2HU9A

X-ray structure of the archaeoglobus fulgidus copz n-terminal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRVTEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of a Zn2+ and [2Fe-2S]-containing copper chaperone from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Metal transport
molecule keywords Mercuric transport protein periplasmic component
total genus 43
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18423 zf_CopZ Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hu9A02
2.20.25.270 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2hu9A01
4E6KG 1Y56A 2HU9A
chains in the Genus database with same CATH superfamily
3E3VA 3FBNB 1ERDA 4YEJA 1DGRM 3FK6A 3S3MA 1LPQA 3NH8A 1S7MA 3A0BC 1IN5A 2OCCH 2MA3A 1TC3C 1IO2A 4A6DA 1I6HI 2DDAA 4AYBA 3MVPA 3GTGJ 3ELKA 2JA8I 3BR6A 2V79A 2DLLA 2LG4A 3LSTA 2O8KA 3S15I 4Y3OA 2M2EA 4BYYA 3AG2H 1ZGAA 3CP8A 2DT6A 1R36A 2K3RA 4JOMA 3TBIA 1W36C 3KZIC 4UB6C 3ZQQA 1KU7A 2IRFG 3FWEA 3R0AA 3IAS2 3AKZA 1HW2A 2DOFA 4F93B 3PIPF 1ENHA 1VQN1 3JR9A 2ELHA 4IOCF 5IT9K 1RKWA 1ETXA 3DCFA 5HLHA 5LHIA 2L0KA 1E0EA 3EUAA 1U6GA 2DDBA 3M9AA 2DMUA 4FISA 2X6YA 4QPOA 4HF0A 3W3CA 5B3SH 2QYOA 1VQ9I 3CF5F 1R71A 2IGMA 2JIMA 2CUZA 1MJ9A 4KMFA 3BWGA 3D6WA 1Q821 5M5YJ 3Q87A 1YG2A 5KCMA 1B9MA 1OR7A 3RJPA 4XICA 3SQNA 4CZCA 1H88C 3CCMI 1K83I 1LQ1A 2OOYB 4CCJA 5GAEJ 1A04A 3AG1H 5FRNA 2OZUA 2GTHA 3H0GI 2A68F 2MYSA 2CGPA 2JMOA 1KD11 2BJOA 4Y52I 3VPRA 4ASNA 2HKXA 1XMAA 3VSLA 3J80b 2QENA 2XKOA 2CO5A 3DKXA 4HA8A 1OMIA 5DUKA 4CZZA 4NUBA 3HPHA 3FKII 5EGOA 2JRMA 2WA0A 3BJAA 3PO3I 2XB5A 1FSHA 5JVTA 3S2DI 1VQOI 2JUCA 2IZ3A 5ED4A 2KIMA 2JVGA 3IHUA 3ESWA 1VQ41 3TP0A 3BP8A 4LK1F 2K86A 2V1NA 5DV5A 2ESHA 4DK1A 1B6AA 1T56A 3S2WA 1KYZA 2JUGA 2NVTJ 3KLNA 4KITB 3LAPA 4XKWA 2QREB 3HKZA 3ABLH 1R1TA 4I09A 3CC7I 2FA5A 1R23A 3WGHA 3PNTA 2LF7A 2QQAA 1QVGY 3O3KA 3L2WA 2OC6A 1QVFZ 2E2JI 4M6YA 1K78A 2M0CA 4G8XA 1QPMA 2QGUA 1Z67A 3LSHA 2GXAA 2XGDA 3QPTA 2MW8A 2GBYA 3HL2A 2CW8A 3CUQC 1USPB 2LY9A 3E1SA 3K2ZA 1YIJI 2YUSA 3ABMH 4B1RA 2MD5A 2JA5I 3GTMS 2QSFX 4YIRX 3HPGA 2FEZA 1IRXA 1XGOA 2VIXA 3CCVZ 2FMLA 3GTKJ 5EGOB 3HTUA 1PFTA 1Q1VA 2JN6A 2QA41 1Q822 2QF7A 4N4OB 4PUSA 4RB1A 3TDUC 4DIQA 1FIAA 1D8JA 2FE3A 1FOYA 1MBGA 1K8A2 3AAFA 1YJW1 4H4KC 2KLOA 4BHCA 3H9JA 4OIQF 1MKMA 5DCMA 3QYFA 2LP0A 1UJ8A 1FDOA 2V26A 2DI3A 2D1VA 5EZGA 3CCE1 2NVUB 2ZSIB 1WJCA 1JTYA 1I3AA 2FNPA 3RKQA 3WGGA 5BPDA 1YQAA 2HTJA 1HBXG 2DA6A 1ZAOA 1BN5A 3DBRB 2RAEA 1ON1A 4XLFA 2VKDA 2ISZA 2VQCA 3LWFA 1VQ4Z 1KQ9A 3UR3C 2QZ8A 2DA4A 1IN6A 2NVYJ 3RKXA 3WTWC 3HDDA 2NVQI 2R4GA 3G3ZA 2HF1A 5JLWA 1XDSA 2L3DA 3S14I 4F55A 1ZQ3P 3DWLE 2W84A 3BDDA 1NH3A 2XROA 1RNIA 1Z7LA 1R6RA 4PFOA 2RV8A 3CXCZ 1W5SA 3IH4A 2R3SA 3GLLA 2QQ9A 1VQ71 3F3FC 5E1XA 1WSUA 5TGTA 1O4XA 2QEX1 4IHTA 3GTLI 4PFPA 3M3YJ 1OQYA 2WTEA 1Z0XA 3E7LA 1WJAA 2XF7A 1WJFA 4R8HA 4BBRI 1IXCA 5H2FC 4KJZA 1I5ZA 1R00A 2K85A 3B6CA 1QGPA 1GUUA 5FGMA 3FKJA 2P0WA 1N75A 2MG4A 2Z9OA 4A3II 3QOPA 5IT3A 4G94A 2ZFUA 1TQPA 2X6OA 3IF8A 3BPXA 4DOZA 5LEKA 1YOVB 3V8JA 3LA7A 2VUMJ 2EBIA 3VFZA 5BQTA 1K61A 2DA1A 2KJBA 3OOUA 1FDIA 3H0DA 3HB9A 2NS0A 3GBGA 1L0OC 2PI0A 3FXKA 2ZKZA 4RGRA 1K4SA 1T98A 4HPQA 1EH6A 1YE9A 3LMMA 3OW2Z 5B1AH 2HDDA 1ZRDA 2R7ZJ 4JQFA 3HOSA 5E17F 4A93I 1VQ7Z 3KP3A 4HZFA 1MGTA 2R7WA 1EH7A 1DP3A 2FU4A 4XN3A 2JIRA 5D1OB 2CQQA 5CKTA 1YJ9Z 3ZOBA 4NBBA 2GOXB 2M5WA 4NBAA 4Y17A 2JUBA 3I3LA 2FNAA 1D0ZA 3CCQZ 4NBGA 1OYWA 2OTL1 2Y0SA 1B72B 1VI0A 2VPZA 2NS8A 4P9FA 4ZDLA 5M5WJ 3HGYA 4F7ZA 2A5YB 2JA6J 2KMUA 4XONA 4NBEA 4YG2F 1KU3A 3L09A 2MLGA 2PJRA 3K4KA 4Q5SF 1SANA 3W6VA 5JLXA 2CJJA 5HVQC 5FLVA 1D8KA 4V2GA 1S72I 4U0YA 4MQVA 3BZ6A 1TWFJ 3RPUD 4QTUA 2EJRA 4IHXA 4CICA 1DPUA 3VMHA 3VYSB 4BUPA 4MD7A 1HCRA 3GZ6A 2G7UA 1B59A 3FHNA 4ESBA 3KLOA 3GUDA 4A3FJ 2Y9ZA 2EK5A 4L0ZB 3K70D 1GLNA 2BYVE 3K70C 3GTPJ 4E2XA 2FMYA 4A6EA 4RBOA 1X1CA 2DA2A 2F4IA 1X4PA 1UHWA 1IRZA 1WCMI 4B4CA 2D5VA 3L2QA 3CMMA 2BW3B 2MABA 1VQMI 2DE7A 1VQL1 2JPCA 3MZHA 3C3WA 4PJJA 1BJZA 4ESJA 4EJUA 3TW6A 5JR3A 4BNCA 4DNCA 1D0XA 4HNTA 4KICA 5FLXb 1PUFA 2KIFA 5ICCA 3KCCA 1Y1VJ 3KYDB 3F21A 1I3QJ 2LSOA 2DFFA 3JW4A 3EDPA 4MNUA 3HYIA 3LA2A 2H6CA 3TDZC 4IHSA 4GGGA 4XRFA 4M3GA 1RRJA 3BOQA 4EEFG 1ZGJA 4RLFA 4ZYGA 2XIGA 4KYWA 1J9IA 1XSDA 4IZZA 1H8AC 4II3A 2E35A 4B3AA 1T08B 2P4WA 5LD2C 3IKVA 5B1BH 1BOBA 1HF0A 1M902 1HKTA 1Z21A 4BY1I 1X19A 3CDHA 5FLMJ 3ZQLA 2PJPA 3M4OI 5LBQA 1D5VA 3NH4A 3FXRA 4V2FA 4XKBA 1E3OC 4GO1A 3F8BA 3DLAA 3GTJI 1HW1A 1W7PD 1IN7A 4DW6A 3QPHA 1IW7F 4UXNA 2I5UA 1QPIA 1R5HA 1XG1A 3CCUI 4A3EI 3TOBA 2E1MB 3I4PA 2W48A 4DYRA 1PYVA 2COMA 3OYNA 1AA7A 1TTYA 2LOOA 1Q812 3RQIA 5L3GA 1J59A 3PSIA 1O7FA 1BI1A 5KHDA 1YO5C 1P6RA 2OAZA 2L9RA 1Z77A 3G6EI 4BQOA 1MSFC 3HOWJ 4CA0A 2JWTA 2K9MA 3GFMA 4Q48A 3NAUA 5TJJA 3DFGA 1Q16A 2CSOA 3DLLF 2DJIA 4D7NA 1XMKA 5L3DA 3I56Z 3I59B 3S1MI 4GYGA 4IHVA 4G7OF 3EERA 2DW4A 5IYDJ 4BY7I 4M9ZA 2HYGD 3S1QJ 1X1PA 2JVHA 1YJN1 2AO9A 2IGNA 2FF4A 2DAOA 2BY2A 1ETKA 2Q8KA 2OZ6A 2YR2A 3HGGA 3K4NA 1JUMA 1TWGJ 3OL4A 5ILSA 2QBYB 4E30A 4IEJA 1VQ5Z 2JSCA 4ENMA 1W0UA 4A3BJ 2GZWA 3GTJJ 1IV6A 2H6BA 4EVIA 4C30A 3JRFA 2QWWA 1RESA 1Y8RB 3OSFA 2XPUA 3BG9A 4IRGA 3VYUB 2E1MC 2JA7I 3OIQA 2XASA 2F2EA 3IWFA 2COBA 1YHQ1 4M73A 4BEHA 1FC3A 1O3RA 2X6WA 5FJ8J 1UG2A 3ERMA 3ZQFA 3FM5A 3C18A 1IG7A 4E31A 1YIJ1 4I99C 3QWLA 4A3MI 3JRIA 4A69C 1OCTC 3D1NI 4OIOF 2WY7Q 4IRIA 4Z2YA 2PK7A 1C0WA 3K0LA 4CCMA 3LNQA 4FTHA 2AS5F 2H27A 5IOZA 4LB6B 2Z16A 3ZN1A 1P4AA 1WHUA 2JPBA 2J5OA 2CUEA 1Y1VI 3NWSA 4IXAA 3DPTA 3KP5A 1HKQA 3CMAI 1YRNA 3CC71 4A3LJ 4JYKA 3S16I 1OPCA 1RR7A 3HXLA 5H6RA 4BJTA 2BHZA 2H85A 4G6DA 2P6TA 5K5RA 1P9NA 5CPRB 4HSRA 3MONA 5EDNA 3CDIA 4RGSA 2DOAA 1GDTA 1VQPI 4RDUA 3QWUA 5ILUA 2XSDC 3ZQHA 2EIKH 4PSWA 2IS2A 2HWVA 2K7LA 5C44J 1LB2A 3VMIA 3FMRA 1TQMA 3VWBA 2HOSA 4H0EA 4MEXF 3RPUA 4ZH4F 5C4XJ 3G4SZ 2P28A 1ZRCA 1HDPA 5BS6A 5FKMA 1J09A 2JJ7A 3GEZA 4E32A 3IRQA 4CO8A 1Q861 1YS7A 1YIOA 3KYLA 2BEOA 4AYBN 1E3PA 4XKVA 3W2AA 2RDPA 4UHTA 1W36D 1AOYA 2ZJ2A 2O6GE 5CM2M 1MMNA 1MZBA 1R1VA 2JT1A 4CDGA 4ENKA 1LEAA 2KKOA 2R7TA 1W5TA 5HODA 3HRSA 2X6XA 1G8XA 5E18F 5CQEA 2MC3A 4HNVA 4KIFA 2VPLA 3QAHA 2CH0A 4OAZA 3CJTB 5E8GA 3J7A4 2P81A 1OCRH 2LY1A 3MEXA 3BROA 5CVRA 2RHBA 1U0JA 3I55Z 3WTYC 3BR2A 4LD5A 1IZ1A 4MO7A 5HS7A 1YHQZ 2M34A 1VQ8Z 2HXOA 1JJ8C 1MBJA 3K69A 4J19A 2GLOA 4AIDA 3CMEZ 2LIYA 4NQWA 2X4HA 1YITI 1AKHA 2HDCA 2OBPA 4RB0A 1QHHD 4ESFA 4CCKA 2VUGA 1IN4A 1S8NA 2L7ZA 2YX7A 4BKXA 3F22A 3BQZA 1FLIA 1PP7U 4B8XA 4HSTA 5AIQA 1B8IA 2ESNA 1TWHJ 4A0YA 3ECHA 2E5ZA 1QVGZ 4N9HA 3JRHA 1ZHFA 3ZQCA 4MRIA 2E5NA 3S93A 2BW3A 3GCFA 2E60A 4HDVA 1K6OA 1FX7A 5E1WA 3CQZJ 1X2NA 1Z9CA 4G12A 1YHQI 3I59A 2F6CA 5IP6A 2H1KA 3K4JA 4A3MJ 5JHFA 2YS9A 4Y33A 4A2UA 4MHGA 1W0TA 4KA4A 2F5DA 5DCMB 1JT6A 1U5TA 2XGXA 2F4MA 3CCJ1 1YUKA 2KISA 4HH4A 4MFEA 1H9GA 2W03A 1KC82 3P5JB 2VF1A 4LMYA 3ASNH 3QP5A 2V4JC 1RUOA 1Y56A 2E2HJ 3LSJA 5DD8A 5BOXA 1SIWA 1OYIA 2UUZA 5HLTA 3L00A 1B4AA 2PMZA 1ZH5A 1N25A 3DQVC 1SD5A 5L3BA 3D5RC 2W24A 4F92B 2W57A 2XAGA 3S1QI 1UELB 4M3BA 5HS9A 2RQPA 4NBCA 1JUPA 2MBFA 1YIT1 1YS6A 1X1AA 3MZYA 2HQNA 1SD4A 2VXDA 5FD6A 1UB9A 1ZG1A 3F6VA 1H0MA 2KRHA 2C6YA 3CD6I 2BE5F 1P7JA 3CCU1 5LL6f 1R5GA 1VQPZ 2CW0F 3NWTA 2ACJA 1TW2A 1FWZA 3L2UA 2CS3A 2RNJA 4TV7A 3P7NA 4BXFA 3SDGA 1V5GA 1Z02A 1JJ2Z 2JQ7A 4EJOA 3MKYB 1ZELA 5FKKA 3ONQA 4E7ZA 3G4S1 3CCS1 1RZ4A 4UNOA 3QYEA 4XLNF 1Z3YA 5J1UA 2XPWA 3CCSZ 1SFOI 1ULYA 2CRGA 2L9VA 3SZPA 3JREA 4AUXA 5JFRA 5DUIA 5K1YA 3IL2A 2LRDA 4FT8A 1MJAA 2W82A 4KIGA 4JX6A 3CCVI 2IZ4A 3WU1B 2HZDA 2Q1ZB 1T95A 2W25A 1BW5A 1FOWA 4EM2A 1P4XA 2P5LC 3S17I 2VBZA 2HQRA 5DS9A 2AKLA 5K5OA 4M3FA 4NC8A 4XRMA 3HSFA 3J81f 3GMEA 2DTRA 1IDZA 2ECBA 5FLXK 2VJIA 4MTDA 2W00A 4N0BA 5M3FJ 5D5UB 2ISYA 2LKXA 1OLTA 5CYVA 4DBRA 4BQQA 5IP9I 3OMYA 1MNEA 3WHCA 2RPRA 3S3NA 3F9KA 2I10A 2EA4A 1BI2A 2OPTA 3I56I 3LAJA 1X2MA 1SAUA 2AYDA 5E1ZB 3RYPA 3WG7H 4IHYA 4NB9A 3CME1 3I58A 2E19A 2GXGA 4HV5A 1S721 3EQLF 3V7SA 2KI7B 3PO3S 3MMYB 1XGSA 3FBIB 3HG9A 1TWFI 2JTVA 1AWCA 1YW8A 5J4YA 3BPVA 4D0PA 1Y1WI 2R7FA 4PCQA 1HLVA 1QU3A 4D5FA 5FROA 2DA7A 1FP1D 4M3EA 3REOA 3Q0WA 4QTRA 4FASD 1K9M2 3NARA 3ECOA 5HNHA 1Z05A 3EETA 3LOCA 5E8IA 2HEOA 5J8CA 1ZRFA 3MQ0A 1WH7A 3IKTA 4DGLA 3HRUA 4HX7A 1ZG5A 3TO6A 2VQLA 1V55H 4X1EA 1MDMA 3DPUA 3CUQA 4RA2A 2VPRA 1YI2I 2GIVA 3L2VA 1G6NA 3KYCB 4A93J 3ABTA 4UUVA 2EZKA 3I561 3OOPA 5K7FA 3G1OA 2ZBKA 2ADUA 1JJ2Y 6PAXA 2VBXA 5T64A 4XOPA 3J80f 1XDUA 2QVOA 2F5CA 1CF7A 1NHAA 3OYGA 1LDKB 1FTZA 1VQMZ 4QTTA 2XF5A 2A6HF 3H35A 2PM9A 4LB5A 3G1MA 1BBYA 3CC41 2M7BA 1DUXC 2PQ8A 5M3MJ 2PG4A 5C4JJ 4BHPA 1KC81 2PMUA 4ZTFA 3E5QA 2QEXI 4M71A 2LTPA 3CPWY 1XTAA 3D0SA 1VQ6Z 3JSPA 4L5IA 1KA8A 2VPWA 3BQYA 3GFIA 1FPQA 4LFUA 4CH7A 3GTLJ 2PEXA 5DTDA 3FMSA 2BXZA 2QSHX 3HUGB 3GKQA 1JXSA 4D7MA 4BDYA 3H1CA 4RAYA 3R4KA 1OCCH 2QQBA 4B43A 1SVMA 5IP9J 2KDOA 4CSWA 3CPWZ 2IP2A 2EZLA 2J5PA 3HUGA 2LBFB 3G4SI 3I4MJ 1LEBA 1BC7C 1IDYA 3WTSC 1N78A 1Y0NA 3CTAA 3GFLA 3IH3A 4GDFA 4RVGA 2GXBA 4FHTA 4BBSI 1V5EA 4JBAA 1L1OC 2VQGA 4PJ0C 2L4AA 5D5VB 1WQ2A 1WGXA 3K4MA 3M1EA 4OINF 4EJVA 2YADA 3BG0B 1FJLA 1HSJA 3G2BA 5A2QK 2IPQX 2CUJA 2NAPA 2D45A 1DL6A 2ZMEA 1QQIA 2FOWA 4XL9A 4BJ6C 1VFCA 2BY0A 4GCVA 2XGEA 1K78B 3CJRB 2L9NA 1T6SA 4OAYA 4EM1A 