4X6AI

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI02
3FKII 3S1MI 1R9TI 1Y1VI 4A3EI 4NBEA 4MH4A 4BBSI 2P3YA 4A3MI 3M4OI 2NVTI 1USPB 3HOXI 3HOYI 2NVXI 3D6WA 4NB9A 2JA8I 1DL6A 2JA7I 3GCFA 2R92I 2VUMI 3I4MI 3M3YI 4NBCA 5FLMI 1RLYA 4A3FI 5C44I 2DE6A 4A3BI 1USPA 3PO2I 1RO4A 2B63I 3S2HI 1TWFI 4A3II 1NUIA 3I07A 4A3JI 5C3EI 3VB9A 3U50C 1X3ZA 2R93I 4A3LI 3S1RI 1N2FA 4NB8A 3GTMS 4A3DI 3HOVI 3VMIA 3GTQI 4NBAA 3HOUI 2E2JI 4BXXI 4QTTA 3K7AI 3GTPI 1ML8A 1PFTA 1ZB9A 2F4MA 3VMHA 3PO3S 1X3WA 4XX2A 4BBRI 3GTOI 3CQZI 3Q87A 4QTUA 3S1NI 3H0GI 1TWCI 2HF1A 1VLAA 1I50I 1WW9A 1SFOI 3S14I 2K5RA 4NBGA 3GTLI 2PK7A 4X6AI 2DE7A 3GTKI 4A3GI 1ZB8A 2BJOA 5CM2M 3S2DI 2NVQI 3EERA 2KPIA 3GTMI 4Y7NI 4NOZA 3RZOI 2YU9I 4A93I 3S1QI 5C4XI 2R7ZI 2NVYI 1Y1VS 3LUSA 1Y1WI 5IP7I 2J6AA 3GKQA 3PO3I 2JNYA 4NBHA 1LQLA 2F4OA 3VMGA 4NBFA 4BY1I 3S15I 1I6HI 3I4NI 2E2II 2JA6I 1QYPA 4NBDA 3GTJI 2JR6A 2RBLA 1K83I 1I3QI 4NBBA 5IP9I 4A3KI 3S16I 1YUAA 1TFIA 1TWHI 2JA5I 3HOWI 2AKLA 2E2HI 3HOZI 1TWGI 4BY7I 1WCMI 5C4JI 4A3CI 1TWAI 2DE5A 2JS4A 3RZDI 3GTGI 3S17I 3ESWA 4Y52I 1L1OC 3H3VJ
chains in the Genus database with same CATH superfamily
1Z01A 4A3EI 4MONA 1KC82 5D1OA 3HOYI 1YITZ 2NVXI 2OTJZ 3D6WA 1DL6A 1KD11 2VUMI 1M901 3M3YI 4A3FI 2VUGA 3VTNA 2PMZA 3G6E1 2JIMA 1USPA 2OOYB 4NFRA 4AYBA 1NUIA 3CC2Z 2RHBA 1N8R2 2QA41 3GTQI 3HOVI 1VQ81 1VQ61 4BXXI 3NFZA 2VPYA 4QTTA 3PO3S 3IR7A 3CQZI 3I55Z 4QTUA 1VQ41 3HKZA 1SIWA 1TWCI 3CCE1 1ZH1A 2I3CA 3CD61 3JAMf 3OW2Y 3CCL1 2DE7A 1VQO1 1ZB8A 4E33A 3CC7Z 4NOZA 2QREB 1VQ9Z 2IV2X 1Q862 3S1QI 2NVYI 2RT9A 2VPWA 5T6BA 1Q7Y2 2J6AA 2PM9A 1YIT1 3GKQA 3F3PC 1LQLA 4NBFA 3CCRZ 3I4NI 2E2II 2JA6I 4E2YA 1QYPA 4NBDA 1M1K2 3EEDA 2QRCB 1I3QI 2LEXA 2JA5I 3HOWI 2KI7B 2OTL1 4A3CI 1WIIA 3CCUZ 1QVGY 3S17I 1L1OC 3CC21 3HOUI 1Q821 3I56Z 4TNUA 1Y1VI 3IF8A 3M4OI 1NJI1 1VQNZ 1VQLZ 2O4HA 1WJ2A 2JA7I 3I551 3I4MI 1Z02A 2Q4ZA 3G4SZ 3CCMZ 1YIJZ 2JIQA 1RLYA 1QXFA 3KIHA 2DE6A 1K8A1 4DK1A 4A3BI 3PO2I 2B63I 3S2HI 2R6MA 3G71Z 1Q16A 4A3II 3NDJA 2VPXA 3IX0A 2RPRA 1YJN1 3CC71 3T4NB 2V8JA 2JMOA 3S1RI 1RO2A 1N2FA 3NH4A 3J80f 1AA6A 2QR1B 4NBAA 1VQPZ 2GTIA 3CMA1 1QF8A 4E2XA 3CXCZ 4RVGA 1PFTA 3CME1 3GTOI 