4X6AI

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI02
3VMHA 1X3WA 2F4MA 2YU9I 1TWCI 4BBRI 4NBGA 1ZB9A 4NBDA 3PO2I 1RO4A 3I07A 3S2HI 4A3DI 4NOZA 2B63I 3H3VJ 1NUIA 2R93I 3GTQI 2HF1A 3S2DI 3GCFA 1USPB 3Q87A 3VMGA 4BXXI 4BY7I 3GTMI 4XX2A 2NVYI 2P3YA 1SFOI 3S16I 1PFTA 4A3KI 3S15I 3GTKI 3GTMS 4Y7NI 1TWHI 3D6WA 1TWFI 1DL6A 1I6HI 2AKLA 3K7AI 2K5RA 4A93I 2E2II 3FKII 3S1NI 2JA6I 1R9TI 4A3MI 4NBFA 1L1OC 5CM2M 2JR6A 1YUAA 4Y52I 2DE5A 3M3YI 1I50I 2JNYA 5IP7I 4A3BI 2DE6A 1Y1VI 2R7ZI 4A3JI 2KPIA 2F4OA 1TWAI 4NB9A 3HOUI 1QYPA 1Y1VS 2NVTI 3ESWA 2E2HI 3I4MI 4NBBA 2R92I 4NBAA 5C3EI 4BY1I 1RLYA 4QTUA 4A3CI 3S14I 1LQLA 4QTTA 3EERA 4NB8A 4NBHA 2NVQI 3CQZI 3GKQA 4A3GI 2J6AA 1N2FA 2JA7I 3S1MI 3GTOI 3S17I 3S1QI 5IP9I 1K83I 3HOXI 3GTGI 1ZB8A 2BJOA 2JS4A 3VMIA 1ML8A 2NVXI 4NBCA 5FLMI 3PO3I 1X3ZA 5C44I 3S1RI 3RZDI 1TWGI 4A3FI 2PK7A 3PO3S 3GTPI 3RZOI 2VUMI 4A3LI 2RBLA 4X6AI 2DE7A 1WCMI 2E2JI 3I4NI 1USPA 1TFIA 2JA5I 4MH4A 3HOYI 3LUSA 4A3II 1WW9A 3VB9A 1I3QI 3HOVI 3U50C 3HOZI 5C4JI 1VLAA 4NBEA 3GTJI 3M4OI 3GTLI 3H0GI 5C4XI 4A3EI 1Y1WI 3HOWI 2JA8I 4BBSI
chains in the Genus database with same CATH superfamily
1VQOZ 2YU9I 1TWCI 1ZB9A 3CC4Z 5FLXb 2IV2X 5IT9f 1KC82 3PO2I 1VQ81 1Z01A 2B63I 4E30A 3H3VJ 3S2DI 3NH8A 3FQMA 2M48A 3G711 1PFTA 4MONA 4MXUA 3TDHB 3CCMZ 3CD61 3J81f 4RVDA 1TWHI 1K9M2 1VQ4Z 1YJN1 2ZAEB 2AKLA 1WIIA 1X0TA 3F3FC 4NH1C 2NAPA 2QLVB 2E2II 1YJW1 3CPWY 4NFRA 3CCQ1 4MRIA 1VQL1 5D1PA 2VUGA 5IP7I 2O4HA 4A3BI 5IT9b 2QKDA 1Y1VI 2PM9A 2R7ZI 4NB9A 3HOUI 1QYPA 2NVTI 4RVGA 3ESWA 4NBBA 1ZH1A 3BG1B 2R92I 4NBAA 1AA6A 2OTLZ 2EGTA 2W03A 4A3CI 4QTTA 1FDOA 2QR1B 3CCJZ 1NJI1 2OZKA 3CC71 3CQZI 1M901 1N2FA 3CMAZ 4RVHA 2OOXB 1JJ2Z 3S1MI 2OTJ1 1QVFY 2M6NA 1VQ6Z 5IP9I 3IX0A 2JS4A 5D1OA 3VMIA 4NBCA 3CCU1 1KQSZ 1N8R1 4E2YA 4DQYB 2GTIA 1KD11 4X6AI 2DE7A 2JA5I 1VQN1 1VQP1 3HOVI 3U50C 1Q7Y1 3IR7A 3CMEZ 4NBEA 3T4NB 3CCR1 3HOWI 2JIQA 2RT9A 1W2BY 2RPRA 2JA8I 1Q861 2F4MA 5D1OB 1YHQ1 3NDJA 4NBDA 3CCL1 2P28A 1QVGZ 3CD6Z 5T6BA 4A3DI 1NUIA 3D2LA 1M1K1 1S721 1YUKA 2E9HA 