2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mercuric transport protein periplasmic component
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
1Y56A 4E6KG 2HU9A
chains in the Genus database with same CATH superfamily
3FXRA 1RLYA 3LA3A 1S3JA 4MIMA 2JA7I 4UB8C 4CCJA 2UXNA 4P1WA 3HPGA 4GGGA 2PQ8A 2ZJPF 2DW4A 1PUEE 2FJ1A 3RZDI 5D4SA 1VQNZ 3L1PA 2XAGA 1WJEA 3C7JA 2QCOA 4M3DA 2N8GA 2E34A 3IF8A 2IP2A 4AIKA 9ANTA 1XSVA 5TRDA 4E30A 4X1EA 2Q0OA 2W03A 2CQNA 4HNUA 2CW0F 2K9NA 4IXAA 2I5UA 4Y15A 1QYPA 3N97A 4E2XA 4BHPA 1R58A 2GA2A 3WGIA 2H85A 4ZDLA 2H1LA 2DT6A 4XLFA 1QHHD 3WTSC 1UELB 3ZQFA 1YI2Z 1GUUA 1FNNA 2NAZA 1ZH1A 2L54A 5HS7A 1FC3A 5LRRA 4AU7A 4Y7NJ 2QBYB 1S72I 1DUXC 4HDUA 5BMZA 2DFIA 3MCZA 3CCE1 3FKIJ 2QKDA 1JGGA 4A69C 3I0TA 2L7KA 2XGEA 3LSTA 3BT9A 2F48A 3NFZA 2RC4A 3FXMA 2XVCA 1YHQ1 4RVDA 5HS9A 5IYBJ 2IXSA 1Z67A 4A3DI 4XIDA 1S5LC 2L02A 4MLOA 3WGGA 1BC7C 3FMRA 2KIFA 4CHUA 2EGTA 1JGSA 3CCMI 3FDYA 2HKOA 4X6AI 1VQMZ 1O57A 2LC2A 1A5JA 4J19A 4HA8A 5E18F 4WX9A 3CDIA 3SYTA 3OYAA 3DCFA 5IT9f 4FX4A 1O7FA 4G8XA 3S3NA 1DU0A 1IRGA 2DMPA 2VKVA 1ZLJA 3GFJA 1H8AC 1ULYA 2KIQA 3L2QA 2OBPA 3H3ZA 2DOFA 5E20A 1FTTA 5BNGA 2HF1A 1BI2A 4CA0A 3VMHA 4IEJA 5D1OB 4P9FA 5DUKA 1LPQA 3TDHB 4E7LA 2CV1A 3FXKA 3JAMf 4FT8A 5E3OA 2HU9A 1FDOA 3GW2A 4I98B 2VPLA 1QBJA 1Y0UA 4EJTA 5D6FA 1NG7A 5LEJA 2IPQX 2JVHA 5E17F 5H2FC 3CCL1 1YIJZ 2ZCWA 1NUIA 3CD6Z 5DS9A 5IYCJ 4A3GI 4C9YA 1MGTA 2K9QA 3PIPF 4UXNA 1VQKI 2HYGD 4II2A 2JA5I 3CP8A 1Z0XA 2Y0SN 5CVJA 1VQO1 3I55Z 2VLAA 2V1NA 5GADJ 3GTQJ 2M0CA 4EJOA 2R7XA 1YJWZ 3B6CA 2ZMEB 4F93B 1M1K2 1SMTA 2JZYA 1FOWA 4CZCA 5J4YA 5ICCA 4OIPF 3LAJA 2O4HA 1MNEA 2XGDA 1P4WA 3VB2A 3DEWA 4L9NA 2E36A 1YIT1 3CUQC 4U0WA 2FD5A 4MO7A 2YR2A 5BS6A 2DI3A 1FX7A 4B47A 1N77A 4N4OB 2FA5A 4BXUA 3A0HC 2CWEA 3OMYA 1IRXA 5EG0B 3BPVA 3MQ0A 5HNFA 4XORA 2R7TA 4IHXA 2F5VA 2X1CA 3P9KA 5CVRA 5EZGA 2EPFA 4JX6A 4GYGA 4HGZA 5IP7J 1O4XA 5FKOA 4WXCA 1TQPA 1OQYA 3LA7A 3OW2Z 3JAMZ 1NG6A 4LB5A 2GQQA 4MEXF 4HF2A 4BXXI 2WADA 2KQRA 3E6CC 2MYSA 2Y69H 3DKYA 3BJAA 4OAZA 1X1DA 4XBFA 4NNJA 4XK4A 2L5QA 2LSOA 2GBYA 3FXJA 3DTEA 3I5UA 1XN7A 2LEXA 4NBFA 4EVIA 2PK7A 1JTYA 3PL8A 1H88C 1QRYA 4IF4A 2CFOA 4E6KG 5F6FA 3K1NA 2RNGA 2Y48A 3QWLA 4M9ZA 3CO6C 4BBRJ 4YFKF 4BEHB 3QWUA 2LFBA 1NJI2 2DMQA 4HOBA 5EEGA 2DLLA 1WJAA 3L2WA 2H27A 1FJLA 3IR7A 2RN7A 3CCRI 1ZRCA 4BAYA 1T0FA 2R7UA 1ETVA 2Q2EB 3QYBA 4PK4A 1MMNA 3CC2Z 5C4XJ 2QEX1 1XCVA 4FCYA 1TC3C 1QO0D 2PMHA 4ZTJA 1TWCI 2VC0A 1K78B 4Y17A 3DWLE 3T8TA 2UUZA 3LMMA 4RGUA 1G2HA 1D1CA 1LJ9A 1E3PA 1ZYRF 4E4HA 2EZKA 4CYCB 4WCGA 2W00A 3BTJA 4BYYA 3NAUA 2OTLZ 4Y52I 4I7HA 4HQMA 2Q1ZB 4XOPA 4HV5A 1CF7A 2HQ5A 2VUGA 4PUSA 3M7GA 3S1MJ 2HWVA 1K8A2 2NYXA 1SANA 3RZDJ 3BQZA 4YG2F 3KIFA 4QSHA 3CMAI 4RGXA 3OSFA 4D9JA 2Q8KA 2PMUA 3HTUA 2DA7A 2H6CA 3CCQZ 3PSIA 6PAXA 1K61A 1BW5A 2JA2A 1SD7A 4S05A 4PZJA 3HXLA 2ZNYA 3JTGA 2F5DA 3DPUA 5CJ9A 2ACJA 2KLOA 4DBQA 2VBWA 4ZDOA 3FIWA 1BI0A 1U78A 1ACIA 2MD5A 3COAC 1YW8A 3NH8A 3RZOI 4MQVA 1YTYA 5JI6A 3EEDA 2K4JA 1EJ9A 4CCOA 1GV5A 3WTWC 1RR7A 3K6GA 1WH7A 4P9UA 3HBLA 1HBXG 3CCS1 1W2BY 2QQ8A 2W1OA 3CO7C 3PFYA 2BY0A 2UV1A 1N2FA 1USPA 3CJQB 3H0DA 3C2GA 1S6LA 2CO5A 1B8IB 5IOZA 2JS4A 3J81f 5IT3A 3CC41 2EB7A 4RMNA 1FZPB 5B5EC 2LP0A 1WFXA 2R5ZA 4CGZA 3W6KB 3P5JB 4FISA 4JP0A 3BY6A 5E1WA 5IP9I 3DKWA 5DDGA 3FQQA 3LUSA 2STWA 1TWAI 1OCZH 5J1UA 3WGHA 1I39A 3RPQA 1UHMA 3MMYB 2R4GA 4A0YA 5TGTA 1UAAA 4DGLA 3K4NA 4UV9A 1Y0NA 3G4S1 3HM5A 2E60A 3SQNA 2AQEA 1ETXA 1QVGY 4ENNA 2DT5A 3R61A 5IT9K 2XV4S 5ED4A 1SD4A 1VQPI 5CM2M 1TT5B 1Q822 4YRVA 3PUBA 3G1LA 2OTJI 4BY1I 4W1UA 3IHUA 3TDUC 3GTMS 2JIOA 2P6TA 1QNTA 1ZG3A 3EERA 2CSOA 3S32A 1Z6RA 2I8DA 4QLCU 4L9JA 3HPHA 4BBSJ 1B1BA 3JAMK 1U5TA 4P96A 3Q9VA 3CCJ1 3GX4X 1HKTA 4MRIA 5ERIA 4A0ZA 1TWFJ 3ISPA 4N0BA 1L0OC 1RETA 1YW7A 1A36A 3PO3S 2X1DA 4XN3A 3IAS2 1M901 3BG1B 3NH4A 1VQLZ 1MW7A 4HF0A 3M4OI 1SVLA 1ZGAA 1OCRH 3OYMA 2XAUA 2R3SA 3JRDA 1SMYF 3AKZA 1KQSZ 5CVVA 4HBLA 3F9KA 3JRGA 5KHDA 1AA6A 2Y0MA 3H36A 1Q1VA 3KEYA 5JFRA 2D5VA 4A5MA 4CUGA 1WRJA 5FLXb 2DPUA 2JQ7A 3BR3A 1IXSB 5H6RA 1FDIA 4DQYB 3T0YA 4XLPF 1X1CA 2O7OA 1IUYA 4V2FA 4XQFA 1YJNZ 4E7HA 1G3TA 3F0CA 3KP4A 2Z16A 3GCFA 1HC8A 4IHVA 2TCTA 2FQ3A 3LL7A 3LSGA 3J7A4 4KJZA 5J40A 2Y9YA 3CCVZ 1TWHJ 4IZZA 5KK1A 2MABA 3FQMA 3BTCA 4R8HA 4XOTA 3U50C 2FOWA 4CO8A 2CUJA 2LDUA 5F27A 2GM4A 1FSHA 3GUDA 5GTHC 4B48A 1YIOA 2KFDA 4R1HA 4CL1A 1ITYA 4M6YA 1IDYA 2CUEA 1T8IA 5DTDA 2GA1A 2PBIA 3DEEA 1K4TA 3ZMZA 3D1NI 5D5UB 3G6E1 1Q861 1Y1WI 1WHUA 3OYGA 3JSPA 2MH9A 2VQGA 4F52A 3NRVA 3HRUA 2BE5F 2E1CA 3G3ZA 3W2AA 4C2MJ 1DP3A 1QPIA 3A1YA 3ABMH 2A3SA 2LNBA 5AONA 1LFUP 1X1AA 5K1YA 3BJOA 4CCMA 3PFIA 2AS5F 3H5AA 2H09A 1P9QC 3GFMA 2HS5A 2ISZA 5D4RA 2Z9OA 1TW3A 2R7VA 1W7PB 4I01A 4RS8A 1GLNA 3HZJA 1ZLKA 2QQBA 4U7DA 3CCEZ 2HYJA 3RKWA 4DYRA 1R36A 5CLSA 2E71A 2UZKA 2K86A 1X3ZB 3KZYA 1V5FA 3BG6A 4RB2C 2NS8A 2WWYA 1YHQZ 3CMA1 2L7ZA 4Q4ZF 1IC8A 1HSJA 3HOWI 1T08B 3KE2A 3LSMA 1Z6TA 3WE3A 4A2UA 3VFZA 1D5VA 5BQTA 2COBA 2KHMA 2M5WA 1O3RA 3F23A 3QOPA 5FLXf 3ONQA 1DPUA 3BZCA 4A3BI 4M72A 3HRTA 3T5XA 3ULQB 3VTNA 1Q7Y2 1KD11 3F3XA 1UHWA 1VQ9I 2BXZA 4GRIA 2IJLA 3CCYA 4A3EJ 1QA6A 4CCLA 2PEXA 4UUSA 1OLTA 1JE8A 3HOXI 2I10A 1UCRA 1TBXA 4EM2A 1RUNA 3DLLF 2BV6A 1IF1A 2HGCA 1MDMA 2DE7A 3OYNA 3RPUD 2WBMA 1QF8A 2DJNA 2QQ9A 3FXLA 1ETKA 4O6JA 1YJ91 2G7UA 3CCLZ 1C0WA 2XPVA 1JHFA 3WTYC 4KMUX 4BJ6C 5ICGA 3JCUC 1AKHB 2KKOA 2EFNA 4ZYEA 4Q5SF 3U2RA 3OYBA 1R1VA 5L3DA 2IGKA 2FNPA 2CFXA 3OR2C 2OF7A 2L3DA 3R60A 1VQOZ 2BHZA 5HLTA 1A31A 2ME6A 1RO2A 3GBGA 5FKNA 1X0TA 2LYCA 2E2JI 2OZ6A 3J81K 1WJDA 3S15I 2LY1A 3CME1 2RBLA 1KYWA 4I0AA 3RKYA 4IO9F 3HEFA 2DYRH 3JRAA 2NVXJ 2RHBA 2OCCH 4KDPA 1OYIA 3S1QI 1MIJA 2K4BA 2LVSA 3S2WA 1MMSA 3BCBA 1YITZ 1KU9A 1GVDA 4KT5C 2BHYA 2RKHA 2QA4I 2W57A 2X1EA 1RI7A 2M4KA 4BY7J 4G6DA 3WTZA 4E2ZA 1X4OA 4NBEA 4U0VA 3U9GA 1WZ2A 3RTRA 5GPCA 5HODA 1FYKA 1HW2A 5K5OA 3KFWX 1R49A 3FX3A 1XSDA 4G94A 4RVHA 3CQZJ 1DQUA 1ZHFA 2HQNA 1TWGJ 3TBIA 1ZH5A 2AYDA 2OZUA 3S17I 1IN5A 2CW8A 1L3LA 4A3LI 4XRFA 5K7FA 2QKMB 2F2EA 1YYVA 3BCAA 2L7MP 4RA2A 2GXBA 4BQQA 1PVEA 3IH2A 3L2VA 4NBGA 4XRSG 1DL6A 4IPAA 5FB2A 2XAQA 3PQKA 2XROA 3I4MJ 2A5YB 2DTRA 1OKRA 2YUSA 1KZHA 5F1JA 4NUBA 2DAOA 1D8KA 3ZMDA 2XPWA 4E7JA 2O6GE 4PJMA 3RJPA 2VXDA 1QVGZ 3SZTA 1QZYA 1R5HA 1PDNC 3LSIA 1TQIA 2HVQA 3CCUI 2VB6A 4IHSA 2DFHA 2ZBKA 4OWRB 3Q0VA 5DCMB 3TP0A 3ABLH 2ZC2A 1R1TA 3WU1B 4LJZF 3D9XA 3ML6A 3ZQLA 2QEXZ 2V8KA 4A3FJ 3CUQB 4RGRA 2LR8A 4EMSA 4F3QA 5F1RA 1W36C 1YUKA 2OV7A 4XKVA 3LQQA 1ZKGA 3BZKA 4GXOA 1U9OA 2BOLA 1JKRC 3VYTB 4WF2A 1WI9A 2JJ7A 1ZG5A 3G1MA 1JKOC 4A3CI 5CVUA 1LE8A 3TOAA 3IV5A 3M8FA 3X2QH 2QENA 1RO4A 3SEZA 3HIFA 4G7ZF 3GZNB 2P8TA 1Z91A 2QYOA 3O8GA 2BEOA 3LNQA 4CDGA 4QTTA 3MZYA 3AAFA 1TP4A 3IL2A 2K3FA 2QREB 1D5YA 4GFBA 1EF4A 3A03A 4MXUA 3CMYA 4ITVA 1WCMJ 2X9DA 4A5NA 2R7ZJ 5E1XA 4NH1C 1KQ9A 2XPUA 3E6BA 3JRIA 3HUGA 2JVGA 2W24A 1XGNA 2DMUA 3TKYA 4MH4A 4QPOA 1KRLA 2DK8A 1R1UA 3EPZA 1GV2A 3NWSA 4A3KJ 2CMPA 1VQ7I 3BOQA 4XSXF 3BG3A 2L01A 3OYIA 1A35A 3J7YJ 3TE5B 2LY9A 5E3LA 4I99C 1FIPA 2IEKA 3U21A 2HOEA 4WXHA 4OIRF 2V26A 3DXJF 4LLGF 2EBIA 5JLXA 1FPQA 5C4JJ 1VQ8I 2OUMA 2OCEA 2I3CA 1MBGA 2D1VA 2WY8Q 1I50I 4KIBA 3QYEA 1YO5C 1HDDC 1SFXA 3NWTA 5LLQA 3CC4Z 4EJUA 2WAEA 3OYCA 4BDYA 3KIHA 2DMNA 1F1ZA 2E7WA 4I6ZA 1FTZA 1CGPA 1YJN1 5C3EI 4XLAA 2NRAC 1LDDA 4FE4A 3LSHA 1Y8CA 1FBSA 2VOPA 4YIFA 3GFLA 2EILH 3MWMA 2H8WA 3DTIA 3K69A 2F4IA 5ILSA 3AL0C 3C2BA 4A3BJ 5FLXK 1X58A 2CQQA 5JHFA 3TDZC 3C3WA 3B02A 4MGRA 3G4SZ 5CVIA 2CV0A 1MJ9A 3P9IA 1L1OC 2W7NA 1FLIA 3G71I 3F8MA 2JT1A 3SHFA 3HOXJ 1VQKZ 2DA6A 4I02A 4A3MJ 2KZVA 1SAXA 4PDKA 3FHNA 3RIRA 3KX2A 3J7AO 1LVKA 1T6SA 3HG9A 2O3FA 4PFPA 5FROA 5B1AH 1Z9CA 2O8XA 3B73A 2LH9A 5IPAA 5BPDA 2IS1A 3CCJZ 2E1MB 3I54A 4M3FA 3Q9SA 1VQ6I 2GTHA 1JJ6C 1J75A 1RQFA 3GWZA 4RAZA 2LMDA 1Y1VJ 3GTGI 3ZP5A 2LRDA 2O61A 4ZJZA 2CV2A 1RESA 3HTSB 1X3WA 2QRDB 3FM3A 3K9TA 4E31A 1V5GA 2UXXA 3NDIA 3S15J 3L7WA 3N4MA 1PUFA 3BTLA 1K79A 1MMAA 3Q0UA 2R92I 5F04A 3S1NI 1SAUA 1U8RA 3MN2A 1QZZA 1XMAA 1ENHA 3VMGA 2MSYA 2M6NA 5D6EA 3V42A 1Z77A 2EIKH 2K5RA 3BP8A 4KT6A 2VONA 2ZFWA 4L5IA 1R9TI 3V8KA 1O3SA 3LFKA 3M1CA 2HI3A 1MBHA 1POGA 4MD9A 3S3MA 4S04A 1WJCA 2YX4A 3RSNA 2V1XA 2FUG2 2R7OA 3ZQQA 4DBRA 1I3QI 1NTCA 2OA4A 4CZZA 1MSEC 1LDKB 1FBQA 3I561 4XR6A 4JK1X 3S93A 3ZMSA 3ZQCA 5IOYA 1QVTA 3EETA 1N78A 3MZLB 1E2XA 3IKTA 4A12A 1YX5A 3G6EZ 2DJIA 3S17J 2DN0A 2K3PA 1LFBA 2H6BA 4HX4A 1WJFA 2CU7A 4A3LJ 2AXLA 2GOXB 3IWZA 3A01A 1S7OA 1IRZA 4NOZA 2R93I 1S29A 2HTSA 2PJPA 1FOYA 4AIDA 3V4GA 5M5XJ 3OYFA 3Q3SA 3BTIA 5TJJA 4XONA 4KUMA 2E19A 2DYSH 2G2KA 1IXCA 2C6YA 5F08A 4PFOA 2O53A 3QQAA 1OCOH 3R0JA 2VODA 3M8JA 4U7BA 2M9HA 1WQ2A 2WV1A 4I76A 1MNDA 4XLHA 3K7AI 1YRNB 3N05A 1WJBA 4PGGA 4MNUA 4XMYA 3E97A 4NBDA 1T2KA 1SEUA 4XICA 4OAYA 2ZB9A 3H35A 2QSFX 4L5JA 1Z7UA 1JKQC 2EZLA 4LITA 1HKSA 5JVGF 3RI4A 5JR3A 5LL6f 1GDTA 2E2HI 3PNVA 2MA3A 3S2HI 1TZLA 3CMAZ 3K4CA 3GTKI 2WB1N 1LNWA 1B6AA 1UB9A 1X4PA 2Y2ZA 4HYEA 1VTNC 3Q87A 2KRCA 1F43A 4F7ZA 2XF7A 2FMLA 4MD8A 3GO5A 4E2WA 1VQNI 2VE9A 5LFAA 4A3JI 3SEQA 4DK1A 2K9MA 3RDIA 3LA2A 3NQOA 2MG4A 4LD5A 3MZHA 4E70A 2JA8J 5LRSA 1H0MA 5L3FA 5IT9Z 1DGWY 2KPIA 