2VF1A 1QVGZ 3S14I 2K5RA 1QVFY 1KD12 2V8IA 1M902 1JJ2Y 1YUKA 2PK7A 2OZKA 3CCU1 1VQ71 3CCJZ 1YJWZ 3I561 2V45A 2V3VA 2KPIA 3RZOI 3MZLB 2HU9A 5C4XI 3CCSZ 3LUSA 1VQL1 3FQMA 2QLVB 3PO3I 3VMGA 1K9M1 4E2ZA 3G4S1 1YHQZ 2O53A 3GTJI 2QEX1 1K731 1YUAA 1TFIA 2AKLA 2E2HI 2G2KA 3KIFA 1YI2Z 5D1OB 4BY7I 1S72Z 2JUBA 5FLXb 1KQSY 4Y52I 3GTGI 3ESWA 2OTJ1 4EWCA 1R9TI 4MH4A 1VQP1 2P3YA 4A3MI 2VPZA 5A2Qb 2LIYA 2E7ZA 1USPB 3HOXI 4NB9A 4DGLA 2JA8I 4MD9A 3GCFA 2W04A 4E2WA 5IT9f 5FLMI 1Q811 1RNIA 3J81b 2EGTA 2M6NA 2Y0SA 3G6EZ 3CPWY 2NAPA 4MXUA 2V8KA 4RVDA 3CCS1 1Q812 1NP6A 3GTMS 4A3DI 3VMIA 2E2JI 3BG1B 1ML8A 1ZB9A 1Q822 2F4MA 3VMHA 3OW2Z 4XX2A 1YHQ1 3P5JB 2OOXB 1NJI2 4MD7A 2HF1A 4E32A 1VLAA 1I50I 1WW9A 2QKDA 3MONA 1Y8CA 4NBGA 1YI21 1S721 1VQ4Z 2WAQA 1VQ91 4E31A 3NH5A 1KC81 3GTKI 3CCQZ 1K8A2 2LFUA 3CCVZ 2IZ4A 2NVQI 3EERA 1VQ5Z 3CCR1 1YJ9Z 5IP7I 1VQOZ 2JNYA 4NBHA 2F4OA 2GU2A 4HGYA 4BY1I 3S15I 3J7A4 3F3FC 3JAMb 4MRIA 1W2BY 1K83I 4NBBA 1JWHC 3CPWZ 1FDOA 3FQQA 4DQYB 3TDHB 1N8R1 2K3RA 1VQMZ 4RS4A 1WZNA 5T64A 1TWAI 1VQN1 2JIOA 3RZDI 2E9HA 3H3VJ 3IFUA 3FKII 3S1MI 4RV9A 3CC4Z 4NBEA 2OTLZ 4BBSI 2IZ3A 2JIPA 2NVTI 3CCM1 2Q51A 1YIJ1 1S7MA 1FDIA 1RQFA 2R92I 3D2LA 2AYDA 5IT9b 5D1PA 2P28A 4NBCA 3G711 1Z03A 1RO0A 5C44I 5AN9F 1VQKZ 1K9M2 1RO4A 1Q861 4E30A 1TWFI 3I07A 5T67A 1Q7Y1 3CCQ1 4A3JI 5C3EI 3VB9A 3U50C 3CCV1 1X3ZA 2R93I 3MZKB 1K732 1VQ51 4A3LI 1YJ91 4NB8A 1YJNZ 1QVFZ 1P9NA 1M1K1 3K7AI 3GTPI 1JJ2Z 4RVFA 1X3WA 4BBRI 1W2BZ 5LL6f 2GTHA 3Q87A 3TE5B 3CMAZ 3S1NI 3H0GI 3CCJ1 2RIQA 1YJW1 2W03A 4CL1A 3CMEZ 2WB1A 1SFOI 2M48A 3CXCY 3GTLI 1VQM1 3NH8A 4HH4A 4X6AI 3J80b 4MD8A 4A3GI 2BJOA 5CM2M 3S2DI 2ZAEB 3BG0B 3CC41 3GTMI 4Y7NI 2YU9I 1VQ7Z 5FLXf 2R7ZI 1Y1VS 1Y1WI 4NH1C 2QA4Z 1VQ8Z 1VQ6Z 2JIRA 3D9XA 4RVHA 2QRDB 1X0TA 1KQSZ 4S1TA 5A2Qf 1I6HI 1KRLA 1VQK1 3QWUA 2JR6A 2RBLA 3CCEZ 5IP9I 4A3KI 3S16I 1TWHI 3NDIA 4HGZA 3CD6Z 3HOZI 1TWGI 2YADA 1WCMI 5C4JI 3J81f 2QEXZ 2DE5A 2JS4A 2H85A 3CCLZ 4A93I
chains in the Genus database with same CATH topology