3GTQI 3CC2Z 3GCFA 2OOYB 2VPWA 3Q87A 4DK1A 1YJWZ 3JAMf 1VQ91 1P9NA 3MONA 3G6E1 1SFOI 3CCQZ 1VQLZ 1Z03A 3GTMS 1TWFI 2LFUA 1YI21 3G4S1 3K7AI 2K5RA 5A2Qb 1R9TI 1KRLA 4RV9A 3I551 1SIWA 2JR6A 4Y52I 1QF8A 2DE5A 3OW2Z 1I50I 1S7MA 3D9XA 4A3JI 2F4OA 3NH4A 2QEXZ 2H85A 1Q16A 1YIJ1 3IF8A 5C3EI 1RO0A 1RLYA 3CCUZ 1NJI2 3S14I 2GTHA 1LQLA 4NB8A 2NVQI 4A3GI 2V3VA 3MZKB 2VPYA 1Y8CA 2JA7I 1VQNZ 3S17I 3HOXI 3GTGI 5LL6f 1ML8A 1N8R2 1X3ZA 5C44I 3S1RI 3CCRZ 1KD12 1VQKZ 2IZ4A 3I56Z 2PK7A 3CCS1 3RZOI 3CCEZ 1YIT1 3MZLB 2VUMI 4A3LI 1VQM1 2E2JI 1TFIA 2Y0SA 1YHQZ 1YJ91 1WW9A 1Q7Y2 3VB9A 2QA41 3P5JB 3J81b 3NDIA 4S1TA 1VQO1 2RIQA 3FQQA 3GTJI 3GTLI 1VQ7Z 3CC41 5C4XI 1Y1WI 1VQ5Z 4BBSI 2LEXA 3CXCZ 1VQ9Z 4NBGA 2QRDB 4E33A 3CCV1 2JIPA 1M1K2 1Q811 3VMGA 1VQ8Z 1VQ41 4BY7I 3GTMI 4XX2A 2P3YA 3S16I 2YADA 3S15I 1K731 3IFUA 3F3PC 4E2ZA 2E7ZA 3D6WA 1DL6A 3G71Z 3FKII 2JA6I 2V45A 2W04A 3EEDA 1YIJZ 1YJNZ 4MD8A 1L1OC 3M3YI 2JNYA 2V8KA 2DE6A 2JUBA 2KPIA 2OTL1 3CPWZ 4DGLA 3I4MI 3CCJ1 4BY1I 1JJ2Y 3CMA1 4QTUA 1VQ61 3TE5B 4HGYA 2J6AA 2VPXA 4AYBA 1KQSY 3GTOI 3S1QI 3QWUA 1Q821 2BJOA 4EWCA 2QA4Z 3CC7Z 2WB1A 1K8A1 3RZDI 2JIOA 2OTJZ 4E32A 4RS4A 1QVFZ 4A3FI 1RO2A 4MD9A 3VTNA 3PO3S 2QREB 2K3RA 3JAMb 3CME1 1USPA 3KIHA 2Q51A 4MH4A 1M902 2VPZA 2G2KA 3CCVZ 4CL1A 5C4JI 3HOZI 2PMZA 3M4OI 4E2WA 1QVGY 1VQPZ 3VMHA 2JIMA 1X3WA 3NH5A 2JMOA 1FDIA 5AN9F 4BBRI 2V8JA 2V8IA 2O53A 3CC21 1Z02A 1RO4A 1W2BZ 3I07A 3S2HI 1KC81 4NOZA 4MD7A 1Q812 1QXFA 2R93I 2HF1A 3CCLZ 2HU9A 1USPB 4BXXI 5T64A 1K732 3HKZA 2NVYI 1S72Z 1Q862 4A3KI 3GTKI 2I3CA 4Y7NI 2WAQA 3G6EZ 1I6HI 1K9M1 4HH4A 4A93I 2LIYA 3OW2Y 2RHBA 3S1NI 5T67A 4A3MI 4NBFA 2Q4ZA 1YI2Z 3G4SZ 2QEX1 3NFZA 5CM2M 1YUAA 3CCM1 2R6MA 3J80f 3I55Z 1TWAI 2VF1A 1RQFA 1Y1VS 1WJ2A 2E2HI 4E31A 3EERA 4NBHA 1WZNA 2AYDA 3GKQA 1Q822 5FLXf 1K83I 1VQK1 5A2Qf 3I561 1ZB8A 2NVXI 3CCE1 3J7A4 1K8A2 3BG0B 5FLMI 4HGZA 3PO3I 2QRCB 2JIRA 3KIFA 1TWGI 3GTPI 1RNIA 3J80b 2RBLA 1WCMI 3I4NI 1VQ71 3HOYI 3LUSA 4TNUA 4A3II 1JWHC 1NP6A 1VQ51 1I3QI 3CCSZ 1YITZ 4RVFA 1VLAA 3CXCY 1VQMZ 3H0GI 1YJ9Z 2IZ3A 4A3EI 4E2XA 2KI7B 2GU2A
