MTD A;  1UHW A;  3VMG A;  2RC4 A;  1A36 A;  1GVD A;  4KN4 X;  4ETS A;  4A3K J;  3AKZ A;  4RGU A;  2YUS A;  2XAU A;  1OPC A;  2M4G A;  1S8N A;  1ZRC A;  2CUZ A;  1N8R 2;  3HOV J;  1TW3 A;  1X3Z A;  3F8M A;  3I9V 2;  4XM3 A;  4WK8 F;  4NBD A;  1YIT Z;  3C7J A;  3ZRG A;  3DQV C;  2DAO A;  4BH9 A;  5F04 A;  1YTY A;  5DYM A;  4M73 A;  1FY7 A;  1FDI A;  1LE8 A;  1H89 C;  5FD5 A;  4EEF G;  3VWB A;  2R4G A;  5E18 F;  3E5U A;  1K9M 1;  3PO3 S;  1X1C A;  2ELJ A;  2EJR A;  3SQN A;  3PUF A;  2EIL H;  5FGM A;  1Z9C A;  1NG6 A;  1TWG J;  4ZDO A;  2F5D A;  4UUS A;  3U1D A;  5EZG A;  5F0C A;  5M5W J;  5C4X I;  5FO5 A;  1LFP A;  2R7W A;  3I56 1;  1VQ6 1;  3BR2 A;  1LUJ B;  4XLH A;  4NBH A;  4XN0 A;  2Y0S N;  3CMA I;  5FRM A;  1M1K 1;  4NHJ A;  3BG6 A;  4RM3 A;  3AG2 H;  3Q87 A;  2P8T A;  4P55 A;  1O4X A;  1K78 A;  1CGP A;  2A68 F;  4UV9 A;  3WU2 C;  4WXC A;  1FOY A;  1FNN A;  4P96 A;  4NNJ A;  4Y7N J;  4WCG A;  4IVN A;  2JTV A;  3Q5F A;  4MNU A;  3ZQ7 A;  3A0H C;  1YRN B;  1PJR A;  2HOA A;  2ZBK A;  3PM1 A;  1KD1 1;  1U9N A;  3ZPL A;  2HNH A;  4F92 B;  3LAJ A;  3CP8 A;  2JIQ A;  3HOS A;  1UHS A;  1YX5 A;  4LG0 A;  1P7I A;  4XX2 A;  3S15 J;  5H20 A;  5IT9 K;  3K6G A;  3HBL A;  4HF0 A;  1JE8 A;  3QYF A;  4YRV A;  4G12 A;  3MKZ A;  3BP8 A;  3I4N I;  4B44 A;  1IG7 A;  3FIW A;  4U88 A;  2B63 J;  2I5U A;  2FBI A;  2QQ9 A;  3DPU A;  1JJ6 C;  1RUN A;  5FKO A;  3IX0 A;  1QVU A;  2Q1Z B;  3DU5 A;  2GZW A;  1SMY F;  2VT3 A;  3LA3 A;  2Q0O A;  4OWR B;  4ZDL A;  4KA4 A;  1YIJ 1;  3M7G A;  2Z9O A;  3M1E A;  1L1O C;  2FQ4 A;  1Z67 A;  2MSY A;  1YLF A;  2IZ3 A;  1CF7 B;  1DU6 A;  4RAG A;  4RBO A;  2DMQ A;  2E7W A;  1R22 A;  4F7Z A;  1ZEL A;  3I59 B;  3CCL I;  1S9H A;  3KP2 A;  1I1S A;  1SVM A;  3W2W A;  1Z7U A;  1IAW A;  2HU9 A;  3GTQ I;  2GWR A;  1LDD A;  3S2H J;  4KIG A;  2E2I I;  3BQZ A;  1RLY A;  3CC7 1;  1EKE A;  5BNG A;  3J7A O;  4PUS A;  1D3Y A;  4BBS J;  4RGS A;  3NFZ A;  1UG0 A;  4FAS D;  4MLO A;  1WJC A;  4B3A A;  3NWT A;  3I55 Z;  5EEA A;  3KLN A;  2DPU A;  2IS6 A;  2XAF A;  1ORK A;  1ODD A;  1IRF A;  2R7X A;  5JFR A;  5E1X A;  3BDD A;  1ZB9 A;  3T8R A;  5GAH J;  3HYI A;  2WV0 A;  2EB7 A;  1DU0 A;  2VPW A;  5B66 C;  2LVS A;  3H5A A;  2M2E A;  2JIO A;  2K27 A;  4FET A;  3OS2 A;  2TCT A;  3ZMS A;  5J8C A;  1K6Y A;  3E7L A;  5EG0 B;  5JHU A;  5EJC A;  2JNY A;  1MND A;  3CCS I;  2FMY A;  2ZNY A;  1WCM I;  1VQO I;  2ISY A;  2EV0 A;  2LDU A;  4GGG A;  2DE6 A;  2XB0 X;  1AKH B;  3LOC A;  2PQ8 A;  3U1K A;  2O8K A;  4RV9 A;  3MON A;  2DW4 A;  2ZJQ F;  1JUS A;  4BQN A;  3CQZ I;  3FWE A;  2BVM A;  2NVY I;  4C2M J;  3C18 A;  4CZC A;  4ENJ A;  3L2R A;  3GXO A;  