4O5VA 2JA2A 3HOYI 3IC7A 1KYWA 3C2BA 4WF2A 1VNDA 2STWA 3I0TA 1R7JA 1FYKA 1SFUA 2FQ4A 3A02A 3W2VA 3W2WA 5ILVA 2RN7A 1AKHB 2XV4S 2EIJH 2IW5A 4S0HB 2FJ1A 4F52A 4LLLA 3B02A 2DPDA 1NK2P 3MZKB 3CCLI 1A35A 1ZK8A 2OQGA 2YSRA 4JX4A 1Y1VS 2VT2A 3WTUC 1MNMC 3QPSA 4WX9A 4OMZA 5J1RA 3FQQA 1SFXA 4L9TA 2WWYA 1KRLA 1F1ZA 3BJOA 3CC2Z 5LFAA 5LRRA 4CUGA 5FRMA 2DT5A 3CP2A 2V9KA 1XGMA 1IGNA 1N77A 1KQSY 2CV0A 2X9DA 2HZTA 1X4OA 2NS7A 2E2JJ 4JX5A 4ITVA 3BR0A 2ECCA 1SFEA 1XPXA 1S7AA 3DBLB 3K4CA 4X6AJ 2UV1A 1JT0A 3BLYA 4YRVA 1VQ4I 2NVTI 1ACIA 3B73A 4FE4A 4PJLA 2M87A 3M07A 1G3SA 1V3FA 2QLVB 3QODA 1F9NA 3OWTA 4UVCA 2X1DA 2VN2A 5D6FA 2DODA 2O8XA 4E7SA 3OYJA 1WRJA 1M1K2 4KT6A 2XKPA 1K8A1 4E7HA 2E7WA 1EH8A 3B6AA 3S2DJ 2JK3A 4AVPA 2ID3A 2M4GA 2QEXZ 2BVLA 1FP2A 5IOYA 3FISA 2R93J 2Z3YA 1SD7A 4PJNA 4CHUA 2DU9A 2Z1DA 1IF1A 3CCJZ 4C9YA 4IHWA 5LHHA 1VF9A 4WWCA 1RPWA 1A6IA 4C2MJ 4EMSA 1RO2A 5HDGA 3Q0UA 4L18B 2EZHA 4XKCA 2V9PA 5FLMI 2Z5UA 1R9TI 2RQQA 3CCEZ 1VQ91 1I27A 1Q811 3MAJA 4Z6YA 3HTSB 3CD61 2HFHA 3ZP5A 2ZFWA 1YW7A 1MBFA 1H89C 2G0EA 2KFDA 2NXNB 2EQRA 2ZCWA 3J7AO 3PNYA 3GYHX 2P7CB 1WI3A 1YI2Z 1TQIA 1ZLJA 3DP7A 2E71A 1WW9A 4HQMA 1A36A 3FK7A 3SDBA 3TO7A 3DBHB 2I8DA 1GXQA 1Z3XA 5F1RA 2OD5A 1ZB8A 2O4HA 4XLHA 2IS1A 2HOTA 2D2WA 1Q1HA 2DMNA 3K6GA 4UUSB 2QBYA 4G6QA 2F4OA 3VODA 2O9LA 1MMDA 4S1TA 3FXQA 1Y1WJ 2XAFA 2LFUA 3KFWX 4ZZLA 2VQHA 4XIDA 3J80Z 3NQOA 2DJNA 1XCBA 1WCMJ 1OCPA 1NP6A 2HXIA 3OYKA 4HBLA 3CCJI 2LR8A 1B8IB 1IN8A 3CCQ1 1ZG3A 2IAIA 5E3LA 4L9JA 3SEQA 2GTIA 1NTCA 2R7XA 1U5TC 4D1QA 1Z91A 4XM3A 3BR3A 2XDVA 2ZXJA 3WHBA 3OY9A 1LVKA 3QRFF 2A61A 2V1XA 4U0VA 5C4XI 3CCL1 5ICGA 3KX2A 2K5RA 1AU7A 2QKMB 5C44I 1MW7A 3R61A 2HPIA 4NC6A 2Y2ZA 1KZHA 4BU2A 2E7XA 5A2Qf 3F3PC 1VTNC 1JJ6C 4WXHA 2V6EA 3CCQI 2VKHA 3V4GA 4ENNA 1A5JA 3DKWA 2W4SA 1FIPA 1G3TA 4AWXB 3EYYA 4W97A 2VPXA 1LDJA 1N8R2 1Y8QB 3PQJA 3MN2A 2Q4ZA 3PIOF 2LKSA 2XB0X 4OMYA 1FMWA 3U9GA 2EINH 5GP9A 1XSVA 3MCZA 1U8RA 4HF2A 2STTA 3I71A 2MFZA 3TOAA 1VQO1 3JTGA 4EGZA 2K9NA 3BTIA 5HOOA 5GPAA 2OJED 1RIOH 3OYFA 3ZCOA 5FFZA 4NBDA 5BNGA 2VXZA 1R5ID 2WAEA 4DGWB 2L9SA 2ID6A 1JKRC 3DTIA 1K79A 2GOMA 1IC8A 1P4WA 2FOKA 4S05A 2VUMI 1B1BA 1VZ0A 1Y6IA 3CCRZ 3S32A 1XSXA 4WXDA 3NFZA 1K7AA 1A6QA 3ESWB 2DA5A 1PJRA 1FMVA 4P1WA 4NFRA 4FE7A 4P55A 4NQWB 1SVOA 4I7HA 1BIAA 2W1OA 3OR2C 4RAGA 4WXCA 5EEGA 2HPMA 3FXOA 3ZQGA 1E3HA 2IS6A 4NB5A 5JVGF 1LE8B 4GFBA 3IUOA 4IF4A 1FBUA 1LKXA 3IP4B 3CO7C 2HDWA 2BHYA 4HAMA 4I6ZA 3HSEA 3IAM2 3QP6A 5H6QA 5IYBJ 1HQCA 4X6AI 2P3YA 3EPZA 2DPUA 2WAQA 3IFUA 4XQFA 4U7BA 2IEKA 5GADJ 1LFPA 4G9YA 4R79A 1MMSA 2K9SA 1B72A 1LVAA 5F0FA 1QRYA 2DQLA 3KEYA 5LLQA 2HQ5A 4BJ5C 4MTEA 3HOUJ 2KZGA 3M4OJ 2RBLA 4LK0F 4OOIA 2KRFA 3JCUC 4KISA 4E7IA 4XORA 5BPIA 2W7NA 1QA6A 2F5EA 3ABKH 3ROUA 1GV2A 1T0FC 2P8TA 3CJQB 3ZMUA 1Q7Y1 1ZB9A 1ZR4A 4LGWA 3V8KA 2QRDB 1LQLA 1HOMA 3LFKA 1K731 2DA3A 2IA0A 2V6CA 3DU5A 1BA5A 1E2XA 1I50J 5K7ZA 3E5XA 1IV8A 3KEOA 3CCRI 1REPC 4E2WA 3CF2A 2X48A 2FBIA 3HOYJ 1FYMA 1O3QA 2M1BA 3J80K 1YRNB 3RDIA 1TWHI 4RGUA 1ZH1A 3SZGA 4L5EA 3JAMZ 3JTHA 2NOGA 3OYBA 2R6MA 3NEUA 2MGQA 1LJ9A 2VL8A 1CQTA 1DP7P 2R7VA 3J7ZI 5IT9Z 2CV1A 2ZXHA 2R7SA 1S7OA 3GTPI 3H5NA 4ZDOA 3K4LA 3PL8A 3CMEI 2UWMA 4U0WA 2FBKA 5FKLA 1Y39A 4RM2A 2IXSA 3CXCY 1I1GA 3IV5A 2VJJA 1FNNA 4RM3A 3CMYA 3QPLA 1WJ5A 3ZQIA 3AG4H 1WJ2A 3K1PA 4CCNA 4L9NA 3OYIA 4CCLA 1ZYRF 1BR4A 2YPRA 3H36A 2OQRA 2JSPA 4A3CI 2XAQA 4UV8A 2TCTA 1U2WA 3CDLA 3RKWA 2P5KA 5E3NA 4ZDPA 3DXJF 3HRTA 2OTJZ 4RVHA 1UAAA 2JIQA 3H92A 4HQEA 1RETA 1B9NA 3K9TA 5T6BA 2K9LA 2LF8A 4E7JA 2WB1N 1YX5A 5C4JI 2DE5A 3OSGA 2DYSH 5GAGJ 4HEA2 3FXMA 4KNYA 3FKIJ 4OU0A 2K27A 2A05A 4BH9A 2OTJI 4O3MA 1LDDA 1Q7Y2 2ZXWH 4B47A 2JRTA 4EM0B 2KL4A 2B7EA 2VI6A 4QIWN 5EYRA 1EJ9A 3S16J 1YJ91 2JA6I 3BG7A 5D4SA 3QU3A 3WU2C 4HDUA 1WFXA 1WI9A 3BZKA 1RO0A 4BL0B 3NDIA 3CMAZ 4PGGA 1RR8C 3TE5B 3D2LA 5D5WB 4RMNA 5E3MA 2ZJRF 1MBKA 1MIJA 4YIFA 3KIFA 4S04A 2HKOA 2G7HA 3FHZA 4ZYAA 3F72A 3FF5A 4A3IJ 1HSTA 1W2BZ 1LUJB 2R5ZB 3EEDA 1YI21 1U5TB 3OV8A 3F8FA 2O53A 4BBRJ 1R58A 1TT0A 2BOLA 4CXFA 5HLGA 3CCEI 5H20A 1T2KA 1BOAA 3VSKA 2QR1B 5CVVA 3CC21 3OIOA 4HF1A 2V8JA 2MH9A 1WJDA 1T38A 2DK8A 2OTLI 2QRCB 4I02A 1W2BY 2EV6A 2R93I 3O2PE 4RLQA 4PJMA 2ZMEC 3U21A 1FY7A 2K02A 5DM6F 4RB2C 1PUEE 1DPRA 3KIHA 3D5LA 3S1MJ 5J1YA 4LG0A 3FXUA 1NK3P 1AA6A 5GTIC 1TBXA 2Y48A 2M3AA 3F6OA 2VJ4A 4BXUA 3TMOA 1KQ0A 1XB4A 2J6AA 2LMDA 4XLPF 3I07A 3M3YI 1QVUA 2H09A 2PBIA 1TT5B 2M7AA 5FB2A 1W4MA 3WGIA 2YX4A 5FFXA 1HW5A 3O8HA 3N05A 4XR6A 4AVZA 4PK4A 3ZMVA 4A3EJ 3RPQA 4MGRA 1TWCI 3D9XA 1IAWA 3HZJA 5CVUA 1APLC 4AM3A 1IUFA 1VQK1 2GA1A 2VODA 2CU7A 1IJWC 2V1DA 4BAYA 4A5NA 2NVQJ 4IRHA 1N2FA 4CCOA 2NVYI 1IUYA 3AFHA 2I3CA 3BTJA 2Z2SB 1MBHA 3I64A 1J0RA 3SZTA 4QSHA 1U9OA 2VKEA 3D5SC 4BY1J 3KP7A 4G6TB 3CO6C 1YJWZ 3GTKI 4E33A 3WODF 2Y31A 3S17J 2M8GX 3FX3A 3NRVA 3G71Z 2R7QA 2EFNA 4V19K 1NUIA 3PJRA 3LSGA 4A3JJ 2P6SA 3Q9VA 4UVBA 2TRTA 2WADA 1FZPB 2DN0A 3BG1B 1YX3A 2JA5J 3PO2J 4K2EA 3H3VJ 2FXAA 1R22A 4HW0A 3DF8A 2VKVA 3U1DA 3J81Z 5J40A 3CCV1 2M30A 4L5JA 1X0TA 5TISC 3GFJA 3TQNA 3M8JA 2WV0A 3LSMA 1JKQC 3VDXA 5IY5H 1DGWY 2O5RA 2E1NA 1FOKA 1Z6TA 3GVAA 2LH9A 1KGSA 2XHKA 3HKZN 4UUSA 1H9TA 2V1UA 3C1DA 4NBFA 2GA2A 1MMAA 1VQ51 4Y15A 2K9QA 3S8PA 1D1CA 4B44A 1VQ8I 4Y13A 3DKYA 4HYEA 3K10A 4QPQA 2ME6A 1V54H 4AIKA 3I4MI 1RO4A 5TRDA 3UKGA 3BC8A 1SMTA 4BEHB 1JHHA 3DEUA 1PVEA 3H3VK 3FDYA 4HLXA 1BL0A 2DQRA 1BI0A 2G2KA 4DQ2A 3LSKA 3FIWA 3NDJA 2HOEA 1W1WE 1WZ2A 1S72Z 3RZOI 2QA4I 3JAMK 1KU2A 3HOXJ 2E2HI 1SMYF 1VQKZ 4GYIA 1W7PB 2CQXA 3M8EA 1T39A 4HGYA 3U50C 2BXYA 5ICFA 1IRGA 1P2FA 2QA4Z 2GIZA 1UCRA 2HTSA 4ON0A 3RTRA 2BZTA 3SEZA 1BM9A 4BE2A 4OWRB 3LQQA 2HU9A 4XX2A 1J75A 3DTEA 2OCEA 1P9QC 2DOEA 1WWXA 4RVDA 5IYCJ 3L1PA 3ABUA 3L2RA 3N97A 2IGOA 2R5YA 3KP2A 1FT9A 1F4KA 4MFDA 4G7HF 2R7ZI 4DZJA 3I4NI 1HKSA 3HRMA 4HX4A 3A01B 5CJ9A 1ZN2A 1WVRA 4AC0A 2WY8Q 2PMHA 4I0AA 1K83J 4M6XA 2NNYA 3A03A 3FMQA 5CVIA 2DT7B 3H9GA 1R49A 1QNTA 1HC8A 3JAMb 1P92A 3M8FA 3J7YJ 3S3OA 2KT0A 1WKMA 2YU3A 2Q51A 3JRBA 3HEFA 3NH5A 2A69F 5C3EJ 3G1LA 3BR5A 3BT9A 2JA8J 2EA2A 1R4NB 3R0JA 1R4MB 2WBMA 4KIBA 1ODDA 3HHHA 2E34A 3BG5A 3DEWA 3I5UA 2P5VA 2VOOA 2O61A 2MC4A 2VBWA 3GX4X 3C7JA 2KPIA 1AHDP 2W85A 2O03A 3CCYA 4FX4A 2JIOA 2K4JA 2VE8A 3S14J 1I39A 1XN7A 5IT9f 1Z1DA 2ZMEB 3ZR8X 1OR7C 2EGTA 2IJLA 4GXOA 3LUSA 3KP6A 2XAJA 4R1HA 1QF8A 3DEEA 1VQNZ 3OW2Y 4U87A 2F4OB 3ISPA 2GAUA 3T4NB 3ZPLA 1E17A 3HOZI 1RUNA 4XN0A 3HIFA 1HXDA 4CL1A 4ZYHA 2ZSHB 2OOXB 1FEXA 3G6EZ 3GTQJ 3EUKL 5EZHA 2CFOA 3RZDJ 2UXNA 3ZRGA 3H9QA 1QZZA 2A07F 2WV1A 4M72A 3FXLA 1XX5A 3U1KA 2ZAEB 3S1NI 2K5CA 3R6SA 2ZO4A 1WIIA 3CCUZ 1O3TA 1VQP1 2FQ3A 4MQ9F 4YFKF 1SAXA 2EFQA 2DBBA 5CVJA 4EATA 1K6YA 2Y0SN 2GU2A 3QQAA 2PJRB 3O6BB 1ETYA 1BC8C 3CC2I 5BMZA 5L3FA 3ZN0A 2ETHA 5EJCA 3MZ8A 4M74A 1EF4A 2DFIA 5HDNA 3WTTC 3CCLZ 4WCGA 3VMGA 2L2OA 1ORKA 4ENJA 3M1CA 2JA7J 2PFBA 5EEAA 3T5XA 1TL8A 2AXTC 1SFOJ 4BDZA 1DQUA 1IXRC 5FKNA 2XC7A 3Q5FA 1YYVA 1PP8F 5C3EI 1W7PA 5KK1A 1K4TA 2OUMA 1TWGI 1MNDA 4CGZA 3HOVI 3J7AY 4I2OA 4DYQA 2XSJC 3GW2A 3F8NA 5CQGA 3T0YA 1ZTRA 3AG3H 2VOPA 3DV8A 3M7GA 3T1BA 2DTZA 2ELJA 3TL4X 4IQJA 3MKLA 1G59A 1ONVA 5KAIC 3OYHA 4IOAF 3GO5A 4LG3A 2EH3A 1OCZH 5F04A 3V7CA 3LSPA 1ZR2A 2B63J 4O6JA 5L3EA 5D8LB 1YJNI 1LFUP 2LVSA 2OTJ1 1Z01A 3OYCA 2QLZA 3WE2A 1MDMB 2EIMH 2DXIA 1T8IA 2L02A 3RKYA 3WG9A 3V42A 2KRCA 4A3GJ 2W04A 4QWQA 3J81K 4MXUA 2Y0MA 3BCBA 2IV2X 3WE3A 3HC7A 1Y0UA 5KAFC 1JE8A 2IBDA 3L2CA 2JS4A 1MBEA 5M5XJ 1U8BA 3RSNA 2CQ7A 2VC0A 4Y7NI 3E6BA 2PN6A 1ZGWA 2KQRA 3VEPA 2Z33A 1BR1A 4AD9A 3KZYA 3BTCA 2JIPA 1OCOH 1EKEA 2M45A 4Y7NJ 5HDKA 2EB7A 3TO9A 3GTOJ 2M8EA 4XLCA 1I6XA 1MH4A 3CQZI 5EG0B 2JZYA 1MJBA 3BZCA 5LGUA 2DMTA 2R92J 3RQ4A 3N4MA 5KNLA 4EWCA 4A3GI 2QUFA 3Q9SA 1WJBA 2QKLB 2R0QC 1QYPA 1U9NA 4FQGA 3UNGC 3I54A 1I3QI 1QVFY 3CLQA 3V8LA 4RAZA 2H8WA 2ICWG 4MIMA 3MKZA 3F23A 1VQ7I 3CC4I 1U3EM 1T33A 5F08A 2VB6A 4XLEA 1FOXA 2KZVA 5LGNA 2MLKA 4L0YB 4JK1X 2TDXA 2L7MP 3LSRA 1UMQA 4L9VA 4A3DJ 4HRIA 4M9XA 4E2ZA 4IPAA 2E7ZA 3RYRA 2L54A 1XMXA 2MSYA 4NDLA 3GWZA 1SD6A 4X0GA 2V9VA 3HOVJ 1O57A 4LLGF 1ETQA 1XCVA 1G3WA 2HYFA 2HQAA 3P5JA 1QZEA 4CYCB 1O7LA 3CC4Z 1LFBA 4WK8F 1OISA 2EPFA 1X58A 3E97A 2XGCA 3JRAA 3DPLC 4I01A 3I55I 1S7EA 3QOEA 2BY1A 1YFHA 3G711 4A0ZA 3K7AJ 3MD2A 5DD4A 3JSOA 1ZLKA 4LG0B 5IP7J 1KD12 2IS4A 4A3JI 1G2HA 3BCAA 3FM3A 1YJWI 2ZJQF 2M48A 1TNSA 2EZIA 2Y9YA 2M6NA 2P7VB 2VBYA 2NOJB 2X1CA 3ERED 2H8RA 2X51A 5E79C 1WJEA 3WTZA 3CESA 3LQRA 2L7FP 1X1BA 3EYIA 4KFCA 2ZNYA 4EJWA 2NYXA 1RNLA 3LFUA 5D6EA 1FTTA 4NBHA 3IX0A 2DK5A 2F5FA 2AQFA 4C2TA 1JWHC 2L01A 3VB2A 2HI3A 2LC2A 2IA1A 3WTXC 1BW6A 3Q0VA 1BJAA 2GWRA 1GVDA 2RGVA 4KMUX 3HM5A 4XSZF 3OS2A 2NAZA 1XGNA 4BE0A 1Z6RA 2KIQA 4BXXJ 1BIBA 4XSXF 1BI3A 4A5MA 1RLYA 3RZDI 3GTQI 1O3SA 1BR2A 2XAUA 4CYCA 4BE1A 1QVTA 4E70A 3JRGA 4N9IA 2E36A 1JHFA 1YJNZ 2YU9I 4F3QA 4RGXA 4A3LI 3C2GA 1TWAJ 3MZLB 3VTNA 3ZMDA 4PSXA 5IPAA 2GQQA 2XVCA 2X0LA 5F6FA 5D8KB 3H5RA 3TEDA 3WU0A 2XPVA 4QLCU 2H94A 1RKTA 2A6TA 2ZNZA 5AN9F 1MMGA 2LK2A 4ZC3A 3SJMA 2E2IJ 1QO0D 2OTLZ 3ULQB 2XF6A 2BY3A 3QYBA 5HLIA 5A2Qb 2LKPA 3BG6A 4M9SA 4C3HJ 3VYTB 2A3SA 3J81b 4CYDA 4DQYB 3IH2A 4IKFA 4XRSA 2R5YB 2HS5A 2BVMA 3S2HJ 4BS9A 3C2HA 2KDZA 2D1HA 3DTKA 4G7ZF 3P9CA 2RC4A 5J6XA 5GAHJ 