1Z01A 4A3EI 4MONA 1KC82 5D1OA 3HOYI 1YITZ 2NVXI 2OTJZ 3D6WA 1DL6A 1KD11 2VUMI 1M901 3M3YI 4A3FI 2VUGA 3VTNA 2PMZA 3G6E1 1USPA 2OOYB 4NFRA 4AYBA 1NUIA 3CC2Z 2RHBA 1N8R2 2QA41 3GTQI 3HOVI 1VQ81 1VQ61 4BXXI 3NFZA 4QTTA 3PO3S 3CQZI 3I55Z 4QTUA 1VQ41 3HKZA 3CCE1 1TWCI 1ZH1A 2I3CA 3CD61 3JAMf 3OW2Y 3CCL1 2DE7A 1VQO1 1ZB8A 4E33A 3CC7Z 4NOZA 2QREB 1VQ9Z 3S1QI 1Q862 2NVYI 2RT9A 5T6BA 1Q7Y2 2J6AA 2PM9A 1YIT1 3GKQA 3F3PC 1LQLA 4NBFA 3CCRZ 3I4NI 2E2II 2JA6I 4E2YA 1QYPA 4NBDA 1M1K2 3EEDA 2QRCB 1I3QI 2JA5I 3HOWI 2KI7B 2OTL1 4A3CI 1WIIA 3CCUZ 1QVGY 3S17I 1L1OC 3CC21 3HOUI 1Q821 3I56Z 4TNUA 1Y1VI 3IF8A 3M4OI 1NJI1 1VQNZ 1VQLZ 2O4HA 2JA7I 3I551 3I4MI 1Z02A 2Q4ZA 3G4SZ 3CCMZ 1YIJZ 1RLYA 3KIHA 2DE6A 1K8A1 4DK1A 4A3BI 3PO2I 2B63I 3S2HI 2R6MA 3G71Z 4A3II 3NDJA 3IX0A 2RPRA 1YJN1 3CC71 3T4NB 2V8JA 2JMOA 3S1RI 1RO2A 1N2FA 3NH4A 3J80f 2QR1B 4NBAA 1VQPZ 2GTIA 3CMA1 1QF8A 4E2XA 3CXCZ 4RVGA 1PFTA 3CME1 3GTOI 2VF1A 1QVGZ 3S14I 2K5RA 1QVFY 1KD12 2V8IA 1M902 1JJ2Y 1YUKA 2PK7A 2OZKA 3CCU1 1VQ71 3CCJZ 1YJWZ 3I561 2KPIA 3RZOI 3MZLB 2HU9A 5C4XI 3CCSZ 3LUSA 1VQL1 3FQMA 2QLVB 3PO3I 3VMGA 1K9M1 4E2ZA 3G4S1 1YHQZ 2O53A 3GTJI 2QEX1 1K731 1YUAA 1TFIA 2AKLA 2E2HI 2G2KA 3KIFA 1YI2Z 5D1OB 4BY7I 1S72Z 2JUBA 5FLXb 1KQSY 4Y52I 3GTGI 3ESWA 2OTJ1 4EWCA 1R9TI 4MH4A 1VQP1 2P3YA 4A3MI 5A2Qb 2LIYA 1USPB 3HOXI 4NB9A 4DGLA 2JA8I 4MD9A 3GCFA 2W04A 4E2WA 5IT9f 5FLMI 1Q811 1RNIA 3J81b 2EGTA 2M6NA 2Y0SA 3G6EZ 3CPWY 4MXUA 2V8KA 4RVDA 3CCS1 1Q812 1NP6A 3GTMS 4A3DI 3VMIA 2E2JI 3BG1B 1ML8A 1ZB9A 1Q822 2F4MA 3VMHA 3OW2Z 4XX2A 1YHQ1 3P5JB 2OOXB 1NJI2 4MD7A 2HF1A 4E32A 1VLAA 1I50I 1WW9A 2QKDA 3MONA 4NBGA 1YI21 1S721 1VQ4Z 2WAQA 1VQ91 4E31A 3NH5A 1KC81 3GTKI 3CCQZ 1K8A2 2LFUA 3CCVZ 2IZ4A 2NVQI 3EERA 1VQ5Z 3CCR1 1YJ9Z 5IP7I 1VQOZ 2JNYA 4NBHA 2F4OA 2GU2A 4HGYA 4BY1I 3S15I 3J7A4 3F3FC 3JAMb 4MRIA 1W2BY 1K83I 4NBBA 1JWHC 3CPWZ 3FQQA 4DQYB 3TDHB 1N8R1 2K3RA 1VQMZ 4RS4A 5T64A 1TWAI 1VQN1 3RZDI 2E9HA 3H3VJ 3IFUA 3FKII 3S1MI 4RV9A 3CC4Z 4NBEA 2OTLZ 4BBSI 2IZ3A 2NVTI 3CCM1 2Q51A 1YIJ1 1S7MA 1RQFA 2R92I 5IT9b 5D1PA 2P28A 4NBCA 3G711 1Z03A 1RO0A 5C44I 5AN9F 1VQKZ 1K9M2 1RO4A 1Q861 4E30A 1TWFI 3I07A 5T67A 1Q7Y1 3CCQ1 4A3JI 5C3EI 3VB9A 3U50C 3CCV1 1X3ZA 2R93I 3MZKB 1K732 1VQ51 4A3LI 1YJ91 4NB8A 1YJNZ 1QVFZ 1P9NA 1M1K1 3K7AI 3GTPI 1JJ2Z 4RVFA 1X3WA 4BBRI 1W2BZ 5LL6f 2GTHA 3Q87A 