4A3J J;  2R5Y A;  5D1P A;  1VFC A;  2Z1D A;  1WI9 A;  1VF9 A;  3OYL A;  4OIP F;  3P5J B;  2R7Q A;  2E2J J;  4GYG A;  4FTH A;  5IOY A;  2DA7 A;  4RM2 A;  2F5V A;  1ZG1 A;  2VQL A;  3KYD B;  3HTS B;  1MNE A;  2X1D A;  3IAM 2;  3DTI A;  1FOX A;  3DKW A;  5JR3 A;  2GIV A;  1KA8 A;  4W97 A;  3V8L A;  4UUS B;  2P7V B;  3OSG A;  2W04 A;  3BTJ A;  2HQR A;  3BZ6 A;  3IFU A;  3S3O A;  4ZTJ A;  2L01 A;  4M6V A;  3BG0 B;  1YOV B;  2DQL A;  4PSX A;  4NH1 C;  3FBN B;  1N77 A;  2DA2 A;  3DU6 A;  3I4M J;  3IH3 A;  3VMH A;  3J81 f;  1XMK A;  2CG4 A;  1UJ8 A;  4FQG A;  3ERM A;  3HOZ I;  2EZH A;  2KJB A;  1RI7 A;  4DYC A;  1LEB A;  3KP7 A;  3EYI A;  3ROU A;  2PFB A;  4Y15 A;  1QU3 A;  1YJN I;  3TGN A;  3I56 Z;  1VQ6 Z;  1MMN A;  2G7H A;  2DTR A;  3GTP J;  4LB5 A;  2FF4 A;  5F08 A;  5M3F J;  2VPX A;  2PEX A;  4UB8 C;  4CCM A;  1L0O C;  1TWA I;  4E70 A;  3IC7 A;  1QYP A;  3GTQ J;  2CSO A;  3H3V J;  1YS6 A;  3CC2 I;  1UST A;  5LEJ A;  1OMI A;  4YIR X;  1RUO A;  2ZSH B;  3CCQ Z;  2QBY B;  2CU7 A;  1FP1 D;  3K7A J;  5T64 A;  2M9H A;  3VFZ A;  3GTG J;  1OR7 C;  5FLX b;  4GFB A;  1Y8Q B;  3PJR A;  5LL6 f;  4A3B I;  4PZJ A;  1LFU P;  1XGS A;  4IRG A;  2LBF B;  1VQK 1;  1O7L A;  2COM A;  4LFU A;  3LSM A;  3OWT A;  4U87 A;  1TWC J;  1XDS A;  2E1O A;  2HDC A;  2KMU A;  4XLN F;  2L7F P;  3ZQI A;  2EIN H;  1ETW A;  3MZY A;  2RDP A;  4XRF A;  5DM7 F;  1LQL A;  2FQ3 A;  1R1V A;  2Y69 H;  3M8E A;  2IS1 A;  3AG4 H;  1K4S A;  2YX7 A;  2PM9 A;  5CM2 M;  3JRH A;  1WRJ A;  4XSZ F;  1YIJ Z;  3EED A;  1FTT A;  1ENH A;  3CCE I;  1I3Q J;  1R71 A;  4A3I I;  3ZQG A;  3F6O A;  4BDY A;  3O6B B;  4A3L J;  3J80 f;  1I27 A;  1WH7 A;  2AHQ A;  3KIF A;  1QNT A;  4ANJ A;  3Q9V A;  4HBL A;  3R0J A;  4BS9 A;  3FDY A;  2HOT A;  5D5X B;  1PFT A;  4UHT A;  1SFK A;  1AOY A;  2OQG A;  2HFH A;  2HKO A;  4RAY A;  1OJL A;  4HAM A;  2VJJ A;  5IP7 I;  4Y4R A;  1QA6 A;  1FYM A;  4MON A;  1O3T A;  3CC7 Z;  1G8X A;  1BC8 C;  4E7H A;  3CC4 I;  2RIQ A;  1Q7Y 2;  2H09 A;  4XLA A;  2DDB A;  2CQN A;  4IHW A;  3BLY A;  2DOA A;  1R6R A;  2HGC A;  5KAF C;  3D5R C;  2NXN B;  2RNG A;  5L3F A;  3CP2 A;  1XMA A;  3KPH A;  1BR4 A;  1J75 A;  5EGO B;  5KK1 A;  2DFH A;  3K4B A;  4QSH A;  1Y1W J;  3FKJ A;  1OFC X;  3HUG B;  4HQE A;  1G3T A;  1RO0 A;  2BOL A;  2XAQ A;  3VB9 A;  2R0Q C;  3CD6 1;  5HLT A;  3VYR B;  5FB2 A;  4B1R A;  2YR2 A;  2ZME A;  2H1L A;  5DUI A;  4YEJ A;  4DQY B;  4P9F A;  2PN6 A;  3ZQF A;  1KU9 A;  2XAJ A;  2EPF A;  1ZQ3 P;  1LVA A;  2HTJ A;  2CJJ A;  4KYW A;  3E0J B;  2E36 A;  1H9T A;  4E7L A;  4BBR J;  2QSH X;  2JMW A;  2R7R A;  2DXI A;  2CQX A;  1SD7 A;  3DFG A;  1IXC A;  3J81 K;  2WB1 