2YS9A 3CUOA 5LHIA 4LG0B 2O5RA 1PJRA 4M73A 1I3AA 2QGUA 3ASNH 2VI6A 2DA3A 1IDZA 4NBCA 3I59A 1VI0A 4W97A 1BBYA 2VPWA 5AN9F 2J5PA 4WK8F 2O03A 4MHGA 2DFEA 3M3YJ 1WKMA 1YI2I 2P81A 3IC7A 2ZAEB 2HDDA 3DBHB 2R0QC 4D7MA 1KGSA 1ZGWA 3J81b 3JW4A 1JJ2Z 2VJIA 1OCCH 2QVOA 1BOBA 2VN2A 5ILUA 2B9SA 2H8RA 1TFIA 2ZXHA 3HB9A 2F4OA 1YJ9Z 2JUBA 2WA0A 3P7NA 1IZ1A 4UY8I 3S14J 2OOXB 4PJJA 1FIAA 3O3KA 4H4KC 4AYBN 1M1K1 1Y6IA 3S3OA 3GTPJ 2JA6I 2Y0SA 2JMOA 3R0AA 2Q4ZA 1WPKA 3HSRA 2G9WA 1UFMA 1MJBA 1QVUA 3MKWB 2R5YA 2R7QA 3RCOA 1VQMI 1ERDA 3CMEZ 2EA4A 4C3JJ 5HNHA 3I58A 1J7KA 2FSWA 2ZSHB 5C3EJ 2ZO4A 2XSJC 5HLGA 5HOOA 1DDNA 3NARA 3S1RI 1JWHC 2Z5UA 2WB1A 3BR1A 1JUSA 2Y75A 4Z6YA 2VJ4A 5KAFC 2PJRB 2AKLA 3HHHA 3J80f 4DYQA 2Z33A 2JSPA 2WAQN 5D8LB 3NEUA 2Q2EA 1YLFA 2VT3A 4G12A 2ELKA 1EKEA 2KIMA 1XG1A 4C3HJ 2HVSA 4E32A 2XB5A 2JA7J 3F6OA 1X3UA 5E3MA 1Q811 5LGUA 2O0YA 1YIJI 1CF7B 3F8CA 3GLXA 3OR1C 4CSWA 4CYCA 3CD6I 4BH9A 3Q0WA 3ZOBA 2XIGA 4P5OA 1U3EM 2XASA 1S721 4IJAA 2W85A 1EH8A 1QVFY 1K83I 5M3MJ 1Y56A 5ILVA 4HDVA 3I55I 2HDCA 2L2OA 1NJI1 3K10A 2F5CA 2W48A 4LLLA 1K9M2 2QR1B 4XX2A 3IFUA 1YJWI 4UNOA 2HPIA 3FM5A 5FFZA 2O8KA 2B63I 4XLNF 1MMGA 1I6HI 5J3LA 2FMYA 3L2RA 2FX0A 4AYBA 3VWBA 3EDPA 2E5ZA 5FD5A 3OYEA 3K1MA 4EJWA 1R4NB 3CCM1 1Z3YA 3HRSA 2R92J 2JPBA 3KYLA 3J7ZI 3S1NJ 3CDHA 1ZARA 2JIMA 4NBHA 2P4WA 2W82A 3CDLA 3DU6A 3K4LA 1USPB 3WODF 2V79A 1K731 2OZKA 3H9GA 2JSCA 5D1PA 2IZ4A 4GDFA 4A3DJ 3MONA 4BE0A 4UHTA 2MBFA 3A0BC 1MBKA 5B3SH 2IRFG 5IP6A 4IKFA 3FMQA 1B8IA 2WAQA 2FXAA 3B6AA 1YX3A 4X6AJ 4NQWA 4M9XA 4XNFA 1HKQA 4RB3C 1TTYA 4I0BA 2EH3A 1IGNA 1U9NA 2XAJA 5ICFA 3VOEA 4XLCA 4BS9A 3QU3A 1W0UA 3MVPA 2JUGA 4QPQA 4HV6A 2QSGX 5EGOA 4IRGA 1OFCX 3GXOA 3T8RA 1VQK1 2R93J 1KU2A 3CPWY 2M7BA 5M3FJ 5JHUA 4MTDA 4G6TB 4MONA 1IO2A 4K2EA 3MZKB 3OYHA 2LKXA 1Q16A 2P3YA 3KZZA 4IQJA 2GOMA 1R5GA 2X6OA 1UG0A 2DA1A 1D0XA 1Z3XA 2IA2A 1U5TB 2LK2A 3K7AJ 2FNAA 2R7RA 2NS0A 3DV8A 2XF6A 2HPMA 3CC2I 4A3GJ 1SFOI 1SFKA 2HXOA 2ZJ2A 2LBFA 1ORKA 2JA5J 2L0KA 2DDBA 2LD5A 1U0JA 2GIZA 2X6YA 2BVLA 3J81Z 1HA8A 2RV8A 5FD6A 1N8R1 5FRMA 3DBLB 3OYDA 4J01A 4LGWA 1J5YA 2OTLI 1Q862 2H1KA 2OQRA 1IXRC 4A3II 1TW2A 2VKDA 2XKOA 3E6MA 2HOSA 1ZK8A 4HAMA 3FISA 3F6VA 1S7AA 4HQEA 3TEDA 2VE8A 2VT2A 4AUXA 3E1SA 2VPXA 2LREA 3CCQI 1JHHA 3BR6A 4LK1F 3NH5A 1BJAA 4RM3A 4UVBA 2NVYI 2WV0A 1FEXA 2V9PA 2JNYA 2P6SA 1X2MA 1RIOH 1ZAOA 3IX0A 4QTRA 3ZQIA 3VB9A 4DGWB 4E7SA 3VEPA 1Y1VS 2Y31A 4I09A 1E3HA 1V54H 1X1BA 3T4NB 2EFQA 1O3TA 2NAPA 4MD7A 2E2II 4BGDA 5IYDJ 4ENJA 4BXXJ 4HLYA 2F6CA 4WXDA 3CCR1 3QP5A 4ESBA 3WU2C 2PG4A 2QLZA 1XMKA 5F64A 3GTJI 3U1DA 1R71A 4NC8A 2ZJRF 4DW6A 1VZ0A 2P0WA 4G6QA 4RGSA 4B43A 3OYJA 1PP7U 1JI8A 4ASNA 1W7PD 4ESJA 1Z21A 1ZR4A 1YUAA 3H9JA 3OY9A 3F72A 2RREA 5D5WB 3J7AY 1D8JA 2QA4Z 5A2Qf 3HOVI 2JWTA 2HKXA 4B09A 2XRNA 4QWQA 3KP5A 5HDNA 1BOAA 3PJRA 2A05A 3BJ6A 2YSRA 2ETHA 3GMEA 4B1RA 3IRRA 1Z1DA 5K5RA 2XC7A 1LUJB 4KFCA 2HOTA 4MEYF 3D6WA 2ECCA 3ZMVA 1TWCJ 3VYUB 1ZB8A 5E79C 4HLXA 2KMUA 4RM2A 4Y13A 1ZELA 1IW7F 2KDOA 5B1BH 4L18B 3J80K 3VPRA 4DQ2A 4XKCA 3G2BA 2M45A 4FETA 3GTMI 3LAPA 2X51A 3BLYA 5JVTA 4Y52J 3ZXSA 2NXNB 1X3ZA 3MD2A 4AWXB 1YW9A 5L3BA 3K70D 3ZR8X 4IRIA 1LKXA 4Z2YA 3JRHA 1D0ZA 3H3VK 4IHWA 3I56Z 4CYDA 3RQ4A 1KONA 3H0GI 1S7MA 2V1DA 2R6MA 3SDGA 3VYRB 2EFPA 2VJJA 1XX5A 2X48A 5BOXA 4O3MA 3QU6A 2F5EA 3I3LA 3H5NA 1HLVA 5DM7F 3WTUC 2BJOA 2DE6A 2TDXA 4ZYAA 5E8IA 1IV8A 5HS8A 2OQGA 2B7EA 3TL4X 1RNLA 3W3CA 4UUSB 2OJED 2HYFA 2BY1A 5BPIA 4JBAA 3RZOJ 3S16I 1Y8RB 3ESWA 3I4PA 2NVQI 1MDMB 1P4XA 1Y39A 2EQRA 2XUBA 3E3VA 4RAGA 1AWCA 5J47A 2ESNA 1XGSA 4M9SA 3BG0B 3C1DA 1Z7LA 3W2WA 4UVAA 2LKSA 3A4CA 3SFIA 4C30A 3CCVI 1V3FA 5L3GA 3BG9A 1ODDA 2L9VA 4Y4RA 2OD5A 1PFTA 4EV0A 4F91B 4ZZDA 3RPUA 4ESFA 4U0YA 1YS7A 2XRLA 3M1EA 1YE9A 4FHTA 2JK3A 4EGYA 1I27A 2A07F 1GVJA 3FBIB 5IP9J 1VQP1 1A6QA 1T56A 3F8FA 4IVNA 1TWAJ 4BQAA 2OTJ1 1Q7Y1 3S8PA 2YADA 1TT0A 4JOMA 5FLXZ 3E5QA 1B72B 1GHCA 4E7ZA 1VLAA 4PJLA 2DDAA 1FMVA 4Y7NI 2KRFA 1APLC 1W2BZ 1I1GA 3HOSA 2LIYA 2NVUB 1OPCA 4YFNF 3FBNB 4MFDA 4BQOA 1VQ5I 4BY1J 2COMA 2BW3A 3D5SC 4IOCF 3OYLA 2ZXJA 1T98A 1G3YA 4II3A 1ONVA 1HQCA 3TO9A 4XRMA 3TO7A 1NHAA 3FKJA 4BNCA 1LEBA 5K7HA 3ZQHA 2J6AA 3BROA 2OU2A 2DA4A 2VBYA 2RNJA 3TQNA 4AVZA 2FU4A 1RC9A 3C18A 3CCEI 1JKPC 3M4OJ 3VMIA 2W4SA 2IGOA 1E17A 2VQHA 3QPSA 2MGQA 1G3WA 4M3GA 3DKXA 1ETYA 5EEAA 2XSDC 1YHQI 1SIWA 4DYCA 2P5LC 2V3VA 3SDBA 3WHCA 2VPYA 4KA4A 1HSTA 1BR1A 4HW0A 2HQRA 4JYKA 2GTIA 3HGGA 4RB1A 1UJ8A 3KYCB 3KP3A 3FZVA 5EJCA 1IN4A 3OV8A 5H20A 4BXFA 5J8CA 2WC2A 3BG5A 2RIQA 1W5CC 1WSUA 2Z1DA 2WY7Q 4L5EA 2D2WA 4M3BA 3WHBA 2QSHX 1FOXA 2JTVA 4OMYA 2G7HA 3H9QA 2LFUA 1G4DA 3CC7I 3HOTA 4NB5A 5FLMI 1H9GA 3LSJA 1A6IA 3HKZN 2LTPA 3I53A 3BPXA 4U88A 2M87A 4JX5A 1LE8B 5EDNA 2VPZA 2ZXIA 3VODA 2XF5A 1VQ6Z 3MFKA 3HOYI 1RUOA 3GTQI 5FLVA 4FX0A 2MH2A 1KC82 2XAFA 2RGVA 2EZIA 3CLOA 1FP2A 1Y1WJ 2R7WA 1WW9A 4ZYHA 3CCLI 1BA5A 2LKPA 1ZR2A 2BGCA 2A69F 2JPCA 4EM1A 4B3AA 4XL9A 3QODA 2OAZA 1S72Z 1TNTA 1VQ4I 1ETQA 5E8GA 4G9YA 3GEZA 4LB6B 3W2VA 5ICEA 1JJ8C 3GTJJ 2Z3YA 1N25A 3H3VJ 1VQOI 3D5RC 3ZN1A 3HUGB 2KZGA 1I5ZA 2YU9I 3SFZA 3CF2A 1RO0A 3OSGA 2ESHA 2XAHA 1YOVB 1DPRA 1QU3A 3MKLA 1F9NA 3GF2A 2IW5A 3UKGA 5A2QK 3CCMZ 3PIOF 1NP6A 1YITI 3ZPLA 3FF5A 1FYLA 2IV2X 3KP6A 3DU5A 3ROUA 1VQ91 2IBDA 3GKQA 4TNUA 5H6QA 2X4HA 5GAGJ 4ZH4F 1FY7A 3HOWJ 5DV5A 4G7HF 4H0EA 2CGPA 3OIOA 4DOZA 1XCBA 2PI0A 1LFPA 4PJ0C 4RDUA 2ADUA 1S7EA 4LG3A 1IV6A 3CJTB 3LSKA 4YELA 3CXCY 3MAJA 5DD4A 1DP7P 3A2KA 1U6GA 4BBRI 4RVGA 1XDSA 3HKZA 1TL8A 2F4MA 2VJ5A 1Y8QB 1YG2A 2L4AA 5HLIA 1ZRFA 1XDUA 4L9VA 2DPDA 2ECBA 2CW7A 4YIIA 1JUPA 1P7IA 4JQFA 1SD6A 4E7IA 1HOMA 4D7NA 2JIPA 2K7LA 5HDKA 1P7JA 2IVMA 2KIUA 3ECHA 4EATA 5D5VB 2ELHA 2ZXWH 4GO1A 3S16J 3K0LA 3LOCA 1P6RA 3RKQA 2P5KA 4YIRX 4FTHA 1R00A 2IZ3A 3OIQA 4BHBA 4FASD 1KQ0A 4M71A 2FBHA 2A6EF 3FK6A 2LF7A 3FHZA 2QEXI 3S1MI 2CH0A 5FKKA 3K2AA 2YX7A 4NB8A 3TW7A 2FEZA 3ERMA 1T38A 2DXIA 2QA41 4IX7A 1JUMA 3K70C 4BE2A 4Q47A 1F5TA 2E2JJ 2LG4A 2HTJA 2YPRA 4NB9A 3ABTA 1X3WB 5KCMA 3IAM2 2ID3A 3EQLF 3H5RA 2K27A 2DT7B 2IGNA 4D1QA 3L2CA 1VQ51 2PN6A 2JMWA 5AIQA 5EYRA 1S8NA 4BL0B 4IHYA 4M3EA 1PUFB 2QKLB 3S1QJ 2PFBA 5LBQA 2ZJQF 3FMSA 1CQTA 3KP2A 1X1PA 1RZ4A 4G7OF 2VPRA 5DM6F 2QBYA 4NBBA 4ON0A 2R7DA 3K4BA 2ICWG 3V7CA 4C2UA 1MZBA 5KAIC 1R6RA 4CCKA 2VKEA 3DPTA 1ZGJA 3DLAA 1N75A 1G3SA 5LGNA 3KP7A 1W1WE 2A68F 2GXAA 5DYMA 4KN4X 1BC8C 1MD0A 3BR2A 4RLQA 2DBBA 5D5XB 1DU6A 4ZDPA 1STZA 4GCVA 3CCU1 4KISA 3CCSI 4NBAA 1U8BA 1AHDP 3AG1H 4PGHA 3CCRZ 4A93I 1OCPA 1QPMA 2E7ZA 2OPTA 3A01B 3ECOA 1KQSY 3CC4I 3LSRA 2CG4A 4KYWA 2D45A 5CKTA 1UHSA 3JRCA 2GIVA 4Q48A 5IY5H 5D1OA 4ZYDA 3H1CA 3CF5F 4RS4A 1HCRA 2DODA 3D2LA 3CC71 3J80b 3WE2A 3OOPA 2V8IA 3EUHA 1XMXA 2BZTA 3F3PC 2FBKA 3UNGC 4AIJA 4EWCA 2JRMA 1M1EB 4FQGA 3RKXA 4BBSI 1MH4A 2K9LA 4KNYA 3G4SI 1YRNA 1XGOA 4S0HB 2VUMI 1YS6A 1TWFI 4ENKA 2VOOA 2EFWA 2FF4A 4A3CJ 4HGYA 1XPXA 3L09A 1LVAA 5FLMJ 1J0RA 3OS2A 1SFUA 3KLOA 3IWFA 1VQ41 1BIBA 2M1BA 4C3IJ 2ZMEA 3JR9A 1J09A 1MNMC 2Z2SB 1KQ8A 4DIQA 3T1BA 3HOYJ 1I1SA 3M07A 4IOAF 1QHGA 1VQ71 3CCJI 3R4KA 1XC5A 2VKHA 1FMWA 4UB6C 1GT0C 2KP6A 4DZJA 1XB4A 4D5FA 1LEAA 2EFOA 4HPQA 1VQ81 2GAUA 4F92B 1TWHI 3DP7A 3KPHA 2XDVA 1KU3A 2XKPA 5EG0A 4M6XA 2CRGA 2QF7A 4MFEA 3WG7H 5J1YA 3EYIA 2KJBA 1D1BA 2M8GX 3I59B 3O8HA 3V8LA 2D1HA 4LG0A 2K3RA 3HOUI 2YU9J 2EV0A 2R7SA 1W4MA 3MKZA 3JRBA 1EV7A 3EUKL 3OL4A 1K6YA 2A5WA 1UG2A 3V7SA 2GZWA 4M74A 2ISYA 3S2DI 5M5YJ 1I6XA 3HOZI 4HSRA 4BKXA 2V9KA 2F4OB 4AVPA 4OMZA 1ZB9A 1WH5A 1I50J 1MJAA 2K5CA 5CQEA 1U2WA 3ZRGA 3DTKA 2V7FA 4F55A 5JLWA 5FKLA 4CCNA 3K2ZA 2RQQA 4A6EA 3GTLI 3OL3A 4TV7A 1Q812 1XTAA 1BI3A 1VQPZ 3G711 2NOGA 4NFRA 2OTJZ 4BEHA 4KITB 2R5YB 5CYVA 1WGXA 3M9AA 3ZQ7A 5LEKA 1ZREA 2ZKZA 3G6EI 5T67A 1IRFA 2P7VB 2XGCA 5DEQA 3HL2A 4XSZF 5DCFA 3VSKA 3BR5A 5J1RA 1D0YA 1ETOA 2Y9ZA 1TNSA 4UVCA 3C2HA 3TGNA 2H94A 1OR7A 4L0YB 1VQ61 3MEXA 1IUFA 2PJRA 2QRCB 1TLHB 1K78A 2E1NA 5CQGA 1QZEA 2MC4A 2DCEA 4S1TA 2BY3A 4BU2A 5EEHA 1R23A 1UMQA 3CESA 3K1PA 2K85A 2A61A 1K4SA 2M4GA 3NDJA 3I4NI 3WU0A 3QPHA 1K6OA 1W5SA 1Z03A 3E7LA 1K732 2VBZA 3ABKH 1ZN2A 2EJRA 1VF9A 3CXCZ 2K02A 4XN0A 3KIOA 3GTGJ 3GTOI 3GZ5A 3IH4A 1YFHA 2UWMA 2IA0A 4FE7A 1PP8F 2M2EA 4A3EI 1Z05A 2JR6A 2VF1A 3D0SA 1G8XA 2V8JA 2J5OA 2KPMA 3HHGA 5J4VA 1XS9A 5K5QA 1XD7A 2Z99A 2RT9A 2LOOA 4EGZA 2TRTA 3IP4B 2XGXA 1RKWA 3GFIA 5F0FA 2HR3A 2AQFA 4MQ9F 5B66C 2M3AA 4B4CA 5FO5A 1AOYA 2QQAA 3RQIA 4P55A 1P9NA 1T33A 1MKMA 2CJJA 2FOKA 4U87A 1R9TJ 2Q51A 1HXDA 1PYVA 2E1MC 4UUTA 3J80Z 2R5ZB 3KETA 2DTZA 2VASA 4OU0A 1BR2A 4NC6A 1K8A1 4LK0F 3I07A 3GYHX 1SVOA 5DUIA 1LDJA 4N9HA 2BBYA 1I3QJ 1VFCA 2MLKA 3P5JA 1M902 2NVTI 3KLNA 1J59A 4RAYA 2PMZN 5T6BA 4UUVA 4AM3A 2B0LA 2L7FP 3WTXC 3QRFF 1MSFC 1WVRA 4NQWB 5L3EA 2IS2A 1YJ9I 3U1KA 1BW6A 2EA2A 1K9M1 2HFHA 4EQQA 2NVXI 1WI3A 4LIVA 2MLGA 1REPC 5A2Qb 1N8R2 3SZPA 2CQKA 5EGOB 4A93J 5HLHA 4HRIA 3KEOA 4R79A 4BHCA 4B44A 1F36A 3FK7A 3SXYA 3W6JB 5LHHA 1SC7A 2X6WA 4BY7I 3F8BA 1FBUA 5LD2C 2NNYA 2DU9A 3H3UA 1BR4A 3CMEI 2CQXA 3L00A 1BJZA 3TO6A 4EJVA 4ZTFA 2EV6A 3ABUA 1ON2A 2GWRA 1W36D 4BUPA 3AFHA 1J2XA 3HSFA 2BYVE 3CQZI 2DK5A 4LOCA 1VQN1 1TWGI 2M30A 1XGMA 3PSFA 2LBFB 2IA1A 1B9MA 4EEFG 