3TE5B 3CMAZ 3S1NI 3H0GI 3CCJ1 2RIQA 1YJW1 2W03A 4CL1A 3CMEZ 2WB1A 1SFOI 2M48A 3CXCY 3GTLI 1VQM1 3NH8A 4HH4A 4X6AI 3J80b 4MD8A 4A3GI 2BJOA 5CM2M 3S2DI 2ZAEB 3BG0B 3CC41 3GTMI 4Y7NI 2YU9I 1VQ7Z 5FLXf 2R7ZI 1Y1VS 1Y1WI 4NH1C 2QA4Z 1VQ8Z 1VQ6Z 3D9XA 4RVHA 2QRDB 1X0TA 1KQSZ 4S1TA 5A2Qf 1I6HI 1KRLA 1VQK1 3QWUA 2JR6A 2RBLA 3CCEZ 5IP9I 4A3KI 3S16I 1TWHI 3NDIA 4HGZA 3CD6Z 3HOZI 1TWGI 2YADA 1WCMI 5C4JI 3J81f 2QEXZ 2DE5A 2JS4A 2H85A 3CCLZ 4A93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI I;  3S1M I;  1R9T I;  1Y1V I;  4A3E I;  4NBE A;  4MH4 A;  4BBS I;  2P3Y A;  4A3M I;  3M4O I;  2NVT I;  1USP B;  3HOX I;  3HOY I;  2NVX I;  3D6W A;  4NB9 A;  2JA8 I;  1DL6 A;  2JA7 I;  3GCF A;  2R92 I;  2VUM I;  3I4M I;  3M3Y I;  4NBC A;  5FLM I;  1RLY A;  4A3F I;  5C44 I;  2DE6 A;  4A3B I;  1USP A;  3PO2 I;  1RO4 A;  2B63 I;  3S2H I;  1TWF I;  4A3I I;  1NUI A;  3I07 A;  4A3J I;  5C3E I;  3VB9 A;  3U50 C;  1X3Z A;  2R93 I;  4A3L I;  3S1R I;  1N2F A;  4NB8 A;  3GTM S;  4A3D I;  3HOV I;  3VMI A;  3GTQ I;  4NBA A;  3HOU I;  2E2J I;  4BXX I;  4QTT A;  3K7A I;  3GTP I;  1ML8 A;  1PFT A;  1ZB9 A;  2F4M A;  3VMH A;  3PO3 S;  1X3W A;  4XX2 A;  4BBR I;  3GTO I;  3CQZ I;  3Q87 A;  4QTU A;  3S1N I;  3H0G I;  1TWC I;  2HF1 A;  1VLA A;  1I50 I;  1WW9 A;  1SFO I;  3S14 I;  2K5R A;  4NBG A;  3GTL I;  2PK7 A;  4X6A I;  2DE7 A;  3GTK I;  4A3G I;  1ZB8 A;  2BJO A;  5CM2 M;  3S2D I;  2NVQ I;  3EER A;  2KPI A;  3GTM I;  4Y7N I;  4NOZ A;  3RZO I;  2YU9 I;  4A93 I;  3S1Q I;  5C4X I;  2R7Z I;  2NVY I;  1Y1V S;  3LUS A;  1Y1W I;  5IP7 I;  2J6A A;  3GKQ A;  3PO3 I;  2JNY A;  4NBH A;  1LQL A;  2F4O A;  3VMG A;  4NBF A;  4BY1 I;  3S15 I;  1I6H I;  3I4N I;  2E2I I;  2JA6 I;  1QYP A;  4NBD A;  3GTJ I;  2JR6 A;  2RBL A;  1K83 I;  1I3Q I;  4NBB A;  5IP9 I;  4A3K I;  3S16 I;  1YUA A;  1TFI A;  1TWH I;  2JA5 I;  3HOW I;  2AKL A;  2E2H I;  3HOZ I;  1TWG I;  4BY7 I;  1WCM I;  5C4J I;  4A3C I;  1TWA I;  2DE5 A;  2JS4 A;  3RZD I;  3GTG I;  3S17 I;  3ESW A;  4Y52 I;  1L1O C;  3H3V J; 
#chains in the Genus database with same CATH topology