1F36A 4A3BI 3GZ5A 2CYYA 4A0XA 5LRSA 2V7FA 5FLXZ 2UXXA 4DZPA 4UB8C 4KN4X 4KDPA 2MH2A 3PFIA 3MWMA 1R1UA 3F0CA 2VPYA 1D1BA 4BY7J 3ZMZA 2LYCA 2N8GA 1POGA 1RI7A 3ZQ7A 2HR3A 4FCYA 4ETSA 2CG4A 3CD6Z 3HOWI 3DU6A 3S1RI 2F5VA 3W6JB 3JRDA 2E9HA 2K4BA 1IRFA 4U88A 3BTLA 2RNGA 1NG6A 3BY6A 1UZCA 2CMPA 2WB1A 4LOCA 2HYJA 2L4MA 4FX0A 4C3JJ 2B9SA 1VQNI 2JNYA 2AXLA 3F8MA 5FLXf 4UUTA 4JP0A 2PX9A 3EUHC 3VOEA 4AIHA 3SXYA 4IO9F 4RV9A 4MONA 1EA3A 4ABZA 2K3PA 4ZZDA 4XLAA 4IJAA 2LNBA 2K3FA 3T8TA 3HOXI 1CGPA 1J7KA 5E20A 1Z03A 3CCMZ 2CQNA 1OYYA 1KU9A 2LREA 3EUHA 3GZNB 3HSRA 2PMZN 4IX7A 4I98B 4A3CJ 5DEQA 1GXPA 4D5CA 3FQMA 1XS9A 5IP7I 3I9V2 4ZYEA 9ANTA 1VQ81 3L7WA 5GPCA 2B0LA 2HNHA 2FX0A 2VASA 2BGCA 5AIPA 2O3FA 4OIPF 3PUFA 1PDNC 4FETA 3TGNA 4KUMA 1MSEC 4M6VA 3OYEA 1XC5A 5B5EC 4LIUA 2R5ZA 2EFOA 2OU2A 1UFMA 1D0YA 2NVXJ 2HVSA 2V45A 1ZKGA 1UHMA 1K732 3JAMf 3KPHA 4E2YA 2NNNA 1KONA 5K5QA 4E7KA 2L5QA 1YITZ 2NVXI 4NBQA 3IWZA 1TW3A 1S6LA 4ZYDA 4NB8A 2RIQA 3KIOA 1OFCX 1S3JA 4HG2A 2LLKA 3TKYA 4Q4ZF 4A3FI 3A4CA 5AONA 1F5TA 1MH3A 2RKHA 4W1UA 2Q2EB 5F27A 3P9KA 1LE8A 4UY8I 3CLOA 2CW7A 5D5XB 5F0CA 3PO3J 1USPA 2OA4A 3ML6A 1KQ8A 1ZREA 3E6DA 2KIUA 1QBJA 4HLYA 4HGZA 1I1SA 1U78A 1Q862 1J5YA 2DYRH 3RCOA 3TDHB 2VC1A 1X3WA 3K1NA 2O0YA 3L9FA 2FD5A 4Y52J 2WAQN 2HVRA 3HOUI 1VQKI 1JI8A 4Y4RA 4A12A 3H0GJ 5FD5A 1HDDC 5FO5A 1JKOC 4C3IJ 4U7DA 5E3OA 2VE9A 1N8R1 2Y69H 2JR6A 3MFKA 2DE6A 2CWEA 3GTMJ 1TWCJ 1JTXA 1X3WB 2RT9A 5F1JA 3RIRA 4TNUA 2FSWA 2V8KA 3CCM1 2IT0A 3LSIA 2FRHA 1NG7A 3W6KB 3OYAA 4PZJA 2LD5A 2XRNA 5L3CA 4YFXF 1OKRA 2ELKA 1W5CC 4BACA 2AQEA 2R7OA 3OYMA 2Q2EA 3Q3SA 1Y8CA 3AL0B 4NNJA 5A2QZ 3BJ6A 3VB9A 2LDUA 5JI6A 3PM1A 2ZB9A 4XK4A 1ETVA 1IXSB 2QKDA 3CMA1 2ME0A 4IQ4A 3ZMTA 3F3XA 3PUBA 2R7UA 1GT0C 1V5FA 1ML8A 3OS0A 3BG3A 4BHBA 1JUSA 2DFEA 1SFKA 5B66C 3A2KA 4E4HA 2HVQA 5J47A 4RB3C 3TW7A 2LFBA 1ETWA 2LY2A 2DCEA 3WTVC 3E6MA 2DFHA 4LITA 2NRAC 1T0FA 1X3UA 3OS1A 3ZXSA 1FSEA 4DJAA 5JHUA 2E1CA 3G71I 4B09A 1QHGA 1GV5A 4EJTA 3I551 5CLSA 4D9JA 3O8GA 4BXXI 5LGTA 1VQ5I 4BGDA 2WC2A 2CQKA 3T8RA 2KHMA 1PUFB 2F48A 4NHJA 1NJI1 3IRRA 3GTMI 1TP4A 3V7RA 1M1K1 2Z99A 3K2AA 3E6CC 1S5LC 4RS4A 2KPMA 2RVCA 4ZJZA 1YTYA 3P9IA 5J3LA 4XOTA 5EEHA 1SEUA 2KP6A 4HNUA 3S1NJ 4NH1C 2VJ5A 1D3YA 2M9HA 2G9WA 1ITYA 4AIJA 3U2RA 5D1PA 2WAFA 3G6E1 1L3LA 1VQ6I 5FKOA 4UVAA 3CZ6A 1D1AA 2QM3A 2XAHA 1G4DA 5DYMA 2HGCA 4NOZA 1WH5A 3I53A 2CV2A 4P9UA 1GVJA 3GLXA 1JGSA 2FUG2 4MD9A 4ANJA 1LNWA 4LJZF 1VQLZ 2IA2A 3SFIA 1M1EB 1TLHB 2VT3A 3H3ZA 2UZKA 2FBHA 3E5UA 1JKPC 4MD8A 2EV5A 4XMYA 1RQFA 1VLAA 3OR1C 1FBQA 1X1DA 2A5WA 3K7AI 3FXJA 1UHSA 2E1OA 3PQKA 5EF6A 3PNVA 4RAFA 1Z7UA 5EG0A 4RS8A 4F91B 2EFWA 1SC7A 2PLYA 1VQ61 3KETA 3FZVA 3LA3A 1YIJZ 4KN7X 3KZZA 2CUFA 1JGGA 2QSGX 2R92I 2XRLA 3TP3A 1WPKA 1WZNA 1P7IA 3AL0C 5DM7F 4B3XA 4PGHA 4B48A 5LEJA 1MD0A 1M901 4BQAA 2ZXIA 2MD0A 5IT9b 4A3KI 4A3DI 3CC7Z 3CCR1 3E0JB 3CUOA 1FYLA 2CFXA 2H1LA 1VQLI 1VQM1 2EV0A 1R9TJ 1ZARA 3ZMSA 4HX8A 3I4NJ 3HBLA 4Q47A 2ZC2A 2GM4A 1I50I 3OYLA 4EV0A 3RI4A 1F43A 2HOAA 2OF7A 3JRCA 3COAC 1QXFA 2DMPA 1GHCA 5DDGA 1VQOZ 4IVNA 5J4VA 4AU7A 1TFIA 3OIPA 2KJCA 3H5AA 3GTOI 2Q0OA 1TZLA 3GXOA 3LL7A 1QZYA 3S1RJ 4LLNA 1UG0A 3BR1A 5HS8A 3K4BA 1OJLA 2OZKA 4I76A 1X3ZA 1FBSA 2EWNA 1NJI2 2B63I 5LHGA 1YW9A 2XUBA 1V4RA 2QCOA 3ASOH 1EV7A 1USSA 4P96A 4A3KJ 3RZOJ 1CF7B 4GRIA 2AHQA 3GCMA 5ICEA 4MLOA 2RREA 3KE2A 3PSFA 3X2QH 1YJ9I 2LEXA 1DU0A 2X1EA 1DU6A 4BQNA 3SFZA 2VLAA 2DO7A 5F0HA 1VQ9Z 2ZJPF 1YUAA 1XD7A 4PDKA 4E7LA 1KQSZ 3OL3A 3MKWB 4YFNF 1S29A 3CUQB 5D4RA 3A1YA 1DDNA 4RVFA 3S2HI 4J00A 2VONA 2JMWA 4MH4A 1ETOA 3K1MA 3ZGKA 3F8CA 2LBFA 5K7HA 5KVRA 3A0HC 4J01A 2E2II 3VYRB 3S15J 2IGKA 1RC9A 2V8IA 2BV6A 2BBYA 3H3UA 3GTGI 3A01A 3CCSI 2O7OA 1K9M1 1D5YA 5J8FA 1YLFA 2F4MB 1I6HJ 4EGYA 3KEQA 3R60A 1HA8A 4XBFA 4M3DA 3SHFA 4N4NB 1TWAI 1TNTA 2DMQA 4MEYF 3IR7A 4OIRF 3PO2I 2YU9J 1ON2A 1SVLA 4YIIA 5ERIA 5F64A 1J2XA 5T67A 4XRSG 4EQQA 5HNFA 2X85A 4P5OA 4ZTJA 2R7RA 5D1OA 5GTHC 2OV7A 3HJEA 4XNFA 4C2UA 4BBSJ 3CJNA 4UV9A 4DBQA 3HHGA 4KT5C 3SYTA 2QQ8A 3QU6A 3HOZJ 3KP4A 2V3VA 3G73A 2L7KA 4HV6A 3GF2A 2EFPA 5DCFA 2Y75A 4I0BA 4YELA 3PFYA 3OYDA 2Y30A 1STZA 2K40A 4IL6C 2M0MA 4NC7A 1X3ZB 3HOTA 1G3YA 2M4KA 4II2A 2EILH 4DYCA 1S9HA 4LIVA 4E6KG 2A6EF 2IVMA 1USTA 1A31A 2R7DA 4HOBA
chains in the Genus database with same CATH topology
2F6CA 4XORA 3FBNB 1ERDA 3K4JA 2W7NA 4YEJA 1DGRM 5JHFA 3S3MA 3NH8A 3DPLC 4Y33A 1S7MA 3QOEA 1T0FC 3CJQB 3G711 3MD2A 1Q7Y1 1ZB9A 1KD12 1I6HI 2F4MA 3CCJ1 2IS4A 2QRDB 4AYBA 1LQLA 4A3JI 1K731 3BCAA 1YUKA 2M48A 2JA8I 4HH4A 2LG4A 3DU5A 2M6NA 2X1CA 2NOJB 4Y3OA 2W03A 1KC82 3P5JB 3S15I 2VF1A 2X51A 4E2WA 3CF2A 2V4JC 3CP8A 2DT6A 1WJEA 1Y56A 2K3RA 3CESA 4JOMA 3TBIA 1X1BA 1W36C 1TWHI 2UUZA 3ZQQA 5HLTA 4A3CI 2PMZA 1ZH1A 3SZGA 3DQVC 3LFUA 4NBHA 3IX0A 3D5RC 3IAS2 4F92B 3AKZA 2AQFA 4C2TA 4F93B 3OYBA 1JWHC 2R6MA 1VQN1 3S1QI 1UELB 4NBCA 2LC2A 2VL8A 2R7VA 1YIT1 1X1AA 2CV1A 1E0EA 3EUAA 2ZXHA 2R7SA 3OS2A 4BE0A 3GTPI 3H5NA 4ZDOA 3RZDI 2VXDA 3K4LA 3PL8A 2X6YA 1RLYA 3GTQI 4QPOA 2UWMA 3W3CA 1BR2A 2KRHA 2XAUA 4BE1A 4RM2A 3CCU1 5LL6f 1YJNZ 1VQPZ 2IXSA 2IGMA 3CXCY 2CUZA 2YU9I 4F3QA 2VJJA 4RM3A 3C2GA 3NWTA 3D6WA 1Q821 1WJ5A 3MZLB 3VTNA 3Q87A 4A3LI 4PSXA 5KCMA 4CCNA 3L2UA 2CS3A 3H5RA 3OYIA 4CCLA 4BXFA 1K83I 1BR4A 4CZCA 1V5GA 1Z02A 1JJ2Z 3MKYB 1ZELA 2JSPA 3ONQA 2A6TA 4CCJA 4E7ZA 5FRNA 2GTHA 2OOYB 2MYSA 2JMOA 5AN9F 1MMGA 3QYEA 4ZC3A 2BJOA 1KD11 1Z3YA 4Y52I 3CCSZ 4ZDPA 1SFOI 2OTLZ 2OTJZ 3VSLA 4RVHA 3J80b 2XF6A 3DKXA 3QYBA 1UAAA 5A2Qb 2LRDA 3BG6A 3VYTB 2W82A 3J81b 4NUBA 3HPHA 3FKII 4DQYB 2WA0A 4IKFA 2IZ4A 3PO3I 5T6BA 2HZDA 2K9LA 1T95A 2BVMA 2Q1ZB 3S2DI 4BS9A 4E7JA 3C2HA 1YX5A 5C4JI 2DE5A 3DTKA 2IZ3A 3S17I 4HEA2 2JVGA 2AKLA 3ESWA 4A3BI 1VQ41 4NC8A 3J81f 2V7FA 1Q7Y2 2V1NA 4DK1A 4B47A 2VJIA 2JUGA 2KL4A 2W00A 1YJ91 4KITB 2JA6I 3BG7A 4XKWA 2QREB 3HKZA 1WFXA 1OLTA 4DBRA 1D1BA 4BQQA 5IP9I 3PNTA 3OMYA 1MNEA 2LYCA 1QVGY 1RO0A 3L2WA 4BL0B 2OC6A 3S3NA 2RPRA 3NDIA 3TE5B 3F9KA 3CMAZ 2E2JI 1QVFZ 4RMNA 3CD6Z 3LSHA 3HOWI 3DU6A 3S1RI 3KIFA 2F5VA 1SAUA 3HL2A 4ZYAA 4NB9A 2CW8A 1USPB 3CME1 2E9HA 3E1SA 1W2BZ 3EEDA 2RNGA 1YI21 1NG6A 2JA5I 3GTMS 1S721 3HPGA 2CMPA 2WB1A 1IRXA 2VIXA 2KI7B 2O53A 5FLXf 3CCVZ 3MMYB 3PO3S 2JNYA 1TT0A 2BOLA 3FBIB 3HG9A 1TWFI 3CCS1 3EUHC 3VSKA 1PFTA 2QR1B 2QA41 3CC21 1Q822 2V8JA 1WJDA 4N4OB 4PUSA 4RV9A 2QRCB 4MONA 1EA3A 1W2BY 2K3PA 4DIQA 4XLAA 1Y1WI 2R93I 4RLQA 4PJMA 1QU3A 3HOXI 5FROA 3U21A 1Z03A 3CCMZ 1K8A2 1YJW1 2LREA 4H4KC 4FASD 2KLOA 4IX7A 1K9M2 5HNHA 3KIHA 3H9JA 3FQMA 3D5LA 5IP7I 3I9V2 3QYFA 1VQ81 2V26A 2M3AA 3CCE1 2VJ4A 2HNHA 2VASA 2ZSIB 1WJCA 3TMOA 4DGLA 2VQLA 2J6AA 4FETA 3I07A 3M3YI 3DPUA 2M7AA 3OYEA 4LIUA 3L2VA 4XLFA 1D0YA 2VKDA 2VQCA 3N05A 4XR6A 2HVSA 4AVZA 4PK4A 1VQ4Z 3UR3C 1TWCI 3D9XA 2NVQI 1K732 3I561 3JAMf 2R4GA 1VQK1 1JJ2Y 2HF1A 5T64A 4XOPA 3J80f 3S14I 4F55A 2NVYI 1N2FA 3DWLE 4CCOA 1LDKB 3OYGA 4E2YA 1KONA 1VQMZ 3AFHA 2I3CA 4QTTA 2XF5A 4E7KA 2L5QA 1Z7LA 1RNIA 1R6RA 2Z2SB 3H35A 4PFOA 2PM9A 1YITZ 3CXCZ 2NVXI 4NB8A 3D5SC 2RIQA 1VQ71 4HG2A 3F3FC 2M7BA 3CC41 4A3FI 5TGTA 2QEX1 3A4CA 4G6TB 1YJWZ 3GTLI 4PFPA 3GTKI 4E33A 3G71Z 1WJAA 2Q2EB 2R7QA 1WJFA 2XF7A 1NUIA 3PJRA 4BBRI 2CW7A 4KJZA 1KC81 3LSGA 4ZTFA 1USPA 2WADA 3BG1B 3CPWY 1YX3A 3FKJA 1VQ6Z 3H3VJ 2P0WA 1N75A 4HGZA 4A3II 1Q862 3RCOA 4CH7A 2ZFUA 3TDHB 3IF8A 1X3WA 4DOZA 3CCV1 1X0TA 3HUGB 3GKQA 2HVRA 3HOUI 1JI8A 4Y4RA 3M8JA 4BDYA 3LSMA 3VDXA 3OOUA 1DGWY 2O5RA 3H0DA 2LH9A 4B43A 2JR6A 1N8R1 2KDOA 4CSWA 3CPWZ 2DE6A 3GBGA 2LBFB 4HPQA 1YE9A 3OW2Z 3LMMA 2RT9A 4NBFA 4TNUA 3CCM1 4JQFA 3HOSA 2V8KA 4A93I 1VQ7Z 1MMAA 1N78A 4RVGA 3LSIA 1VQ51 3S8PA 1D1CA 1NG7A 4B44A 3OYAA 2R7WA 1DP3A 4BBSI 1V5EA 4XN3A 3DKYA 1L1OC 2VQGA 3K10A 4QPQA 5D1OB 3I4MI 4BACA 5CKTA 1RO4A 1YJ9Z 3K4MA 4NBBA 2GOXB 2AQEA 2R7OA 3OYMA 3BC8A 2YADA 3BG0B 3AL0B 4NBAA 4NNJA 4BEHB 3I3LA 2JUBA 3VB9A 3G2BA 1D0ZA 3FDYA 2CUJA 1DL6A 2G2KA 4BJ6C 4XL9A 4NBGA 3LSKA 3CCQZ 2OTL1 2Y0SA 2QKDA 3NDJA 3CMA1 3CJRB 4IQ4A 1S72Z 2L9NA 4ZDLA 3RZOI 3PUBA 2R7UA 4NBEA 2KMUA 4OAYA 4XONA 2JA2A 3G4S1 2E2HI 3HOYI 1VQKZ 2PJRA 1V5FA 3K4KA 1ML8A 3OS0A 4HGYA 3U50C 5HVQC 1SFKA 3W2WA 3W2VA 3A2KA 2QA4Z 4E4HA 2HVQA 3RPUD 3RTRA 2LY2A 4F52A 3SEZA 4BE2A 2DCEA 3MZKB 4QTUA 3VMHA 4OWRB 2HU9A 3VYSB 4BUPA 4LITA 4MD7A 1Y1VS 3DTEA 4XX2A 1P9QC 3FHNA 3OS1A 3ZXSA 4RVDA 3L2RA 3FQQA 4DJAA 3K70D 1GLNA 1KRLA 3CC2Z 1QHGA 2IGOA 5LFAA 3K70C 4D9JA 3I551 4BXXI 4E2XA 4BGDA 2R7ZI 4CUGA 2KHMA 5FRMA 1X1CA 1NJI1 2F4IA 3GTMI 1X4PA 3I4NI 3CP2A 2V9KA 1M1K1 1WCMI 1N77A 1KQSY 2CV0A 3L2QA 3CMMA 2BW3B 1X4OA 2MABA 1VQL1 2DE7A 4RS4A 2KPMA 4ITVA 2WY8Q 4PJJA 4ZJZA 2DT7B 3H9GA 3K4CA 4XOTA 3JAMb 2UV1A 1D0XA 4HNTA 3BLYA 2KP6A 4YRVA 5FLXb 4HNUA 2NVTI 3S3OA 2Q51A 4NH1C 4PJLA 2VJ5A 3NH5A 2QLVB 3QODA 3OWTA 2X1DA 5D1PA 2WAFA 3G6E1 4E7SA 3OYJA 2WBMA 1M1K2 4KT6A 4RLFA 1K8A1 4E7HA 3CZ6A 4IZZA 1D1AA 4II3A 2QEXZ 2M4GA 5LD2C 2MC4A 2BVLA 4NOZA 1BOBA 2KPIA 4PJNA 1M902 2CV2A 1Z21A 4BY1I 1X19A 2Z1DA 3M4OI 3CCJZ 4C9YA 2FUG2 3NH4A 4XKBA 4MD9A 4ANJA 1RO2A 3DLAA 3GTJI 1VQLZ 4XKCA 5IT9f 3ZR8X 5FLMI 1R9TI 1OR7C 4MD8A 2RQQA 2EGTA 3CCEZ 4XMYA 1RQFA 1VLAA 3OR1C 3LUSA 1QF8A 4A3EI 1X1DA 2A5WA 2E1MB 3DEEA 4U87A 3K7AI 3OW2Y 1Q811 1VQNZ 3CD61 1PYVA 3OYNA 1AA7A 3PNVA 2LOOA 3T4NB 1Q812 