3IH3A 1VQ9Z 4BDZA 5DD8A 2ELJA 1RRJA 2E2HJ 2VUMJ 4WWCA 3S2HJ 4OOIA 2ZSIB 3GTKJ 1IN6A 2A6HF 2V4JC 1GXQA 3KZIC 4RBOA 3I4MI 2RPRA 4X0GA 1OYWA 1D1AA 3HRMA 1RNIA 3EUHC 3IRQA 1FWZA 1QXFA 3CP2A 4A3JJ 4ETSA 4IHTA 1YI21 1SFEA 1OCTC 1Q821 3VDXA 1OYYA 3I9V2 2RVCA 5AIPA 1NH3A 2RDPA 2FRHA 3M8EA 2PMZA 1P4AA 4HH4A 4HX7A 3QYFA 1BI1A 1T39A 1X19A 3BG7A 4KN7X 1FYMA 3DQVC 1ML8A 3VYSB 4DZPA 1BM9A 3LWFA 5GAHJ 4HNVA 4HNTA 3RYPA 2IT0A 4A3FI 2HVRA 1FSEA 4XM3A 3GZ6A 2DE5A 1V4RA 3PNTA 2QWWA 2ZMEC 1A04A 5F0HA 3MKYB 1RKTA 3JRFA 1R22A 3ELKA 4ZYGA 3HOUJ 3PO2I 3HJEA 5L3CA 4QIWN 1UZCA 3WTTC 3QP6A 1P2FA 2KL4A 5T64A 1VQM1 2DA5A 1FT9A 1OISA 3Q5FA 3EUAA 1IJWC 2GXGA 3DFGA 4ZZLA 4CICA 3S2DJ 2X0LA 2E5NA 3HOZJ 3BQYA 5GTIC 4BACA 5C44I 2HZTA 3AG4H 1MBFA 3D5LA 2JA6J 5FRNA 1WCMI 2R7ZI 3I71A 1KD12 2CYYA 5GP9A 2V6EA 1D3YA 2LLKA 2QM3A 2V6CA 3OOUA 3GTLJ 1B59A 2RQPA 5F0CA 2E1OA 2X85A 3O6BB 2V1UA 2BY2A 1VQ5Z 5FKMA 4HF1A 1H89C 3S1RJ 3DBRB 4ZC3A 4A3KI 2HDWA 3AL0B 1YIJ1 1W7PA 3CD61 5J8FA 2GLOA 2LF8A 3MZ8A 2IAIA 3LSPA 1OMIA 2DO7A 3GLLA 1WIIA 4C2TA 3R6SA 2X6XA 1LB2A 4GYIA 5EZHA 3TW6A 2MD0A 4NDLA 4AD9A 5C4JI 2VQCA 3I551 2HNHA 2M0MA 4RB0A 2JIRA 1USTA 1YJW1 2JRTA 3DEUA 2QZ8A 3W6VA 5LGTA 1X2NA 1RPWA 1J9IA 1HW5A 1WJ5A 5FGMA 4E7KA 1S9HA 3PO3I 2F5FA 3I64A 3LFUA 4KIGA 1VQLI 3I4NJ 3E6DA 4MTEA 3CCUZ 2M7AA 1K83J 3RYRA 1OR7C 1USSA 1T0FC 1TQMA 4HX8A 3WTVC 4OIOF 1MBJA 2STTA 1Z01A 3JTHA 4HEA2 3BDDA 1BIAA 5HDGA 1FP1D 1E0EA 1W0TA 2QLVB 2HZDA 4BE1A 2PM9A 3GTOJ 1FOKA 2JN6A 2B63J 3V7RA 5LHGA 1I6HJ 1T95A 4HG2A 2DFFA 2VQLA 3PNYA 5FFXA 3SJMA 1YJNI 1IN7A 3ESWB 2DA2A 1MH3A 1RR8C 2EZHA 4ANJA 5A2QZ 3CC7Z 4PSWA 3CMMA 3TP3A 1R4MB 2DOAA 1K7AA 2FE3A 3A02A 4A3MI 2AXTC 2L4MA 4N9IA 3L9FA 3H92A 2OC6A 1WJ2A 1V5EA 5HVQC 1AKHA 2E35A 1KYZA 2E9HA 1BL0A 2CUFA 1IG7A 1V55H 1EH7A 1E3OC 4PSXA 3HDDA 2EINH 4IRHA 1QVFZ 1LQ1A 4DJAA 5FJ8J 2KISA 4D5CA 3BR0A 2V45A 5E1ZB 2NS7A 1WZNA 4PJNA 1Y1VI 2EK5A 1VQ4Z 4L0ZB 2PLYA 1SVMA 4BJTA 4OIQF 2NVTJ 2M48A 1IAWA 3HC7A 2ME0A 2KJCA 4OINF 2KDZA 2E7XA 3EYYA 5KNLA 1EH6A 3HSEA 1XSXA 2IS4A 1VQ7Z 4BQNA 3FKII 3IUOA 3CC21 1B9NA 2IGMA 3TOBA 1W5TA 1Z02A 4RVFA 2L9RA 4D0PA 1JTXA 1HF0A 3AG2H 1ZTRA 1B72A 2KI7B 2VXZA 2EV5A 3IKVA 3OS0A 4LMYA 1VQ8Z 2RAEA 4XLEA 3QAHA 2OOYB 1ON1A 4RLFA 2XHKA 4KMFA 2BW3B 3E5XA 5GPAA 3ZMTA 3ERED 2OTL1 3HYIA 2EIMH 4JX4A 4NHJA 2L9NA 2EIJH 1BN5A 3LQRA 1SFOJ 3CLQA 3QOEA 2XB0X 2IS6A 3KCCA 4QTUA 4XKWA 4XKBA 1JT6A 4IQ4A 4B8XA 3CCQ1 2GU2A 4UV8A 3CTAA 2R7FA 2NOJB 4I2OA 4Y33A 2KT0A 1QQIA 3PUFA 2ID6A 3GCMA 4HSTA 3CPWZ 4V19K 1AU7A 5EF6A 3KYDB 4NC7A 4YEJA 4A3IJ 3G71Z 3KEQA 3JREA 3BWGA 3E0JB 1GXPA 1NK3P 3K4MA 4DNCA 2L9SA 3I56I 3F8NA 2W84A 5M5WJ 3DF8A 3ZMUA 4KICA 4A6DA 2AO9A 3TMOA 1OJLA 1KU7A 3G1OA 2CQ7A 2JUCA 4HZFA 1EA3A 4XRSA 3OS1A 3BC8A 5DCMA 1LQLA 3QPTA 2PX9A 2ZFUA 1U5TC 2M8EA 2FQ4A 2NVYJ 3G73A 2O9LA 3CUQA 1QGPA 4LFUA 3F21A 1R5ID 4A0XA 3K4JA 3OWTA 3ZCOA 3OIPA 4NBQA 2DQLA 1O3QA 3OW2Y 3FXUA 1AA7A 2K9SA 5TISC 1JJ2Y 2E2IJ 3ZGKA 3PO2J 2WAFA 2QUFA 3ZN0A 3E5UA 3CJNA 1ZQ3P 2FBIA 3ZQGA 5E3NA 1P92A 2VBXA 4RV9A 3FXQA 5GAEJ 4BJ5C 4CXFA 2JA8I 4EM0B 2EWNA 1DGRM 3P9CA 5C44J 2BVMA 2DQRA 2NNNA 3JSOA 2CUZA 1NK2P 2HEOA 1ETWA 3DPLC 3QPLA 1HW1A 3HOVJ 1HDPA 2LY2A 3HGYA 3K4KA 1WWXA 2HXIA 4E2YA 4KIFA 5IP7I 2P28A 2YU3A 2VL8A 2A6TA 3REOA 4V2GA 4ABZA 1O7LA 3PM1A 1JXSA 3M3YI 4ENMA 2DOEA 3WG9A 1ZG1A 4B3XA 1VNDA 2W04A 3VSLA 3UR3C 5D8KB 3L2UA 2Y30A 1VQL1 3PQJA 1R7JA 3F22A 4AC0A 4IL6C 5KVRA 3F3FC 3FWEA 3CCSZ 3GTMJ 2P7CB 3S14I 1H9TA 2BXYA 3V8JA 1KC81 3BZ6A 1MBEA 3GTPI 4E33A 4CH7A 4N4NB 4AIHA 1YQAA 5K7ZA 2VC1A 1MMDA 1SD5A 2AHQA 3H0GJ 5CPRB 4J00A 5J6XA 3ASOH 4RAFA 1B4AA 2F4MB 4PCQA 3SZGA 3CZ6A 2VIXA 2P5VA 4Y3OA 5IT9b 1F4KA 3PO3J 5C4XI 2MC3A 1G59A 3OYKA 2WTEA 2HOAA 2ZNZA 3CCV1 3CJRB 1KA8A 3O2PE 2M34A 4O5VA 2MW8A 2MFZA 4L9TA 1G6NA 2JIQA 2CS3A 2HQAA 3AG3H 1IN8A 3JAMb 2G0EA 2K40A 2KRHA 4YFXF 3GVAA 4LLNA 2DMTA 1ZRDA 2NVQJ 1Q1HA 3FXOA 1JT0A 2V9VA 4LIUA 4M6VA 2W25A
chains in the Genus database with same CATH topology
1RLYA 4A3II 2VKDA 3ZRGA 2X1EA 3DTKA 2M4KA 2V7FA 4CCJA 4F55A 2JA7I 4P1WA 4E2ZA 3HPGA 1X4OA 4CCNA 4NBEA 3RZDI 1VQNZ 2RQQA 3GTLI 3OL3A 1WJEA 3E1SA 1Q812 1VQPZ 3RTRA 3G711 2LREA 4NFRA 2OTJZ 3IF8A 4BEHA 4KITB 3NH5A 4RM3A 4RVHA 4E30A 1DQUA 2NVYI 2W03A 3TBIA 5T67A 3S17I 2JNYA 4HNUA 2CW8A 4A3LI 1QYPA 2QKMB 3IX0A 4E2XA 3HL2A 3VB9A 3VSKA 4DGWB 3BCAA 1D0YA 4E7SA 1Y1VS 2H85A 4ZDLA 3C2HA 4BQQA 2DT6A 4XLFA 1X1BA 3L2VA 4NBGA 3T4NB 1VQ61 1QHHD 1DL6A 2PJRA 1UELB 2QRCB 4MD7A 1YI2Z 2E2II 4BGDA 5CQGA 1ZH1A 2F6CA 2MC4A 4AU7A 4NUBA 2DCEA 3CCR1 4S1TA 4E7JA 4BU2A 4PJMA 3CESA 3GTJI 2VXDA 3CCE1 1QVGZ 2M4GA 4NC8A 2QKDA 3NDJA 3I4NI 2L7KA 1VZ0A 2P0WA 3LSIA 3NFZA 4B43A 3OYJA 2HVQA 1JI8A 2VB6A 1Z03A 1K732 4OWRB 1Z21A 1YHQ1 4RVDA 1YUAA 2IXSA 3H9JA 4A3DI 3D9XA 3OY9A 2RREA 4MLOA 3J7AY 2QA4Z 5A2Qf 3CXCZ 2QEXZ 3HOVI 2V8KA 4XN0A 2EGTA 3GTOI 1YUKA 4F3QA 1W36C 3PJRA 3FDYA 2OV7A 4XKVA 2UWMA 4X6AI 3HOUI 1VQMZ 4A3EI 2BOLA 2LC2A 2JR6A 2VF1A 3VYTB 1G8XA 2V8JA 4A3CI 2KPMA 2XC7A 3SYTA 3D6WA 3OYAA 1RO4A 5IT9f 3SEZA 2LOOA 3VYUB 3S3NA 1ZB8A 3IP4B 2RT9A 5C4XI 3L2QA 2KMUA 2AQFA 4RM2A 1ZELA 2KDOA 2HF1A 2M3AA 4CA0A 4QTTA 3VMHA 4XKCA 3G2BA 5D1OB 4FETA 1P9NA 3GTMI 2X51A 3BLYA 2QREB 4U87A 3ZXSA 1X3ZA 2Q51A 3MD2A 4E7LA 3TDHB 2CV1A 3K70D 4MXUA 3JAMf 3ZR8X 1PYVA 2E1MC 4ITVA 2HU9A 1LKXA 1D0ZA 4NH1C 3I56Z 2VPLA 3RQ4A 1KONA 2VASA 3H0GI 1S7MA 1BR2A 1K8A1 1NG7A 3I07A 2JVGA 2R6MA 3VYRB 2JVHA 2VJJA 3CCL1 1YIJZ 1NUIA 4MH4A 4QPOA 3CD6Z 1KRLA 1M902 2NVTI 3I3LA 3EPZA 3H5NA 2BJOA 2DE6A 3NWSA 5T6BA 4A3GI 4C9YA 4ZYAA 4NQWB 4II2A 2JA5I 2CMPA 3TL4X 3CP8A 3W3CA 3OYIA 2IS2A 1VQO1 3TE5B 3I55Z 2VLAA 2V1NA 1K9M1 2NVXI 3S16I 3U21A 2R7XA 3ESWA 4LIVA 1YJWZ 2NVQI 5A2Qb 1N8R2 4F93B 2V26A 1M1K2 4HRIA 2OUMA 2I3CA 4CZCA 4R79A 2WY8Q 4B44A 1I50I 2O4HA 3BG0B 3QYEA 3CC4Z 3NWTA 1MNEA 1Z7LA 2X6WA 3W2WA 4BY7I 3A4CA 2WAEA 3OYCA 4C30A 4BDYA 3KIHA 1YIT1 5LD2C 1YJN1 1BR4A 5C3EI 4XLAA 4ZTFA 4Y4RA 4B47A 1N77A 4N4OB 3LSHA 4F91B 1PFTA 1YE9A 1W36D 3OMYA 3AFHA 1IRXA 4BUPA 1VQN1 3CQZI 3FBIB 1TWGI 1VQP1 5HNFA 3DTIA 4XORA 2F4IA 2R7TA 3AL0C 3PSFA 2LBFB 2OTJ1 5JHFA 1Q7Y1 2F5VA 2X1CA 3G4SZ 3S8PA 4BDZA 2CV0A 1VQ9Z 2YADA 2ELJA 1TT0A 4HGZA 4JOMA 1L1OC 2W7NA 2ZSIB 2V4JC 3OW2Z 1NG6A 4E7ZA 1VLAA 3I4MI 2RPRA 4PJLA 4X0GA 1VQKZ 4BXXI 1FMVA 1D1AA 2WADA 1RNIA 4Y7NI 2KQRA 3EUHC 2MYSA 3DKYA 2KZVA 4OAZA 1W2BZ 1X1DA 3CP2A 3FHNA 4NNJA 3KX2A 2L5QA 3HOSA 2LIYA 1LVKA 1YI21 4PFPA 3HG9A 3FBNB 1Q821 3DTEA 3VDXA 5FROA 4BQOA 4NBFA 3D5SC 2BW3A 3I9V2 2PK7A 3PL8A 2LH9A 2IS1A 3OYLA 2PMZA 2CFOA 4E6KG 4HH4A 2E1MB 4II3A 2RNGA 3CCJZ 3QYFA 1X19A 3BG7A 4BEHB 3DQVC 3FKJA 2GTHA 1ML8A 3VYSB 3QWUA 1NJI2 1RQFA 2J6AA 1WJAA 4HNTA 3L2WA 4A3FI 2HVRA 4XM3A 3GTGI 2DE5A 2LRDA 3PNTA 2R7UA 4ZJZA 4AVZA 2CV2A 3MKYB 2Q2EB 3QYBA 4PK4A 1MMNA 1X3WA 2QRDB 2QEX1 3CC2Z 4E31A 3VMIA 3PO2I 1V5GA 2W4SA 3NDIA 2IGOA 5T64A 2KL4A 2VQHA 4ZTJA 1TWCI 1MMAA 1VQM1 2R92I 3DKXA 3EUAA 3DWLE 3S1NI 2UUZA 3LMMA 1SAUA 3VMGA 1D1CA 3SDBA 2E5NA 2M6NA 4E4HA 3V42A 4BACA 5C44I 1BR1A 2K5RA 2W00A 4KT6A 2GTIA 1R9TI 2OTLZ 4Y52I 2Q1ZB 4XOPA 3D5LA 3M1CA 5FRNA 1WCMI 4BXFA 2R7ZI 2VUGA 4PUSA 1KD12 4MD9A 1K8A2 3S3MA 2RIQA 2V6EA 1WJCA 3RSNA 2FUG2 2Z1DA 2WY7Q 3OOUA 3KIFA 2R7OA 3ZQQA 4DBRA 1I3QI 4D9JA 2LFUA 2X85A 3H9QA 1LDKB 3CCQZ 3I561 1VQ5Z 4XR6A 3S93A 3PSIA 1N78A 3HOTA 3MZLB 5FLMI 2JA2A 4ZC3A 4A3KI 1YX5A 2HDWA 3HXLA 3AL0B 1YIJ1 3DPUA 3G6EZ 2KLOA 2DJIA 3CD61 4DBQA 2K3PA 2ZXIA 4ZDOA 2XF5A 1VQ6Z 1WJFA 2R93I 2GOXB 3NH8A 3HOYI 3RZOI 4NOZA 1WIIA 3GTQI 4C2TA 2X6XA 3EEDA 1KC82 3OYFA 2MD0A 1WW9A 2R7WA 5C4JI 2VQCA 4CCOA 3I551 2HNHA 4XONA 2G2KA 2M0MA 4PFOA 3K6GA 2O53A 3CCS1 4XL9A 3QODA 1YJW1 1W2BY 2W1OA 1S72Z 3PFYA 2UV1A 1N2FA 1USPA 3M8JA 4U7BA 1WJ5A 3W2VA 4E7KA 1S9HA 3PO3I 3CJQB 1MNDA 3LFUA 4XLHA 3K7AI 3H3VJ 3H0DA 3C2GA 2JS4A 3J81f 3CC21 3D5RC 3CC41 3N05A 3HUGB 1WJBA 2YU9I 4XMYA 3CF2A 1RO0A 4NBDA 4RMNA 2M7AA 3CCUZ 1WFXA 3P5JB 5IP9I 1OR7C 1T0FC 4OAYA 1QU3A 1Z01A 4HEA2 3H35A 3FQQA 3LUSA 1TWAI 1E0EA 2QLVB 2HZDA 4LITA 4BE1A 2PM9A 5LL6f 3CCMZ 2E2HI 3PNVA 1NP6A 3S2HI 3MMYB 1T95A 1TZLA 2R4GA 4HG2A 5TGTA 1UAAA 2VQLA 3K4NA 3K4CA 3PNYA 4DGLA 3Q87A 3GTKI 1X4PA 3DU5A 4ANJA 3GKQA 2E60A 2KRCA 4TNUA 3G4S1 4PSWA 3CC7Z 2AQEA 3CMMA 2XF7A 1QVGY 2DOAA 4MD8A 4A3MI 4E2WA 5LFAA 4A3JI 3SEQA 4DK1A 2K9MA 5CM2M 1Q822 4YRVA 3PUBA 2OC6A 4BY1I 3GTMS 1V5EA 5HVQC 4DOZA 1LFPA 2KPIA 1DGWY 2E9HA 4LG3A 3EERA 3LSKA 4YELA 3S32A 3CXCY 3A2KA 4BBRI 4PSXA 2I8DA 2O5RA 1PJRA 3HKZA 2F4MA 4DJAA 4RVGA 3HPHA 1QVFZ 2VJ5A 4NBCA 4PJNA 3CCJ1 1Y1VI 4MRIA 1VQ4Z 3PO3S 2X1DA 4XN3A 5AN9F 2CW7A 3IAS2 4BJTA 1M901 3BG1B 3NH4A 1VQLZ 1MW7A 4JQFA 2M48A 3HC7A 2ZAEB 4E7IA 3M4OI 3OYMA 2XAUA 1JJ2Z 3J81b 3AKZA 5KNLA 1KQSZ 2VJIA 2IS4A 1VQ7Z 4EATA 1BOBA 1TFIA 2F4OA 3F9KA 4BQNA 2ZXHA 3IUOA 5KHDA 3FKII 3KEYA 2JUBA 2IGMA 2WA0A 1Z02A 4RVFA 4CUGA 5FLXb 2KI7B 2VXZA 2OOXB 4DQYB 3OS0A 4PJJA 1X1CA 4H4KC 4XLEA 2OOYB 1VQ8Z 2IZ3A 1Y6IA 3S3OA 1M1K1 4RLFA 2BW3B 4XQFA 1YJNZ 3OIQA 4FASD 4E7HA 2Y0SA 2JMOA 2JA6I 2Z16A 3GCFA 2Q4ZA 3LL7A 3LSGA 3J7A4 3S1MI 4KJZA 2CH0A 3CCVZ 4NB8A 4IZZA 2OTL1 3MKWB 2DXIA 2R7QA 2MABA 3RCOA 1ERDA 3CMEZ 2L9NA 3FQMA 5HNHA 2QA41 4IX7A 2ZSHB 3K70C 2XSJC 4XOTA 4BE2A 5HOOA 2LG4A 3U50C 