 1Z01 A;  4A3E I;  4MON A;  1KC8 2;  5D1O A;  3HOY I;  1YIT Z;  2NVX I;  2OTJ Z;  3D6W A;  1DL6 A;  1KD1 1;  2VUM I;  1M90 1;  3M3Y I;  4A3F I;  2VUG A;  3VTN A;  2PMZ A;  3G6E 1;  2JIM A;  1USP A;  2OOY B;  4NFR A;  4AYB A;  1NUI A;  3CC2 Z;  2RHB A;  1N8R 2;  2QA4 1;  3GTQ I;  3HOV I;  1VQ8 1;  1VQ6 1;  4BXX I;  3NFZ A;  2VPY A;  4QTT A;  3PO3 S;  3IR7 A;  3CQZ I;  3I55 Z;  4QTU A;  1VQ4 1;  3HKZ A;  1SIW A;  1TWC I;  3CCE 1;  1ZH1 A;  2I3C A;  3CD6 1;  3JAM f;  3OW2 Y;  3CCL 1;  2DE7 A;  1VQO 1;  1ZB8 A;  4E33 A;  3CC7 Z;  4NOZ A;  2QRE B;  1VQ9 Z;  2IV2 X;  1Q86 2;  3S1Q I;  2NVY I;  2RT9 A;  2VPW A;  5T6B A;  1Q7Y 2;  2J6A A;  2PM9 A;  1YIT 1;  3GKQ A;  3F3P C;  1LQL A;  4NBF A;  3CCR Z;  3I4N I;  2E2I I;  2JA6 I;  4E2Y A;  1QYP A;  4NBD A;  1M1K 2;  3EED A;  2QRC B;  1I3Q I;  2LEX A;  2JA5 I;  3HOW I;  2KI7 B;  2OTL 1;  4A3C I;  1WII A;  3CCU Z;  1QVG Y;  3S17 I;  1L1O C;  3CC2 1;  3HOU I;  1Q82 1;  3I56 Z;  4TNU A;  1Y1V I;  3IF8 A;  3M4O I;  1NJI 1;  1VQN Z;  1VQL Z;  2O4H A;  1WJ2 A;  2JA7 I;  3I55 1;  3I4M I;  1Z02 A;  2Q4Z A;  3G4S Z;  3CCM Z;  1YIJ Z;  2JIQ A;  1RLY A;  1QXF A;  3KIH A;  2DE6 A;  1K8A 1;  4DK1 A;  4A3B I;  3PO2 I;  2B63 I;  3S2H I;  2R6M A;  3G71 Z;  1Q16 A;  4A3I I;  3NDJ A;  2VPX A;  3IX0 A;  2RPR A;  1YJN 1;  3CC7 1;  3T4N B;  2V8J A;  2JMO A;  3S1R I;  1RO2 A;  1N2F A;  3NH4 A;  3J80 f;  1AA6 A;  2QR1 B;  4NBA A;  1VQP Z;  2GTI A;  3CMA 1;  1QF8 A;  4E2X A;  3CXC Z;  4RVG A;  1PFT A;  3CME 1;  3GTO I;  2VF1 A;  1QVG Z;  3S14 I;  2K5R A;  1QVF Y;  1KD1 2;  2V8I A;  1M90 2;  1JJ2 Y;  1YUK A;  2PK7 A;  2OZK A;  3CCU 1;  1VQ7 1;  3CCJ Z;  1YJW Z;  3I56 1;  2V45 A;  2V3V A;  2KPI A;  3RZO I;  3MZL B;  2HU9 A;  5C4X I;  3CCS Z;  3LUS A;  1VQL 1;  3FQM A;  2QLV B;  3PO3 I;  3VMG A;  1K9M 1;  4E2Z A;  3G4S 1;  1YHQ Z;  2O53 A;  3GTJ I;  2QEX 1;  1K73 1;  1YUA A;  1TFI A;  2AKL A;  2E2H I;  2G2K A;  3KIF A;  1YI2 Z;  5D1O B;  4BY7 I;  1S72 Z;  2JUB A;  5FLX b;  1KQS Y;  4Y52 I;  3GTG I;  3ESW A;  2OTJ 1;  4EWC A;  1R9T I;  4MH4 A;  1VQP 1;  2P3Y A;  4A3M I;  2VPZ A;  5A2Q b;  2LIY A;  2E7Z A;  1USP B;  3HOX I;  4NB9 A;  4DGL A;  2JA8 I;  4MD9 A;  3GCF A;  2W04 A;  4E2W A;  5IT9 f;  