3HOZI 4XN0A 3PSIA 4F91B 5KHDA 1VQ61 3PNYA 4CL1A 1YIJZ 2ZSHB 4BQOA 2OOXB 1YI2Z 4CA0A 2K9MA 3G6EZ 3EUKL 1WW9A 2CFOA 2DJIA 2R92I 3ZRGA 3H9QA 3I56Z 3SDBA 3S1MI 2I8DA 2O4HA 1Z3XA 2ZAEB 1ZB8A 3EERA 3S1NI 3AL0C 2K5CA 4XLHA 4B3XA 4BY7I 4B48A 2IS1A 2JVHA 3K6GA 1WIIA 3CCUZ 1VQP1 2IGNA 2ZXIA 1YJN1 1M901 2MD0A 2F4OA 5IT9b 4A3KI 4A3DI 4S1TA 1MMDA 3CC7Z 3CCR1 3E0JB 2LFUA 4EATA 1K6YA 1VQM1 3K4NA 3OL4A 2VQHA 2GU2A 4E30A 2PJRB 1VQ5Z 1NP6A 3OYKA 3CCQ1 4C30A 3SEQA 1I50I 2GTIA 2R7XA 3OYLA 3VYUB 2E1MC 2JA7I 4D1QA 4XM3A 3OIQA 2XDVA 1YHQ1 4BEHA 3CCLZ 1VQOZ 3OY9A 3VMGA 1LVKA 2L2OA 2X6WA 3M1CA 4E31A 5C4XI 4AU7A 3CCL1 1TFIA 3OIPA 4A3MI 3H5AA 3KX2A 2K5RA 1YIJ1 3GTOI 1TZLA 2QKMB 5C44I 1MW7A 3LL7A 2HPIA 1UG0A 4BU2A 5A2Qf 3K4BA 2WY7Q 4BDZA 1DQUA 1X3ZA 2XC7A 2OZKA 2PK7A 3F3PC 4CCMA 5C3EI 1NJI2 2B63I 1TWGI 2OUMA 2V6EA 2Z16A 1MNDA 3HOVI 3J7AY 1Y1VI 3NWSA 3DPTA 2VKHA 2XSJC 5CQGA 4GRIA 3CC71 2W4SA 4IQJA 2ELJA 3TL4X 3HXLA 4BJTA 4MLOA 1G59A 2H85A 3S16I 2RREA 3PSFA 3OYHA 4LG3A 1P9NA 5CPRB 2X1EA 4HSRA 4BQNA 3MONA 1N8R2 2DOAA 2VLAA 2Q4ZA 3QWUA 1VQ9Z 1YUAA 2OTJ1 4E7LA 3OYCA 1FMWA 1Z01A 1KQSZ 3OL3A 3MKWB 2DXIA 4PSWA 2IS2A 3VMIA 3VWBA 2W04A 3A1YA 2KRCA 3V42A 2MFZA 4MXUA 4RVFA 1VQO1 3BCBA 3S2HI 4J00A 2P28A 3G4SZ 4MH4A 1Q861 3HC7A 1J09A 5HOOA 4E32A 3ZGKA 2JS4A 3KYLA 2LBFA 3OYFA 3ZCOA 4XKVA 3W2AA 1W36D 4NBDA 3RSNA 2VXZA 2WAEA 4DGWB 2L9SA 5CM2M 4Y7NI 1MMNA 3DTIA 2R7TA 4J01A 2KQRA 2E2II 2GOMA 2X6XA 2IGKA 3VYRB 1G8XA 2V8IA 2VUMI 5CQEA 1VZ0A 1Y6IA 1BR1A 3CCRZ 3GTGI 3S32A 2VPLA 1K9M1 3NFZA 2CH0A 1HA8A 4OAZA 1PJRA 3J7A4 1TWAI 1FMVA 4N4NB 4P1WA 4XLCA 4NFRA 2LY1A 3PO2I 4NQWB 3OR2C 2W1OA 2RHBA 3I55Z 1U0JA 5T67A 3CQZI 5HNFA 2HPMA 2IS6A 2X85A 4P5OA 1VQ91 3RQ4A 5KNLA 4ZTJA 2R7RA 4EWCA 4A3GI 3IUOA 1WJBA 2QKLB 5D1OA 1VQ8Z 1YHQZ 1QYPA 2OV7A 3UNGC 1I3QI 1QVFY 1LKXA 3IP4B 3CMEZ 2HDWA 4XNFA 2LIYA 3MKZA 4C2UA 3IAM2 4DBQA 2VB6A 3SYTA 1QHHD 4XLEA 4CCKA 2KZVA 2P3YA 2VUGA 4X6AI 3EPZA 2L7KA 2WAQA 3IFUA 4YELA 4XQFA 3PFYA 3OYDA 4U7BA 4HSTA 1LFPA 4HRIA 3H0GI 4R79A 4E2ZA 2M0MA 2E5ZA 4NC7A 3HOTA 2M4KA 1QVGZ 4II2A 1S9HA 4X0GA 4LIVA 2E5NA 3S93A 4E6KG 4MRIA 2HQAA 3KEYA 2BW3A 3GCFA 2E60A 3CC4Z 4BJ5C 2RBLA 4KISA 4E7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6K G;  1Y56 A;  2HU9 A; 
#chains in the Genus database with same CATH topology
 3E3V A;  3FBN B;  1ERD A;  4YEJ A;  1DGR M;  3FK6 A;  3S3M A;  1LPQ A;  3NH8 A;  1S7M A;  3A0B C;  1IN5 A;  2OCC H;  2MA3 A;  1TC3 C;  1IO2 A;  4A6D A;  1I6H I;  2DDA A;  4AYB A;  3MVP A;  3GTG J;  3ELK A;  2JA8 I;  3BR6 A;  2V79 A;  2DLL A;  2LG4 A;  3LST A;  2O8K A;  3S15 I;  4Y3O A;  2M2E A;  4BYY A;  3AG2 H;  1ZGA A;  3CP8 A;  2DT6 A;  1R36 A;  2K3R A;  4JOM A;  3TBI A;  1W36 C;  3KZI C;  4UB6 C;  3ZQQ A;  1KU7 A;  2IRF G;  3FWE A;  3R0A A;  3IAS 2;  3AKZ A;  1HW2 A;  2DOF A;  4F93 B;  3PIP F;  1ENH A;  1VQN 1;  3JR9 A;  2ELH A;  4IOC F;  5IT9 K;  1RKW A;  1ETX A;  3DCF A;  5HLH A;  5LHI A;  2L0K A;  1E0E A;  3EUA A;  1U6G A;  2DDB A;  3M9A A;  2DMU A;  4FIS A;  2X6Y A;  4QPO A;  4HF0 A;  3W3C A;  5B3S H;  2QYO A;  1VQ9 I;  3CF5 F;  1R71 A;  2IGM A;  2JIM A;  2CUZ A;  1MJ9 A;  4KMF A;  3BWG A;  3D6W A;  1Q82 1;  5M5Y J;  3Q87 A;  1YG2 A;  5KCM A;  1B9M A;  1OR7 A;  3RJP A;  4XIC A;  3SQN A;  4CZC A;  1H88 C;  3CCM I;  1K83 I;  1LQ1 A;  2OOY B;  4CCJ A;  5GAE J;  1A04 A;  3AG1 H;  5FRN A;  2OZU A;  2GTH A;  3H0G I;  2A68 F;  2MYS A;  2CGP A;  2JMO A;  1KD1 1;  2BJO A;  4Y52 I;  3VPR A;  4ASN A;  2HKX A;  1XMA A;  3VSL A;  3J80 b;  2QEN A;  2XKO A;  2CO5 A;  3DKX A;  4HA8 A;  1OMI A;  5DUK A;  4CZZ A;  4NUB A;  3HPH A;  3FKI I;  5EGO A;  2JRM A;  2WA0 A;  3BJA A;  3PO3 I;  2XB5 A;  1FSH A;  5JVT A;  3S2D I;  1VQO I;  2JUC A;  2IZ3 A;  5ED4 A;  2KIM A;  2JVG A;  3IHU A;  3ESW A;  1VQ4 1;  3TP0 A;  3BP8 A;  4LK1 F;  2K86 A;  2V1N A;  5DV5 A;  2ESH A;  4DK1 A;  1B6A A;  1T56 A;  3S2W A;  1KYZ A;  2JUG A;  2NVT J;  3KLN A;  4KIT B;  3LAP A;  4XKW A;  2QRE B;  3HKZ A;  3ABL H;  1R1T A;  4I09 A;  3CC7 I;  2FA5 A;  1R23 A;  3WGH A;  3PNT A;  2LF7 A;  2QQA A;  1QVG Y;  3O3K A;  3L2W A;  2OC6 A;  1QVF Z;  2E2J I;  4M6Y A;  1K78 A;  2M0C A;  4G8X A;  1QPM A;  2QGU A;  1Z67 A;  3LSH A;  2GXA A;  2XGD A;  3QPT A;  2MW8 A;  2GBY A;  3HL2 A;  2CW8 A;  3CUQ C;  1USP B;  2LY9 A;  3E1S A;  3K2Z A;  1YIJ I;  2YUS A;  3ABM H;  4B1R A;  2MD5 A;  2JA5 I;  3GTM S;  2QSF X;  4YIR X;  3HPG A;  2FEZ A;  1IRX A;  1XGO A;  2VIX A;  3CCV Z;  2FML A;  3GTK J;  5EGO B;  3HTU A;  1PFT A;  1Q1V A;  2JN6 A;  2QA4 1;  1Q82 2;  2QF7 A;  4N4O B;  4PUS A;  4RB1 A;  3TDU C;  4DIQ A;  1FIA A;  1D8J A;  2FE3 A;  1FOY A;  1MBG A;  1K8A 2;  3AAF A;  1YJW 1;  4H4K C;  2KLO A;  4BHC A;  3H9J A;  4OIQ F;  1MKM A;  5DCM A;  3QYF A;  2LP0 A;  1UJ8 A;  1FDO A;  2V26 A;  2DI3 A;  2D1V A;  5EZG A;  3CCE 1;  2NVU B;  2ZSI B;  1WJC A;  1JTY A;  1I3A A;  2FNP A;  3RKQ A;  3WGG A;  5BPD A;  1YQA A;  2HTJ A;  1HBX G;  2DA6 A;  1ZAO A;  1BN5 A;  3DBR B;  2RAE A;  1ON1 A;  4XLF A;  2VKD A;  2ISZ A;  2VQC A;  3LWF A;  1VQ4 Z;  1KQ9 A;  3UR3 C;  2QZ8 A;  2DA4 A;  1IN6 A;  2NVY J;  3RKX A;  3WTW C;  3HDD A;  2NVQ I;  2R4G A;  3G3Z A;  2HF1 A;  5JLW A;  1XDS A;  2L3D A;  3S14 I;  4F55 A;  1ZQ3 P;  3DWL E;  2W84 A;  3BDD A;  1NH3 A;  2XRO A;  1RNI A;  1Z7L A;  1R6R A;  4PFO A;  2RV8 A;  3CXC Z;  1W5S A;  3IH4 A;  2R3S A;  3GLL A;  2QQ9 A;  1VQ7 1;  3F3F C;  5E1X A;  1WSU A;  5TGT A;  1O4X A;  2QEX 1;  4IHT A;  3GTL I;  4PFP A;  3M3Y J;  1OQY A;  2WTE A;  1Z0X A;  3E7L A;  1WJA A;  2XF7 A;  1WJF A;  4R8H A;  4BBR I;  1IXC A;  5H2F C;  4KJZ A;  1I5Z A;  1R00 A;  2K85 A;  3B6C A;  1QGP A;  1GUU A;  5FGM A;  3FKJ A;  2P0W A;  1N75 A;  2MG4 A;  2Z9O A;  4A3I I;  3QOP A;  5IT3 A;  4G94 A;  2ZFU A;  1TQP A;  2X6O A;  3IF8 A;  3BPX A;  4DOZ A;  5LEK A;  1YOV B;  3V8J A;  3LA7 A;  2VUM J;  2EBI A;  3VFZ A;  5BQT A;  1K61 A;  2DA1 A;  2KJB A;  3OOU A;  1FDI A;  3H0D A;  3HB9 A;  2NS0 A;  3GBG A;  1L0O C;  2PI0 A;  3FXK A;  2ZKZ A;  4RGR A;  1K4S A;  1T98 A;  4HPQ A;  1EH6 A;  1YE9 A;  3LMM A;  3OW2 Z;  5B1A H;  2HDD A;  1ZRD A;  2R7Z J;  4JQF A;  3HOS A;  5E17 F;  4A93 I;  1VQ7 Z;  3KP3 A;  4HZF A;  1MGT A;  2R7W A;  1EH7 A;  1DP3 A;  2FU4 A;  4XN3 A;  2JIR A;  5D1O B;  2CQQ A;  5CKT A;  1YJ9 Z;  3ZOB A;  4NBB A;  2GOX B;  2M5W A;  4NBA A;  4Y17 A;  2JUB A;  3I3L A;  2FNA A;  1D0Z A;  3CCQ Z;  4NBG A;  1OYW A;  2OTL 1;  2Y0S A;  1B72 B;  1VI0 A;  2VPZ A;  2NS8 A;  4P9F A;  4ZDL A;  5M5W J;  3HGY A;  4F7Z A;  2A5Y B;  2JA6 J;  2KMU A;  4XON A;  4NBE A;  4YG2 F;  1KU3 A;  3L09 A;  2MLG A;  2PJR A;  3K4K A;  4Q5S F;  1SAN A;  3W6V A;  5JLX A;  2CJJ A;  5HVQ C;  5FLV A;  1D8K A;  4V2G A;  1S72 I;  4U0Y A;  4MQV A;  3BZ6 A;  1TWF J;  3RPU D;  4QTU A;  2EJR A;  4IHX A;  4CIC A;  1DPU A;  3VMH A;  3VYS B;  4BUP A;  4MD7 A;  1HCR A;  3GZ6 A;  2G7U A;  1B59 A;  3FHN A;  4ESB A;  3KLO A;  3GUD A;  4A3F J;  2Y9Z A;  2EK5 A;  4L0Z B;  3K70 D;  1GLN A;  2BYV E;  3K70 C;  3GTP J;  4E2X A;  2FMY A;  4A6E A;  4RBO A;  1X1C A;  2DA2 A;  2F4I A;  1X4P A;  1UHW A;  1IRZ A;  1WCM I;  4B4C A;  2D5V A;  3L2Q A;  3CMM A;  2BW3 B;  2MAB A;  1VQM I;  2DE7 A;  1VQL 1;  2JPC A;  3MZH A;  3C3W A;  4PJJ A;  1BJZ A;  4ESJ A;  4EJU A;  3TW6 A;  5JR3 A;  4BNC A;  4DNC A;  1D0X A;  4HNT A;  4KIC A;  5FLX b;  1PUF A;  2KIF A;  5ICC A;  3KCC A;  1Y1V J;  3KYD B;  3F21 A;  1I3Q J;  2LSO A;  2DFF A;  3JW4 A;  3EDP A;  4MNU A;  3HYI A;  3LA2 A;  2H6C A;  3TDZ C;  4IHS A;  4GGG A;  4XRF A;  4M3G A;  1RRJ A;  3BOQ A;  4EEF G;  1ZGJ A;  4RLF A;  4ZYG A;  2XIG A;  4KYW A;  1J9I A;  1XSD A;  4IZZ A;  1H8A C;  4II3 A;  2E35 A;  4B3A A;  1T08 B;  2P4W A;  5LD2 C;  3IKV A;  5B1B H;  1BOB A;  1HF0 A;  1M90 2;  1HKT A;  1Z21 A;  4BY1 I;  1X19 A;  3CDH A;  5FLM J;  3ZQL A;  2PJP A;  3M4O I;  5LBQ A;  1D5V A;  3NH4 A;  3FXR A;  4V2F A;  4XKB A;  1E3O C;  4GO1 A;  3F8B A;  3DLA A;  3GTJ I;  1HW1 A;  1W7P D;  1IN7 A;  4DW6 A;  3QPH A;  1IW7 F;  4UXN A;  2I5U A;  1QPI A;  1R5H A;  1XG1 A;  3CCU I;  4A3E I;  3TOB A;  2E1M B;  3I4P A;  2W48 A;  4DYR A;  1PYV A;  2COM A;  3OYN A;  1AA7 A;  1TTY A;  2LOO A;  1Q81 2;  3RQI A;  5L3G A;  1J59 A;  3PSI A;  1O7F A;  1BI1 A;  5KHD A;  1YO5 C;  1P6R A;  2OAZ A;  2L9R A;  1Z77 A;  3G6E I;  4BQO A;  1MSF C;  3HOW J;  4CA0 A;  2JWT A;  2K9M A;  3GFM A;  4Q48 A;  3NAU A;  5TJJ A;  3DFG A;  1Q16 A;  2CSO A;  3DLL F;  2DJI A;  4D7N A;  1XMK A;  5L3D A;  3I56 Z;  3I59 B;  3S1M I;  4GYG A;  4IHV A;  4G7O F;  3EER A;  2DW4 A;  5IYD J;  4BY7 I;  4M9Z A;  2HYG D;  3S1Q J;  1X1P A;  2JVH A;  1YJN 1;  2AO9 A;  2IGN A;  2FF4 A;  2DAO A;  2BY2 A;  1ETK A;  2Q8K A;  2OZ6 A;  2YR2 A;  3HGG A;  3K4N A;  1JUM A;  1TWG J;  3OL4 A;  5ILS A;  2QBY B;  4E30 A;  4IEJ A;  1VQ5 Z;  2JSC A;  4ENM A;  1W0U A;  4A3B J;  2GZW A;  3GTJ J;  1IV6 A;  2H6B A;  4EVI A;  4C30 A;  3JRF A;  2QWW A;  1RES A;  1Y8R B;  3OSF A;  2XPU A;  3BG9 A;  4IRG A;  3VYU B;  2E1M C;  2JA7 I;  3OIQ A;  2XAS A;  2F2E A;  3IWF A;  2COB A;  1YHQ 1;  4M73 A;  4BEH A;  1FC3 A;  1O3R A;  2X6W A;  5FJ8 J;  1UG2 A;  3ERM A;  3ZQF A;  3FM5 A;  