chains in the Genus database with same CATH topology
1VQOZ 2YU9I 1TWCI 1ZB9A 3CC4Z 5FLXb 5IT9f 1KC82 3PO2I 1VQ81 1Z01A 2B63I 4E30A 3H3VJ 3S2DI 3NH8A 3FQMA 2M48A 3G711 1PFTA 4MONA 4MXUA 3TDHB 3CCMZ 3CD61 3J81f 4RVDA 1TWHI 1K9M2 1VQ4Z 1YJN1 2ZAEB 2AKLA 1WIIA 1X0TA 3F3FC 4NH1C 2QLVB 2E2II 1YJW1 3CPWY 4NFRA 3CCQ1 4MRIA 1VQL1 5D1PA 2VUGA 5IP7I 2O4HA 4A3BI 5IT9b 2QKDA 1Y1VI 2PM9A 2R7ZI 4NB9A 3HOUI 1QYPA 2NVTI 4RVGA 3ESWA 4NBBA 1ZH1A 3BG1B 2R92I 4NBAA 2OTLZ 2EGTA 2W03A 4A3CI 4QTTA 2QR1B 3CCJZ 1NJI1 2OZKA 3CC71 3CQZI 1M901 1N2FA 3CMAZ 4RVHA 2OOXB 1JJ2Z 3S1MI 2OTJ1 1QVFY 2M6NA 1VQ6Z 5IP9I 3IX0A 2JS4A 5D1OA 3VMIA 4NBCA 3CCU1 1KQSZ 1N8R1 4E2YA 4DQYB 2GTIA 1KD11 4X6AI 2DE7A 2JA5I 1VQN1 1VQP1 3HOVI 3U50C 1Q7Y1 3CMEZ 4NBEA 3T4NB 3CCR1 3HOWI 1W2BY 2RT9A 2JA8I 2RPRA 1Q861 2F4MA 5D1OB 1YHQ1 3NDJA 4NBDA 3CCL1 2P28A 1QVGZ 3CD6Z 5T6BA 4A3DI 1NUIA 1M1K1 1S721 1YUKA 2E9HA 3GTQI 3CC2Z 3GCFA 2OOYB 3Q87A 4DK1A 1YJWZ 3JAMf 1VQ91 1P9NA 3MONA 3G6E1 1SFOI 3CCQZ 1VQLZ 1Z03A 3GTMS 1TWFI 2LFUA 1YI21 3G4S1 3K7AI 2K5RA 5A2Qb 1R9TI 1KRLA 4RV9A 3I551 2JR6A 4Y52I 1QF8A 2DE5A 3OW2Z 1I50I 1S7MA 3D9XA 4A3JI 2F4OA 3NH4A 2QEXZ 2H85A 1YIJ1 3IF8A 5C3EI 1RO0A 1RLYA 3CCUZ 1NJI2 3S14I 2GTHA 1LQLA 4NB8A 2NVQI 4A3GI 3MZKB 2JA7I 1VQNZ 3S17I 3HOXI 3GTGI 5LL6f 1ML8A 1N8R2 1X3ZA 5C44I 3S1RI 3CCRZ 1KD12 1VQKZ 2IZ4A 3I56Z 2PK7A 3CCS1 3RZOI 3CCEZ 1YIT1 3MZLB 2VUMI 4A3LI 1VQM1 2E2JI 1TFIA 2Y0SA 1YHQZ 1YJ91 1WW9A 1Q7Y2 3VB9A 2QA41 3P5JB 3J81b 3NDIA 4S1TA 1VQO1 2RIQA 3FQQA 3GTJI 3GTLI 1VQ7Z 3CC41 5C4XI 1Y1WI 1VQ5Z 4BBSI 1VQ9Z 3CXCZ 4NBGA 2QRDB 4E33A 3CCV1 1M1K2 1Q811 3VMGA 1VQ8Z 1VQ41 4BY7I 3GTMI 4XX2A 2P3YA 3S16I 2YADA 3S15I 1K731 3IFUA 3F3PC 4E2ZA 3D6WA 1DL6A 3G71Z 3FKII 2JA6I 2W04A 3EEDA 1YIJZ 1YJNZ 4MD8A 1L1OC 3M3YI 2JNYA 2V8KA 2DE6A 2JUBA 2KPIA 2OTL1 3CPWZ 4DGLA 3I4MI 3CCJ1 4BY1I 1JJ2Y 3CMA1 4QTUA 1VQ61 3TE5B 4HGYA 2J6AA 4AYBA 1KQSY 3GTOI 3S1QI 3QWUA 1Q821 2BJOA 4EWCA 2QA4Z 3CC7Z 2WB1A 1K8A1 3RZDI 2OTJZ 4E32A 4RS4A 1QVFZ 4A3FI 1RO2A 4MD9A 3VTNA 3PO3S 