5FLM I;  1Q81 1;  1RNI A;  3J81 b;  2EGT A;  2M6N A;  2Y0S A;  3G6E Z;  3CPW Y;  2NAP A;  4MXU A;  2V8K A;  4RVD A;  3CCS 1;  1Q81 2;  1NP6 A;  3GTM S;  4A3D I;  3VMI A;  2E2J I;  3BG1 B;  1ML8 A;  1ZB9 A;  1Q82 2;  2F4M A;  3VMH A;  3OW2 Z;  4XX2 A;  1YHQ 1;  3P5J B;  2OOX B;  1NJI 2;  4MD7 A;  2HF1 A;  4E32 A;  1VLA A;  1I50 I;  1WW9 A;  2QKD A;  3MON A;  1Y8C A;  4NBG A;  1YI2 1;  1S72 1;  1VQ4 Z;  2WAQ A;  1VQ9 1;  4E31 A;  3NH5 A;  1KC8 1;  3GTK I;  3CCQ Z;  1K8A 2;  2LFU A;  3CCV Z;  2IZ4 A;  2NVQ I;  3EER A;  1VQ5 Z;  3CCR 1;  1YJ9 Z;  5IP7 I;  1VQO Z;  2JNY A;  4NBH A;  2F4O A;  2GU2 A;  4HGY A;  4BY1 I;  3S15 I;  3J7A 4;  3F3F C;  3JAM b;  4MRI A;  1W2B Y;  1K83 I;  4NBB A;  1JWH C;  3CPW Z;  1FDO A;  3FQQ A;  4DQY B;  3TDH B;  1N8R 1;  2K3R A;  1VQM Z;  4RS4 A;  1WZN A;  5T64 A;  1TWA I;  1VQN 1;  2JIO A;  3RZD I;  2E9H A;  3H3V J;  3IFU A;  3FKI I;  3S1M I;  4RV9 A;  3CC4 Z;  4NBE A;  2OTL Z;  4BBS I;  2IZ3 A;  2JIP A;  2NVT I;  3CCM 1;  2Q51 A;  1YIJ 1;  1S7M A;  1FDI A;  1RQF A;  2R92 I;  3D2L A;  2AYD A;  5IT9 b;  5D1P A;  2P28 A;  4NBC A;  3G71 1;  1Z03 A;  1RO0 A;  5C44 I;  5AN9 F;  1VQK Z;  1K9M 2;  1RO4 A;  1Q86 1;  4E30 A;  1TWF I;  3I07 A;  5T67 A;  1Q7Y 1;  3CCQ 1;  4A3J I;  5C3E I;  3VB9 A;  3U50 C;  3CCV 1;  1X3Z A;  2R93 I;  3MZK B;  1K73 2;  1VQ5 1;  4A3L I;  1YJ9 1;  4NB8 A;  1YJN Z;  1QVF Z;  1P9N A;  1M1K 1;  3K7A I;  3GTP I;  1JJ2 Z;  4RVF A;  1X3W A;  4BBR I;  1W2B Z;  5LL6 f;  2GTH A;  3Q87 A;  3TE5 B;  3CMA Z;  3S1N I;  3H0G I;  3CCJ 1;  2RIQ A;  1YJW 1;  2W03 A;  4CL1 A;  3CME Z;  2WB1 A;  1SFO I;  2M48 A;  3CXC Y;  3GTL I;  1VQM 1;  3NH8 A;  4HH4 A;  4X6A I;  3J80 b;  4MD8 A;  4A3G I;  2BJO A;  5CM2 M;  3S2D I;  2ZAE B;  3BG0 B;  3CC4 1;  3GTM I;  4Y7N I;  2YU9 I;  1VQ7 Z;  5FLX f;  2R7Z I;  1Y1V S;  1Y1W I;  4NH1 C;  2QA4 Z;  1VQ8 Z;  1VQ6 Z;  2JIR A;  3D9X A;  4RVH A;  2QRD B;  1X0T A;  1KQS Z;  4S1T A;  5A2Q f;  1I6H I;  1KRL A;  1VQK 1;  3QWU A;  2JR6 A;  2RBL A;  3CCE Z;  5IP9 I;  4A3K I;  3S16 I;  1TWH I;  3NDI A;  4HGZ A;  3CD6 Z;  3HOZ I;  1TWG I;  2YAD A;  1WCM I;  5C4J I;  3J81 f;  2QEX Z;  2DE5 A;  2JS4 A;  2H85 A;  3CCL Z;  4A93 I; 