3C18 A;  1IG7 A;  4E31 A;  1YIJ 1;  4I99 C;  3QWL A;  4A3M I;  3JRI A;  4A69 C;  1OCT C;  3D1N I;  4OIO F;  2WY7 Q;  4IRI A;  4Z2Y A;  2PK7 A;  1C0W A;  3K0L A;  4CCM A;  3LNQ A;  4FTH A;  2AS5 F;  2H27 A;  5IOZ A;  4LB6 B;  2Z16 A;  3ZN1 A;  1P4A A;  1WHU A;  2JPB A;  2J5O A;  2CUE A;  1Y1V I;  3NWS A;  4IXA A;  3DPT A;  3KP5 A;  1HKQ A;  3CMA I;  1YRN A;  3CC7 1;  4A3L J;  4JYK A;  3S16 I;  1OPC A;  1RR7 A;  3HXL A;  5H6R A;  4BJT A;  2BHZ A;  2H85 A;  4G6D A;  2P6T A;  5K5R A;  1P9N A;  5CPR B;  4HSR A;  3MON A;  5EDN A;  3CDI A;  4RGS A;  2DOA A;  1GDT A;  1VQP I;  4RDU A;  3QWU A;  5ILU A;  2XSD C;  3ZQH A;  2EIK H;  4PSW A;  2IS2 A;  2HWV A;  2K7L A;  5C44 J;  1LB2 A;  3VMI A;  3FMR A;  1TQM A;  3VWB A;  2HOS A;  4H0E A;  4MEX F;  3RPU A;  4ZH4 F;  5C4X J;  3G4S Z;  2P28 A;  1ZRC A;  1HDP A;  5BS6 A;  5FKM A;  1J09 A;  2JJ7 A;  3GEZ A;  4E32 A;  3IRQ A;  4CO8 A;  1Q86 1;  1YS7 A;  1YIO A;  3KYL A;  2BEO A;  4AYB N;  1E3P A;  4XKV A;  3W2A A;  2RDP A;  4UHT A;  1W36 D;  1AOY A;  2ZJ2 A;  2O6G E;  5CM2 M;  1MMN A;  1MZB A;  1R1V A;  2JT1 A;  4CDG A;  4ENK A;  1LEA A;  2KKO A;  2R7T A;  1W5T A;  5HOD A;  3HRS A;  2X6X A;  1G8X A;  5E18 F;  5CQE A;  2MC3 A;  4HNV A;  4KIF A;  2VPL A;  3QAH A;  2CH0 A;  4OAZ A;  3CJT B;  5E8G A;  3J7A 4;  2P81 A;  1OCR H;  2LY1 A;  3MEX A;  3BRO A;  5CVR A;  2RHB A;  1U0J A;  3I55 Z;  3WTY C;  3BR2 A;  4LD5 A;  1IZ1 A;  4MO7 A;  5HS7 A;  1YHQ Z;  2M34 A;  1VQ8 Z;  2HXO A;  1JJ8 C;  1MBJ A;  3K69 A;  4J19 A;  2GLO A;  4AID A;  3CME Z;  2LIY A;  4NQW A;  2X4H A;  1YIT I;  1AKH A;  2HDC A;  2OBP A;  4RB0 A;  1QHH D;  4ESF A;  4CCK A;  2VUG A;  1IN4 A;  1S8N A;  2L7Z A;  2YX7 A;  4BKX A;  3F22 A;  3BQZ A;  1FLI A;  1PP7 U;  4B8X A;  4HST A;  5AIQ A;  1B8I A;  2ESN A;  1TWH J;  4A0Y A;  3ECH A;  2E5Z A;  1QVG Z;  4N9H A;  3JRH A;  1ZHF A;  3ZQC A;  4MRI A;  2E5N A;  3S93 A;  2BW3 A;  3GCF A;  2E60 A;  4HDV A;  1K6O A;  1FX7 A;  5E1W A;  3CQZ J;  1X2N A;  1Z9C A;  4G12 A;  1YHQ I;  3I59 A;  2F6C A;  5IP6 A;  2H1K A;  3K4J A;  4A3M J;  5JHF A;  2YS9 A;  4Y33 A;  4A2U A;  4MHG A;  1W0T A;  4KA4 A;  2F5D A;  5DCM B;  1JT6 A;  1U5T A;  2XGX A;  2F4M A;  3CCJ 1;  1YUK A;  2KIS A;  4HH4 A;  4MFE A;  1H9G A;  2W03 A;  1KC8 2;  3P5J B;  2VF1 A;  4LMY A;  3ASN H;  3QP5 A;  2V4J C;  1RUO A;  1Y56 A;  2E2H J;  3LSJ A;  5DD8 A;  5BOX A;  1SIW A;  1OYI A;  2UUZ A;  5HLT A;  3L00 A;  1B4A A;  2PMZ A;  1ZH5 A;  1N25 A;  3DQV C;  1SD5 A;  5L3B A;  3D5R C;  2W24 A;  4F92 B;  2W57 A;  2XAG A;  3S1Q I;  1UEL B;  4M3B A;  5HS9 A;  2RQP A;  4NBC A;  1JUP A;  2MBF A;  1YIT 1;  1YS6 A;  1X1A A;  3MZY A;  2HQN A;  1SD4 A;  2VXD A;  5FD6 A;  1UB9 A;  1ZG1 A;  3F6V A;  1H0M A;  2KRH A;  2C6Y A;  3CD6 I;  2BE5 F;  1P7J A;  3CCU 1;  5LL6 f;  1R5G A;  1VQP Z;  2CW0 F;  3NWT A;  2ACJ A;  1TW2 A;  1FWZ A;  3L2U A;  2CS3 A;  2RNJ A;  4TV7 A;  3P7N A;  4BXF A;  3SDG A;  1V5G A;  1Z02 A;  1JJ2 Z;  2JQ7 A;  4EJO A;  3MKY B;  1ZEL A;  5FKK A;  3ONQ A;  4E7Z A;  3G4S 1;  3CCS 1;  1RZ4 A;  4UNO A;  3QYE A;  4XLN F;  1Z3Y A;  5J1U A;  2XPW A;  3CCS Z;  1SFO I;  1ULY A;  2CRG A;  2L9V A;  3SZP A;  3JRE A;  4AUX A;  5JFR A;  5DUI A;  5K1Y A;  3IL2 A;  2LRD A;  4FT8 A;  1MJA A;  2W82 A;  4KIG A;  4JX6 A;  3CCV I;  2IZ4 A;  3WU1 B;  2HZD A;  2Q1Z B;  1T95 A;  2W25 A;  1BW5 A;  1FOW A;  4EM2 A;  1P4X A;  2P5L C;  3S17 I;  2VBZ A;  2HQR A;  5DS9 A;  2AKL A;  5K5O A;  4M3F A;  4NC8 A;  4XRM A;  3HSF A;  3J81 f;  3GME A;  2DTR A;  1IDZ A;  2ECB A;  5FLX K;  2VJI A;  4MTD A;  2W00 A;  4N0B A;  5M3F J;  5D5U B;  2ISY A;  2LKX A;  1OLT A;  5CYV A;  4DBR A;  4BQQ A;  5IP9 I;  3OMY A;  1MNE A;  3WHC A;  2RPR A;  3S3N A;  3F9K A;  2I10 A;  2EA4 A;  1BI2 A;  2OPT A;  3I56 I;  3LAJ A;  1X2M A;  1SAU A;  2AYD A;  5E1Z B;  3RYP A;  3WG7 H;  4IHY A;  4NB9 A;  3CME 1;  3I58 A;  2E19 A;  2GXG A;  4HV5 A;  1S72 1;  3EQL F;  3V7S A;  2KI7 B;  3PO3 S;  3MMY B;  1XGS A;  3FBI B;  3HG9 A;  1TWF I;  2JTV A;  1AWC A;  1YW8 A;  5J4Y A;  3BPV A;  4D0P A;  1Y1W I;  2R7F A;  4PCQ A;  1HLV A;  1QU3 A;  4D5F A;  5FRO A;  2DA7 A;  1FP1 D;  4M3E A;  3REO A;  3Q0W A;  4QTR A;  4FAS D;  1K9M 2;  3NAR A;  3ECO A;  5HNH A;  1Z05 A;  3EET A;  3LOC A;  5E8I A;  2HEO A;  5J8C A;  1ZRF A;  3MQ0 A;  1WH7 A;  3IKT A;  4DGL A;  3HRU A;  4HX7 A;  1ZG5 A;  3TO6 A;  2VQL A;  1V55 H;  4X1E A;  1MDM A;  3DPU A;  3CUQ A;  4RA2 A;  2VPR A;  1YI2 I;  2GIV A;  3L2V A;  1G6N A;  3KYC B;  4A93 J;  3ABT A;  4UUV A;  2EZK A;  3I56 1;  3OOP A;  5K7F A;  3G1O A;  2ZBK A;  2ADU A;  1JJ2 Y;  6PAX A;  2VBX A;  5T64 A;  4XOP A;  3J80 f;  1XDU A;  2QVO A;  2F5C A;  1CF7 A;  1NHA A;  3OYG A;  1LDK B;  1FTZ A;  1VQM Z;  4QTT A;  2XF5 A;  2A6H F;  3H35 A;  2PM9 A;  4LB5 A;  3G1M A;  1BBY A;  3CC4 1;  2M7B A;  1DUX C;  2PQ8 A;  5M3M J;  2PG4 A;  5C4J J;  4BHP A;  1KC8 1;  2PMU A;  4ZTF A;  3E5Q A;  2QEX I;  4M71 A;  2LTP A;  3CPW Y;  1XTA A;  3D0S A;  1VQ6 Z;  3JSP A;  4L5I A;  1KA8 A;  2VPW A;  3BQY A;  3GFI A;  1FPQ A;  4LFU A;  4CH7 A;  3GTL J;  2PEX A;  5DTD A;  3FMS A;  2BXZ A;  2QSH X;  3HUG B;  3GKQ A;  1JXS A;  4D7M A;  4BDY A;  3H1C A;  4RAY A;  3R4K A;  1OCC H;  2QQB A;  4B43 A;  1SVM A;  5IP9 J;  2KDO A;  4CSW A;  3CPW Z;  2IP2 A;  2EZL A;  2J5P A;  3HUG A;  2LBF B;  3G4S I;  3I4M J;  1LEB A;  1BC7 C;  1IDY A;  3WTS C;  1N78 A;  1Y0N A;  3CTA A;  3GFL A;  3IH3 A;  4GDF A;  4RVG A;  2GXB A;  4FHT A;  4BBS I;  1V5E A;  4JBA A;  1L1O C;  2VQG A;  4PJ0 C;  2L4A A;  5D5V B;  1WQ2 A;  1WGX A;  3K4M A;  3M1E A;  4OIN F;  4EJV A;  2YAD A;  3BG0 B;  1FJL A;  1HSJ A;  3G2B A;  5A2Q K;  2IPQ X;  2CUJ A;  2NAP A;  2D45 A;  1DL6 A;  2ZME A;  1QQI A;  2FOW A;  4XL9 A;  4BJ6 C;  1VFC A;  2BY0 A;  4GCV A;  2XGE A;  1K78 B;  3CJR B;  2L9N A;  1T6S A;  4OAY A;  4EM1 A;  4O5V A;  2JA2 A;  3HOY I;  3IC7 A;  1KYW A;  3C2B A;  4WF2 A;  1VND A;  2STW A;  3I0T A;  1R7J A;  1FYK A;  1SFU A;  2FQ4 A;  3A02 A;  3W2V A;  3W2W A;  5ILV A;  2RN7 A;  1AKH B;  2XV4 S;  2EIJ H;  2IW5 A;  4S0H B;  2FJ1 A;  4F52 A;  4LLL A;  3B02 A;  2DPD A;  1NK2 P;  3MZK B;  3CCL I;  1A35 A;  1ZK8 A;  2OQG A;  2YSR A;  4JX4 A;  1Y1V S;  2VT2 A;  3WTU C;  1MNM C;  3QPS A;  4WX9 A;  4OMZ A;  5J1R A;  3FQQ A;  1SFX A;  4L9T A;  2WWY A;  1KRL A;  1F1Z A;  3BJO A;  3CC2 Z;  5LFA A;  5LRR A;  4CUG A;  5FRM A;  2DT5 A;  3CP2 A;  2V9K A;  1XGM A;  1IGN A;  1N77 A;  1KQS Y;  2CV0 A;  2X9D A;  2HZT A;  1X4O A;  2NS7 A;  2E2J J;  4JX5 A;  4ITV A;  3BR0 A;  2ECC A;  1SFE A;  1XPX A;  1S7A A;  3DBL B;  3K4C A;  4X6A J;  2UV1 A;  1JT0 A;  3BLY A;  4YRV A;  1VQ4 I;  2NVT I;  1ACI A;  3B73 A;  4FE4 A;  4PJL A;  2M87 A;  3M07 A;  1G3S A;  1V3F A;  2QLV B;  3QOD A;  1F9N A;  3OWT A;  4UVC A;  2X1D A;  2VN2 A;  5D6F A;  2DOD A;  2O8X A;  4E7S A;  3OYJ A;  1WRJ A;  1M1K 2;  4KT6 A;  2XKP A;  1K8A 1;  4E7H A;  2E7W A;  1EH8 A;  3B6A A;  3S2D J;  2JK3 A;  4AVP A;  2ID3 A;  2M4G A;  2QEX Z;  2BVL A;  1FP2 A;  5IOY A;  3FIS A;  2R93 J;  2Z3Y A;  1SD7 A;  4PJN A;  4CHU A;  2DU9 A;  2Z1D A;  1IF1 A;  3CCJ Z;  4C9Y A;  4IHW A;  5LHH A;  1VF9 A;  4WWC A;  1RPW A;  1A6I A;  4C2M J;  4EMS A;  1RO2 A;  5HDG A;  3Q0U A;  4L18 B;  2EZH A;  4XKC A;  2V9P A;  5FLM I;  2Z5U A;  1R9T I;  2RQQ A;  3CCE Z;  1VQ9 1;  1I27 A;  1Q81 1;  3MAJ A;  4Z6Y A;  3HTS B;  3CD6 1;  2HFH A;  3ZP5 A;  2ZFW A;  1YW7 A;  1MBF A;  1H89 C;  2G0E A;  2KFD A;  2NXN B;  2EQR A;  2ZCW A;  3J7A O;  3PNY A;  3GYH X;  2P7C B;  1WI3 A;  1YI2 Z;  1TQI A;  1ZLJ A;  3DP7 A;  2E71 A;  1WW9 A;  4HQM A;  1A36 A;  3FK7 A;  3SDB A;  3TO7 A;  3DBH B;  2I8D A;  1GXQ A;  1Z3X A;  5F1R A;  2OD5 A;  1ZB8 A;  2O4H A;  4XLH A;  2IS1 A;  2HOT A;  2D2W A;  1Q1H A;  2DMN A;  3K6G A;  4UUS B;  2QBY A;  4G6Q A;  2F4O A;  3VOD A;  2O9L A;  1MMD A;  4S1T A;  3FXQ A;  1Y1W J;  2XAF A;  2LFU A;  3KFW X;  4ZZL A;  2VQH A;  4XID A;  3J80 Z;  3NQO A;  2DJN A;  1XCB A;  1WCM J;  1OCP A;  1NP6 A;  2HXI A;  3OYK A;  4HBL A;  3CCJ I;  2LR8 A;  1B8I B;  1IN8 A;  3CCQ 1;  1ZG3 A;  2IAI A;  5E3L A;  4L9J A;  3SEQ A;  2GTI A;  1NTC A;  2R7X A;  1U5T C;  4D1Q A;  1Z91 A;  4XM3 A;  3BR3 A;  2XDV A;  2ZXJ A;  3WHB A;  3OY9 A;  1LVK A;  3QRF F;  2A61 A;  2V1X A;  4U0V A;  5C4X I;  3CCL 1;  5ICG A;  3KX2 A;  2K5R A;  1AU7 A;  2QKM B;  5C44 I;  1MW7 A;  3R61 A;  2HPI A;  4NC6 A;  2Y2Z A;  1KZH A;  4BU2 A;  2E7X A;  5A2Q f;  3F3P C;  1VTN C;  1JJ6 C;  4WXH A;  2V6E A;  3CCQ I;  2VKH A;  3V4G A;  4ENN A;  1A5J A;  3DKW A;  2W4S A;  1FIP A;  1G3T A;  4AWX B;  3EYY A;  4W97 A;  2VPX A;  1LDJ A;  1N8R 2;  1Y8Q B;  3PQJ A;  3MN2 A;  2Q4Z A;  3PIO F;  2LKS A;  2XB0 X;  4OMY A;  1FMW A;  3U9G A;  2EIN H;  5GP9 A;  1XSV A;  3MCZ A;  1U8R A;  4HF2 A;  2STT A;  3I71 A;  2MFZ A;  3TOA A;  1VQO 1;  3JTG A;  4EGZ A;  2K9N A;  3BTI A;  5HOO A;  5GPA A;  2OJE D;  1RIO H;  3OYF A;  3ZCO A;  5FFZ A;  4NBD A;  5BNG A;  2VXZ A;  1R5I D;  2WAE A;  4DGW B;  2L9S A;  2ID6 A;  1JKR C;  3DTI A;  1K79 A;  2GOM A;  1IC8 A;  1P4W A;  2FOK A;  4S05 A;  2VUM I;  1B1B A;  1VZ0 A;  1Y6I A;  3CCR Z;  3S32 A;  1XSX A;  