A;  4I76 A;  4XOR A;  1DUX C;  3MZK B;  4XKC A;  1TWA J;  1YIT I;  3HDD A;  2ME6 A;  1KQ8 A;  2XGE A;  1OLT A;  3BY6 A;  1H88 C;  1T2K A;  2PG4 A;  3FK6 A;  2DYS H;  1KRL A;  2L4A A;  3M1C A;  3OS1 A;  3COA C;  1YUK A;  4V2G A;  3MAJ A;  3WGH A;  5A2Q f;  1D1C A;  2MGQ A;  4OIQ F;  1WI3 A;  3ABM H;  4FE4 A;  4IXA A;  4BHB A;  4CYC B;  3K0L A;  5C3E I;  4UV8 A;  1PUF A;  4U0W A;  1B8I A;  2UZK A;  3G4S 1;  1Y1V J;  2HYF A;  2QLZ A;  5FLM I;  2AXT C;  1IJW C;  1OCT C;  4Q47 A;  2JRT A;  4RDU A;  2VBY A;  1ZLK A;  3TDZ C;  5D4R A;  3H0D A;  3VSK A;  4HF2 A;  1ZHF A;  2QQB A;  2I10 A;  1UFM A;  1R23 A;  1LEA A;  3RPU A;  5J1U A;  2HEO A;  2HXO A;  4PGH A;  1Z02 A;  2MFZ A;  3AFH A;  3DCF A;  2BVL A;  1K8A 2;  2NVX I;  5JLX A;  3HHH A;  4WWC A;  1XSX A;  2QWW A;  4DBQ A;  1GHC A;  1TFI A;  4M74 A;  3BG9 A;  1WZN A;  1LNW A;  1F1Z A;  5JVG F;  4HRI A;  2IPQ X;  2QA4 1;  4UB6 C;  2X1E A;  4NBB A;  2C6Y A;  1AA7 A;  1O3S A;  2X85 A;  3HOT A;  2GTI A;  1NUI A;  1Y6I A;  1TL8 A;  3KZI C;  3GTM J;  3J80 K;  3OYF A;  4E7J A;  2WA0 A;  3ERE D;  5LHI A;  2OJE D;  3NRV A;  3RIR A;  4A2U A;  2MH2 A;  3Q0W A;  3TBI A;  2CS3 A;  3PQK A;  2OCC H;  2K9N A;  5IPA A;  2HPI A;  4RB2 C;  3I53 A;  5E1W A;  2QYO A;  2R6M A;  3HRM A;  2JJ7 A;  3G6E Z;  2V1X A;  3S14 J;  2KRH A;  4A69 C;  3MD2 A;  3S1Q I;  2R92 J;  1QPM A;  1VI0 A;  1U5T B;  4QPQ A;  1JT0 A;  4M6Y A;  2NAP A;  2P4W A;  1Y56 A;  1D8J A;  3S1M J;  1IUF A;  2F4M B;  2OZK A;  2QCO A;  1Q1V A;  2OUM A;  3W6J B;  2LD5 A;  4NB8 A;  1VQ8 I;  1ZH1 A;  2ZXH A;  2EWN A;  2M6N A;  3FF5 A;  3LSH A;  2DPD A;  3DEE A;  5ED4 A;  3L9F A;  1VQ4 Z;  2CFO A;  5DS9 A;  2HDD A;  3BG5 A;  1SVL A;  3NQO A;  1YI2 1;  3WTX C;  4JBA A;  3QP5 A;  1Y1V S;  3HC7 A;  3I55 I;  4I7H A;  1U78 A;  4RB3 C;  1TLH B;  3EYY A;  4P5O A;  2E2H I;  1T95 A;  5DCF A;  5EF6 A;  4BAY A;  1BI2 A;  1Q82 1;  1U6G A;  2GOX B;  3C3W A;  2JA8 I;  3GME A;  3BR1 A;  3PIO F;  3HSF A;  2HVQ A;  1N25 A;  4IHS A;  3TE5 B;  3P9I A;  1P6R A;  3K4K A;  1T98 A;  3LSG A;  5E3N A;  4S1T A;  1QVF Z;  2X6Y A;  3FXO A;  1VQ5 I;  2Q4Z A;  2HQN A;  4XIC A;  1S6L A;  3HRT A;  4KMU X;  1K73 2;  2OTL Z;  1WW9 A;  2V4J C;  3H5R A;  3CCM I;  3A4C A;  3I64 A;  2LKP A;  2VQG A;  5L3G A;  5IT9 b;  1WHU A;  2P3Y A;  3QQA A;  3HOY I;  3PO3 I;  4IX7 A;  5T67 A;  3HKZ A;  2PMH A;  1K6O A;  2WBM A;  2QSG X;  2XF7 A;  3FMS A;  5HS8 A;  3PL8 A;  3JSO A;  1WJF A;  4BGD A;  5B3S H;  2DE7 A;  4XRS G;  3FHZ A;  1QXF A;  6PAX A;  3OOU A;  1MBH A;  4IJA A;  4DQ2 A;  3EPZ A;  5KVR A;  5ERI A;  3CD6 Z;  5A2Q K;  1VQP I;  1HXD A;  1NJI 1;  3U50 C;  2JPB A;  2GU2 A;  3GTM S;  2M8G