2QREB 2K3RA 3JAMb 3CME1 1USPA 3KIHA 2Q51A 4MH4A 1M902 2G2KA 3CCVZ 4CL1A 5C4JI 3HOZI 2PMZA 3M4OI 4E2WA 1QVGY 1VQPZ 3VMHA 3NH5A 1X3WA 2JMOA 5AN9F 4BBRI 2V8JA 2V8IA 2O53A 3CC21 1Z02A 1RO4A 1W2BZ 3I07A 3S2HI 1KC81 4NOZA 4MD7A 1Q812 2R93I 2HF1A 3CCLZ 2HU9A 1USPB 4BXXI 5T64A 1K732 3HKZA 2NVYI 1S72Z 1Q862 4A3KI 3GTKI 2I3CA 4Y7NI 2WAQA 3G6EZ 1I6HI 1K9M1 4HH4A 4A93I 2LIYA 3OW2Y 2RHBA 3S1NI 5T67A 4A3MI 4NBFA 2Q4ZA 1YI2Z 3G4SZ 2QEX1 3NFZA 5CM2M 1YUAA 3CCM1 2R6MA 3J80f 3I55Z 1TWAI 2VF1A 1RQFA 1Y1VS 2E2HI 4E31A 3EERA 4NBHA 3GKQA 1Q822 5FLXf 1K83I 1VQK1 5A2Qf 3I561 1ZB8A 2NVXI 3CCE1 3J7A4 1K8A2 3BG0B 5FLMI 4HGZA 3PO3I 2QRCB 3KIFA 1TWGI 3GTPI 1RNIA 3J80b 2RBLA 1WCMI 3I4NI 1VQ71 3HOYI 3LUSA 4TNUA 4A3II 1JWHC 1NP6A 1VQ51 1I3QI 3CCSZ 1YITZ 4RVFA 1VLAA 3CXCY 1VQMZ 3H0GI 1YJ9Z 2IZ3A 4A3EI 4E2XA 2KI7B 2GU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH A;  1X3W A;  2F4M A;  2YU9 I;  1TWC I;  4BBR I;  4NBG A;  1ZB9 A;  4NBD A;  3PO2 I;  1RO4 A;  3I07 A;  3S2H I;  4A3D I;  4NOZ A;  2B63 I;  3H3V J;  1NUI A;  2R93 I;  3GTQ I;  2HF1 A;  3S2D I;  3GCF A;  1USP B;  3Q87 A;  3VMG A;  4BXX I;  4BY7 I;  3GTM I;  4XX2 A;  2NVY I;  2P3Y A;  1SFO I;  3S16 I;  1PFT A;  4A3K I;  3S15 I;  3GTK I;  3GTM S;  4Y7N I;  1TWH I;  3D6W A;  1TWF I;  1DL6 A;  1I6H I;  2AKL A;  3K7A I;  2K5R A;  4A93 I;  2E2I I;  3FKI I;  3S1N I;  2JA6 I;  1R9T I;  4A3M I;  4NBF A;  1L1O C;  5CM2 M;  2JR6 A;  1YUA A;  4Y52 I;  2DE5 A;  3M3Y I;  1I50 I;  2JNY A;  5IP7 I;  4A3B I;  2DE6 A;  1Y1V I;  2R7Z I;  4A3J I;  2KPI A;  2F4O A;  1TWA I;  4NB9 A;  3HOU I;  1QYP A;  1Y1V S;  2NVT I;  3ESW A;  2E2H I;  3I4M I;  4NBB A;  2R92 I;  4NBA A;  5C3E I;  4BY1 I;  1RLY A;  4QTU A;  4A3C I;  3S14 I;  1LQL A;  4QTT A;  3EER A;  4NB8 A;  4NBH A;  2NVQ I;  3CQZ I;  3GKQ A;  4A3G I;  2J6A A;  1N2F A;  2JA7 I;  3S1M I;  3GTO I;  3S17 I;  3S1Q I;  5IP9 I;  1K83 I;  3HOX I;  3GTG I;  1ZB8 A;  2BJO A;  2JS4 A;  3VMI A;  1ML8 A;  2NVX I;  4NBC A;  5FLM I;  3PO3 I;  1X3Z A;  5C44 I;  3S1R I;  3RZD