#chains in the Genus database with same CATH homology
 1Z01 A;  4A3E I;  4MON A;  1KC8 2;  5D1O A;  3HOY I;  1YIT Z;  2NVX I;  2OTJ Z;  3D6W A;  1DL6 A;  1KD1 1;  2VUM I;  1M90 1;  3M3Y I;  4A3F I;  2VUG A;  3VTN A;  2PMZ A;  3G6E 1;  1USP A;  2OOY B;  4NFR A;  4AYB A;  1NUI A;  3CC2 Z;  2RHB A;  1N8R 2;  2QA4 1;  3GTQ I;  3HOV I;  1VQ8 1;  1VQ6 1;  4BXX I;  3NFZ A;  4QTT A;  3PO3 S;  3CQZ I;  3I55 Z;  4QTU A;  1VQ4 1;  3HKZ A;  3CCE 1;  1TWC I;  1ZH1 A;  2I3C A;  3CD6 1;  3JAM f;  3OW2 Y;  3CCL 1;  2DE7 A;  1VQO 1;  1ZB8 A;  4E33 A;  3CC7 Z;  4NOZ A;  2QRE B;  1VQ9 Z;  3S1Q I;  1Q86 2;  2NVY I;  2RT9 A;  5T6B A;  1Q7Y 2;  2J6A A;  2PM9 A;  1YIT 1;  3GKQ A;  3F3P C;  1LQL A;  4NBF A;  3CCR Z;  3I4N I;  2E2I I;  2JA6 I;  4E2Y A;  1QYP A;  4NBD A;  1M1K 2;  3EED A;  2QRC B;  1I3Q I;  2JA5 I;  3HOW I;  2KI7 B;  2OTL 1;  4A3C I;  1WII A;  3CCU Z;  1QVG Y;  3S17 I;  1L1O C;  3CC2 1;  3HOU I;  1Q82 1;  3I56 Z;  4TNU A;  1Y1V I;  3IF8 A;  3M4O I;  1NJI 1;  1VQN Z;  1VQL Z;  2O4H A;  2JA7 I;  3I55 1;  3I4M I;  1Z02 A;  2Q4Z A;  3G4S Z;  3CCM Z;  1YIJ Z;  1RLY A;  3KIH A;  2DE6 A;  1K8A 1;  4DK1 A;  4A3B I;  3PO2 I;  2B63 I;  3S2H I;  2R6M A;  3G71 Z;  4A3I I;  3NDJ A;  3IX0 A;  2RPR A;  1YJN 1;  3CC7 1;  3T4N B;  2V8J A;  2JMO A;  3S1R I;  1RO2 A;  1N2F A;  3NH4 A;  3J80 f;  2QR1 B;  4NBA A;  1VQP Z;  2GTI A;  3CMA 1;  1QF8 A;  4E2X A;  3CXC Z;  4RVG A;  1PFT A;  3CME 1;  3GTO I;  2VF1 A;  1QVG Z;  3S14 I;  2K5R A;  1QVF Y;  1KD1 2;  2V8I A;  1M90 2;  1JJ2 Y;  1YUK A;  2PK7 A;  2OZK A;  3CCU 1;  1VQ7 1;  3CCJ Z;  1YJW Z;  3I56 1;  2KPI A;  3RZO I;  3MZL B;  2HU9 A;  5C4X I;  3CCS Z;  3LUS A;  1VQL 1;  3FQM A;  2QLV B;  3PO3 I;  3VMG A;  1K9M 1;  4E2Z A;  3G4S 1;  1YHQ Z;  2O53 A;  3GTJ I;  2QEX 1;  1K73 1;  1YUA A;  1TFI A;  2AKL A;  2E2H I;  2G2K A;  3KIF A;  1YI2 Z;  5D1O B;  4BY7 I;  1S72 Z;  2JUB A;  5FLX b;  1KQS Y;  4Y52 I;  3GTG I;  3ESW A;  2OTJ 1;  4EWC A;  1R9T I;  4MH4 A;  1VQP 1;  2P3Y A;  4A3M I;  5A2Q b;  2LIY A;  1USP B;  3HOX I;  4NB9 A;  4DGL A;  2JA8 I;  4MD9 A;  3GCF A;  2W04 A;  4E2W A;  5IT9 