X;  3FKI I;  3C1D A;  1GXP A;  2K86 A;  1SFO I;  4ENM A;  1Y0N A;  3OV8 A;  4YG2 F;  1RKW A;  5C44 J;  2R7F A;  2MLK A;  3HOX I;  2NVX J;  3F8N A;  1ZAO A;  3ECO A;  5F1J A;  1DP3 A;  3ZR8 X;  3SDB A;  2EFW A;  1VQ7 Z;  4XKW A;  4O5V A;  5C4J I;  2JSP A;  3RDI A;  1J5Y A;  2DCE A;  2E7X A;  5FLX Z;  2BY1 A;  1TWH J;  5E3M A;  1UAA A;  3SJM A;  2CW8 A;  3GTJ I;  1WJB A;  2OV7 A;  5DEQ A;  2A6E F;  2VOO A;  1R36 A;  1PUF B;  4JYK A;  2RHB A;  2VUG A;  4BXU A;  4XON A;  3E6D A;  2DMN A;  1U3E M;  2BW3 A;  2OA4 A;  4R79 A;  5EEG A;  2K3P A;  1IF1 A;  4BHP A;  2HOS A;  1KU3 A;  4B48 A;  4GXO A;  3DPL C;  1U5T C;  3OIQ A;  4ZJZ A;  4A3E I;  3RCO A;  3GF2 A;  2CW7 A;  5E3O A;  1SVO A;  3CCR I;  1QVF Y;  1X1B A;  2M48 A;  3WU1 B;  1ZRE A;  4NQW B;  2Q2E B;  1EA3 A;  5J4Y A;  1JKQ C;  3G4S Z;  2JPC A;  5LGT A;  2B7E A;  4A3K I;  5D6F A;  1Y0U A;  1A35 A;  1WKM A;  2XIG A;  4OMZ A;  5J4V A;  3SZT A;  2W84 A;  1VQN 1;  3FXK A;  1XGM A;  3HOV I;  3HOU I;  2GAU A;  4EM0 B;  2ZB9 A;  3OYC A;  4Y17 A;  3MVP A;  2QEX I;  2EIM H;  3I58 A;  1YRN A;  4CUG A;  1C0W A;  3V7R A;  1MSF C;  3HIF A;  2Y31 A;  1VQ9 Z;  4M9S A;  1MGT A;  4G9Y A;  2V7F A;  3CZ6 A;  1BN5 A;  3CMY A;  3CCQ I;  3IHU A;  2M7A A;  3LSI A;  2XB5 A;  4PCQ A;  1TWG I;  2Y30 A;  3Q0V A;  4M3G A;  2HQA A;  5HS7 A;  3F23 A;  2QA4 Z;  3IP4 B;  3H9J A;  4MQ9 F;  3CXC Z;  4D5F A;  4XRM A;  1FLI A;  2VQC A;  3OYK A;  4WF2 A;  1X1P A;  2J6A A;  3CCU 1;  2IAI A;  3M07 A;  1JUP A;  1ERD A;  1HW2 A;  3QPL A;  1WJA A;  2QRC B;  3AAF A;  2V1N A;  1X3U A;  2ZFU A;  4PK4 A;  5F6F A;  3GTK I;  1FX7 A;  3P9K A;  1DQU A;  2BXY A;  4BDZ A;  1IDZ A;  1STZ A;  5IYB J;  2YU3 A;  2CGP A;  1X0T A;  4DZJ A;  3D0S A;  4A5N A;  1CF7 A;  4Y7N I;  3TL4 X;  1Z0X A;  4NBC A;  1YE9 A;  4M3F A;  3I59 A;  1H0M A;  1FDO A;  1NP6 A;  3BZK A;  4ZC3 A;  5ICE A;  5IYC J;  5LLQ A;  4OOI A;  3S15 I;  2PMU A;  4J00 A;  3SDG A;  3ESW B;  1REP C;  2EFO A;  2DA6 A;  3QAH A;  5ICF A;  1XTA A;  3K2Z A;  5J1R A;  1W36 C;  2B63 I;  3DEU A;  3VOE A;  3D5S C;  1FOW A;  1W5C C;  1YI2 Z;  2UXN A;  2FML A;  3FZV A;  3J7Y J;  2R7U A;  2QZ8 A;  3LNQ A;  4KUM A;  4M9Z A;  1W5T A;  4BYY A;  5K5R A;  1FYK A;  2ZAE B;  4HNV A;  1RC9 A;  1ZAR A;  2XPW A;  1ON2 A;  2CW0 F;  1I6H J;  1K83 J;  1R58 A;  2R7D A;  2PJR B;  4Y52 J;  4LD5 A;  2EA4 A;  1RKT A;  4IKF A;  1R7J A;  1ZLJ A;  3CJT B;  2OD5 A;  3ZOB A;  3LSR A;  1BW5 A;  3CXC Y;  5GAE J;  1BOA A;  4XOT A;  1FBU A;  3QPT A;  4HX7 A;  2KDO A;  1E17 A;  2QLV B;  3AG3 H;  1ZK8 A;  3S2H I;  3P9C A;  4N4N B;  2LMD A;  3L00 A;  3HTU A;  3IAS 2;  3K4M A;  4BE2 A;  4FT8 A;  1QRY A;  5D4S A;  1R5G A;  5LRS A;  1ZGW A;  4BBS I;  1UB9 A;  2DA3 A;  2ESN A;  3LST A;  1AKH A;  2MLG A;  3JRC A;  2VE8 A;  3KYL A; 