I;  1TWG I;  4A3F I;  2PK7 A;  3PO3 S;  3GTP I;  3RZO I;  2VUM I;  4A3L I;  2RBL A;  4X6A I;  2DE7 A;  1WCM I;  2E2J I;  3I4N I;  1USP A;  1TFI A;  2JA5 I;  4MH4 A;  3HOY I;  3LUS A;  4A3I I;  1WW9 A;  3VB9 A;  1I3Q I;  3HOV I;  3U50 C;  3HOZ I;  5C4J I;  1VLA A;  4NBE A;  3GTJ I;  3M4O I;  3GTL I;  3H0G I;  5C4X I;  4A3E I;  1Y1W I;  3HOW I;  2JA8 I;  4BBS I; 
#chains in the Genus database with same CATH topology
 1VQO Z;  2YU9 I;  1TWC I;  1ZB9 A;  3CC4 Z;  5FLX b;  2IV2 X;  5IT9 f;  1KC8 2;  3PO2 I;  1VQ8 1;  1Z01 A;  2B63 I;  4E30 A;  3H3V J;  3S2D I;  3NH8 A;  3FQM A;  2M48 A;  3G71 1;  1PFT A;  4MON A;  4MXU A;  3TDH B;  3CCM Z;  3CD6 1;  3J81 f;  4RVD A;  1TWH I;  1K9M 2;  1VQ4 Z;  1YJN 1;  2ZAE B;  2AKL A;  1WII A;  1X0T A;  3F3F C;  4NH1 C;  2NAP A;  2QLV B;  2E2I I;  1YJW 1;  3CPW Y;  4NFR A;  3CCQ 1;  4MRI A;  1VQL 1;  5D1P A;  2VUG A;  5IP7 I;  2O4H A;  4A3B I;  5IT9 b;  2QKD A;  1Y1V I;  2PM9 A;  2R7Z I;  4NB9 A;  3HOU I;  1QYP A;  2NVT I;  4RVG A;  3ESW A;  4NBB A;  1ZH1 A;  3BG1 B;  2R92 I;  4NBA A;  1AA6 A;  2OTL Z;  2EGT A;  2W03 A;  4A3C I;  4QTT A;  1FDO A;  2QR1 B;  3CCJ Z;  1NJI 1;  2OZK A;  3CC7 1;  3CQZ I;  1M90 1;  1N2F A;  3CMA Z;  4RVH A;  2OOX B;  1JJ2 Z;  3S1M I;  2OTJ 1;  1QVF Y;  2M6N A;  1VQ6 Z;  5IP9 I;  3IX0 A;  2JS4 A;  5D1O A;  3VMI A;  4NBC A;  3CCU 1;  1KQS Z;  1N8R 1;  4E2Y A;  4DQY B;  2GTI A;  1KD1 1;  4X6A I;  2DE7 A;  2JA5 I;  1VQN 1;  1VQP 1;  3HOV I;  3U50 C;  1Q7Y 1;  3IR7 A;  3CME Z;  4NBE A;  3T4N B;  3CCR 1;  3HOW I;  2JIQ A;  2RT9 A;  1W2B Y;  2RPR A;  2JA8 I;  1Q86 1;  2F4M A;  5D1O B;  1YHQ 1;  3NDJ A;  4NBD A;  3CCL 1;  2P28 A;  1QVG Z;  3CD6 Z;  5T6B A;  4A3D I;  1NUI A;  3D2L A;  1M1K 1;  1S72 1;  1YUK A;  2E9H A;  3GTQ I;  3CC2 Z;  3GCF A;  2OOY B;  2VPW A;  3Q87 A;  4DK1 A;  1YJW Z;  3JAM f;  1VQ9 1;  1P9N A;  3MON A;  3G6E 1;  1SFO I;  3CCQ Z;  1VQL Z;  1Z03 A;  3GTM S;  1TWF I;  2LFU A;  1YI2 1;  3G4S 1;  3K7A I;  2K5R A;  5A2Q b;  1R9T I;  1KRL A;  4RV9 A;  3I55 1;  