f;  5FLM I;  1Q81 1;  1RNI A;  3J81 b;  2EGT A;  2M6N A;  2Y0S A;  3G6E Z;  3CPW Y;  4MXU A;  2V8K A;  4RVD A;  3CCS 1;  1Q81 2;  1NP6 A;  3GTM S;  4A3D I;  3VMI A;  2E2J I;  3BG1 B;  1ML8 A;  1ZB9 A;  1Q82 2;  2F4M A;  3VMH A;  3OW2 Z;  4XX2 A;  1YHQ 1;  3P5J B;  2OOX B;  1NJI 2;  4MD7 A;  2HF1 A;  4E32 A;  1VLA A;  1I50 I;  1WW9 A;  2QKD A;  3MON A;  4NBG A;  1YI2 1;  1S72 1;  1VQ4 Z;  2WAQ A;  1VQ9 1;  4E31 A;  3NH5 A;  1KC8 1;  3GTK I;  3CCQ Z;  1K8A 2;  2LFU A;  3CCV Z;  2IZ4 A;  2NVQ I;  3EER A;  1VQ5 Z;  3CCR 1;  1YJ9 Z;  5IP7 I;  1VQO Z;  2JNY A;  4NBH A;  2F4O A;  2GU2 A;  4HGY A;  4BY1 I;  3S15 I;  3J7A 4;  3F3F C;  3JAM b;  4MRI A;  1W2B Y;  1K83 I;  4NBB A;  1JWH C;  3CPW Z;  3FQQ A;  4DQY B;  3TDH B;  1N8R 1;  2K3R A;  1VQM Z;  4RS4 A;  5T64 A;  1TWA I;  1VQN 1;  3RZD I;  2E9H A;  3H3V J;  3IFU A;  3FKI I;  3S1M I;  4RV9 A;  3CC4 Z;  4NBE A;  2OTL Z;  4BBS I;  2IZ3 A;  2NVT I;  3CCM 1;  2Q51 A;  1YIJ 1;  1S7M A;  1RQF A;  2R92 I;  5IT9 b;  5D1P A;  2P28 A;  4NBC A;  3G71 1;  1Z03 A;  1RO0 A;  5C44 I;  5AN9 F;  1VQK Z;  1K9M 2;  1RO4 A;  1Q86 1;  4E30 A;  1TWF I;  3I07 A;  5T67 A;  1Q7Y 1;  3CCQ 1;  4A3J I;  5C3E I;  3VB9 A;  3U50 C;  3CCV 1;  1X3Z A;  2R93 I;  3MZK B;  1K73 2;  1VQ5 1;  4A3L I;  1YJ9 1;  4NB8 A;  1YJN Z;  1QVF Z;  1P9N A;  1M1K 1;  3K7A I;  3GTP I;  1JJ2 Z;  4RVF A;  1X3W A;  4BBR I;  1W2B Z;  5LL6 f;  2GTH A;  3Q87 A;  3TE5 B;  3CMA Z;  3S1N I;  3H0G I;  3CCJ 1;  2RIQ A;  1YJW 1;  2W03 A;  4CL1 A;  3CME Z;  2WB1 A;  1SFO I;  2M48 A;  3CXC Y;  3GTL I;  1VQM 1;  3NH8 A;  4HH4 A;  4X6A I;  3J80 b;  4MD8 A;  4A3G I;  2BJO A;  5CM2 M;  3S2D I;  2ZAE B;  3BG0 B;  3CC4 1;  3GTM I;  4Y7N I;  2YU9 I;  1VQ7 Z;  5FLX f;  2R7Z I;  1Y1V S;  1Y1W I;  4NH1 C;  2QA4 Z;  1VQ8 Z;  1VQ6 Z;  3D9X A;  4RVH A;  2QRD B;  1X0T A;  1KQS Z;  4S1T A;  5A2Q f;  1I6H I;  1KRL A;  1VQK 1;  3QWU A;  2JR6 A;  2RBL A;  3CCE Z;  5IP9 I;  4A3K I;  3S16 I;  1TWH I;  3NDI A;  4HGZ A;  3CD6 Z;  3HOZ I;  1TWG I;  2YAD A;  1WCM I;  5C4J I;  3J81 f;  2QEX Z;  2DE5 A;  2JS4 A;  2H85 A;  3CCL Z;  4A93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...