4WXD A;  3NFZ A;  1K7A A;  1A6Q A;  3ESW B;  2DA5 A;  1PJR A;  1FMV A;  4P1W A;  4NFR A;  4FE7 A;  4P55 A;  4NQW B;  1SVO A;  4I7H A;  1BIA A;  2W1O A;  3OR2 C;  4RAG A;  4WXC A;  5EEG A;  2HPM A;  3FXO A;  3ZQG A;  1E3H A;  2IS6 A;  4NB5 A;  5JVG F;  1LE8 B;  4GFB A;  3IUO A;  4IF4 A;  1FBU A;  1LKX A;  3IP4 B;  3CO7 C;  2HDW A;  2BHY A;  4HAM A;  4I6Z A;  3HSE A;  3IAM 2;  3QP6 A;  5H6Q A;  5IYB J;  1HQC A;  4X6A I;  2P3Y A;  3EPZ A;  2DPU A;  2WAQ A;  3IFU A;  4XQF A;  4U7B A;  2IEK A;  5GAD J;  1LFP A;  4G9Y A;  4R79 A;  1MMS A;  2K9S A;  1B72 A;  1LVA A;  5F0F A;  1QRY A;  2DQL A;  3KEY A;  5LLQ A;  2HQ5 A;  4BJ5 C;  4MTE A;  3HOU J;  2KZG A;  3M4O J;  2RBL A;  4LK0 F;  4OOI A;  2KRF A;  3JCU C;  4KIS A;  4E7I A;  4XOR A;  5BPI A;  2W7N A;  1QA6 A;  2F5E A;  3ABK H;  3ROU A;  1GV2 A;  1T0F C;  2P8T A;  3CJQ B;  3ZMU A;  1Q7Y 1;  1ZB9 A;  1ZR4 A;  4LGW A;  3V8K A;  2QRD B;  1LQL A;  1HOM A;  3LFK A;  1K73 1;  2DA3 A;  2IA0 A;  2V6C A;  3DU5 A;  1BA5 A;  1E2X A;  1I50 J;  5K7Z A;  3E5X A;  1IV8 A;  3KEO A;  3CCR I;  1REP C;  4E2W A;  3CF2 A;  2X48 A;  2FBI A;  3HOY J;  1FYM A;  1O3Q A;  2M1B A;  3J80 K;  1YRN B;  3RDI A;  1TWH I;  4RGU A;  1ZH1 A;  3SZG A;  4L5E A;  3JAM Z;  3JTH A;  2NOG A;  3OYB A;  2R6M A;  3NEU A;  2MGQ A;  1LJ9 A;  2VL8 A;  1CQT A;  1DP7 P;  2R7V A;  3J7Z I;  5IT9 Z;  2CV1 A;  2ZXH A;  2R7S A;  1S7O A;  3GTP I;  3H5N A;  4ZDO A;  3K4L A;  3PL8 A;  3CME I;  2UWM A;  4U0W A;  2FBK A;  5FKL A;  1Y39 A;  4RM2 A;  2IXS A;  3CXC Y;  1I1G A;  3IV5 A;  2VJJ A;  1FNN A;  4RM3 A;  3CMY A;  3QPL A;  1WJ5 A;  3ZQI A;  3AG4 H;  1WJ2 A;  3K1P A;  4CCN A;  4L9N A;  3OYI A;  4CCL A;  1ZYR F;  1BR4 A;  2YPR A;  3H36 A;  2OQR A;  2JSP A;  4A3C I;  2XAQ A;  4UV8 A;  2TCT A;  1U2W A;  3CDL A;  3RKW A;  2P5K A;  5E3N A;  4ZDP A;  3DXJ F;  3HRT A;  2OTJ Z;  4RVH A;  1UAA A;  2JIQ A;  3H92 A;  4HQE A;  1RET A;  1B9N A;  3K9T A;  5T6B A;  2K9L A;  2LF8 A;  4E7J A;  2WB1 N;  1YX5 A;  5C4J I;  2DE5 A;  3OSG A;  2DYS H;  5GAG J;  4HEA 2;  3FXM A;  4KNY A;  3FKI J;  4OU0 A;  2K27 A;  2A05 A;  4BH9 A;  2OTJ I;  4O3M A;  1LDD A;  1Q7Y 2;  2ZXW H;  4B47 A;  2JRT A;  4EM0 B;  2KL4 A;  2B7E A;  2VI6 A;  4QIW N;  5EYR A;  1EJ9 A;  3S16 J;  1YJ9 1;  2JA6 I;  3BG7 A;  5D4S A;  3QU3 A;  3WU2 C;  4HDU A;  1WFX A;  1WI9 A;  3BZK A;  1RO0 A;  4BL0 B;  3NDI A;  3CMA Z;  4PGG A;  1RR8 C;  3TE5 B;  3D2L A;  5D5W B;  4RMN A;  5E3M A;  2ZJR F;  1MBK A;  1MIJ A;  4YIF A;  3KIF A;  4S04 A;  2HKO A;  2G7H A;  3FHZ A;  4ZYA A;  3F72 A;  3FF5 A;  4A3I J;  1HST A;  1W2B Z;  1LUJ B;  2R5Z B;  3EED A;  1YI2 1;  1U5T B;  3OV8 A;  3F8F A;  2O53 A;  4BBR J;  1R58 A;  1TT0 A;  2BOL A;  4CXF A;  5HLG A;  3CCE I;  5H20 A;  1T2K A;  1BOA A;  3VSK A;  2QR1 B;  5CVV A;  3CC2 1;  3OIO A;  4HF1 A;  2V8J A;  2MH9 A;  1WJD A;  1T38 A;  2DK8 A;  2OTL I;  2QRC B;  4I02 A;  1W2B Y;  2EV6 A;  2R93 I;  3O2P E;  4RLQ A;  4PJM A;  2ZME C;  3U21 A;  1FY7 A;  2K02 A;  5DM6 F;  4RB2 C;  1PUE E;  1DPR A;  3KIH A;  3D5L A;  3S1M J;  5J1Y A;  4LG0 A;  3FXU A;  1NK3 P;  1AA6 A;  5GTI C;  1TBX A;  2Y48 A;  2M3A A;  3F6O A;  2VJ4 A;  4BXU A;  3TMO A;  1KQ0 A;  1XB4 A;  2J6A A;  2LMD A;  4XLP F;  3I07 A;  3M3Y I;  1QVU A;  2H09 A;  2PBI A;  1TT5 B;  2M7A A;  5FB2 A;  1W4M A;  3WGI A;  2YX4 A;  5FFX A;  1HW5 A;  3O8H A;  3N05 A;  4XR6 A;  4AVZ A;  4PK4 A;  3ZMV A;  4A3E J;  3RPQ A;  4MGR A;  1TWC I;  3D9X A;  1IAW A;  3HZJ A;  5CVU A;  1APL C;  4AM3 A;  1IUF A;  1VQK 1;  2GA1 A;  2VOD A;  2CU7 A;  1IJW C;  2V1D A;  4BAY A;  4A5N A;  2NVQ J;  4IRH A;  1N2F A;  4CCO A;  2NVY I;  1IUY A;  3AFH A;  2I3C A;  3BTJ A;  2Z2S B;  1MBH A;  3I64 A;  1J0R A;  3SZT A;  4QSH A;  1U9O A;  2VKE A;  3D5S C;  4BY1 J;  3KP7 A;  4G6T B;  3CO6 C;  1YJW Z;  3GTK I;  4E33 A;  3WOD F;  2Y31 A;  3S17 J;  2M8G X;  3FX3 A;  3NRV A;  3G71 Z;  2R7Q A;  2EFN A;  4V19 K;  1NUI A;  3PJR A;  3LSG A;  4A3J J;  2P6S A;  3Q9V A;  4UVB A;  2TRT A;  2WAD A;  1FZP B;  2DN0 A;  3BG1 B;  1YX3 A;  2JA5 J;  3PO2 J;  4K2E A;  3H3V J;  2FXA A;  1R22 A;  4HW0 A;  3DF8 A;  2VKV A;  3U1D A;  3J81 Z;  5J40 A;  3CCV 1;  2M30 A;  4L5J A;  1X0T A;  5TIS C;  3GFJ A;  3TQN A;  3M8J A;  2WV0 A;  3LSM A;  1JKQ C;  3VDX A;  5IY5 H;  1DGW Y;  2O5R A;  2E1N A;  1FOK A;  1Z6T A;  3GVA A;  2LH9 A;  1KGS A;  2XHK A;  3HKZ N;  4UUS A;  1H9T A;  2V1U A;  3C1D A;  4NBF A;  2GA2 A;  1MMA A;  1VQ5 1;  4Y15 A;  2K9Q A;  3S8P A;  1D1C A;  4B44 A;  1VQ8 I;  4Y13 A;  3DKY A;  4HYE A;  3K10 A;  4QPQ A;  2ME6 A;  1V54 H;  4AIK A;  3I4M I;  1RO4 A;  5TRD A;  3UKG A;  3BC8 A;  1SMT A;  4BEH B;  1JHH A;  3DEU A;  1PVE A;  3H3V K;  3FDY A;  4HLX A;  1BL0 A;  2DQR A;  1BI0 A;  2G2K A;  4DQ2 A;  3LSK A;  3FIW A;  3NDJ A;  2HOE A;  1W1W E;  1WZ2 A;  1S72 Z;  3RZO I;  2QA4 I;  3JAM K;  1KU2 A;  3HOX J;  2E2H I;  1SMY F;  1VQK Z;  4GYI A;  1W7P B;  2CQX A;  3M8E A;  1T39 A;  4HGY A;  3U50 C;  2BXY A;  5ICF A;  1IRG A;  1P2F A;  2QA4 Z;  2GIZ A;  1UCR A;  2HTS A;  4ON0 A;  3RTR A;  2BZT A;  3SEZ A;  1BM9 A;  4BE2 A;  4OWR B;  3LQQ A;  2HU9 A;  4XX2 A;  1J75 A;  3DTE A;  2OCE A;  1P9Q C;  2DOE A;  1WWX A;  4RVD A;  5IYC J;  3L1P A;  3ABU A;  3L2R A;  3N97 A;  2IGO A;  2R5Y A;  3KP2 A;  1FT9 A;  1F4K A;  4MFD A;  4G7H F;  2R7Z I;  4DZJ A;  3I4N I;  1HKS A;  3HRM A;  4HX4 A;  3A01 B;  5CJ9 A;  1ZN2 A;  1WVR A;  4AC0 A;  2WY8 Q;  2PMH A;  4I0A A;  1K83 J;  4M6X A;  2NNY A;  3A03 A;  3FMQ A;  5CVI A;  2DT7 B;  3H9G A;  1R49 A;  1QNT A;  1HC8 A;  3JAM b;  1P92 A;  3M8F A;  3J7Y J;  3S3O A;  2KT0 A;  1WKM A;  2YU3 A;  2Q51 A;  3JRB A;  3HEF A;  3NH5 A;  2A69 F;  5C3E J;  3G1L A;  3BR5 A;  3BT9 A;  2JA8 J;  2EA2 A;  1R4N B;  3R0J A;  1R4M B;  2WBM A;  4KIB A;  1ODD A;  3HHH A;  2E34 A;  3BG5 A;  3DEW A;  3I5U A;  2P5V A;  2VOO A;  2O61 A;  2MC4 A;  2VBW A;  3GX4 X;  3C7J A;  2KPI A;  1AHD P;  2W85 A;  2O03 A;  3CCY A;  4FX4 A;  2JIO A;  2K4J A;  2VE8 A;  3S14 J;  1I39 A;  1XN7 A;  5IT9 f;  1Z1D A;  2ZME B;  3ZR8 X;  1OR7 C;  2EGT A;  2IJL A;  4GXO A;  3LUS A;  3KP6 A;  2XAJ A;  4R1H A;  1QF8 A;  3DEE A;  1VQN Z;  3OW2 Y;  4U87 A;  2F4O B;  3ISP A;  2GAU A;  3T4N B;  3ZPL A;  1E17 A;  3HOZ I;  1RUN A;  4XN0 A;  3HIF A;  1HXD A;  4CL1 A;  4ZYH A;  2ZSH B;  2OOX B;  1FEX A;  3G6E Z;  3GTQ J;  3EUK L;  5EZH A;  2CFO A;  3RZD J;  2UXN A;  3ZRG A;  3H9Q A;  1QZZ A;  2A07 F;  2WV1 A;  4M72 A;  3FXL A;  1XX5 A;  3U1K A;  2ZAE B;  3S1N I;  2K5C A;  3R6S A;  2ZO4 A;  1WII A;  3CCU Z;  1O3T A;  1VQP 1;  2FQ3 A;  4MQ9 F;  4YFK F;  1SAX A;  2EFQ A;  2DBB A;  5CVJ A;  4EAT A;  1K6Y A;  2Y0S N;  2GU2 A;  3QQA A;  2PJR B;  3O6B B;  1ETY A;  1BC8 C;  3CC2 I;  5BMZ A;  5L3F A;  3ZN0 A;  2ETH A;  5EJC A;  3MZ8 A;  4M74 A;  1EF4 A;  2DFI A;  5HDN A;  3WTT C;  3CCL Z;  4WCG A;  3VMG A;  2L2O A;  1ORK A;  4ENJ A;  3M1C A;  2JA7 J;  2PFB A;  5EEA A;  3T5X A;  1TL8 A;  2AXT C;  1SFO J;  4BDZ A;  1DQU A;  1IXR C;  5FKN A;  2XC7 A;  3Q5F A;  1YYV A;  1PP8 F;  5C3E I;  1W7P A;  5KK1 A;  1K4T A;  2OUM A;  1TWG I;  1MND A;  4CGZ A;  3HOV I;  3J7A Y;  4I2O A;  4DYQ A;  2XSJ C;  3GW2 A;  3F8N A;  5CQG A;  3T0Y A;  1ZTR A;  3AG3 H;  2VOP A;  3DV8 A;  3M7G A;  3T1B A;  2DTZ A;  2ELJ A;  3TL4 X;  4IQJ A;  3MKL A;  1G59 A;  1ONV A;  5KAI C;  3OYH A;  4IOA F;  3GO5 A;  4LG3 A;  2EH3 A;  1OCZ H;  5F04 A;  3V7C A;  3LSP A;  1ZR2 A;  2B63 J;  4O6J A;  5L3E A;  5D8L B;  1YJN I;  1LFU P;  2LVS A;  2OTJ 1;  1Z01 A;  3OYC A;  2QLZ A;  3WE2 A;  1MDM B;  2EIM H;  2DXI A;  1T8I A;  2L02 A;  3RKY A;  3WG9 A;  3V42 A;  2KRC A;  4A3G J;  2W04 A;  4QWQ A;  3J81 K;  4MXU A;  2Y0M A;  3BCB A;  2IV2 X;  3WE3 A;  3HC7 A;  1Y0U A;  5KAF C;  1JE8 A;  2IBD A;  3L2C A;  2JS4 A;  1MBE A;  5M5X J;  1U8B A;  3RSN A;  2CQ7 A;  2VC0 A;  4Y7N I;  3E6B A;  2PN6 A;  1ZGW A;  2KQR A;  3VEP A;  2Z33 A;  1BR1 A;  4AD9 A;  3KZY A;  3BTC A;  2JIP A;  1OCO H;  1EKE A;  2M45 A;  4Y7N J;  5HDK A;  2EB7 A;  3TO9 A;  3GTO J;  2M8E A;  4XLC A;  1I6X A;  1MH4 A;  3CQZ I;  5EG0 B;  2JZY A;  1MJB A;  3BZC A;  5LGU A;  2DMT A;  2R92 J;  3RQ4 A;  3N4M A;  5KNL A;  4EWC A;  4A3G I;  2QUF A;  3Q9S A;  1WJB A;  2QKL B;  2R0Q C;  1QYP A;  1U9N A;  4FQG A;  3UNG C;  3I54 A;  1I3Q I;  1QVF Y;  3CLQ A;  3V8L A;  4RAZ A;  2H8W A;  2ICW G;  4MIM A;  3MKZ A;  3F23 A;  1VQ7 I;  3CC4 I;  1U3E M;  1T33 A;  5F08 A;  2VB6 A;  4XLE A;  1FOX A;  2KZV A;  5LGN A;  2MLK A;  4L0Y B;  4JK1 X;  2TDX A;  2L7M P;  3LSR A;  1UMQ A;  4L9V A;  4A3D J;  4HRI A;  4M9X A;  4E2Z A;  4IPA A;  2E7Z A;  3RYR A;  2L54 A;  1XMX A;  2MSY A;  4NDL A;  3GWZ A;  1SD6 A;  4X0G A;  2V9V A;  3HOV J;  1O57 A;  4LLG F;  1ETQ A;  1XCV A;  1G3W A;  2HYF A;  2HQA A;  3P5J A;  1QZE A;  4CYC B;  1O7L A;  3CC4 Z;  1LFB A;  4WK8 F;  1OIS A;  2EPF A;  1X58 A;  3E97 A;  2XGC A;  3JRA A;  3DPL C;  4I01 A;  3I55 I;  1S7E A;  3QOE A;  2BY1 A;  1YFH A;  3G71 1;  4A0Z A;  3K7A J;  3MD2 A;  5DD4 A;  3JSO A;  1ZLK A;  4LG0 B;  5IP7 J;  1KD1 2;  2IS4 A;  4A3J I;  1G2H A;  3BCA A;  3FM3 A;  1YJW I;  2ZJQ F;  2M48 A;  1TNS A;  2EZI A;  2Y9Y A;  2M6N A;  