1SIW A;  2JR6 A;  4Y52 I;  1QF8 A;  2DE5 A;  3OW2 Z;  1I50 I;  1S7M A;  3D9X A;  4A3J I;  2F4O A;  3NH4 A;  2QEX Z;  2H85 A;  1Q16 A;  1YIJ 1;  3IF8 A;  5C3E I;  1RO0 A;  1RLY A;  3CCU Z;  1NJI 2;  3S14 I;  2GTH A;  1LQL A;  4NB8 A;  2NVQ I;  4A3G I;  2V3V A;  3MZK B;  2VPY A;  1Y8C A;  2JA7 I;  1VQN Z;  3S17 I;  3HOX I;  3GTG I;  5LL6 f;  1ML8 A;  1N8R 2;  1X3Z A;  5C44 I;  3S1R I;  3CCR Z;  1KD1 2;  1VQK Z;  2IZ4 A;  3I56 Z;  2PK7 A;  3CCS 1;  3RZO I;  3CCE Z;  1YIT 1;  3MZL B;  2VUM I;  4A3L I;  1VQM 1;  2E2J I;  1TFI A;  2Y0S A;  1YHQ Z;  1YJ9 1;  1WW9 A;  1Q7Y 2;  3VB9 A;  2QA4 1;  3P5J B;  3J81 b;  3NDI A;  4S1T A;  1VQO 1;  2RIQ A;  3FQQ A;  3GTJ I;  3GTL I;  1VQ7 Z;  3CC4 1;  5C4X I;  1Y1W I;  1VQ5 Z;  4BBS I;  2LEX A;  3CXC Z;  1VQ9 Z;  4NBG A;  2QRD B;  4E33 A;  3CCV 1;  2JIP A;  1M1K 2;  1Q81 1;  3VMG A;  1VQ8 Z;  1VQ4 1;  4BY7 I;  3GTM I;  4XX2 A;  2P3Y A;  3S16 I;  2YAD A;  3S15 I;  1K73 1;  3IFU A;  3F3P C;  4E2Z A;  2E7Z A;  3D6W A;  1DL6 A;  3G71 Z;  3FKI I;  2JA6 I;  2V45 A;  2W04 A;  3EED A;  1YIJ Z;  1YJN Z;  4MD8 A;  1L1O C;  3M3Y I;  2JNY A;  2V8K A;  2DE6 A;  2JUB A;  2KPI A;  2OTL 1;  3CPW Z;  4DGL A;  3I4M I;  3CCJ 1;  4BY1 I;  1JJ2 Y;  3CMA 1;  4QTU A;  1VQ6 1;  3TE5 B;  4HGY A;  2J6A A;  2VPX A;  4AYB A;  1KQS Y;  3GTO I;  3S1Q I;  3QWU A;  1Q82 1;  2BJO A;  4EWC A;  2QA4 Z;  3CC7 Z;  2WB1 A;  1K8A 1;  3RZD I;  2JIO A;  2OTJ Z;  4E32 A;  4RS4 A;  1QVF Z;  4A3F I;  1RO2 A;  4MD9 A;  3VTN A;  3PO3 S;  2QRE B;  2K3R A;  3JAM b;  3CME 1;  1USP A;  3KIH A;  2Q51 A;  4MH4 A;  1M90 2;  2VPZ A;  2G2K A;  3CCV Z;  4CL1 A;  5C4J I;  3HOZ I;  2PMZ A;  3M4O I;  4E2W A;  1QVG Y;  1VQP Z;  3VMH A;  2JIM A;  1X3W A;  3NH5 A;  2JMO A;  1FDI A;  5AN9 F;  4BBR I;  2V8J A;  2V8I A;  2O53 A;  3CC2 1;  1Z02 A;  1RO4 A;  1W2B Z;  3I07 A;  3S2H I;  1KC8 1;  4NOZ A;  4MD7 A;  1Q81 2;  1QXF A;  2R93 I;  2HF1 A;  3CCL Z;  2HU9 A;  1USP B;  4BXX I;  5T64 A;  1K73 2;  3HKZ A;  2NVY I;  1S72 Z;  1Q86 2;  4A3K I;  3GTK I;  2I3C