#chains in the Genus database with same CATH homology
 4BQN A;  2HVR A;  3J7A Y;  3CQZ I;  2AQF A;  3K4N A;  2OOX B;  2BVM A;  2WAE A;  2NVY I;  4MRI A;  4CZC A;  1V5F A;  3A1Y A;  3L2R A;  5D1P A;  3BC8 A;  3IUO A;  1N75 A;  1SAU A;  1TT0 A;  2Z1D A;  3QYB A;  2DJI A;  3MKY B;  3D5L A;  1QF8 A;  4QTU A;  2JVH A;  3MMY B;  3OYL A;  1VQ7 1;  1X4O A;  3P5J B;  2LRE A;  2E60 A;  2VXD A;  1K83 I;  2JR6 A;  2LY1 A;  2R7Q A;  3W2V A;  2L2O A;  1YIT 1;  3HPH A;  1VQL 1;  4Y52 I;  1VZ0 A;  4C2U A;  2BW3 B;  4RM2 A;  2F5V A;  3DKX A;  1RO4 A;  4DK1 A;  1DL6 A;  2VQL A;  3KX2 A;  4OAZ A;  4HST A;  1MNE A;  2VJI A;  2X1D A;  3IAM 2;  3VTN A;  3DTI A;  2F6C A;  2W7N A;  5TGT A;  3G71 1;  2UUZ A;  4AVZ A;  1JWH C;  1Z7L A;  2W04 A;  2E1M C;  1I6H I;  2RPR A;  2W03 A;  4HSR A;  2WAD A;  3H5N A;  3OL3 A;  2V9K A;  3S3O A;  4ZTJ A;  3IFU A;  4XOP A;  3BG0 B;  4N4O B;  2V6E A;  4EWC A;  2MYS A;  4PSX A;  4NH1 C;  3FBN B;  5FLX f;  1N77 A;  2VUM I;  3DU6 A;  4F3Q A;  2QKL B;  5FRN A;  2X6X A;  3KEY A;  2O4H A;  5LD2 C;  3VMH A;  3J81 f;  2VLA A;  4BAC A;  3HOZ I;  4RLF A;  4E4H A;  3OYN A;  1J09 A;  4D1Q A;  4A3J I;  3HL2 A;  4PJM A;  3W2A A;  4KIS A;  3OYM A;  4HGY A;  4RVF A;  1W2B Z;  3DWL E;  3DPT A;  5CQG A;  1QU3 A;  1YJW 1;  2LIY A;  3I56 Z;  1VQ6 Z;  4KIT B;  2VPL A;  2M7B A;  1MMN A;  3VYS B;  2E2J I;  1Z3Y A;  2HDW A;  2V8I A;  4QTT A;  3CC2 1;  3PUB A;  3RTR A;  2JA7 I;  1YJN Z;  4CCM A;  1TWA I;  5LFA A;  4AYB A;  4CSW A;  1QYP A;  3CPW Z;  1YJ9 1;  3VDX A;  1MW7 A;  3OYI A;  1ML8 A;  3H3V J;  3QYE A;  4HNT A;  4XKV A;  4B3X A;  2HF1 A;  1U0J A;  2ZSH B;  3CCQ Z;  1HA8 A;  5T64 A;  5HVQ C;  1MMD A;  1OR7 C;  3I4M I;  5FLX b;  3S2D I;  3PO2 I;  3OYE A;  2DT7 B;  2V26 A;  3PJR A;  3U21 A;  4X6A I;  5LL6 f;  5CKT A;  3J81 b;  4A3B I;  1KC8 2;  1VQK 1;  2LBF B;  2LBF A;  4E33 A;  1X3W A;  1KON A;  3LSM A;  3OWT A;  4U87 A;  5CQE A;  2I3C A;  2QKD A;  5JHF A;  2KMU A;  1VQM Z;  3GTP I;  3CCU Z;  1LQL A;  2W4S A;  2XF5 A;  2VJ5 A;  3OW2 Z;  3OYD A;  3CCE 1;  1Q86 2;  4BQQ A;  2IS1 A;  2RQQ A;  1V5E A;  5CM2 M;  3CMM A;  3H35 A;  3K4C A;  2RRE A;  5CPR B;  4BU2 A;  2UWM A;  2PM9 A;  1YIJ Z;  3M3Y I;  3BG1 B;  3EED A;  5KCM A;  4A3I I;  4BDY A;  3J80 f;  3N05 A;  4PFP A;  1TZL A;  1Q7Y 1;  3CJR B;  3ZCO A;  2RT9 A;  2LY2 A;  1I50 I;  4CCJ A;  1VQ8 1;  1S72 1;  5KHD A;  1RNI A;  3KIF A;  4MH4 A;  3K7A I;  2IXS A;  2CH0 A;  4PSW A;  3BCA A;  4ANJ A;  4BS9 A;  2R7V A;  1W2B Y;  3FDY A;  2CV1 A;  1PFT A;  3CCV Z;  4XR6 A;  3GTG I;  