2P7V B;  2VBY A;  2NOJ B;  2X1C A;  3ERE D;  2H8R A;  2X51 A;  5E79 C;  1WJE A;  3WTZ A;  3CES A;  3LQR A;  2L7F P;  1X1B A;  3EYI A;  4KFC A;  2ZNY A;  4EJW A;  2NYX A;  1RNL A;  3LFU A;  5D6E A;  1FTT A;  4NBH A;  3IX0 A;  2DK5 A;  2F5F A;  2AQF A;  4C2T A;  1JWH C;  2L01 A;  3VB2 A;  2HI3 A;  2LC2 A;  2IA1 A;  3WTX C;  1BW6 A;  3Q0V A;  1BJA A;  2GWR A;  1GVD A;  2RGV A;  4KMU X;  3HM5 A;  4XSZ F;  3OS2 A;  2NAZ A;  1XGN A;  4BE0 A;  1Z6R A;  2KIQ A;  4BXX J;  1BIB A;  4XSX F;  1BI3 A;  4A5M A;  1RLY A;  3RZD I;  3GTQ I;  1O3S A;  1BR2 A;  2XAU A;  4CYC A;  4BE1 A;  1QVT A;  4E70 A;  3JRG A;  4N9I A;  2E36 A;  1JHF A;  1YJN Z;  2YU9 I;  4F3Q A;  4RGX A;  4A3L I;  3C2G A;  1TWA J;  3MZL B;  3VTN A;  3ZMD A;  4PSX A;  5IPA A;  2GQQ A;  2XVC A;  2X0L A;  5F6F A;  5D8K B;  3H5R A;  3TED A;  3WU0 A;  2XPV A;  4QLC U;  2H94 A;  1RKT A;  2A6T A;  2ZNZ A;  5AN9 F;  1MMG A;  2LK2 A;  4ZC3 A;  3SJM A;  2E2I J;  1QO0 D;  2OTL Z;  3ULQ B;  2XF6 A;  2BY3 A;  3QYB A;  5HLI A;  5A2Q b;  2LKP A;  3BG6 A;  4M9S A;  4C3H J;  3VYT B;  2A3S A;  3J81 b;  4CYD A;  4DQY B;  3IH2 A;  4IKF A;  4XRS A;  2R5Y B;  2HS5 A;  2BVM A;  3S2H J;  4BS9 A;  3C2H A;  2KDZ A;  2D1H A;  3DTK A;  4G7Z F;  3P9C A;  2RC4 A;  5J6X A;  5GAH J;  1F36 A;  4A3B I;  3GZ5 A;  2CYY A;  4A0X A;  5LRS A;  2V7F A;  5FLX Z;  2UXX A;  4DZP A;  4UB8 C;  4KN4 X;  4KDP A;  2MH2 A;  3PFI A;  3MWM A;  1R1U A;  3F0C A;  2VPY A;  1D1B A;  4BY7 J;  3ZMZ A;  2LYC A;  2N8G A;  1POG A;  1RI7 A;  3ZQ7 A;  2HR3 A;  4FCY A;  4ETS A;  2CG4 A;  3CD6 Z;  3HOW I;  3DU6 A;  3S1R I;  2F5V A;  3W6J B;  3JRD A;  2E9H A;  2K4B A;  1IRF A;  4U88 A;  3BTL A;  2RNG A;  1NG6 A;  3BY6 A;  1UZC A;  2CMP A;  2WB1 A;  4LOC A;  2HYJ A;  2L4M A;  4FX0 A;  4C3J J;  2B9S A;  1VQN I;  2JNY A;  2AXL A;  3F8M A;  5FLX f;  4UUT A;  4JP0 A;  2PX9 A;  3EUH C;  3VOE A;  4AIH A;  3SXY A;  4IO9 F;  4RV9 A;  4MON A;  1EA3 A;  4ABZ A;  2K3P A;  4ZZD A;  4XLA A;  4IJA A;  2LNB A;  2K3F A;  3T8T A;  3HOX I;  1CGP A;  1J7K A;  5E20 A;  1Z03 A;  3CCM Z;  2CQN A;  1OYY A;  1KU9 A;  2LRE A;  3EUH A;  3GZN B;  3HSR A;  2PMZ N;  4IX7 A;  4I98 B;  4A3C J;  5DEQ A;  1GXP A;  4D5C A;  3FQM A;  1XS9 A;  5IP7 I;  3I9V 2;  4ZYE A;  9ANT A;  1VQ8 1;  3L7W A;  5GPC A;  2B0L A;  2HNH A;  2FX0 A;  2VAS A;  2BGC A;  5AIP A;  2O3F A;  4OIP F;  3PUF A;  1PDN C;  4FET A;  3TGN A;  4KUM A;  1MSE C;  4M6V A;  3OYE A;  1XC5 A;  5B5E C;  4LIU A;  2R5Z A;  2EFO A;  2OU2 A;  1UFM A;  1D0Y A;  2NVX J;  2HVS A;  2V45 A;  1ZKG A;  1UHM A;  1K73 2;  3JAM f;  3KPH A;  4E2Y A;  2NNN A;  1KON A;  5K5Q A;  4E7K A;  2L5Q A;  1YIT Z;  2NVX I;  4NBQ A;  3IWZ A;  1TW3 A;  1S6L A;  4ZYD A;  4NB8 A;  2RIQ A;  3KIO A;  1OFC X;  1S3J A;  4HG2 A;  2LLK A;  3TKY A;  4Q4Z F;  4A3F I;  3A4C A;  5AON A;  1F5T A;  1MH3 A;  2RKH A;  4W1U A;  2Q2E B;  5F27 A;  3P9K A;  1LE8 A;  4UY8 I;  3CLO A;  2CW7 A;  5D5X B;  5F0C A;  3PO3 J;  1USP A;  2OA4 A;  3ML6 A;  1KQ8 A;  1ZRE A;  3E6D A;  2KIU A;  1QBJ A;  4HLY A;  4HGZ A;  1I1S A;  1U78 A;  1Q86 2;  1J5Y A;  2DYR H;  3RCO A;  3TDH B;  2VC1 A;  1X3W A;  3K1N A;  2O0Y A;  3L9F A;  2FD5 A;  4Y52 J;  2WAQ N;  2HVR A;  3HOU I;  1VQK I;  1JI8 A;  4Y4R A;  4A12 A;  3H0G J;  5FD5 A;  1HDD C;  5FO5 A;  1JKO C;  4C3I J;  4U7D A;  5E3O A;  2VE9 A;  1N8R 1;  2Y69 H;  2JR6 A;  3MFK A;  2DE6 A;  2CWE A;  3GTM J;  1TWC J;  1JTX A;  1X3W B;  2RT9 A;  5F1J A;  3RIR A;  4TNU A;  2FSW A;  2V8K A;  3CCM 1;  2IT0 A;  3LSI A;  2FRH A;  1NG7 A;  3W6K B;  3OYA A;  4PZJ A;  2LD5 A;  2XRN A;  5L3C A;  4YFX F;  1OKR A;  2ELK A;  1W5C C;  4BAC A;  2AQE A;  2R7O A;  3OYM A;  2Q2E A;  3Q3S A;  1Y8C A;  3AL0 B;  4NNJ A;  5A2Q Z;  3BJ6 A;  3VB9 A;  2LDU A;  5JI6 A;  3PM1 A;  2ZB9 A;  4XK4 A;  1ETV A;  1IXS B;  2QKD A;  3CMA 1;  2ME0 A;  4IQ4 A;  3ZMT A;  3F3X A;  3PUB A;  2R7U A;  1GT0 C;  1V5F A;  1ML8 A;  3OS0 A;  3BG3 A;  4BHB A;  1JUS A;  2DFE A;  1SFK A;  5B66 C;  3A2K A;  4E4H A;  2HVQ A;  5J47 A;  4RB3 C;  3TW7 A;  2LFB A;  1ETW A;  2LY2 A;  2DCE A;  3WTV C;  3E6M A;  2DFH A;  4LIT A;  2NRA C;  1T0F A;  1X3U A;  3OS1 A;  3ZXS A;  1FSE A;  4DJA A;  5JHU A;  2E1C A;  3G71 I;  4B09 A;  1QHG A;  1GV5 A;  4EJT A;  3I55 1;  5CLS A;  4D9J A;  3O8G A;  4BXX I;  5LGT A;  1VQ5 I;  4BGD A;  2WC2 A;  2CQK A;  3T8R A;  2KHM A;  1PUF B;  2F48 A;  4NHJ A;  1NJI 1;  3IRR A;  3GTM I;  1TP4 A;  3V7R A;  1M1K 1;  2Z99 A;  3K2A A;  3E6C C;  1S5L C;  4RS4 A;  2KPM A;  2RVC A;  4ZJZ A;  1YTY A;  3P9I A;  5J3L A;  4XOT A;  5EEH A;  1SEU A;  2KP6 A;  4HNU A;  3S1N J;  4NH1 C;  2VJ5 A;  1D3Y A;  2M9H A;  2G9W A;  1ITY A;  4AIJ A;  3U2R A;  5D1P A;  2WAF A;  3G6E 1;  1L3L A;  1VQ6 I;  5FKO A;  4UVA A;  3CZ6 A;  1D1A A;  2QM3 A;  2XAH A;  1G4D A;  5DYM A;  2HGC A;  4NOZ A;  1WH5 A;  3I53 A;  2CV2 A;  4P9U A;  1GVJ A;  3GLX A;  1JGS A;  2FUG 2;  4MD9 A;  4ANJ A;  1LNW A;  4LJZ F;  1VQL Z;  2IA2 A;  3SFI A;  1M1E B;  1TLH B;  2VT3 A;  3H3Z A;  2UZK A;  2FBH A;  3E5U A;  1JKP C;  4MD8 A;  2EV5 A;  4XMY A;  1RQF A;  1VLA A;  3OR1 C;  1FBQ A;  1X1D A;  2A5W A;  3K7A I;  3FXJ A;  1UHS A;  2E1O A;  3PQK A;  5EF6 A;  3PNV A;  4RAF A;  1Z7U A;  5EG0 A;  4RS8 A;  4F91 B;  2EFW A;  1SC7 A;  2PLY A;  1VQ6 1;  3KET A;  3FZV A;  3LA3 A;  1YIJ Z;  4KN7 X;  3KZZ A;  2CUF A;  1JGG A;  2QSG X;  2R92 I;  2XRL A;  3TP3 A;  1WPK A;  1WZN A;  1P7I A;  3AL0 C;  5DM7 F;  4B3X A;  4PGH A;  4B48 A;  5LEJ A;  1MD0 A;  1M90 1;  4BQA A;  2ZXI A;  2MD0 A;  5IT9 b;  4A3K I;  4A3D I;  3CC7 Z;  3CCR 1;  3E0J B;  3CUO A;  1FYL A;  2CFX A;  2H1L A;  1VQL I;  1VQM 1;  2EV0 A;  1R9T J;  1ZAR A;  3ZMS A;  4HX8 A;  3I4N J;  3HBL A;  4Q47 A;  2ZC2 A;  2GM4 A;  1I50 I;  3OYL A;  4EV0 A;  3RI4 A;  1F43 A;  2HOA A;  2OF7 A;  3JRC A;  3COA C;  1QXF A;  2DMP A;  1GHC A;  5DDG A;  1VQO Z;  4IVN A;  5J4V A;  4AU7 A;  1TFI A;  3OIP A;  2KJC A;  3H5A A;  3GTO I;  2Q0O A;  1TZL A;  3GXO A;  3LL7 A;  1QZY A;  3S1R J;  4LLN A;  1UG0 A;  3BR1 A;  5HS8 A;  3K4B A;  1OJL A;  2OZK A;  4I76 A;  1X3Z A;  1FBS A;  2EWN A;  1NJI 2;  2B63 I;  5LHG A;  1YW9 A;  2XUB A;  1V4R A;  2QCO A;  3ASO H;  1EV7 A;  1USS A;  4P96 A;  4A3K J;  3RZO J;  1CF7 B;  4GRI A;  2AHQ A;  3GCM A;  5ICE A;  4MLO A;  2RRE A;  3KE2 A;  3PSF A;  3X2Q H;  1YJ9 I;  2LEX A;  1DU0 A;  2X1E A;  1DU6 A;  4BQN A;  3SFZ A;  2VLA A;  2DO7 A;  5F0H A;  1VQ9 Z;  2ZJP F;  1YUA A;  1XD7 A;  4PDK A;  4E7L A;  1KQS Z;  3OL3 A;  3MKW B;  4YFN F;  1S29 A;  3CUQ B;  5D4R A;  3A1Y A;  1DDN A;  4RVF A;  3S2H I;  4J00 A;  2VON A;  2JMW A;  4MH4 A;  1ETO A;  3K1M A;  3ZGK A;  3F8C A;  2LBF A;  5K7H A;  5KVR A;  3A0H C;  4J01 A;  2E2I I;  3VYR B;  3S15 J;  2IGK A;  1RC9 A;  2V8I A;  2BV6 A;  2BBY A;  3H3U A;  3GTG I;  3A01 A;  3CCS I;  2O7O A;  1K9M 1;  1D5Y A;  5J8F A;  1YLF A;  2F4M B;  1I6H J;  4EGY A;  3KEQ A;  3R60 A;  1HA8 A;  4XBF A;  4M3D A;  3SHF A;  4N4N B;  1TWA I;  1TNT A;  2DMQ A;  4MEY F;  3IR7 A;  4OIR F;  3PO2 I;  2YU9 J;  1ON2 A;  1SVL A;  4YII A;  5ERI A;  5F64 A;  1J2X A;  5T67 A;  4XRS G;  4EQQ A;  5HNF A;  2X85 A;  4P5O A;  4ZTJ A;  2R7R A;  5D1O A;  5GTH C;  2OV7 A;  3HJE A;  4XNF A;  4C2U A;  4BBS J;  3CJN A;  4UV9 A;  4DBQ A;  3HHG A;  4KT5 C;  3SYT A;  2QQ8 A;  3QU6 A;  3HOZ J;  3KP4 A;  2V3V A;  3G73 A;  2L7K A;  4HV6 A;  3GF2 A;  2EFP A;  5DCF A;  2Y75 A;  4I0B A;  4YEL A;  3PFY A;  3OYD A;  2Y30 A;  1STZ A;  2K40 A;  4IL6 C;  2M0M A;  4NC7 A;  1X3Z B;  3HOT A;  1G3Y A;  2M4K A;  4II2 A;  2EIL H;  4DYC A;  1S9H A;  4LIV A;  4E6K G;  2A6E F;  2IVM A;  1UST A;  1A31 A;  2R7D A;  4HOB A; 
#chains in the Genus database with same CATH homology
 2F6C A;  4XOR A;  3FBN B;  1ERD A;  3K4J A;  2W7N A;  4YEJ A;  1DGR M;  5JHF A;  3S3M A;  3NH8 A;  3DPL C;  4Y33 A;  1S7M A;  3QOE A;  1T0F C;  3CJQ B;  3G71 1;  3MD2 A;  1Q7Y 1;  1ZB9 A;  1KD1 2;  1I6H I;  2F4M A;  3CCJ 1;  2IS4 A;  2QRD B;  4AYB A;  1LQL A;  4A3J I;  1K73 1;  3BCA A;  1YUK A;  2M48 A;  2JA8 I;  4HH4 A;  2LG4 A;  3DU5 A;  2M6N A;  2X1C A;  2NOJ B;  4Y3O A;  2W03 A;  1KC8 2;  3P5J B;  3S15 I;  2VF1 A;  2X51 A;  4E2W A;  3CF2 A;  2V4J C;  3CP8 A;  2DT6 A;  1WJE A;  1Y56 A;  2K3R A;  3CES A;  4JOM A;  3TBI A;  1X1B A;  1W36 C;  1TWH I;  2UUZ A;  3ZQQ A;  5HLT A;  4A3C I;  2PMZ A;  1ZH1 A;  3SZG A;  3DQV C;  3LFU A;  4NBH A;  3IX0 A;  3D5R C;  3IAS 2;  4F92 B;  3AKZ A;  2AQF A;  4C2T A;  4F93 B;  3OYB A;  1JWH C;  2R6M A;  1VQN 1;  3S1Q I;  1UEL B;  4NBC A;  2LC2 A;  2VL8 A;  2R7V A;  1YIT 1;  1X1A A;  2CV1 A;  1E0E A;  3EUA A;  2ZXH A;  2R7S A;  3OS2 A;  4BE0 A;  3GTP I;  3H5N A;  4ZDO A;  3RZD I;  2VXD A;  3K4L A;  3PL8 A;  2X6Y A;  1RLY A;  3GTQ I;  4QPO A;  2UWM A;  3W3C A;  1BR2 A;  2KRH A;  2XAU A;  4BE1 A;  4RM2 A;  3CCU 1;  5LL6 f;  1YJN Z;  1VQP Z;  2IXS A;  2IGM A;  3CXC Y;  2CUZ A;  2YU9 I;  4F3Q A;  2VJJ A;  4RM3 A;  3C2G A;  3NWT A;  3D6W A;  1Q82 1;  1WJ5 A;  3MZL B;  3VTN A;  3Q87 A;  4A3L I;  4PSX A;  5KCM A;  4CCN A;  3L2U A;  2CS3 A;  3H5R A;  3OYI A;  4CCL A;  4BXF A;  1K83 I;  1BR4 A;  4CZC A;  1V5G A;  1Z02 A;  1JJ2 Z;  3MKY B;  1ZEL