A;  4Y7N I;  2WAQ A;  3G6E Z;  1I6H I;  1K9M 1;  4HH4 A;  4A93 I;  2LIY A;  3OW2 Y;  2RHB A;  3S1N I;  5T67 A;  4A3M I;  4NBF A;  2Q4Z A;  1YI2 Z;  3G4S Z;  2QEX 1;  3NFZ A;  5CM2 M;  1YUA A;  3CCM 1;  2R6M A;  3J80 f;  3I55 Z;  1TWA I;  2VF1 A;  1RQF A;  1Y1V S;  1WJ2 A;  2E2H I;  4E31 A;  3EER A;  4NBH A;  1WZN A;  2AYD A;  3GKQ A;  1Q82 2;  5FLX f;  1K83 I;  1VQK 1;  5A2Q f;  3I56 1;  1ZB8 A;  2NVX I;  3CCE 1;  3J7A 4;  1K8A 2;  3BG0 B;  5FLM I;  4HGZ A;  3PO3 I;  2QRC B;  2JIR A;  3KIF A;  1TWG I;  3GTP I;  1RNI A;  3J80 b;  2RBL A;  1WCM I;  3I4N I;  1VQ7 1;  3HOY I;  3LUS A;  4TNU A;  4A3I I;  1JWH C;  1NP6 A;  1VQ5 1;  1I3Q I;  3CCS Z;  1YIT Z;  4RVF A;  1VLA A;  3CXC Y;  1VQM Z;  3H0G I;  1YJ9 Z;  2IZ3 A;  4A3E I;  4E2X A;  2KI7 B;  2GU2 A; 
#chains in the Genus database with same CATH homology
 1VQO Z;  2YU9 I;  1TWC I;  1ZB9 A;  3CC4 Z;  5FLX b;  5IT9 f;  1KC8 2;  3PO2 I;  1VQ8 1;  1Z01 A;  2B63 I;  4E30 A;  3H3V J;  3S2D I;  3NH8 A;  3FQM A;  2M48 A;  3G71 1;  1PFT A;  4MON A;  4MXU A;  3TDH B;  3CCM Z;  3CD6 1;  3J81 f;  4RVD A;  1TWH I;  1K9M 2;  1VQ4 Z;  1YJN 1;  2ZAE B;  2AKL A;  1WII A;  1X0T A;  3F3F C;  4NH1 C;  2QLV B;  2E2I I;  1YJW 1;  3CPW Y;  4NFR A;  3CCQ 1;  4MRI A;  1VQL 1;  5D1P A;  2VUG A;  5IP7 I;  2O4H A;  4A3B I;  5IT9 b;  2QKD A;  1Y1V I;  2PM9 A;  2R7Z I;  4NB9 A;  3HOU I;  1QYP A;  2NVT I;  4RVG A;  3ESW A;  4NBB A;  1ZH1 A;  3BG1 B;  2R92 I;  4NBA A;  2OTL Z;  2EGT A;  2W03 A;  4A3C I;  4QTT A;  2QR1 B;  3CCJ Z;  1NJI 1;  2OZK A;  3CC7 1;  3CQZ I;  1M90 1;  1N2F A;  3CMA Z;  4RVH A;  2OOX B;  1JJ2 Z;  3S1M I;  2OTJ 1;  1QVF Y;  2M6N A;  1VQ6 Z;  5IP9 I;  3IX0 A;  2JS4 A;  5D1O A;  3VMI A;  4NBC A;  3CCU 1;  1KQS Z;  1N8R 1;  4E2Y A;  4DQY B;  2GTI A;  1KD1 1;  4X6A I;  2DE7 A;  2JA5 I;  1VQN 1;  1VQP 1;  3HOV I;  3U50 C;  1Q7Y 1;  3CME Z;  4NBE A;  3T4N B;  3CCR 1;  3HOW I;  1W2B Y;  2RT9 A;  2JA8 I;  2RPR A;  1Q86 1;  2F4M A;  5D1O B;  1YHQ 1;  3NDJ A;  4NBD A;  3CCL 1;  2P28 A;  1QVG Z;  