1SFK A;  4C2T A;  2CV2 A;  1P9N A;  5HNH A;  3I55 1;  4A3M I;  2VJJ A;  5IP7 I;  4Y4R A;  4MON A;  3K70 C;  3QWU A;  3CC7 Z;  1G8X A;  1Q81 1;  2CMP A;  3LL7 A;  4E7H A;  2K5C A;  4E7I A;  1USP A;  1USP B;  3CPW Y;  2R7S A;  2RIQ A;  1TWC I;  3GBG A;  2HZD A;  3CF2 A;  1Q7Y 2;  4XLA A;  2OTJ 1;  1LVK A;  3BLY A;  2DOA A;  4A3F I;  1YHQ Z;  1R6R A;  4RVG A;  3JAM f;  1VQ5 1;  4KJZ A;  3D5R C;  1D0X A;  3LSK A;  2RNG A;  4F93 B;  3S8P A;  3CP2 A;  4F91 B;  1BR4 A;  1IRX A;  2VJ4 A;  2GTH A;  3CCM 1;  2JA2 A;  3K4B A;  3FKJ A;  1I3Q I;  2ZXI A;  3HUG B;  2Z16 A;  1RO0 A;  2BOL A;  3VB9 A;  4A3L I;  4XMY A;  3E1S A;  4HEA 2;  2R7T A;  3AL0 B;  1WJ5 A;  3FQQ A;  5HLT A;  1Q81 2;  3VYR B;  3J80 b;  3EUH C;  4BJT A;  4CCK A;  3CD6 1;  2Y0S A;  3VYU B;  4YEJ A;  4DQY B;  2KPI A;  3OS0 A;  4J01 A;  2K3R A;  1VQO Z;  4LIV A;  4E7S A;  3OYB A;  2PMZ A;  1Z01 A;  3S1N I;  4E2W A;  1P9Q C;  3M8J A;  3D9X A;  3NH5 A;  3OW2 Y;  1VQP 1;  2W1O A;  3S16 I;  4CCO A;  4CCL A;  3E0J B;  4HNU A;  1UEL B;  4E7L A;  1Z03 A;  3H9G A;  2LH9 A;  1QVF Y;  2LFU A;  2LOO A;  3VMI A;  2K9M A;  2JUB A;  2E9H A;  2R7R A;  2DXI A;  4C9Y A;  2HVS A;  2X6W A;  2WB1 A;  4XOR A;  3IF8 A;  3MZK B;  4A3D I;  4A3G I;  4XKC A;  4PJL A;  4D9J A;  4BJ5 C;  4XN3 A;  3JAM b;  2E5N A;  4E7K A;  1X4P A;  3PSI A;  3PSF A;  4BXF A;  1OLT A;  2M3A A;  1Y1W I;  1TWF I;  3OL4 A;  1KRL A;  2L9S A;  3M1C A;  3OS1 A;  1MMG A;  1T0F C;  1YUK A;  2KL4 A;  5A2Q f;  4NFR A;  1D1C A;  1VQL Z;  1M1K 1;  5C3E I;  4A3C I;  1NJI 2;  4E2X A;  2X1C A;  4ZTF A;  3HG9 A;  1JJ2 Y;  3G4S 1;  1K8A 1;  3TDH B;  3CME 1;  3GCF A;  1QHG A;  3G71 Z;  2JS4 A;  1LKX A;  2GOM A;  3CCR 1;  3HOW I;  1D1A A;  4NBA A;  3GTL I;  3RSN A;  2IZ4 A;  5FLM I;  2E5Z A;  3DTE A;  5KNL A;  4BBR I;  3I07 A;  1Z3X A;  3DTK A;  4BJ6 C;  3NH8 A;  3L2U A;  3CMA 1;  4PFO A;  3VSK A;  3H0D A;  4CA0 A;  3L2Q A;  5HOO A;  3L2V A;  1KQS Z;  3OIP A;  1YUA A;  1VQN Z;  1VQ9 1;  2WAQ A;  1Z02 A;  1KC8 1;  1K8A 2;  2MFZ A;  3AFH A;  2M0M A;  2BVL A;  3SYT A;  2NVX I;  3GTO I;  2YAD A;  3OMY A;  2QEX 1;  1K9M 2;  2NOJ B;  1YJW Z;  4BY1 I;  4DBQ A;  4BEH B;  4BEH A;  3OYA A;  2JUG A;  2DT6 A;  1TFI A;  2O5R A;  4JOM A;  1Q86 1;  4LIU A;  2JA6 I;  3TMO A;  4HRI A;  2QA4 1;  4F55 A;  2X1E A;  4II2 A;  4BE1 A;  1VLA A;  4NBB A;  5A2Q b;  3CC2 Z;  1AA7 A;  3CCQ 1;  2KP6 A;  2X85 A;  3HOT A;  1FMW A;  1DGR M;  2A5W A;  1NUI A;  1Y6I A;  1Y1V I;  2GTI A;  3C2H A;  3ZQQ A;  1BR2 A;  2VAS A;  3OYF A;  4LIT A;  2WA0 A;  2MC4 A;  4E7J A;  1X1D A;  2H85 A;  2QRD B;  1R9T I;  1DGW Y;  3K10 A;  4HG2 A;  2R7O A;  4DGW B;  4TNU A;  1V5G A;  4F52 A;  