3S1RI 3QOEA 1JWHC 2CUJA 2WB1A 2IS6A 2AKLA 2VJ4A 2PJRB 5KCMA 4NB9A 4QTUA 3IAM2 4XKWA 3H5RA 4XKBA 4B48A 4IQ4A 2DT7B 2IGNA 4D1QA 2GU2A 4CL1A 3J80f 3CCQ1 2JSPA 4BL0B 1VQ51 2NOJB 2QKLB 4Y33A 3DEEA 4HSTA 3G6E1 3CPWZ 1Y1WI 1Q861 3OYGA 4NBBA 4F52A 2VQGA 4NC7A 4YEJA 3G71Z 3K4BA 3E0JB 2HVSA 4E32A 3K4MA 4C2UA 4CCKA 1R6RA 2L9SA 3W2AA 3DPTA 1DP3A 3DLAA 3TMOA 1N75A 1Q811 3A1YA 3OR1C 4CSWA 3OS1A 1EA3A 3BC8A 1LQLA 1X1AA 4P5OA 2ZFUA 1S721 4CCMA 1QVFY 1K83I 4RLQA 3H5AA 1Y56A 1P9QC 2L2OA 1NJI1 4ZDPA 3K10A 3K4JA 3OWTA 3ZCOA 1K9M2 3OIPA 2R7VA 2QR1B 4KISA 4XX2A 3CCU1 4NBAA 3IFUA 3CCRZ 3OW2Y 2HPIA 2B63I 1GLNA 4A93I 1AA7A 1MMGA 1I6HI 3L2RA 3CCEZ 1JJ2Y 1KQSY 4AYBA 3VWBA 3ZGKA 2E5ZA 2WAFA 3OYEA 1VQ91 3CCM1 1Z3YA 1V5FA 3BG6A 5CKTA 4RV9A 1YHQZ 3CMA1 5D1OA 3KYLA 1YJ9Z 3HOWI 4BJ5C 4NBHA 3LSMA 4RS4A 2W82A 3CC71 2JA8I 3DU6A 3K4LA 1USPB 3J80b 1DGRM 2KHMA 2V8IA 2BVMA 1K731 2CUZA 3H9GA 2OZKA 3F3PC 5D1PA 4EWCA 3UNGC 2IZ4A 5FLXf 3DPLC 3ONQA 3MONA 4BE0A 4A3BI 3VTNA 1Q7Y2 4BBSI 2K9LA 2LY2A 3K4KA 3CMAZ 1KD11 4E2YA 4IKFA 4GRIA 5IP7I 2P28A 2WAQA 2VUMI 1YX3A 2A6TA 2VL8A 1TWFI 4XNFA 4CCLA 3M3YI 4HGYA 1OLTA 3HOXI 4B3XA 4BS9A 4XLCA 3OS2A 1VQ41 2W04A 3VSLA 2JUGA 3UR3C 4QPQA 3L2UA 2DE7A 3OYNA 1J09A 2Z2SB 1VQL1 4DIQA 3RPUD 2WBMA 1QF8A 1VQK1 3F3FC 3CPWY 3CCSZ 2M7BA 3S14I 1QHGA 1VQ71 4G6TB 4MONA 1KC81 2VKHA 1YJ91 3CCLZ 3GTPI 1FMWA 4CH7A 4N4NB 4E33A 2KP6A 1MMDA 4BJ6C 4J00A 5CPRB 3MZKB 3OYHA 2P3YA 3OYBA 4HPQA 4IQJA 1VQ81 2GOMA 2IGKA 1UG0A 3OR2C 4F92B 1TWHI 2XDVA 3SZGA 3CZ6A 2VIXA 4Y3OA 5IT9b 1D0XA 1Z3XA 1VQOZ 5HLTA 2R7RA 2HPMA 1D1BA 1RO2A 1G59A 2XF6A 3GBGA 3OYKA 2LYCA 1X0TA 1SFKA 2K3RA 1SFOI 2E2JI 2R7SA 3S15I 1WJDA 2LBFA 3CCV1 3CJRB 3MKZA 2LY1A 2MFZA 2CS3A 3CME1 2HQAA 2RBLA 3EUKL 3OL4A 1K6YA 2A5WA 1U0JA 3S2DI 2X6YA 2BVLA 2RHBA 3HOZI 1HA8A 3JAMb 3S1QI 2KRHA 4HSRA 1N8R1 2V9KA 5FRMA 3OYDA 3BCBA 4J01A 1YITZ 4LIUA 1ZB9A 1Q862 5CQEA 2K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y56 A;  4E6K G;  2HU9 A; 
#chains in the Genus database with same CATH topology
 3FXR A;  1RLY A;  3LA3 A;  1S3J A;  4MIM A;  2JA7 I;  4UB8 C;  4CCJ A;  2UXN A;  4P1W A;  3HPG A;  4GGG A;  2PQ8 A;  2ZJP F;  2DW4 A;  1PUE E;  2FJ1 A;  3RZD I;  5D4S A;  1VQN Z;  3L1P A;  2XAG A;  1WJE A;  3C7J A;  2QCO A;  4M3D A;  2N8G A;  2E34 A;  3IF8 A;  2IP2 A;  4AIK A;  9ANT A;  1XSV A;  5TRD A;  4E30 A;  4X1E A;  2Q0O A;  2W03 A;  2CQN A;  4HNU A;  2CW0 F;  2K9N A;  4IXA A;  2I5U A;  4Y15 A;  1QYP A;  3N97 A;  4E2X A;  4BHP A;  1R58 A;  2GA2 A;  3WGI A;  2H85 A;  4ZDL A;  2H1L A;  2DT6 A;  4XLF A;  1QHH D;  3WTS C;  1UEL B;  3ZQF A;  1YI2 Z;  1GUU A;  1FNN A;  2NAZ A;  1ZH1 A;  2L54 A;  5HS7 A;  1FC3 A;  5LRR A;  4AU7 A;  4Y7N J;  2QBY B;  1S72 I;  1DUX C;  4HDU A;  5BMZ A;  2DFI A;  3MCZ A;  3CCE 1;  3FKI J;  2QKD A;  1JGG A;  4A69 C;  3I0T A;  2L7K A;  2XGE A;  3LST A;  3BT9 A;  2F48 A;  3NFZ A;  2RC4 A;  3FXM A;  2XVC A;  1YHQ 1;  4RVD A;  5HS9 A;  5IYB J;  2IXS A;  1Z67 A;  4A3D I;  4XID A;  1S5L C;  2L02 A;  4MLO A;  3WGG A;  1BC7 C;  3FMR A;  2KIF A;  4CHU A;  2EGT A;  1JGS A;  3CCM I;  3FDY A;  2HKO A;  4X6A I;  1VQM Z;  1O57 A;  2LC2 A;  1A5J A;  4J19 A;  4HA8 A;  5E18 F;  4WX9 A;  3CDI A;  3SYT A;  3OYA A;  3DCF A;  5IT9 f;  4FX4 A;  1O7F A;  4G8X A;  3S3N A;  1DU0 A;  1IRG A;  2DMP A;  2VKV A;  1ZLJ A;  3GFJ A;  1H8A C;  1ULY A;  2KIQ A;  3L2Q A;  2OBP A;  3H3Z A;  2DOF A;  5E20 A;  1FTT A;  5BNG A;  2HF1 A;  1BI2 A;  4CA0 A;  3VMH A;  4IEJ A;  5D1O B;  4P9F A;  5DUK A;  1LPQ A;  3TDH B;  4E7L A;  2CV1 A;  3FXK A;  3JAM f;  4FT8 A;  5E3O A;  2HU9 A;  1FDO A;  3GW2 A;  4I98 B;  2VPL A;  1QBJ A;  1Y0U A;  4EJT A;  5D6F A;  1NG7 A;  5LEJ A;  2IPQ X;  2JVH A;  5E17 F;  5H2F C;  3CCL 1;  1YIJ Z;  2ZCW A;  1NUI A;  3CD6 Z;  5DS9 A;  5IYC J;  4A3G I;  4C9Y A;  1MGT A;  2K9Q A;  3PIP F;  4UXN A;  1VQK I;  2HYG D;  4II2 A;  2JA5 I;  3CP8 A;  1Z0X A;  2Y0S N;  5CVJ A;  1VQO 1;  3I55 Z;  2VLA A;  2V1N A;  5GAD J;  3GTQ J;  2M0C A;  4EJO A;  2R7X A;  1YJW Z;  3B6C A;  2ZME B;  4F93 B;  1M1K 2;  1SMT A;  2JZY A;  1FOW A;  4CZC A;  5J4Y A;  5ICC A;  4OIP F;  3LAJ A;  2O4H A;  1MNE A;  2XGD A;  1P4W A;  3VB2 A;  3DEW A;  4L9N A;  2E36 A;  1YIT 1;  3CUQ C;  4U0W A;  2FD5 A;  4MO7 A;  2YR2 A;  5BS6 A;  2DI3 A;  1FX7 A;  4B47 A;  1N77 A;  4N4O B;  2FA5 A;  4BXU A;  3A0H C;  2CWE A;  3OMY A;  1IRX A;  5EG0 B;  3BPV A;  3MQ0 A;  5HNF A;  4XOR A;  2R7T A;  4IHX A;  2F5V A;  2X1C A;  3P9K A;  5CVR A;  5EZG A;  2EPF A;  4JX6 A;  4GYG A;  4HGZ A;  5IP7 J;  1O4X A;  5FKO A;  4WXC A;  1TQP A;  1OQY A;  3LA7 A;  3OW2 Z;  3JAM Z;  1NG6 A;  4LB5 A;  2GQQ A;  4MEX F;  4HF2 A;  4BXX I;  2WAD A;  2KQR A;  3E6C C;  2MYS A;  2Y69 H;  3DKY A;  3BJA A;  4OAZ A;  1X1D A;  4XBF A;  4NNJ A;  4XK4 A;  2L5Q A;  2LSO A;  2GBY A;  3FXJ A;  3DTE A;  3I5U A;  1XN7 A;  2LEX A;  4NBF A;  4EVI A;  2PK7 A;  1JTY A;  3PL8 A;  1H88 C;  1QRY A;  4IF4 A;  2CFO A;  4E6K G;  5F6F A;  3K1N A;  2RNG A;  2Y48 A;  3QWL A;  4M9Z A;  3CO6 C;  4BBR J;  4YFK F;  4BEH B;  3QWU A;  2LFB A;  1NJI 2;  2DMQ A;  4HOB A;  5EEG A;  2DLL A;  1WJA A;  3L2W A;  2H27 A;  1FJL A;  3IR7 A;  2RN7 A;  3CCR I;  1ZRC A;  4BAY A;  1T0F A;  2R7U A;  1ETV A;  2Q2E B;  3QYB A;  4PK4 A;  1MMN A;  3CC2 Z;  5C4X J;  2QEX 1;  1XCV A;  4FCY A;  1TC3 C;  1QO0 D;  2PMH A;  4ZTJ A;  1TWC I;  2VC0 A;  1K78 B;  4Y17 A;  3DWL E;  3T8T A;  2UUZ A;  3LMM A;  4RGU A;  1G2H A;  1D1C A;  1LJ9 A;  1E3P A;  1ZYR F;  4E4H A;  2EZK A;  4CYC B;  4WCG A;  2W00 A;  3BTJ A;  4BYY A;  3NAU A;  2OTL Z;  4Y52 I;  4I7H A;  4HQM A;  2Q1Z B;  4XOP A;  4HV5 A;  1CF7 A;  2HQ5 A;  2VUG A;  4PUS A;  3M7G A;  3S1M J;  2HWV A;  1K8A 2;  2NYX A;  1SAN A;  3RZD J;  3BQZ A;  4YG2 F;  3KIF A;  4QSH A;  3CMA I;  4RGX A;  3OSF A;  4D9J A;  2Q8K A;  2PMU A;  3HTU A;  2DA7 A;  2H6C A;  3CCQ Z;  3PSI A;  6PAX A;  1K61 A;  1BW5 A;  2JA2 A;  1SD7 A;  4S05 A;  4PZJ A;  3HXL A;  2ZNY A;  3JTG A;  2F5D A;  3DPU A;  5CJ9 A;  2ACJ A;  2KLO A;  4DBQ A;  2VBW A;  4ZDO A;  3FIW A;  1BI0 A;  1U78 A;  1ACI A;  2MD5 A;  3COA C;  1YW8 A;  3NH8 A;  3RZO I;  4MQV A;  1YTY A;  5JI6 A;  3EED A;  2K4J A;  1EJ9 A;  4CCO A;  1GV5 A;  3WTW C;  1RR7 A;  3K6G A;  1WH7 A;  4P9U A;  3HBL A;  1HBX G;  3CCS 1;  1W2B Y;  2QQ8 A;  2W1O A;  3CO7 C;  3PFY A;  2BY0 A;  2UV1 A;  1N2F A;  1USP A;  3CJQ B;  3H0D A;  3C2G A;  1S6L A;  2CO5 A;  1B8I B;  5IOZ A;  2JS4 A;  3J81 f;  5IT3 A;  3CC4 1;  2EB7 A;  4RMN A;  1FZP B;  5B5E C;  2LP0 A;  1WFX A;  2R5Z A;  4CGZ A;  3W6K B;  3P5J B;  4FIS A;  4JP0 A;  3BY6 A;  5E1W A;  5IP9 I;  3DKW A;  5DDG A;  3FQQ A;  3LUS A;  2STW A;  1TWA I;  1OCZ H;  5J1U A;  3WGH A;  1I39 A;  3RPQ A;  1UHM A;  3MMY B;  2R4G A;  4A0Y A;  5TGT A;  1UAA A;  4DGL A;  3K4N A;  4UV9 A;  1Y0N A;  3G4S 1;  3HM5 A;  2E60 A;  3SQN A;  2AQE A;  1ETX A;  1QVG Y;  4ENN A;  2DT5 A;  3R61 A;  5IT9 K;  2XV4 S;  5ED4 A;  1SD4 A;  1VQP I;  5CM2 M;  1TT5 B;  1Q82 2;  4YRV A;  3PUB A;  3G1L A;  2OTJ I;  4BY1 I;  4W1U A;  3IHU A;  3TDU C;  3GTM S;  2JIO A;  2P6T A;  1QNT A;  1ZG3 A;  3EER A;  2CSO A;  3S32 A;  1Z6R A;  2I8D A;  4QLC U;  4L9J A;  3HPH A;  4BBS J;  1B1B A;  3JAM K;  1U5T A;  4P96 A;  3Q9V A;  3CCJ 1;  3GX4 X;  1HKT A;  4MRI A;  5ERI A;  4A0Z A;  1TWF J;  3ISP A;  4N0B A;  1L0O C;  1RET A;  1YW7 A;  1A36 A;  3PO3 S;  2X1D A;  4XN3 A;  3IAS 2;  1M90 1;  3BG1 B;  3NH4 A;  1VQL Z;  1MW7 A;  4HF0 A;  3M4O I;  1SVL A;  1ZGA A;  1OCR H;  3OYM A;  2XAU A;  2R3S A;  3JRD A;  1SMY F;  3AKZ A;  1KQS Z;  5CVV A;  4HBL A;  3F9K A;  3JRG A;  5KHD A;  1AA6 A;  2Y0M A;  3H36 A;  1Q1V A;  3KEY A;  5JFR A;  2D5V A;  4A5M A;  4CUG A;  1WRJ A;  5FLX b;  2DPU A;  2JQ7 A;  3BR3 A;  1IXS B;  5H6R A;  1FDI A;  4DQY B;  3T0Y A;  4XLP F;  1X1C A;  2O7O A;  1IUY A;  4V2F A;  4XQF A;  1YJN Z;  4E7H A;  1G3T A;  3F0C A;  3KP4 A;  2Z16 A;  3GCF A;  1HC8 A;  4IHV A;  2TCT A;  2FQ3 A;  3LL7 A;  3LSG A;  3J7A 4;  4KJZ A;  5J40 A;  2Y9Y A;  3CCV Z;  1TWH J;  4IZZ A;  5KK1 A;  2MAB A;  3FQM A;  3BTC A;  4R8H A;  4XOT A;  3U50 C;  2FOW A;  4CO8 A;  2CUJ A;  2LDU A;  5F27 A;  2GM4 A;  1FSH A;  3GUD A;  5GTH C;  4B48 A;  1YIO A;  2KFD A;  4R1H A;  4CL1 A;  1ITY A;  4M6Y A;  1IDY A;  2CUE A;  1T8I A;  5DTD A;  2GA1 A;  2PBI A;  3DEE A;  1K4T A;  3ZMZ A;  3D1N I;  5D5U B;  3G6E 1;  1Q86 1;  1Y1W I;  1WHU A;  3OYG A;  3JSP A;  2MH9 A;  2VQG A;  4F52 A;  3NRV A;  3HRU A;  2BE5 F;  2E1C A;  3G3Z A;  3W2A A;  4C2M J;  1DP3 A;  1QPI A;  3A1Y A;  3ABM H;  2A3S A;  2LNB A;  5AON A;  1LFU P;  1X1A A;  5K1Y A;  3BJO A;  4CCM A;  3PFI A;  2AS5 F;  3H5A A;  2H09 A;  1P9Q C;  3GFM A;  2HS5 A;  2ISZ A;  5D4R A;  2Z9O A;  1TW3 A;  2R7V A;  1W7P B;  4I01 A;  4RS8 A;  1GLN A;  3HZJ A;  1ZLK A;  2QQB A;  4U7D A;  3CCE Z;  2HYJ A;  3RKW A;  4DYR A;  1R36 A;  5CLS A;  2E71 A;  2UZK A;  2K86 A;  1X3Z B;  3KZY A;  1V5F A;  3BG6 A;  4RB2 C;  2NS8 A;  2WWY A;  1YHQ Z;  3CMA 1;  2L7Z A;  4Q4Z F;  1IC8 A;  1HSJ A;  3HOW I;  1T08 B;  3KE2 A;  3LSM A;  1Z6T A;  3WE3 A;  4A2U A;  3VFZ A;  1D5V A;  5BQT