A;  2JSP A;  3ONQ A;  2A6T A;  4CCJ A;  4E7Z A;  5FRN A;  2GTH A;  2OOY B;  2MYS A;  2JMO A;  5AN9 F;  1MMG A;  3QYE A;  4ZC3 A;  2BJO A;  1KD1 1;  1Z3Y A;  4Y52 I;  3CCS Z;  4ZDP A;  1SFO I;  2OTL Z;  2OTJ Z;  3VSL A;  4RVH A;  3J80 b;  2XF6 A;  3DKX A;  3QYB A;  1UAA A;  5A2Q b;  2LRD A;  3BG6 A;  3VYT B;  2W82 A;  3J81 b;  4NUB A;  3HPH A;  3FKI I;  4DQY B;  2WA0 A;  4IKF A;  2IZ4 A;  3PO3 I;  5T6B A;  2HZD A;  2K9L A;  1T95 A;  2BVM A;  2Q1Z B;  3S2D I;  4BS9 A;  4E7J A;  3C2H A;  1YX5 A;  5C4J I;  2DE5 A;  3DTK A;  2IZ3 A;  3S17 I;  4HEA 2;  2JVG A;  2AKL A;  3ESW A;  4A3B I;  1VQ4 1;  4NC8 A;  3J81 f;  2V7F A;  1Q7Y 2;  2V1N A;  4DK1 A;  4B47 A;  2VJI A;  2JUG A;  2KL4 A;  2W00 A;  1YJ9 1;  4KIT B;  2JA6 I;  3BG7 A;  4XKW A;  2QRE B;  3HKZ A;  1WFX A;  1OLT A;  4DBR A;  1D1B A;  4BQQ A;  5IP9 I;  3PNT A;  3OMY A;  1MNE A;  2LYC A;  1QVG Y;  1RO0 A;  3L2W A;  4BL0 B;  2OC6 A;  3S3N A;  2RPR A;  3NDI A;  3TE5 B;  3F9K A;  3CMA Z;  2E2J I;  1QVF Z;  4RMN A;  3CD6 Z;  3LSH A;  3HOW I;  3DU6 A;  3S1R I;  3KIF A;  2F5V A;  1SAU A;  3HL2 A;  4ZYA A;  4NB9 A;  2CW8 A;  1USP B;  3CME 1;  2E9H A;  3E1S A;  1W2B Z;  3EED A;  2RNG A;  1YI2 1;  1NG6 A;  2JA5 I;  3GTM S;  1S72 1;  3HPG A;  2CMP A;  2WB1 A;  1IRX A;  2VIX A;  2KI7 B;  2O53 A;  5FLX f;  3CCV Z;  3MMY B;  3PO3 S;  2JNY A;  1TT0 A;  2BOL A;  3FBI B;  3HG9 A;  1TWF I;  3CCS 1;  3EUH C;  3VSK A;  1PFT A;  2QR1 B;  2QA4 1;  3CC2 1;  1Q82 2;  2V8J A;  1WJD A;  4N4O B;  4PUS A;  4RV9 A;  2QRC B;  4MON A;  1EA3 A;  1W2B Y;  2K3P A;  4DIQ A;  4XLA A;  1Y1W I;  2R93 I;  4RLQ A;  4PJM A;  1QU3 A;  3HOX I;  5FRO A;  3U21 A;  1Z03 A;  3CCM Z;  1K8A 2;  1YJW 1;  2LRE A;  4H4K C;  4FAS D;  2KLO A;  4IX7 A;  1K9M 2;  5HNH A;  3KIH A;  3H9J A;  3FQM A;  3D5L A;  5IP7 I;  3I9V 2;  3QYF A;  1VQ8 1;  2V26 A;  2M3A A;  3CCE 1;  2VJ4 A;  2HNH A;  2VAS A;  2ZSI B;  1WJC A;  3TMO A;  4DGL A;  2VQL A;  2J6A A;  4FET A;  3I07 A;  3M3Y I;  3DPU A;  2M7A A;  3OYE A;  4LIU A;  3L2V A;  4XLF A;  1D0Y A;  2VKD A;  2VQC A;  3N05 A;  4XR6 A;  2HVS A;  4AVZ A;  4PK4 A;  1VQ4 Z;  3UR3 C;  1TWC I;  3D9X A;  2NVQ I;  1K73 2;  3I56 1;  3JAM f;  2R4G A;  1VQK 1;  1JJ2 Y;  2HF1 A;  5T64 A;  4XOP A;  3J80 f;  3S14 I;  4F55 A;  2NVY I;  1N2F A;  3DWL E;  4CCO A;  1LDK B;  3OYG A;  4E2Y A;  1KON A;  1VQM Z;  3AFH A;  2I3C A;  4QTT A;  2XF5 A;  4E7K A;  2L5Q A;  1Z7L A;  1RNI A;  1R6R A;  2Z2S B;  3H35 A;  4PFO A;  2PM9 A;  1YIT Z;  3CXC Z;  2NVX I;  4NB8 A;  3D5S C;  2RIQ A;  1VQ7 1;  4HG2 A;  3F3F C;  2M7B A;  3CC4 1;  4A3F I;  5TGT A;  2QEX 1;  3A4C A;  4G6T B;  1YJW Z;  3GTL I;  4PFP A;  3GTK I;  4E33 A;  3G71 Z;  1WJA A;  2Q2E B;  2R7Q A;  1WJF A;  2XF7 A;  1NUI A;  3PJR A;  4BBR I;  2CW7 A;  4KJZ A;  1KC8 1;  3LSG A;  4ZTF A;  1USP A;  2WAD A;  3BG1 B;  3CPW Y;  1YX3 A;  3FKJ A;  1VQ6 Z;  3H3V J;  2P0W A;  1N75 A;  4HGZ A;  4A3I I;  1Q86 2;  3RCO A;  4CH7 A;  2ZFU A;  3TDH B;  3IF8 A;  1X3W A;  4DOZ A;  3CCV 1;  1X0T A;  3HUG B;  3GKQ A;  2HVR A;  3HOU I;  1JI8 A;  4Y4R A;  3M8J A;  4BDY A;  3LSM A;  3VDX A;  3OOU A;  1DGW Y;  2O5R A;  3H0D A;  2LH9 A;  4B43 A;  2JR6 A;  1N8R 1;  2KDO A;  4CSW A;  3CPW Z;  2DE6 A;  3GBG A;  2LBF B;  4HPQ A;  1YE9 A;  3OW2 Z;  3LMM A;  2RT9 A;  4NBF A;  4TNU A;  3CCM 1;  4JQF A;  3HOS A;  2V8K A;  4A93 I;  1VQ7 Z;  1MMA A;  1N78 A;  4RVG A;  3LSI A;  1VQ5 1;  3S8P A;  1D1C A;  1NG7 A;  4B44 A;  3OYA A;  2R7W A;  1DP3 A;  4BBS I;  1V5E A;  4XN3 A;  3DKY A;  1L1O C;  2VQG A;  3K10 A;  4QPQ A;  5D1O B;  3I4M I;  4BAC A;  5CKT A;  1RO4 A;  1YJ9 Z;  3K4M A;  4NBB A;  2GOX B;  2AQE A;  2R7O A;  3OYM A;  3BC8 A;  2YAD A;  3BG0 B;  3AL0 B;  4NBA A;  4NNJ A;  4BEH B;  3I3L A;  2JUB A;  3VB9 A;  3G2B A;  1D0Z A;  3FDY A;  2CUJ A;  1DL6 A;  2G2K A;  4BJ6 C;  4XL9 A;  4NBG A;  3LSK A;  3CCQ Z;  2OTL 1;  2Y0S A;  2QKD A;  3NDJ A;  3CMA 1;  3CJR B;  4IQ4 A;  1S72 Z;  2L9N A;  4ZDL A;  3RZO I;  3PUB A;  2R7U A;  4NBE A;  2KMU A;  4OAY A;  4XON A;  2JA2 A;  3G4S 1;  2E2H I;  3HOY I;  1VQK Z;  2PJR A;  1V5F A;  3K4K A;  1ML8 A;  3OS0 A;  4HGY A;  3U50 C;  5HVQ C;  1SFK A;  3W2W A;  3W2V A;  3A2K A;  2QA4 Z;  4E4H A;  2HVQ A;  3RPU D;  3RTR A;  2LY2 A;  4F52 A;  3SEZ A;  4BE2 A;  2DCE A;  3MZK B;  4QTU A;  3VMH A;  4OWR B;  2HU9 A;  3VYS B;  4BUP A;  4LIT A;  4MD7 A;  1Y1V S;  3DTE A;  4XX2 A;  1P9Q C;  3FHN A;  3OS1 A;  3ZXS A;  4RVD A;  3L2R A;  3FQQ A;  4DJA A;  3K70 D;  1GLN A;  1KRL A;  3CC2 Z;  1QHG A;  2IGO A;  5LFA A;  3K70 C;  4D9J A;  3I55 1;  4BXX I;  4E2X A;  4BGD A;  2R7Z I;  4CUG A;  2KHM A;  5FRM A;  1X1C A;  1NJI 1;  2F4I A;  3GTM I;  1X4P A;  3I4N I;  3CP2 A;  2V9K A;  1M1K 1;  1WCM I;  1N77 A;  1KQS Y;  2CV0 A;  3L2Q A;  3CMM A;  2BW3 B;  1X4O A;  2MAB A;  1VQL 1;  2DE7 A;  4RS4 A;  2KPM A;  4ITV A;  2WY8 Q;  4PJJ A;  4ZJZ A;  2DT7 B;  3H9G A;  3K4C A;  4XOT A;  3JAM b;  2UV1 A;  1D0X A;  4HNT A;  3BLY A;  2KP6 A;  4YRV A;  5FLX b;  4HNU A;  2NVT I;  3S3O A;  2Q51 A;  4NH1 C;  4PJL A;  2VJ5 A;  3NH5 A;  2QLV B;  3QOD A;  3OWT A;  2X1D A;  5D1P A;  2WAF A;  3G6E 1;  4E7S A;  3OYJ A;  2WBM A;  1M1K 2;  4KT6 A;  4RLF A;  1K8A 1;  4E7H A;  3CZ6 A;  4IZZ A;  1D1A A;  4II3 A;  2QEX Z;  2M4G A;  5LD2 C;  2MC4 A;  2BVL A;  4NOZ A;  1BOB A;  2KPI A;  4PJN A;  1M90 2;  2CV2 A;  1Z21 A;  4BY1 I;  1X19 A;  2Z1D A;  3M4O I;  3CCJ Z;  4C9Y A;  2FUG 2;  3NH4 A;  4XKB A;  4MD9 A;  4ANJ A;  1RO2 A;  3DLA A;  3GTJ I;  1VQL Z;  4XKC A;  5IT9 f;  3ZR8 X;  5FLM I;  1R9T I;  1OR7 C;  4MD8 A;  2RQQ A;  2EGT A;  3CCE Z;  4XMY A;  1RQF A;  1VLA A;  3OR1 C;  3LUS A;  1QF8 A;  4A3E I;  1X1D A;  2A5W A;  2E1M B;  3DEE A;  4U87 A;  3K7A I;  3OW2 Y;  1Q81 1;  1VQN Z;  3CD6 1;  1PYV A;  3OYN A;  1AA7 A;  3PNV A;  2LOO A;  3T4N B;  1Q81 2;  3HOZ I;  4XN0 A;  3PSI A;  4F91 B;  5KHD A;  1VQ6 1;  3PNY A;  4CL1 A;  1YIJ Z;  2ZSH B;  4BQO A;  2OOX B;  1YI2 Z;  4CA0 A;  2K9M A;  3G6E Z;  3EUK L;  1WW9 A;  2CFO A;  2DJI A;  2R92 I;  3ZRG A;  3H9Q A;  3I56 Z;  3SDB A;  3S1M I;  2I8D A;  2O4H A;  1Z3X A;  2ZAE B;  1ZB8 A;  3EER A;  3S1N I;  3AL0 C;  2K5C A;  4XLH A;  4B3X A;  4BY7 I;  4B48 A;  2IS1 A;  2JVH A;  3K6G A;  1WII A;  3CCU Z;  1VQP 1;  2IGN A;  2ZXI A;  1YJN 1;  1M90 1;  2MD0 A;  2F4O A;  5IT9 b;  4A3K I;  4A3D I;  4S1T A;  1MMD A;  3CC7 Z;  3CCR 1;  3E0J B;  2LFU A;  4EAT A;  1K6Y A;  1VQM 1;  3K4N A;  3OL4 A;  2VQH A;  2GU2 A;  4E30 A;  2PJR B;  1VQ5 Z;  1NP6 A;  3OYK A;  3CCQ 1;  4C30 A;  3SEQ A;  1I50 I;  2GTI A;  2R7X A;  3OYL A;  3VYU B;  2E1M C;  2JA7 I;  4D1Q A;  4XM3 A;  3OIQ A;  2XDV A;  1YHQ 1;  4BEH A;  3CCL Z;  1VQO Z;  3OY9 A;  3VMG A;  1LVK A;  2L2O A;  2X6W A;  3M1C A;  4E31 A;  5C4X I;  4AU7 A;  3CCL 1;  1TFI A;  3OIP A;  4A3M I;  3H5A A;  3KX2 A;  2K5R A;  1YIJ 1;  3GTO I;  1TZL A;  2QKM B;  5C44 I;  1MW7 A;  3LL7 A;  2HPI A;  1UG0 A;  4BU2 A;  5A2Q f;  3K4B A;  2WY7 Q;  4BDZ A;  1DQU A;  1X3Z A;  2XC7 A;  2OZK A;  2PK7 A;  3F3P C;  4CCM A;  5C3E I;  1NJI 2;  2B63 I;  1TWG I;  2OUM A;  2V6E A;  2Z16 A;  1MND A;  3HOV I;  3J7A Y;  1Y1V I;  3NWS A;  3DPT A;  2VKH A;  2XSJ C;  5CQG A;  4GRI A;  3CC7 1;  2W4S A;  4IQJ A;  2ELJ A;  3TL4 X;  3HXL A;  4BJT A;  4MLO A;  1G59 A;  2H85 A;  3S16 I;  2RRE A;  3PSF A;  3OYH A;  4LG3 A;  1P9N A;  5CPR B;  2X1E A;  4HSR A;  4BQN A;  3MON A;  1N8R 2;  2DOA A;  2VLA A;  2Q4Z A;  3QWU A;  1VQ9 Z;  1YUA A;  2OTJ 1;  4E7L A;  3OYC A;  1FMW A;  1Z01 A;  1KQS Z;  3OL3 A;  3MKW B;  2DXI A;  4PSW A;  2IS2 A;  3VMI A;  3VWB A;  2W04 A;  3A1Y A;  2KRC A;  3V42 A;  2MFZ A;  4MXU A;  4RVF A;  1VQO 1;  3BCB A;  3S2H I;  4J00 A;  2P28 A;  3G4S Z;  4MH4 A;  1Q86 1;  3HC7 A;  1J09 A;  5HOO A;  4E32 A;  3ZGK A;  2JS4 A;  3KYL A;  2LBF A;  3OYF A;  3ZCO A;  4XKV A;  3W2A A;  1W36 D;  4NBD A;  3RSN A;  2VXZ A;  2WAE A;  4DGW B;  2L9S A;  5CM2 M;  4Y7N I;  1MMN A;  3DTI A;  2R7T A;  4J01 A;  2KQR A;  2E2I I;  2GOM A;  2X6X A;  2IGK A;  3VYR B;  1G8X A;  2V8I A;  2VUM I;  5CQE A;  1VZ0 A;  1Y6I A;  1BR1 A;  3CCR Z;  3GTG I;  3S32 A;  2VPL A;  1K9M 1;  3NFZ A;  2CH0 A;  1HA8 A;  4OAZ A;  1PJR A;  3J7A 4;  1TWA I;  1FMV A;  4N4N B;  4P1W A;  4XLC A;  4NFR A;  2LY1 A;  3PO2 I;  4NQW B;  3OR2 C;  2W1O A;  2RHB A;  3I55 Z;  1U0J A;  5T67 A;  3CQZ I;  5HNF A;  2HPM A;  2IS6 A;  2X85 A;  4P5O A;  1VQ9 1;  3RQ4 A;  5KNL A;  4ZTJ A;  2R7R A;  4EWC A;  4A3G I;  3IUO A;  1WJB A;  2QKL B;  5D1O A;  1VQ8 Z;  1YHQ Z;  1QYP A;  2OV7 A;  3UNG C;  1I3Q I;  1QVF Y;  1LKX A;  3IP4 B;  3CME Z;  2HDW A;  4XNF A;  2LIY A;  3MKZ A;  4C2U A;  3IAM 2;  4DBQ A;  2VB6 A;  3SYT A;  1QHH D;  4XLE A;  4CCK A;  2KZV A;  2P3Y A;  2VUG A;  4X6A I;  3EPZ A;  2L7K A;  2WAQ A;  3IFU A;  4YEL A;  4XQF A;  3PFY A;  3OYD A;  4U7B A;  4HST A;  1LFP A;  4HRI A;  3H0G I;  4R79 A;  4E2Z A;  2M0M A;  2E5Z A;  4NC7 A;  3HOT A;  2M4K A;  1QVG Z;  4II2 A;  1S9H A;  4X0G A;  4LIV A;  2E5N A;  3S93 A;  4E6K G;  4MRI A;  2HQA A;  3KEY A;  2BW3 A;  3GCF A;  2E60 A;  3CC4 Z;  4BJ5 C;  2RBL A;  4KIS A;  4E7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...