3TBI A;  3C2G A;  2CS3 A;  3AL0 C;  2NVT I;  3RZO I;  3RZD I;  2P0W A;  4A93 I;  2HPI A;  3VYT B;  3EUK L;  1G59 A;  3HPG A;  4NC7 A;  3A2K A;  2R6M A;  3G6E Z;  3G2B A;  1VQM 1;  2LC2 A;  2L7K A;  1KD1 2;  2K5R A;  4QPO A;  5HNF A;  2KRH A;  4P1W A;  4IZZ A;  3MD2 A;  4BL0 B;  2DE5 A;  3S1Q I;  3OR2 C;  4QPQ A;  3UR3 C;  1WFX A;  2X51 A;  1WII A;  3EER A;  4EAT A;  2VKD A;  1Y56 A;  5IT9 f;  3VSL A;  4JQF A;  3MKW B;  2KI7 B;  2F4M A;  2OZK A;  1WJE A;  3CCL 1;  2OUM A;  4XQF A;  3QOD A;  3CCE Z;  3NWS A;  4BY7 I;  3OYJ A;  4NUB A;  4NB8 A;  2VF1 A;  1ZH1 A;  2ZXH A;  3K4L A;  2M6N A;  3LSH A;  4CL1 A;  3SEQ A;  3DEE A;  1VQ4 Z;  1BR1 A;  4GRI A;  2CFO A;  1KQS Y;  3GTM I;  3LUS A;  1K73 1;  2XC7 A;  1JI8 A;  3NH4 A;  3RPU D;  3S1R I;  1YI2 1;  4OAY A;  1D0Z A;  3PNV A;  4XL9 A;  1Y1V S;  3HC7 A;  1VQ8 Z;  1JJ2 Z;  1S72 Z;  3CCJ 1;  2IGO A;  4P5O A;  1NG7 A;  4ZYA A;  1T95 A;  3SEZ A;  1Q82 1;  3DKY A;  4E30 A;  1LDK B;  2E2H I;  2GOX B;  2V8J A;  3ZGK A;  4E7Z A;  2JA8 I;  2IGN A;  3SZG A;  3BG7 A;  2G2K A;  3CC4 Z;  3BCB A;  2HVQ A;  3DLA A;  2F4O A;  3MZL B;  3TE5 B;  3M4O I;  3S14 I;  3K4K A;  3LSG A;  3S93 A;  4NBG A;  4S1T A;  1QVF Z;  2X6Y A;  2R92 I;  4X0G A;  2Q4Z A;  4XKB A;  2JMO A;  2R93 I;  1K73 2;  3QOE A;  3S1M I;  2OTL Z;  1WW9 A;  2V4J C;  3H5R A;  3PNY A;  2IGK A;  3A4C A;  4E32 A;  2OTJ Z;  2VQG A;  1M90 1;  3F3P C;  2JA5 I;  2QR1 B;  2R7Z I;  5IT9 b;  1D0Y A;  2P3Y A;  3HOY I;  3PO3 I;  4BQO A;  4E2Y A;  4IX7 A;  1E0E A;  3HKZ A;  2XSJ C;  5T67 A;  1VQ5 Z;  2WBM A;  1Q82 2;  2XF7 A;  4B47 A;  3PL8 A;  3ZXS A;  1WJF A;  3CCS 1;  4BGD A;  3CCM Z;  3NDI A;  2DE7 A;  4RMN A;  3RQ4 A;  4AU7 A;  1MMA A;  3OOU A;  4NOZ A;  4E2Z A;  3GKQ A;  1YX3 A;  3FBI B;  3EPZ A;  4E6K G;  3L2W A;  3PFY A;  3CD6 Z;  2QKM B;  5AN9 F;  3S3N A;  1NJI 1;  1GLN A;  3U50 C;  2GU2 A;  3GTM S;  3FKI I;  1M90 2;  2K9L A;  3VMG A;  1RQF A;  1Z21 A;  4NBE A;  3NDJ A;  1SFO I;  3FHN A;  3S32 A;  2KQR A;  2CV0 A;  3HOX I;  1VQP Z;  3AKZ A;  3I3L A;  2XAU A;  2M4G A;  2VKH A;  2CUZ A;  1N8R 2;  1DP3 A;  3ZR8 X;  3SDB A;  4ZDP A;  3D6W A;  4NB9 A;  1VQ7 Z;  1N78 A;  4XKW A;  1X3Z A;  4HGZ A;  5C4J I;  2JSP A;  3I9V 2;  4XM3 A;  2DCE A;  2IGM A;  4NBD A;  3ZRG A;  1YIT Z;  2W00 A;  1UAA A;  3GTJ I;  2CW8 A;  3J7A 4;  1WJB A;  2OV7 A;  3DQV C;  3MON A;  1BOB A;  2F4I A;  2RHB A;  2VUG A;  4XON A;  2AKL A;  3CES A;  4YEL A;  2BW3 A;  2JVG A;  2R4G A;  3LFU A;  2I8D A;  2KRC A;  4BUP A;  4CH7 A;  4R79 A;  1K9M 1;  2K3P A;  1X1C A;  2ELJ A;  3LMM A;  3PO3 S;  4B48 A;  1NG6 A;  2LRD A;  3DPL C;  2IS4 A;  4ZDO A;  4RS4 A;  4CCN A;  3OIQ A;  4ZJZ A;  4A3E I;  3RCO A;  5C4X I;  3H9Q A;  4BXX I;  2CW7 A;  4C30 A;  4PJN A;  3FQM A;  5T6B A;  1LFP A;  1X1B A;  2M48 A;  2V8K A;  2A6T A;  2VB6 A;  2R7W A;  1QVG Y;  4NQW B;  2MD0 A;  2Q2E B;  3I56 1;  1VQ6 1;  1EA3 A;  3G4S Z;  4XLH A;  4NBH A;  4XN0 A;  1X19 A;  4DJA A;  5FRM A;  3CME Z;  4A3K I;  4RVD A;  1QHH D;  2L5Q A;  3BG6 A;  4RM3 A;  5C44 I;  3Q87 A;  4XLC A;  3CCR Z;  2MAB A;  4XLF A;  4HPQ A;  2NVQ I;  1YJN 1;  1VQN 1;  3HOV I;  3CJQ B;  3W3C A;  3HOU I;  2UV1 A;  3CMA Z;  2ZSI B;  4NNJ A;  2EGT A;  2VXZ A;  3OYC A;  2L9N A;  1TWH I;  4NBF A;  4LG3 A;  3OYG A;  3ONQ A;  2VQH A;  1PJR A;  4CUG A;  1KD1 1;  4IQ4 A;  1X1A A;  1VQ9 Z;  1YJ9 Z;  2WAF A;  2V7F A;  2HNH A;  4F92 B;  1M1K 2;  1D1B A;  3CP8 A;  3CZ6 A;  3HOS A;  4B43 A;  2QEX Z;  1YX5 A;  2M7A A;  2WY8 Q;  3LSI A;  4XX2 A;  2W82 A;  3F9K A;  3K6G A;  1TWG I;  4DBR A;  2KPM A;  1RO2 A;  3QYF A;  4YRV A;  4DOZ A;  2HQA A;  3VWB A;  4HH4 A;  2QA4 Z;  3MKZ A;  3IP4 B;  3H9J A;  3I4N I;  3S17 I;  4B44 A;  3CXC Z;  1ZB8 A;  2VQC A;  3OYK A;  2J6A A;  2O53 A;  3CCU 1;  3DPU A;  3IX0 A;  3UNG C;  4U7B A;  1W36 D;  1ERD A;  2QRC B;  2Q1Z B;  1WJA A;  2RBL A;  1VQK Z;  3DU5 A;  2M4K A;  2V1N A;  4MXU A;  3G6E 1;  2ZFU A;  4OWR B;  4ZDL A;  4PK4 A;  2E1M B;  1YIJ 1;  3PNT A;  4MD9 A;  3GTK I;  4KT6 A;  2BJO A;  1DQU A;  4XNF A;  1L1O C;  4BDZ A;  4Y7N I;  2IZ3 A;  1X0T A;  3K70 D;  4NC8 A;  5IP9 I;  3TL4 X;  4NBC A;  1YE9 A;  1ZEL A;  5FRO A;  1NP6 A;  4ZC3 A;  1S7M A;  1S9H A;  3CCV 1;  2OC6 A;  2P28 A;  3W2W A;  3OY9 A;  4RLQ A;  4DIQ A;  3OR1 C;  3OYH A;  2HPM A;  2Q51 A;  1VQ4 1;  3S15 I;  4J00 A;  2AQE A;  2HU9 A;  2WY7 Q;  3ESW A;  3CCS Z;  3GTQ I;  4XLE A;  2XDV A;  2E2I I;  3CCL Z;  4H4K C;  1RLY A;  3CC7 1;  2PK7 A;  4PUS A;  4DGL A;  2YU9 I;  4II3 A;  3EUA A;  4PJJ A;  3NFZ A;  4MD8 A;  1UG0 A;  4FAS D;  1W36 C;  4MLO A;  4RVH A;  1WJC A;  2KLO A;  2B63 I;  2LG4 A;  3NWT A;  1N2F A;  3I55 Z;  2VIX A;  3K4J A;  1YHQ 1;  3D5S C;  2IS6 A;  3T4N B;  2VL8 A;  1QVG Z;  4G6T B;  4ITV A;  1YI2 Z;  2KHM A;  4Y33 A;  3CC4 1;  2R7U A;  2R7X A;  2KZV A;  3KIH A;  2QRE B;  3S3M A;  1ZB9 A;  3V42 A;  2ZAE B;  3CCJ Z;  2IS2 A;  4Y3O A;  1PYV A;  3H5A A;  2OTL 1;  2OOY B;  4E31 A;  2PJR B;  2PJR A;  3H0G I;  3HXL A;  4IKF A;  4FET A;  1N8R 1;  3OS2 A;  3CXC Y;  1VQO 1;  1K6Y A;  2CUJ A;  4XOT A;  4IQJ A;  4BE0 A;  2JNY A;  1MND A;  2FUG 2;  2KDO A;  2QLV B;  1FMV A;  3S2H I;  1WCM I;  1WJD A;  4N4N B;  4MD7 A;  5D1O B;  4BE2 A;  3IAS 2;  3K4M A;  2DE6 A;  5D1O A;  2LYC A;  2Z2S B;  4BBS I;  2XF6 A;  4RV9 A;  3KYL A;  3F3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...