A;  2COB A;  2KHM A;  2M5W A;  1O3R A;  3F23 A;  3QOP A;  5FLX f;  3ONQ A;  1DPU A;  3BZC A;  4A3B I;  4M72 A;  3HRT A;  3T5X A;  3ULQ B;  3VTN A;  1Q7Y 2;  1KD1 1;  3F3X A;  1UHW A;  1VQ9 I;  2BXZ A;  4GRI A;  2IJL A;  3CCY A;  4A3E J;  1QA6 A;  4CCL A;  2PEX A;  4UUS A;  1OLT A;  1JE8 A;  3HOX I;  2I10 A;  1UCR A;  1TBX A;  4EM2 A;  1RUN A;  3DLL F;  2BV6 A;  1IF1 A;  2HGC A;  1MDM A;  2DE7 A;  3OYN A;  3RPU D;  2WBM A;  1QF8 A;  2DJN A;  2QQ9 A;  3FXL A;  1ETK A;  4O6J A;  1YJ9 1;  2G7U A;  3CCL Z;  1C0W A;  2XPV A;  1JHF A;  3WTY C;  4KMU X;  4BJ6 C;  5ICG A;  3JCU C;  1AKH B;  2KKO A;  2EFN A;  4ZYE A;  4Q5S F;  3U2R A;  3OYB A;  1R1V A;  5L3D A;  2IGK A;  2FNP A;  2CFX A;  3OR2 C;  2OF7 A;  2L3D A;  3R60 A;  1VQO Z;  2BHZ A;  5HLT A;  1A31 A;  2ME6 A;  1RO2 A;  3GBG A;  5FKN A;  1X0T A;  2LYC A;  2E2J I;  2OZ6 A;  3J81 K;  1WJD A;  3S15 I;  2LY1 A;  3CME 1;  2RBL A;  1KYW A;  4I0A A;  3RKY A;  4IO9 F;  3HEF A;  2DYR H;  3JRA A;  2NVX J;  2RHB A;  2OCC H;  4KDP A;  1OYI A;  3S1Q I;  1MIJ A;  2K4B A;  2LVS A;  3S2W A;  1MMS A;  3BCB A;  1YIT Z;  1KU9 A;  1GVD A;  4KT5 C;  2BHY A;  2RKH A;  2QA4 I;  2W57 A;  2X1E A;  1RI7 A;  2M4K A;  4BY7 J;  4G6D A;  3WTZ A;  4E2Z A;  1X4O A;  4NBE A;  4U0V A;  3U9G A;  1WZ2 A;  3RTR A;  5GPC A;  5HOD A;  1FYK A;  1HW2 A;  5K5O A;  3KFW X;  1R49 A;  3FX3 A;  1XSD A;  4G94 A;  4RVH A;  3CQZ J;  1DQU A;  1ZHF A;  2HQN A;  1TWG J;  3TBI A;  1ZH5 A;  2AYD A;  2OZU A;  3S17 I;  1IN5 A;  2CW8 A;  1L3L A;  4A3L I;  4XRF A;  5K7F A;  2QKM B;  2F2E A;  1YYV A;  3BCA A;  2L7M P;  4RA2 A;  2GXB A;  4BQQ A;  1PVE A;  3IH2 A;  3L2V A;  4NBG A;  4XRS G;  1DL6 A;  4IPA A;  5FB2 A;  2XAQ A;  3PQK A;  2XRO A;  3I4M J;  2A5Y B;  2DTR A;  1OKR A;  2YUS A;  1KZH A;  5F1J A;  4NUB A;  2DAO A;  1D8K A;  3ZMD A;  2XPW A;  4E7J A;  2O6G E;  4PJM A;  3RJP A;  2VXD A;  1QVG Z;  3SZT A;  1QZY A;  1R5H A;  1PDN C;  3LSI A;  1TQI A;  2HVQ A;  3CCU I;  2VB6 A;  4IHS A;  2DFH A;  2ZBK A;  4OWR B;  3Q0V A;  5DCM B;  3TP0 A;  3ABL H;  2ZC2 A;  1R1T A;  3WU1 B;  4LJZ F;  3D9X A;  3ML6 A;  3ZQL A;  2QEX Z;  2V8K A;  4A3F J;  3CUQ B;  4RGR A;  2LR8 A;  4EMS A;  4F3Q A;  5F1R A;  1W36 C;  1YUK A;  2OV7 A;  4XKV A;  3LQQ A;  1ZKG A;  3BZK A;  4GXO A;  1U9O A;  2BOL A;  1JKR C;  3VYT B;  4WF2 A;  1WI9 A;  2JJ7 A;  1ZG5 A;  3G1M A;  1JKO C;  4A3C I;  5CVU A;  1LE8 A;  3TOA A;  3IV5 A;  3M8F A;  3X2Q H;  2QEN A;  1RO4 A;  3SEZ A;  3HIF A;  4G7Z F;  3GZN B;  2P8T A;  1Z91 A;  2QYO A;  3O8G A;  2BEO A;  3LNQ A;  4CDG A;  4QTT A;  3MZY A;  3AAF A;  1TP4 A;  3IL2 A;  2K3F A;  2QRE B;  1D5Y A;  4GFB A;  1EF4 A;  3A03 A;  4MXU A;  3CMY A;  4ITV A;  1WCM J;  2X9D A;  4A5N A;  2R7Z J;  5E1X A;  4NH1 C;  1KQ9 A;  2XPU A;  3E6B A;  3JRI A;  3HUG A;  2JVG A;  2W24 A;  1XGN A;  2DMU A;  3TKY A;  4MH4 A;  4QPO A;  1KRL A;  2DK8 A;  1R1U A;  3EPZ A;  1GV2 A;  3NWS A;  4A3K J;  2CMP A;  1VQ7 I;  3BOQ A;  4XSX F;  3BG3 A;  2L01 A;  3OYI A;  1A35 A;  3J7Y J;  3TE5 B;  2LY9 A;  5E3L A;  4I99 C;  1FIP A;  2IEK A;  3U21 A;  2HOE A;  4WXH A;  4OIR F;  2V26 A;  3DXJ F;  4LLG F;  2EBI A;  5JLX A;  1FPQ A;  5C4J J;  1VQ8 I;  2OUM A;  2OCE A;  2I3C A;  1MBG A;  2D1V A;  2WY8 Q;  1I50 I;  4KIB A;  3QYE A;  1YO5 C;  1HDD C;  1SFX A;  3NWT A;  5LLQ A;  3CC4 Z;  4EJU A;  2WAE A;  3OYC A;  4BDY A;  3KIH A;  2DMN A;  1F1Z A;  2E7W A;  4I6Z A;  1FTZ A;  1CGP A;  1YJN 1;  5C3E I;  4XLA A;  2NRA C;  1LDD A;  4FE4 A;  3LSH A;  1Y8C A;  1FBS A;  2VOP A;  4YIF A;  3GFL A;  2EIL H;  3MWM A;  2H8W A;  3DTI A;  3K69 A;  2F4I A;  5ILS A;  3AL0 C;  3C2B A;  4A3B J;  5FLX K;  1X58 A;  2CQQ A;  5JHF A;  3TDZ C;  3C3W A;  3B02 A;  4MGR A;  3G4S Z;  5CVI A;  2CV0 A;  1MJ9 A;  3P9I A;  1L1O C;  2W7N A;  1FLI A;  3G71 I;  3F8M A;  2JT1 A;  3SHF A;  3HOX J;  1VQK Z;  2DA6 A;  4I02 A;  4A3M J;  2KZV A;  1SAX A;  4PDK A;  3FHN A;  3RIR A;  3KX2 A;  3J7A O;  1LVK A;  1T6S A;  3HG9 A;  2O3F A;  4PFP A;  5FRO A;  5B1A H;  1Z9C A;  2O8X A;  3B73 A;  2LH9 A;  5IPA A;  5BPD A;  2IS1 A;  3CCJ Z;  2E1M B;  3I54 A;  4M3F A;  3Q9S A;  1VQ6 I;  2GTH A;  1JJ6 C;  1J75 A;  1RQF A;  3GWZ A;  4RAZ A;  2LMD A;  1Y1V J;  3GTG I;  3ZP5 A;  2LRD A;  2O61 A;  4ZJZ A;  2CV2 A;  1RES A;  3HTS B;  1X3W A;  2QRD B;  3FM3 A;  3K9T A;  4E31 A;  1V5G A;  2UXX A;  3NDI A;  3S15 J;  3L7W A;  3N4M A;  1PUF A;  3BTL A;  1K79 A;  1MMA A;  3Q0U A;  2R92 I;  5F04 A;  3S1N I;  1SAU A;  1U8R A;  3MN2 A;  1QZZ A;  1XMA A;  1ENH A;  3VMG A;  2MSY A;  2M6N A;  5D6E A;  3V42 A;  1Z77 A;  2EIK H;  2K5R A;  3BP8 A;  4KT6 A;  2VON A;  2ZFW A;  4L5I A;  1R9T I;  3V8K A;  1O3S A;  3LFK A;  3M1C A;  2HI3 A;  1MBH A;  1POG A;  4MD9 A;  3S3M A;  4S04 A;  1WJC A;  2YX4 A;  3RSN A;  2V1X A;  2FUG 2;  2R7O A;  3ZQQ A;  4DBR A;  1I3Q I;  1NTC A;  2OA4 A;  4CZZ A;  1MSE C;  1LDK B;  1FBQ A;  3I56 1;  4XR6 A;  4JK1 X;  3S93 A;  3ZMS A;  3ZQC A;  5IOY A;  1QVT A;  3EET A;  1N78 A;  3MZL B;  1E2X A;  3IKT A;  4A12 A;  1YX5 A;  3G6E Z;  2DJI A;  3S17 J;  2DN0 A;  2K3P A;  1LFB A;  2H6B A;  4HX4 A;  1WJF A;  2CU7 A;  4A3L J;  2AXL A;  2GOX B;  3IWZ A;  3A01 A;  1S7O A;  1IRZ A;  4NOZ A;  2R93 I;  1S29 A;  2HTS A;  2PJP A;  1FOY A;  4AID A;  3V4G A;  5M5X J;  3OYF A;  3Q3S A;  3BTI A;  5TJJ A;  4XON A;  4KUM A;  2E19 A;  2DYS H;  2G2K A;  1IXC A;  2C6Y A;  5F08 A;  4PFO A;  2O53 A;  3QQA A;  1OCO H;  3R0J A;  2VOD A;  3M8J A;  4U7B A;  2M9H A;  1WQ2 A;  2WV1 A;  4I76 A;  1MND A;  4XLH A;  3K7A I;  1YRN B;  3N05 A;  1WJB A;  4PGG A;  4MNU A;  4XMY A;  3E97 A;  4NBD A;  1T2K A;  1SEU A;  4XIC A;  4OAY A;  2ZB9 A;  3H35 A;  2QSF X;  4L5J A;  1Z7U A;  1JKQ C;  2EZL A;  4LIT A;  1HKS A;  5JVG F;  3RI4 A;  5JR3 A;  5LL6 f;  1GDT A;  2E2H I;  3PNV A;  2MA3 A;  3S2H I;  1TZL A;  3CMA Z;  3K4C A;  3GTK I;  2WB1 N;  1LNW A;  1B6A A;  1UB9 A;  1X4P A;  2Y2Z A;  4HYE A;  1VTN C;  3Q87 A;  2KRC A;  1F43 A;  4F7Z A;  2XF7 A;  2FML A;  4MD8 A;  3GO5 A;  4E2W A;  1VQN I;  2VE9 A;  5LFA A;  4A3J I;  3SEQ A;  4DK1 A;  2K9M A;  3RDI A;  3LA2 A;  3NQO A;  2MG4 A;  4LD5 A;  3MZH A;  4E70 A;  2JA8 J;  5LRS A;  1H0M A;  5L3F A;  5IT9 Z;  1DGW Y;  2KPI A;  2YS9 A;  3CUO A;  5LHI A;  4LG0 B;  2O5R A;  1PJR A;  4M73 A;  1I3A A;  2QGU A;  3ASN H;  2VI6 A;  2DA3 A;  1IDZ A;  4NBC A;  3I59 A;  1VI0 A;  4W97 A;  1BBY A;  2VPW A;  5AN9 F;  2J5P A;  4WK8 F;  2O03 A;  4MHG A;  2DFE A;  3M3Y J;  1WKM A;  1YI2 I;  2P81 A;  3IC7 A;  2ZAE B;  2HDD A;  3DBH B;  2R0Q C;  4D7M A;  1KGS A;  1ZGW A;  3J81 b;  3JW4 A;  1JJ2 Z;  2VJI A;  1OCC H;  2QVO A;  1BOB A;  2VN2 A;  5ILU A;  2B9S A;  2H8R A;  1TFI A;  2ZXH A;  3HB9 A;  2F4O A;  1YJ9 Z;  2JUB A;  2WA0 A;  3P7N A;  1IZ1 A;  4UY8 I;  3S14 J;  2OOX B;  4PJJ A;  1FIA A;  3O3K A;  4H4K C;  4AYB N;  1M1K 1;  1Y6I A;  3S3O A;  3GTP J;  2JA6 I;  2Y0S A;  2JMO A;  3R0A A;  2Q4Z A;  1WPK A;  3HSR A;  2G9W A;  1UFM A;  1MJB A;  1QVU A;  3MKW B;  2R5Y A;  2R7Q A;  3RCO A;  1VQM I;  1ERD A;  3CME Z;  2EA4 A;  4C3J J;  5HNH A;  3I58 A;  1J7K A;  2FSW A;  2ZSH B;  5C3E J;  2ZO4 A;  2XSJ C;  5HLG A;  5HOO A;  1DDN A;  3NAR A;  3S1R I;  1JWH C;  2Z5U A;  2WB1 A;  3BR1 A;  1JUS A;  2Y75 A;  4Z6Y A;  2VJ4 A;  5KAF C;  2PJR B;  2AKL A;  3HHH A;  3J80 f;  4DYQ A;  2Z33 A;  2JSP A;  2WAQ N;  5D8L B;  3NEU A;  2Q2E A;  1YLF A;  2VT3 A;  4G12 A;  2ELK A;  1EKE A;  2KIM A;  1XG1 A;  4C3H J;  2HVS A;  4E32 A;  2XB5 A;  2JA7 J;  3F6O A;  1X3U A;  5E3M A;  1Q81 1;  5LGU A;  2O0Y A;  1YIJ I;  1CF7 B;  3F8C A;  3GLX A;  3OR1 C;  4CSW A;  4CYC A;  3CD6 I;  4BH9 A;  3Q0W A;  3ZOB A;  2XIG A;  4P5O A;  1U3E M;  2XAS A;  1S72 1;  4IJA A;  2W85 A;  1EH8 A;  1QVF Y;  1K83 I;  5M3M J;  1Y56 A;  5ILV A;  4HDV A;  3I55 I;  2HDC A;  2L2O A;  1NJI 1;  3K10 A;  2F5C A;  2W48 A;  4LLL A;  1K9M 2;  2QR1 B;  4XX2 A;  3IFU A;  1YJW I;  4UNO A;  2HPI A;  3FM5 A;  5FFZ A;  2O8K A;  2B63 I;  4XLN F;  1MMG A;  1I6H I;  5J3L A;  2FMY A;  3L2R A;  2FX0 A;  4AYB A;  3VWB A;  3EDP A;  2E5Z A;  5FD5 A;  3OYE A;  3K1M A;  4EJW A;  1R4N B;  3CCM 1;  1Z3Y A;  3HRS A;  2R92 J;  2JPB A;  3KYL A;  3J7Z I;  3S1N J;  3CDH A;  1ZAR A;  2JIM A;  4NBH A;  2P4W A;  2W82 A;  3CDL A;  3DU6 A;  3K4L A;  1USP B;  3WOD F;  2V79 A;  1K73 1;  2OZK A;  3H9G A;  2JSC A;  5D1P A;  2IZ4 A;  4GDF A;  4A3D J;  3MON A;  4BE0 A;  4UHT A;  2MBF A;  3A0B C;  1MBK A;  5B3S H;  2IRF G;  5IP6 A;  4IKF A;  3FMQ A;  1B8I A;  2WAQ A;  2FXA A;  3B6A A;  1YX3 A;  4X6A J;  4NQW A;  4M9X A;  4XNF A;  1HKQ A;  4RB3 C;  1TTY A;  4I0B A;  2EH3 A;  1IGN A;  1U9N A;  2XAJ A;  5ICF A;  3VOE A;  4XLC A;  4BS9 A;  3QU3 A;  1W0U A;  3MVP A;  2JUG A;  4QPQ A;  4HV6 A;  2QSG X;  5EGO A;  4IRG A;  1OFC X;  3GXO A;  3T8R A;  1VQK 1;  2R93 J;  1KU2 A;  3CPW Y;  2M7B A;  5M3F J;  5JHU A;  4MTD A;  4G6T B;  4MON A;  1IO2 A;  4K2E A;  3MZK B;  3OYH A;  2LKX A;  1Q16 A;  2P3Y A;  3KZZ A;  4IQJ A;  2GOM A;  1R5G A;  2X6O A;  1UG0 A;  2DA1 A;  1D0X A;  1Z3X A;  2IA2 A;  1U5T B;  2LK2 A;  3K7A J;  2FNA A;  2R7R A;  2NS0 A;  3DV8 A;  2XF6 A;  2HPM A;  3CC2 I;  4A3G J;  1SFO I;  1SFK A;  2HXO A;  2ZJ2 A;  2LBF A;  1ORK A;  2JA5 J;  2L0K A;  2DDB A;  2LD5 A;  1U0J A;  2GIZ A;  2X6Y A;  2BVL A;  3J81 Z;  1HA8 A;  2RV8 A;  5FD6 A;  1N8R 1;  5FRM A;  3DBL B;  3OYD A;  4J01 A;  4LGW A;  1J5Y A;  2OTL I;  1Q86 2;  2H1K A;  2OQR A;  1IXR C;  4A3I I;  1TW2 A;  2VKD A;  2XKO A;  3E6M A;  2HOS A;  1ZK8 A;  4HAM A;  3FIS A;  3F6V A;  1S7A A;  4HQE A;  3TED A;  2VE8 A;  2VT2 A;  4AUX A;  3E1S A;  2VPX A;  2LRE A;  3CCQ I;  1JHH A;  3BR6 A;  4LK1 F;  3NH5 A;  1BJA A;  4RM3 A;  4UVB A;  2NVY I;  2WV0 A;  1FEX A;  2V9P A;  2JNY A;  2P6S A;  1X2M A;  1RIO H;  1ZAO A;  3IX0 A;  4QTR A;  3ZQI A;  3VB9 A;  4DGW B;  4E7S A;  3VEP A;  1Y1V S;  2Y31 A;  4I09 A;  1E3H A;  1V54 H;  1X1B A;  3T4N B;  2EFQ A;  1O3T A;  2NAP A;  4MD7 A;  2E2I I;  4BGD A;  5IYD J;  4ENJ A;  4BXX J;  4HLY A;  2F6C A;  4WXD A;  3CCR 1;  3QP5 A;  4ESB A;  3WU2 C;  2PG4 A;  2QLZ A;  1XMK A;  5F64 A;  3GTJ I;  3U1D A;  1R71 A;  4NC8 A;  2ZJR F;  4DW6 A;  1VZ0 A;  2P0W A;  4G6Q A;  4RGS A;  4B43 A;  3OYJ A;  1PP7 U;  1JI8 A;  4ASN A;  1W7P D;  4ESJ A;  1Z21 A;  1ZR4 A;  1YUA A;  3H9J A;  3OY9 A;  3F72 A;  2RRE A;  5D5W B;  3J7A Y;  1D8J A;  2QA4 Z;  5A2Q f;  3HOV I;  2JWT A;  2HKX A;  4B09 A;  2XRN A;  4QWQ A;  3KP5 A;  5HDN A;  1BOA A;  3PJR A;  2A05 A;  3BJ6 A;  2YSR A;  2ETH A;  3GME A;  4B1R A;  3IRR A;  1Z1D A;  5K5R A;  2XC7 A;  1LUJ B;  4KFC A;  2HOT A;  4MEY F;  3D6W A;  2ECC A;  3ZMV A;  1TWC J;  3VYU B;  1ZB8 A;  5E79 C;  4HLX A;  2KMU A;  4RM2 A;  4Y13 A;  1ZEL A;  1IW7 F;  2KDO A;  5B1B H;  4L18 B;  3J80 K;  3VPR A;  4DQ2 A;  4XKC A;  3G2B A;  2M45 A;  4FET A;  3GTM I;  3LAP A;  2X51 A;  3BLY A;  5JVT A;  4Y52 J;  3ZXS A;  2NXN B;  1X3Z A;  3MD2 A;  4AWX B;  1YW9 A;  5L3B A;  3K70 D;  3ZR8 X;  4IRI A;  1LKX A;  4Z2Y A;  3JRH A;  1D0Z A;  3H3V K;  4IHW A;  3I56 Z;  4CYD A;  3RQ4 A;  1KON A;  3H0G I;  1S7M A;  2V1D A;  2R6M A;  3SDG A;  3VYR B;  2EFP A;  2VJJ A;  1XX5 A;  2X48 A;  5BOX A;  4O3M A;  3QU6 A;  2F5E A;  3I3L A;  3H5N A;  1HLV A;  5DM7 F;  3WTU C;  2BJO A;  2DE6 A;  2TDX A;  4ZYA A;  5E8I A;  1IV8 A;  5HS8 A;  2OQG A;  2B7E A;  3TL4 X;  1RNL A;  3W3C A;  4UUS B;  2OJE D;  2HYF A;  2BY1 A;  5BPI A;  4JBA A;  3RZO J;  3S16 I;  1Y8R B;  3ESW A;  3I4P A;  2NVQ I;  1MDM B;  1P4X A;  1Y39 A;  2EQR A;  2XUB A;  3E3V A;  4RAG A;  1AWC A;  5J47 A;  2ESN A;  1XGS A;  4M9S A;  3BG0 B;  3C1D A;  1Z7L A;  3W2W A;  4UVA A;  2LKS A;  3A4C A;  3SFI A;  4C30 A;  3CCV I;  1V3F A;  5L3G A;  3BG9 A;  1ODD A;  2L9V A;  4Y4R A;  2OD5 A;  1PFT A;  4EV0 A;  4F91 B;  4ZZD A;  3RPU A;  4ESF A;  4U0Y A;  1YS7 A;  2XRL A;  3M1E A;  1YE9 A;  4FHT A;  2JK3 A;  4EGY A;  1I27 A;  2A07 F;  1GVJ A;  3FBI B;  5IP9 J;  1VQP 1;  1A6Q A;  1T56 A;  3F8F A;  4IVN A;  1TWA J;  4BQA A;  2OTJ 1;  1Q7Y 1;  3S8P A;  2YAD A;  1TT0 A;  4JOM A;  5FLX Z;  3E5Q A;  1B72 B;  1GHC A;  4E7Z A;  1VLA A;  4PJL A;  2DDA A;  1FMV A;  4Y7N I;  2KRF A;  1APL C;  1W2B Z;  1I1G A;  3HOS A;  2LIY A;  2NVU B;  1OPC A;  4YFN F;  3FBN B;  4MFD A;  4BQO A;  1VQ5 I;  4BY1 J;  2COM A;  2BW3 A;  3D5S C;  4IOC F;  3OYL A;  2ZXJ A;  1T98 A;  1G3Y A;  4II3 A;  1ONV A;  1HQC A;  3TO9 A;  4XRM A;  3TO7 A;  1NHA A;  3FKJ A;  4BNC A;  1LEB A;  5K7H A;  3ZQH A;  2J6A A;  3BRO A;  2OU2 A;  2DA4 A;  2VBY A;  2RNJ A;  3TQN A;  4AVZ A;  2FU4 A;  1RC9 A;  3C18 A;  3CCE I;  1JKP C;  3M4O J;  3VMI A;  2W4S A;  2IGO A;  1E17 A;  2VQH A;  3QPS A;  2MGQ A;  1G3W A;  4M3G A;  3DKX A;  1ETY A;  5EEA A;  2XSD C;  1YHQ I;  1SIW A;  4DYC A;  2P5L C;  2V3V A;  3SDB A;  3WHC A;  2VPY A;  4KA4 A;  1HST A;  1BR1 A;  4HW0 A;  2HQR A;  4JYK A;  2GTI A;  3HGG A;  4RB1 A;  1UJ8 A;  3KYC B;  3KP3 A;  3FZV A;  5EJC A;  1IN4 A;  3OV8 A;  5H20 A;  4BXF A;  5J8C A;  2WC2 A;  3BG5 A;  2RIQ A;  1W5C C;  1WSU A;  2Z1D A;  2WY7 Q;  4L5E A;  2D2W A;  4M3B A;  3WHB A;  2QSH X;  1FOX A;  2JTV A;  4OMY A;  2G7H A;  3H9Q A;  2LFU A;  1G4D A;  3CC7 I;  3HOT A;  4NB5 A;  5FLM I;  1H9G A;  3LSJ A;  1A6I A;  3HKZ N;  2LTP A;  3I53 A;  3BPX A;  4U88 A;  2M87 A;  4JX5 A;  1LE8 B;  5EDN A;  2VPZ A;  2ZXI A;  3VOD A;  2XF5 A;  1VQ6 Z;  3MFK A;  3HOY I;  1RUO A;  3GTQ I;  5FLV A;  4FX0 A;  2MH2 A;  1KC8 2;  2XAF A;  2RGV A;  2EZI A;  3CLO A;  1FP2 A;  1Y1W J;  2R7W A;  1WW9 A;  4ZYH A;  3CCL I;  1BA5 A;  2LKP A;  1ZR2 A;  2BGC A;  2A69 F;  2JPC A;  4EM1 A;  4B3A A;  4XL9 A;  3QOD A;  2OAZ A;  1S72 Z;  1TNT A;  1VQ4 I;  1ETQ A;  5E8G A;  4G9Y A;  3GEZ A;  4LB6 B;  3W2V A;  5ICE A;  1JJ8 C;  3GTJ J;  2Z3Y A;  1N25 A;  3H3V J;  1VQO I;  3D5R C;  3ZN1 A;  3HUG B;  2KZG A;  1I5Z A;  2YU9 I;  3SFZ A;  3CF2 A;  1RO0 A;  3OSG A;  2ESH A;  2XAH A;  1YOV B;  1DPR A;  1QU3 A;  3MKL A;  1F9N A;  3GF2 A;  2IW5 A;  3UKG A;  5A2Q K;  3CCM Z;  3PIO F;  1NP6 A;  1YIT I;  3ZPL A;  3FF5 A;  1FYL A;  2IV2 X;  3KP6 A;  3DU5 A;  3ROU A;  1VQ9 1;  2IBD A;  3GKQ A;  4TNU A;  5H6Q A;  2X4H A;  5GAG J;  4ZH4 F;  1FY7 A;  3HOW J;  5DV5 A;  4G7H F;  4H0E A;  2CGP A;  3OIO A;  4DOZ A;  1XCB A;  2PI0 A;  1LFP A;  4PJ0 C;  4RDU A;  2ADU A;  1S7E A;  4LG3 A;  1IV6 A;  3CJT B;  3LSK A;  4YEL A;  3CXC Y;  3MAJ A;  5DD4 A;  1DP7 P;  3A2K A;  1U6G A;  4BBR I;  4RVG A;  1XDS A;  3HKZ A;  1TL8 A;  2F4M A;  2VJ5 A;  1Y8Q B;  1YG2 A;  2L4A A;  5HLI A;  1ZRF A;  1XDU A;  4L9V A;  2DPD A;  2ECB A;  2CW7 A;  4YII A;  1JUP A;  1P7I A;  4JQF A;  1SD6 A;  4E7I A;  1HOM A;  4D7N A;  2JIP A;  2K7L A;  5HDK A;  1P7J A;  2IVM A;  2KIU A;  3ECH A;  4EAT A;  5D5V B;  2ELH A;  2ZXW H;  4GO1 A;  3S16 J;  3K0L A;  3LOC A;  1P6R A;  3RKQ A;  2P5K A;  4YIR X;  4FTH A;  1R00 A;  2IZ3 A;  3OIQ A;  4BHB A;  4FAS D;  1KQ0 A;  4M71 A;  2FBH A;  2A6E F;  3FK6 A;  2LF7 A;  3FHZ A;  2QEX I;  3S1M I;  2CH0 A;  5FKK A;  3K2A A;  2YX7 A;  4NB8 A;  3TW7 A;  2FEZ A;  3ERM A;  1T38 A;  2DXI A;  2QA4 1;  4IX7 A;  1JUM A;  3K70 C;  4BE2 A;  4Q47 A;  1F5T A;  2E2J J;  2LG4 A;  2HTJ A;  2YPR A;  4NB9 A;  3ABT A;  1X3W B;  5KCM A;  3IAM 2;  2ID3 A;  3EQL F;  3H5R A;  2K27 A;  2DT7 B;  2IGN A;  4D1Q A;  3L2C A;  1VQ5 1;  2PN6 A;  2JMW A;  5AIQ A;  5EYR A;  1S8N A;  4BL0 B;  4IHY A;  4M3E A;  1PUF B;  2QKL B;  3S1Q J;  2PFB A;  5LBQ A;  2ZJQ F;  3FMS A;  1CQT A;  3KP2 A;  1X1P A;  1RZ4 A;  4G7O F;  2VPR A;  5DM6 F;  2QBY A;  4NBB A;  4ON0 A;  2R7D A;  3K4B A;  2ICW G;  3V7C A;  4C2U A;  1MZB A;  5KAI C;  1R6R A;  4CCK A;  2VKE A;  3DPT A;  1ZGJ A;  3DLA A;  1N75 A;  1G3S A;  5LGN A;  3KP7 A;  1W1W E;  2A68 F;  2GXA A;  5DYM A;  4KN4 X;  1BC8 C;  1MD0 A;  3BR2 A;  4RLQ A;  2DBB A;  5D5X B;  1DU6 A;  4ZDP A;  1STZ A;  4GCV A;  3CCU 1;  4KIS A;  3CCS I;  4NBA A;  1U8B A;  1AHD P;  3AG1 H;  4PGH A;  3CCR Z;  4A93 I;  1OCP A;  1QPM A;  2E7Z A;  2OPT A;  3A01 B;  3ECO A;  1KQS Y;  3CC4 I;  3LSR A;  2CG4 A;  4KYW A;  2D45 A;  5CKT A;  1UHS A;  3JRC A;  2GIV A;  4Q48 A;  5IY5 H;  5D1O A;  4ZYD A;  3H1C A;  3CF5 F;  4RS4 A;  1HCR A;  2DOD A;  3D2L A;  3CC7 1;  3J80 b;  3WE2 A;  3OOP A;  2V8I A;  3EUH A;  1XMX A;  2BZT A;  3F3P C;  2FBK A;  3UNG C;  4AIJ A;  4EWC A;  2JRM A;  1M1E B;  4FQG A;  3RKX A;  4BBS I;  1MH4 A;  2K9L A;  4KNY A;  3G4S I;  1YRN A;  1XGO A;  4S0H B;  2VUM I;  1YS6 A;  1TWF I;  4ENK A;  2VOO A;  2EFW A;  2FF4 A;  4A3C J;  4HGY A;  1XPX A;  3L09 A;  1LVA A;  5FLM J;  1J0R A;  3OS2 A;  1SFU A;  3KLO A;  3IWF A;  1VQ4 1;  1BIB A;  2M1B A;  4C3I J;  2ZME A;  3JR9 A;  1J09 A;  1MNM C;  2Z2S B;  1KQ8 A;  4DIQ A;  3T1B A;  3HOY J;  1I1S A;  3M07 A;  4IOA F;  1QHG A;  1VQ7 1;  3CCJ I;  3R4K A;  1XC5 A;  2VKH A;  1FMW A;  4UB6 C;  1GT0 C;  2KP6 A;  4DZJ A;  1XB4 A;  4D5F A;  1LEA A;  2EFO A;  4HPQ A;  1VQ8 1;  2GAU A;  4F92 B;  1TWH I;  3DP7 A;  3KPH A;  2XDV A;  1KU3 A;  2XKP A;  5EG0 A;  4M6X A;  2CRG A;  2QF7 A;  4MFE A;  3WG7 H;  5J1Y A;  3EYI A;  2KJB A;  1D1B A;  2M8G X;  3I59 B;  3O8H A;  3V8L A;  2D1H A;  4LG0 A;  2K3R A;  3HOU I;  2YU9 J;  2EV0 A;  2R7S A;  1W4M A;  3MKZ A;  3JRB A;  1EV7 A;  3EUK L;  3OL4 A;  1K6Y A;  2A5W A;  1UG2 A;  3V7S A;  2GZW A;  4M74 A;  2ISY A;  3S2D I;  5M5Y J;  1I6X A;  3HOZ I;  4HSR A;  4BKX A;  2V9K A;  2F4O B;  4AVP A;  4OMZ A;  1ZB9 A;  1WH5 A;  1I50 J;  1MJA A;  2K5C A;  5CQE A;  1U2W A;  3ZRG A;  3DTK A;  2V7F A;  4F55 A;  5JLW A;  5FKL A;  4CCN A;  3K2Z A;  2RQQ A;  4A6E A;  3GTL I;  3OL3 A;  4TV7 A;  1Q81 2;  1XTA A;  1BI3 A;  1VQP Z;  3G71 1;  2NOG A;  4NFR A;  2OTJ Z;  4BEH A;  4KIT B;  2R5Y B;  5CYV A;  1WGX A;  3M9A A;  3ZQ7 A;  5LEK A;  1ZRE A;  2ZKZ A;  3G6E I;  5T67 A;  1IRF A;  2P7V B;  2XGC A;  5DEQ A;  3HL2 A;  4XSZ F;  5DCF A;  3VSK A;  3BR5 A;  5J1R A;  1D0Y A;  1ETO A;  2Y9Z A;  1TNS A;  4UVC A;  3C2H A;  3TGN A;  2H94 A;  1OR7 A;  4L0Y B;  1VQ6 1;  3MEX A;  1IUF A;  2PJR A;  2QRC B;  1TLH B;  1K78 A;  2E1N A;  5CQG A;  1QZE A;  2MC4 A;  2DCE A;  4S1T A;  2BY3 A;  4BU2 A;  5EEH A;  1R23 A;  1UMQ A;  3CES A;  3K1P A;  2K85 A;  2A61 A;  1K4S A;  2M4G A;  3NDJ A;  3I4N I;  3WU0 A;  3QPH A;  1K6O A;  1W5S A;  1Z03 A;  3E7L A;  1K73 2;  2VBZ A;  3ABK H;  1ZN2 A;  2EJR A;  1VF9 A;  3CXC Z;  2K02 A;  4XN0 A;  3KIO A;  3GTG J;  3GTO I;  3GZ5 A;  3IH4 A;  1YFH A;  2UWM A;  2IA0 A;  4FE7 A;  1PP8 F;  2M2E A;  4A3E I;  1Z05 A;  2JR6 A;  2VF1 A;  3D0S A;  1G8X A;  2V8J A;  2J5O A;  2KPM A;  3HHG A;  5J4V A;  1XS9 A;  5K5Q A;  1XD7 A;  2Z99 A;  2RT9 A;  2LOO A;  4EGZ A;  2TRT A;  3IP4 B;  2XGX A;  1RKW A;  3GFI A;  5F0F A;  2HR3 A;  2AQF A;  4MQ9 F;  5B66 C;  2M3A A;  4B4C A;  5FO5 A;  1AOY A;  2QQA A;  3RQI A;  4P55 A;  1P9N A;  1T33 A;  1MKM A;  2CJJ A;  2FOK A;  4U87 A;  1R9T J;  2Q51 A;  1HXD A;  1PYV A;  2E1M C;  4UUT A;  3J80 Z;  2R5Z B;  3KET A;  2DTZ A;  2VAS A;  4OU0 A;  1BR2 A;  4NC6 A;  1K8A 1;  4LK0 F;  3I07 A;  3GYH X;  1SVO A;  5DUI A;  1LDJ A;  4N9H A;  2BBY A;  1I3Q J;  1VFC A;  2MLK A;  3P5J A;  1M90 2;  2NVT I;  3KLN A;  1J59 A;  4RAY A;  2PMZ N;  5T6B A;  4UUV A;  4AM3 A;  2B0L A;  2L7F P;  3WTX C;  3QRF F;  1MSF C;  1WVR A;  4NQW B;  5L3E A;  2IS2 A;  1YJ9 I;  3U1K A;  1BW6 A;  2EA2 A;  1K9M 1;  2HFH A;  4EQQ A;  2NVX I;  1WI3 A;  4LIV A;  2MLG A;  1REP C;  5A2Q b;  1N8R 2;  3SZP A;  2CQK A;  5EGO B;  4A93 J;  5HLH A;  4HRI A;  3KEO A;  4R79 A;  4BHC A;  4B44 A;  1F36 A;  3FK7 A;  3SXY A;  3W6J B;  5LHH A;  1SC7 A;  2X6W A;  4BY7 I;  3F8B A;  1FBU A;  5LD2 C;  2NNY A;  2DU9 A;  3H3U A;  1BR4 A;  3CME I;  2CQX A;  3L00 A;  1BJZ A;  3TO6 A;  4EJV A;  4ZTF A;  2EV6 A;  3ABU A;  1ON2 A;  2GWR A;  1W36 D;  4BUP A;  3AFH A;  1J2X A;  3HSF A;  2BYV E;  3CQZ I;  2DK5 A;  4LOC A;  1VQN 1;  1TWG I;  2M30 A;  1XGM A;  3PSF A;  2LBF B;  2IA1 A;  1B9M A;  4EEF G;  3IH3 A;  1VQ9 Z;  4BDZ A;  5DD8 A;  2ELJ A;  1RRJ A;  2E2H J;  2VUM J;  4WWC A;  3S2H J;  4OOI A;  2ZSI B;  3GTK J;  1IN6 A;  2A6H F;  2V4J C;  1GXQ A;  3KZI C;  4RBO A;  3I4M I;  2RPR A;  4X0G A;  1OYW A;  1D1A A;  3HRM A;  1RNI A;  3EUH C;  3IRQ A;  1FWZ A;  1QXF A;  3CP2 A;  4A3J J;  4ETS A;  4IHT A;  1YI2 1;  1SFE A;  1OCT C;  1Q82 1;  3VDX A;  1OYY A;  3I9V 2;  2RVC A;  5AIP A;  1NH3 A;  2RDP A;  2FRH A;  3M8E A;  2PMZ A;  1P4A A;  4HH4 A;  4HX7 A;  3QYF A;  1BI1 A;  1T39 A;  1X19 A;  3BG7 A;  4KN7 X;  1FYM A;  3DQV C;  1ML8 A;  3VYS B;  4DZP A;  1BM9 A;  3LWF A;  5GAH J;  4HNV A;  4HNT A;  3RYP A;  2IT0 A;  4A3F I;  2HVR A;  1FSE A;  4XM3 A;  3GZ6 A;  2DE5 A;  1V4R A;  3PNT A;  2QWW A;  2ZME C;  1A04 A;  5F0H A;  3MKY B;  1RKT A;  3JRF A;  1R22 A;  3ELK A;  4ZYG A;  3HOU J;  3PO2 I;  3HJE A;  5L3C A;  4QIW N;  1UZC A;  3WTT C;  3QP6 A;  1P2F A;  2KL4 A;  5T64 A;  1VQM 1;  2DA5 A;  1FT9 A;  1OIS A;  3Q5F A;  3EUA A;  1IJW C;  2GXG A;  3DFG A;  4ZZL A;  4CIC A;  3S2D J;  2X0L A;  2E5N A;  3HOZ J;  3BQY A;  5GTI C;  4BAC A;  5C44 I;  2HZT A;  3AG4 H;  1MBF A;  3D5L A;  2JA6 J;  5FRN A;  1WCM I;  2R7Z I;  3I71 A;  1KD1 2;  2CYY A;  5GP9 A;  2V6E A;  1D3Y A;  2LLK A;  2QM3 A;  2V6C A;  3OOU A;  3GTL J;  1B59 A;  2RQP A;  5F0C A;  2E1O A;  2X85 A;  3O6B B;  2V1U A;  2BY2 A;  1VQ5 Z;  5FKM A;  4HF1 A;  1H89 C;  3S1R J;  3DBR B;  4ZC3 A;  4A3K I;  2HDW A;  3AL0 B;  1YIJ 1;  1W7P A;  3CD6 1;  5J8F A;  2GLO A;  2LF8 A;  3MZ8 A;  2IAI A;  3LSP A;  1OMI A;  2DO7 A;  3GLL A;  1WII A;  4C2T A;  3R6S A;  2X6X A;  1LB2 A;  4GYI A;  5EZH A;  3TW6 A;  2MD0 A;  4NDL A;  4AD9 A;  5C4J I;  2VQC A;  3I55 1;  2HNH A;  2M0M A;  4RB0 A;  2JIR A;  1UST A;  1YJW 1;  2JRT A;  3DEU A;  2QZ8 A;  3W6V A;  5LGT A;  1X2N A;  1RPW A;  1J9I A;  1HW5 A;  1WJ5 A;  5FGM A;  4E7K A;  1S9H A;  3PO3 I;  2F5F A;  3I64 A;  3LFU A;  4KIG A;  1VQL I;  3I4N J;  3E6D A;  4MTE A;  3CCU Z;  2M7A A;  1K83 J;  3RYR A;  1OR7 C;  1USS A;  1T0F C;  1TQM A;  4HX8 A;  3WTV C;  4OIO F;  1MBJ A;  2STT A;  1Z01 A;  3JTH A;  4HEA 2;  3BDD A;  1BIA A;  5HDG A;  1FP1 D;  1E0E A;  1W0T A;  2QLV B;  2HZD A;  4BE1 A;  2PM9 A;  3GTO J;  1FOK A;  2JN6 A;  2B63 J;  3V7R A;  5LHG A;  1I6H J;  1T95 A;  4HG2 A;  2DFF A;  2VQL A;  3PNY A;  5FFX A;  3SJM A;  1YJN I;  1IN7 A;  3ESW B;  2DA2 A;  1MH3 A;  1RR8 C;  2EZH A;  4ANJ A;  5A2Q Z;  3CC7 Z;  4PSW A;  3CMM A;  3TP3 A;  1R4M B;  2DOA A;  1K7A A;  2FE3 A;  3A02 A;  4A3M I;  2AXT C;  2L4M A;  4N9I A;  3L9F A;  3H92 A;  2OC6 A;  1WJ2 A;  1V5E A;  5HVQ C;  1AKH A;  2E35 A;  1KYZ A;  2E9H A;  1BL0 A;  2CUF A;  1IG7 A;  1V55 H;  1EH7 A;  1E3O C;  4PSX A;  3HDD A;  2EIN H;  4IRH A;  1QVF Z;  1LQ1 A;  4DJA A;  5FJ8 J;  2KIS A;  4D5C A;  3BR0 A;  2V45 A;  5E1Z B;  2NS7 A;  1WZN A;  4PJN A;  1Y1V I;  2EK5 A;  1VQ4 Z;  4L0Z B;  2PLY A;  1SVM A;  4BJT A;  4OIQ F;  2NVT J;  2M48 A;  1IAW A;  3HC7 A;  2ME0 A;  2KJC A;  4OIN F;  2KDZ A;  2E7X A;  3EYY A;  5KNL A;  1EH6 A;  3HSE A;  1XSX A;  2IS4 A;  1VQ7 Z;  4BQN A;  3FKI I;  3IUO A;  3CC2 1;  1B9N A;  2IGM A;  3TOB A;  1W5T A;  1Z02 A;  4RVF A;  2L9R A;  4D0P A;  1JTX A;  1HF0 A;  3AG2 H;  1ZTR A;  1B72 A;  2KI7 B;  2VXZ A;  2EV5 A;  3IKV A;  3OS0 A;  4LMY A;  1VQ8 Z;  2RAE A;  4XLE A;  3QAH A;  2OOY B;  1ON1 A;  4RLF A;  2XHK A;  4KMF A;  2BW3 B;  3E5X A;  5GPA A;  3ZMT A;  3ERE D;  2OTL 1;  3HYI A;  2EIM H;  4JX4 A;  4NHJ A;  2L9N A;  2EIJ H;  1BN5 A;  3LQR A;  1SFO J;  3CLQ A;  3QOE A;  2XB0 X;  2IS6 A;  3KCC A;  4QTU A;  4XKW A;  4XKB A;  1JT6 A;  4IQ4 A;  4B8X A;  3CCQ 1;  2GU2 A;  4UV8 A;  3CTA A;  2R7F A;  2NOJ B;  4I2O A;  4Y33 A;  2KT0 A;  1QQI A;  3PUF A;  2ID6 A;  3GCM A;  4HST A;  3CPW Z;  4V19 K;  1AU7 A;  5EF6 A;  3KYD B;  4NC7 A;  4YEJ A;  4A3I J;  3G71 Z;  3KEQ A;  3JRE A;  3BWG A;  3E0J B;  1GXP A;  1NK3 P;  3K4M A;  4DNC A;  2L9S A;  3I56 I;  3F8N A;  2W84 A;  5M5W J;  3DF8 A;  3ZMU A;  4KIC A;  4A6D A;  2AO9 A;  3TMO A;  1OJL A;  1KU7 A;  3G1O A;  2CQ7 A;  2JUC A;  4HZF A;  1EA3 A;  4XRS A;  3OS1 A;  3BC8 A;  5DCM A;  1LQL A;  3QPT A;  2PX9 A;  2ZFU A;  1U5T C;  2M8E A;  2FQ4 A;  2NVY J;  3G73 A;  2O9L A;  3CUQ A;  1QGP A;  4LFU A;  3F21 A;  1R5I D;  4A0X A;  3K4J A;  3OWT A;  3ZCO A;  3OIP A;  4NBQ A;  2DQL A;  1O3Q A;  3OW2 Y;  3FXU A;  1AA7 A;  2K9S A;  5TIS C;  1JJ2 Y;  2E2I J;  3ZGK A;  3PO2 J;  2WAF A;  2QUF A;  3ZN0 A;  3E5U A;  3CJN A;  1ZQ3 P;  2FBI A;  3ZQG A;  5E3N A;  1P92 A;  2VBX A;  4RV9 A;  3FXQ A;  5GAE J;  4BJ5 C;  4CXF A;  2JA8 I;  4EM0 B;  2EWN A;  1DGR M;  3P9C A;  5C44 J;  2BVM A;  2DQR A;  2NNN A;  3JSO A;  2CUZ A;  1NK2 P;  2HEO A;  1ETW A;  3DPL C;  3QPL A;  1HW1 A;  3HOV J;  1HDP A;  2LY2 A;  3HGY A;  3K4K A;  1WWX A;  2HXI A;  4E2Y A;  4KIF A;  5IP7 I;  2P28 A;  2YU3 A;  2VL8 A;  2A6T A;  3REO A;  4V2G A;  4ABZ A;  1O7L A;  3PM1 A;  1JXS A;  3M3Y I;  4ENM A;  2DOE A;  3WG9 A;  1ZG1 A;  4B3X A;  1VND A;  2W04 A;  3VSL A;  3UR3 C;  5D8K B;  3L2U A;  2Y30 A;  1VQL 1;  3PQJ A;  1R7J A;  3F22 A;  4AC0 A;  4IL6 C;  5KVR A;  3F3F C;  3FWE A;  3CCS Z;  3GTM J;  2P7C B;  3S14 I;  1H9T A;  2BXY A;  3V8J A;  1KC8 1;  3BZ6 A;  1MBE A;  3GTP I;  4E33 A;  4CH7 A;  4N4N B;  4AIH A;  1YQA A;  5K7Z A;  2VC1 A;  1MMD A;  1SD5 A;  2AHQ A;  3H0G J;  5CPR B;  4J00 A;  5J6X A;  3ASO H;  4RAF A;  1B4A A;  2F4M B;  4PCQ A;  3SZG A;  3CZ6 A;  2VIX A;  2P5V A;  4Y3O A;  5IT9 b;  1F4K A;  3PO3 J;  5C4X I;  2MC3 A;  1G59 A;  3OYK A;  2WTE A;  2HOA A;  2ZNZ A;  3CCV 1;  3CJR B;  1KA8 A;  3O2P E;  2M34 A;  4O5V A;  2MW8 A;  2MFZ A;  4L9T A;  1G6N A;  2JIQ A;  2CS3 A;  2HQA A;  3AG3 H;  1IN8 A;  3JAM b;  2G0E A;  2K40 A;  2KRH A;  4YFX F;  3GVA A;  4LLN A;  2DMT A;  1ZRD A;  2NVQ J;  1Q1H A;  3FXO A;  1JT0 A;  2V9V A;  4LIU A;  4M6V A;  2W25 A; 
#chains in the Genus database with same CATH homology
 1RLY A;  4A3I I;  2VKD A;  3ZRG A;  2X1E A;  3DTK A;  2M4K A;  2V7F A;  4CCJ A;  4F55 A;  2JA7 I;  4P1W A;  4E2Z A;  3HPG A;  1X4O A;  4CCN A;  4NBE A;  3RZD I;  1VQN Z;  2RQQ A;  3GTL I;  3OL3 A;  1WJE A;  3E1S A;  1Q81 2;  1VQP Z;  3RTR A;  3G71 1;  2LRE A;  4NFR A;  2OTJ Z;  3IF8 A;  4BEH A;  4KIT B;  3NH5 A;  4RM3 A;  4RVH A;  4E30 A;  1DQU A;  2NVY I;  2W03 A;  3TBI A;  5T67 A;  3S17 I;  2JNY A;  4HNU A;  2CW8 A;  4A3L I;  1QYP A;  2QKM B;  3IX0 A;  4E2X A;  3HL2 A;  3VB9 A;  3VSK A;  4DGW B;  3BCA A;  1D0Y A;  4E7S A;  1Y1V S;  2H85 A;  4ZDL A;  3C2H A;  4BQQ A;  2DT6 A;  4XLF A;  1X1B A;  3L2V A;  4NBG A;  3T4N B;  1VQ6 1;  1QHH D;  1DL6 A;  2PJR A;  1UEL B;  2QRC B;  4MD7 A;  1YI2 Z;  2E2I I;  4BGD A;  5CQG A;  1ZH1 A;  2F6C A;  2MC4 A;  4AU7 A;  4NUB A;  2DCE A;  3CCR 1;  4S1T A;  4E7J A;  4BU2 A;  4PJM A;  3CES A;  3GTJ I;  2VXD A;  3CCE 1;  1QVG Z;  2M4G A;  4NC8 A;  2QKD A;  3NDJ A;  3I4N I;  2L7K A;  1VZ0 A;  2P0W A;  3LSI A;  3NFZ A;  4B43 A;  3OYJ A;  2HVQ A;  1JI8 A;  2VB6 A;  1Z03 A;  1K73 2;  4OWR B;  1Z21 A;  1YHQ 1;  4RVD A;  1YUA A;  2IXS A;  3H9J A;  4A3D I;  3D9X A;  3OY9 A;  2RRE A;  4MLO A;  3J7A Y;  2QA4 Z;  5A2Q f;  3CXC Z;  2QEX Z;  3HOV I;  2V8K A;  4XN0 A;  2EGT A;  3GTO I;  1YUK A;  4F3Q A;  1W36 C;  3PJR A;  3FDY A;  2OV7 A;  4XKV A;  2UWM A;  4X6A I;  3HOU I;  1VQM Z;  4A3E I;  2BOL A;  2LC2 A;  2JR6 A;  2VF1 A;  3VYT B;  1G8X A;  2V8J A;  4A3C I;  2KPM A;  2XC7 A;  3SYT A;  3D6W A;  3OYA A;  1RO4 A;  5IT9 f;  3SEZ A;  2LOO A;  3VYU B;  3S3N A;  1ZB8 A;  3IP4 B;  2RT9 A;  5C4X I;  3L2Q A;  2KMU A;  2AQF A;  4RM2 A;  1ZEL A;  2KDO A;  2HF1 A;  2M3A A;  4CA0 A;  4QTT A;  3VMH A;  4XKC A;  3G2B A;  5D1O B;  4FET A;  1P9N A;  3GTM I;  2X51 A;  3BLY A;  2QRE B;  4U87 A;  3ZXS A;  1X3Z A;  2Q51 A;  3MD2 A;  4E7L A;  3TDH B;  2CV1 A;  3K70 D;  4MXU A;  3JAM f;  3ZR8 X;  1PYV A;  2E1M C;  4ITV A;  2HU9 A;  1LKX A;  1D0Z A;  4NH1 C;  3I56 Z;  2VPL A;  3RQ4 A;  1KON A;  2VAS A;  3H0G I;  1S7M A;  1BR2 A;  1K8A 1;  1NG7 A;  3I07 A;  2JVG A;  2R6M A;  3VYR B;  2JVH A;  2VJJ A;  3CCL 1;  1YIJ Z;  1NUI A;  4MH4 A;  4QPO A;  3CD6 Z;  1KRL A;  1M90 2;  2NVT I;  3I3L A;  3EPZ A;  3H5N A;  2BJO A;  2DE6 A;  3NWS A;  5T6B A;  4A3G I;  4C9Y A;  4ZYA A;  4NQW B;  4II2 A;  2JA5 I;  2CMP A;  3TL4 X;  3CP8 A;  3W3C A;  3OYI A;  2IS2 A;  1VQO 1;  3TE5 B;  3I55 Z;  2VLA A;  2V1N A;  1K9M 1;  2NVX I;  3S16 I;  3U21 A;  2R7X A;  3ESW A;  4LIV A;  1YJW Z;  2NVQ I;  5A2Q b;  1N8R 2;  4F93 B;  2V26 A;  1M1K 2;  4HRI A;  2OUM A;  2I3C A;  4CZC A;  4R79 A;  2WY8 Q;  4B44 A;  1I50 I;  2O4H A;  3BG0 B;  3QYE A;  3CC4 Z;  3NWT A;  1MNE A;  1Z7L A;  2X6W A;  3W2W A;  4BY7 I;  3A4C A;  2WAE A;  3OYC A;  4C30 A;  4BDY A;  3KIH A;  1YIT 1;  5LD2 C;  1YJN 1;  1BR4 A;  5C3E I;  4XLA A;  4ZTF A;  4Y4R A;  4B47 A;  1N77 A;  4N4O B;  3LSH A;  4F91 B;  1PFT A;  1YE9 A;  1W36 D;  3OMY A;  3AFH A;  1IRX A;  4BUP A;  1VQN 1;  3CQZ I;  3FBI B;  1TWG I;  1VQP 1;  5HNF A;  3DTI A;  4XOR A;  2F4I A;  2R7T A;  3AL0 C;  3PSF A;  2LBF B;  2OTJ 1;  5JHF A;  1Q7Y 1;  2F5V A;  2X1C A;  3G4S Z;  3S8P A;  4BDZ A;  2CV0 A;  1VQ9 Z;  2YAD A;  2ELJ A;  1TT0 A;  4HGZ A;  4JOM A;  1L1O C;  2W7N A;  2ZSI B;  2V4J C;  3OW2 Z;  1NG6 A;  4E7Z A;  1VLA A;  3I4M I;  2RPR A;  4PJL A;  4X0G A;  1VQK Z;  4BXX I;  1FMV A;  1D1A A;  2WAD A;  1RNI A;  4Y7N I;  2KQR A;  3EUH C;  2MYS A;  3DKY A;  2KZV A;  4OAZ A;  1W2B Z;  1X1D A;  3CP2 A;  3FHN A;  4NNJ A;  3KX2 A;  2L5Q A;  3HOS A;  2LIY A;  1LVK A;  1YI2 1;  4PFP A;  3HG9 A;  3FBN B;  1Q82 1;  3DTE A;  3VDX A;  5FRO A;  4BQO A;  4NBF A;  3D5S C;  2BW3 A;  3I9V 2;  2PK7 A;  3PL8 A;  2LH9 A;  2IS1 A;  3OYL A;  2PMZ A;  2CFO A;  4E6K G;  4HH4 A;  2E1M B;  4II3 A;  2RNG A;  3CCJ Z;  3QYF A;  1X19 A;  3BG7 A;  4BEH B;  3DQV C;  3FKJ A;  2GTH A;  1ML8 A;  3VYS B;  3QWU A;  1NJI 2;  1RQF A;  2J6A A;  1WJA A;  4HNT A;  3L2W A;  4A3F I;  2HVR A;  4XM3 A;  3GTG I;  2DE5 A;  2LRD A;  3PNT A;  2R7U A;  4ZJZ A;  4AVZ A;  2CV2 A;  3MKY B;  2Q2E B;  3QYB A;  4PK4 A;  1MMN A;  1X3W A;  2QRD B;  2QEX 1;  3CC2 Z;  4E31 A;  3VMI A;  3PO2 I;  1V5G A;  2W4S A;  3NDI A;  2IGO A;  5T64 A;  2KL4 A;  2VQH A;  4ZTJ A;  1TWC I;  1MMA A;  1VQM 1;  2R92 I;  3DKX A;  3EUA A;  3DWL E;  3S1N I;  2UUZ A;  3LMM A;  1SAU A;  3VMG A;  1D1C A;  3SDB A;  2E5N A;  2M6N A;  4E4H A;  3V42 A;  4BAC A;  5C44 I;  1BR1 A;  2K5R A;  2W00 A;  4KT6 A;  2GTI A;  1R9T I;  2OTL Z;  4Y52 I;  2Q1Z B;  4XOP A;  3D5L A;  3M1C A;  5FRN A;  1WCM I;  4BXF A;  2R7Z I;  2VUG A;  4PUS A;  1KD1 2;  4MD9 A;  1K8A 2;  3S3M A;  2RIQ A;  2V6E A;  1WJC A;  3RSN A;  2FUG 2;  2Z1D A;  2WY7 Q;  3OOU A;  3KIF A;  2R7O A;  3ZQQ A;  4DBR A;  1I3Q I;  4D9J A;  2LFU A;  2X85 A;  3H9Q A;  1LDK B;  3CCQ Z;  3I56 1;  1VQ5 Z;  4XR6 A;  3S93 A;  3PSI A;  1N78 A;  3HOT A;  3MZL B;  5FLM I;  2JA2 A;  4ZC3 A;  4A3K I;  1YX5 A;  2HDW A;  3HXL A;  3AL0 B;  1YIJ 1;  3DPU A;  3G6E Z;  2KLO A;  2DJI A;  3CD6 1;  4DBQ A;  2K3P A;  2ZXI A;  4ZDO A;  2XF5 A;  1VQ6 Z;  1WJF A;  2R93 I;  2GOX B;  3NH8 A;  3HOY I;  3RZO I;  4NOZ A;  1WII A;  3GTQ I;  4C2T A;  2X6X A;  3EED A;  1KC8 2;  3OYF A;  2MD0 A;  1WW9 A;  2R7W A;  5C4J I;  2VQC A;  4CCO A;  3I55 1;  2HNH A;  4XON A;  2G2K A;  2M0M A;  4PFO A;  3K6G A;  2O53 A;  3CCS 1;  4XL9 A;  3QOD A;  1YJW 1;  1W2B Y;  2W1O A;  1S72 Z;  3PFY A;  2UV1 A;  1N2F A;  1USP A;  3M8J A;  4U7B A;  1WJ5 A;  3W2V A;  4E7K A;  1S9H A;  3PO3 I;  3CJQ B;  1MND A;  3LFU A;  4XLH A;  3K7A I;  3H3V J;  3H0D A;  3C2G A;  2JS4 A;  3J81 f;  3CC2 1;  3D5R C;  3CC4 1;  3N05 A;  3HUG B;  1WJB A;  2YU9 I;  4XMY A;  3CF2 A;  1RO0 A;  4NBD A;  4RMN A;  2M7A A;  3CCU Z;  1WFX A;  3P5J B;  5IP9 I;  1OR7 C;  1T0F C;  4OAY A;  1QU3 A;  1Z01 A;  4HEA 2;  3H35 A;  3FQQ A;  3LUS A;  1TWA I;  1E0E A;  2QLV B;  2HZD A;  4LIT A;  4BE1 A;  2PM9 A;  5LL6 f;  3CCM Z;  2E2H I;  3PNV A;  1NP6 A;  3S2H I;  3MMY B;  1T95 A;  1TZL A;  2R4G A;  4HG2 A;  5TGT A;  1UAA A;  2VQL A;  3K4N A;  3K4C A;  3PNY A;  4DGL A;  3Q87 A;  3GTK I;  1X4P A;  3DU5 A;  4ANJ A;  3GKQ A;  2E60 A;  2KRC A;  4TNU A;  3G4S 1;  4PSW A;  3CC7 Z;  2AQE A;  3CMM A;  2XF7 A;  1QVG Y;  2DOA A;  4MD8 A;  4A3M I;  4E2W A;  5LFA A;  4A3J I;  3SEQ A;  4DK1 A;  2K9M A;  5CM2 M;  1Q82 2;  4YRV A;  3PUB A;  2OC6 A;  4BY1 I;  3GTM S;  1V5E A;  5HVQ C;  4DOZ A;  1LFP A;  2KPI A;  1DGW Y;  2E9H A;  4LG3 A;  3EER A;  3LSK A;  4YEL A;  3S32 A;  3CXC Y;  3A2K A;  4BBR I;  4PSX A;  2I8D A;  2O5R A;  1PJR A;  3HKZ A;  2F4M A;  4DJA A;  4RVG A;  3HPH A;  1QVF Z;  2VJ5 A;  4NBC A;  4PJN A;  3CCJ 1;  1Y1V I;  4MRI A;  1VQ4 Z;  3PO3 S;  2X1D A;  4XN3 A;  5AN9 F;  2CW7 A;  3IAS 2;  4BJT A;  1M90 1;  3BG1 B;  3NH4 A;  1VQL Z;  1MW7 A;  4JQF A;  2M48 A;  3HC7 A;  2ZAE B;  4E7I A;  3M4O I;  3OYM A;  2XAU A;  1JJ2 Z;  3J81 b;  3AKZ A;  5KNL A;  1KQS Z;  2VJI A;  2IS4 A;  1VQ7 Z;  4EAT A;  1BOB A;  1TFI A;  2F4O A;  3F9K A;  4BQN A;  2ZXH A;  3IUO A;  5KHD A;  3FKI I;  3KEY A;  2JUB A;  2IGM A;  2WA0 A;  1Z02 A;  4RVF A;  4CUG A;  5FLX b;  2KI7 B;  2VXZ A;  2OOX B;  4DQY B;  3OS0 A;  4PJJ A;  1X1C A;  4H4K C;  4XLE A;  2OOY B;  1VQ8 Z;  2IZ3 A;  1Y6I A;  3S3O A;  1M1K 1;  4RLF A;  2BW3 B;  4XQF A;  1YJN Z;  3OIQ A;  4FAS D;  4E7H A;  2Y0S A;  2JMO A;  2JA6 I;  2Z16 A;  3GCF A;  2Q4Z A;  3LL7 A;  3LSG A;  3J7A 4;  3S1M I;  4KJZ A;  2CH0 A;  3CCV Z;  4NB8 A;  4IZZ A;  2OTL 1;  3MKW B;  2DXI A;  2R7Q A;  2MAB A;  3RCO A;  1ERD A;  3CME Z;  2L9N A;  3FQM A;  5HNH A;  2QA4 1;  4IX7 A;  2ZSH B;  3K70 C;  2XSJ C;  4XOT A;  4BE2 A;  5HOO A;  2LG4 A;  3U50 C;  3S1R I;  3QOE A;  1JWH C;  2CUJ A;  2WB1 A;  2IS6 A;  2AKL A;  2VJ4 A;  2PJR B;  5KCM A;  4NB9 A;  4QTU A;  3IAM 2;  4XKW A;  3H5R A;  4XKB A;  4B48 A;  4IQ4 A;  2DT7 B;  2IGN A;  4D1Q A;  2GU2 A;  4CL1 A;  3J80 f;  3CCQ 1;  2JSP A;  4BL0 B;  1VQ5 1;  2NOJ B;  2QKL B;  4Y33 A;  3DEE A;  4HST A;  3G6E 1;  3CPW Z;  1Y1W I;  1Q86 1;  3OYG A;  4NBB A;  4F52 A;  2VQG A;  4NC7 A;  4YEJ A;  3G71 Z;  3K4B A;  3E0J B;  2HVS A;  4E32 A;  3K4M A;  4C2U A;  4CCK A;  1R6R A;  2L9S A;  3W2A A;  3DPT A;  1DP3 A;  3DLA A;  3TMO A;  1N75 A;  1Q81 1;  3A1Y A;  3OR1 C;  4CSW A;  3OS1 A;  1EA3 A;  3BC8 A;  1LQL A;  1X1A A;  4P5O A;  2ZFU A;  1S72 1;  4CCM A;  1QVF Y;  1K83 I;  4RLQ A;  3H5A A;  1Y56 A;  1P9Q C;  2L2O A;  1NJI 1;  4ZDP A;  3K10 A;  3K4J A;  3OWT A;  3ZCO A;  1K9M 2;  3OIP A;  2R7V A;  2QR1 B;  4KIS A;  4XX2 A;  3CCU 1;  4NBA A;  3IFU A;  3CCR Z;  3OW2 Y;  2HPI A;  2B63 I;  1GLN A;  4A93 I;  1AA7 A;  1MMG A;  1I6H I;  3L2R A;  3CCE Z;  1JJ2 Y;  1KQS Y;  4AYB A;  3VWB A;  3ZGK A;  2E5Z A;  2WAF A;  3OYE A;  1VQ9 1;  3CCM 1;  1Z3Y A;  1V5F A;  3BG6 A;  5CKT A;  4RV9 A;  1YHQ Z;  3CMA 1;  5D1O A;  3KYL A;  1YJ9 Z;  3HOW I;  4BJ5 C;  4NBH A;  3LSM A;  4RS4 A;  2W82 A;  3CC7 1;  2JA8 I;  3DU6 A;  3K4L A;  1USP B;  3J80 b;  1DGR M;  2KHM A;  2V8I A;  2BVM A;  1K73 1;  2CUZ A;  3H9G A;  2OZK A;  3F3P C;  5D1P A;  4EWC A;  3UNG C;  2IZ4 A;  5FLX f;  3DPL C;  3ONQ A;  3MON A;  4BE0 A;  4A3B I;  3VTN A;  1Q7Y 2;  4BBS I;  2K9L A;  2LY2 A;  3K4K A;  3CMA Z;  1KD1 1;  4E2Y A;  4IKF A;  4GRI A;  5IP7 I;  2P28 A;  2WAQ A;  2VUM I;  1YX3 A;  2A6T A;  2VL8 A;  1TWF I;  4XNF A;  4CCL A;  3M3Y I;  4HGY A;  1OLT A;  3HOX I;  4B3X A;  4BS9 A;  4XLC A;  3OS2 A;  1VQ4 1;  2W04 A;  3VSL A;  2JUG A;  3UR3 C;  4QPQ A;  3L2U A;  2DE7 A;  3OYN A;  1J09 A;  2Z2S B;  1VQL 1;  4DIQ A;  3RPU D;  2WBM A;  1QF8 A;  1VQK 1;  3F3F C;  3CPW Y;  3CCS Z;  2M7B A;  3S14 I;  1QHG A;  1VQ7 1;  4G6T B;  4MON A;  1KC8 1;  2VKH A;  1YJ9 1;  3CCL Z;  3GTP I;  1FMW A;  4CH7 A;  4N4N B;  4E33 A;  2KP6 A;  1MMD A;  4BJ6 C;  4J00 A;  5CPR B;  3MZK B;  3OYH A;  2P3Y A;  3OYB A;  4HPQ A;  4IQJ A;  1VQ8 1;  2GOM A;  2IGK A;  1UG0 A;  3OR2 C;  4F92 B;  1TWH I;  2XDV A;  3SZG A;  3CZ6 A;  2VIX A;  4Y3O A;  5IT9 b;  1D0X A;  1Z3X A;  1VQO Z;  5HLT A;  2R7R A;  2HPM A;  1D1B A;  1RO2 A;  1G59 A;  2XF6 A;  3GBG A;  3OYK A;  2LYC A;  1X0T A;  1SFK A;  2K3R A;  1SFO I;  2E2J I;  2R7S A;  3S15 I;  1WJD A;  2LBF A;  3CCV 1;  3CJR B;  3MKZ A;  2LY1 A;  2MFZ A;  2CS3 A;  3CME 1;  2HQA A;  2RBL A;  3EUK L;  3OL4 A;  1K6Y A;  2A5W A;  1U0J A;  3S2D I;  2X6Y A;  2BVL A;  2RHB A;  3HOZ I;  1HA8 A;  3JAM b;  3S1Q I;  2KRH A;  4HSR A;  1N8R 1;  2V9K A;  5FRM A;  3OYD A;  3BCB A;  4J01 A;  1YIT Z;  4LIU A;  1ZB9 A;  1Q86 2;  5CQE A;  2K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...