3CD6 Z;  5T6B A;  4A3D I;  1NUI A;  1M1K 1;  1S72 1;  1YUK A;  2E9H A;  3GTQ I;  3CC2 Z;  3GCF A;  2OOY B;  3Q87 A;  4DK1 A;  1YJW Z;  3JAM f;  1VQ9 1;  1P9N A;  3MON A;  3G6E 1;  1SFO I;  3CCQ Z;  1VQL Z;  1Z03 A;  3GTM S;  1TWF I;  2LFU A;  1YI2 1;  3G4S 1;  3K7A I;  2K5R A;  5A2Q b;  1R9T I;  1KRL A;  4RV9 A;  3I55 1;  2JR6 A;  4Y52 I;  1QF8 A;  2DE5 A;  3OW2 Z;  1I50 I;  1S7M A;  3D9X A;  4A3J I;  2F4O A;  3NH4 A;  2QEX Z;  2H85 A;  1YIJ 1;  3IF8 A;  5C3E I;  1RO0 A;  1RLY A;  3CCU Z;  1NJI 2;  3S14 I;  2GTH A;  1LQL A;  4NB8 A;  2NVQ I;  4A3G I;  3MZK B;  2JA7 I;  1VQN Z;  3S17 I;  3HOX I;  3GTG I;  5LL6 f;  1ML8 A;  1N8R 2;  1X3Z A;  5C44 I;  3S1R I;  3CCR Z;  1KD1 2;  1VQK Z;  2IZ4 A;  3I56 Z;  2PK7 A;  3CCS 1;  3RZO I;  3CCE Z;  1YIT 1;  3MZL B;  2VUM I;  4A3L I;  1VQM 1;  2E2J I;  1TFI A;  2Y0S A;  1YHQ Z;  1YJ9 1;  1WW9 A;  1Q7Y 2;  3VB9 A;  2QA4 1;  3P5J B;  3J81 b;  3NDI A;  4S1T A;  1VQO 1;  2RIQ A;  3FQQ A;  3GTJ I;  3GTL I;  1VQ7 Z;  3CC4 1;  5C4X I;  1Y1W I;  1VQ5 Z;  4BBS I;  1VQ9 Z;  3CXC Z;  4NBG A;  2QRD B;  4E33 A;  3CCV 1;  1M1K 2;  1Q81 1;  3VMG A;  1VQ8 Z;  1VQ4 1;  4BY7 I;  3GTM I;  4XX2 A;  2P3Y A;  3S16 I;  2YAD A;  3S15 I;  1K73 1;  3IFU A;  3F3P C;  4E2Z A;  3D6W A;  1DL6 A;  3G71 Z;  3FKI I;  2JA6 I;  2W04 A;  3EED A;  1YIJ Z;  1YJN Z;  4MD8 A;  1L1O C;  3M3Y I;  2JNY A;  2V8K A;  2DE6 A;  2JUB A;  2KPI A;  2OTL 1;  3CPW Z;  4DGL A;  3I4M I;  3CCJ 1;  4BY1 I;  1JJ2 Y;  3CMA 1;  4QTU A;  1VQ6 1;  3TE5 B;  4HGY A;  2J6A A;  4AYB A;  1KQS Y;  3GTO I;  3S1Q I;  3QWU A;  1Q82 1;  2BJO A;  4EWC A;  2QA4 Z;  3CC7 Z;  2WB1 A;  1K8A 1;  3RZD I;  2OTJ Z;  4E32 A;  4RS4 A;  1QVF Z;  4A3F I;  1RO2 A;  4MD9 A;  3VTN A;  3PO3 S;  2QRE B;  2K3R A;  3JAM b;  3CME 1;  1USP A;  3KIH A;  2Q51 A;  4MH4 A;  1M90 2;  2G2K A;  3CCV Z;  4CL1 A;  5C4J I;  3HOZ I;  2PMZ A;  3M4O I;  4E2W A;  1QVG Y;  1VQP Z;  3VMH A;  3NH5 A;  1X3W A;  2JMO A;  5AN9 F;  4BBR I;  2V8J A;  2V8I A;  2O53 A;  3CC2 1;  1Z02 A;  1RO4 A;  1W2B Z;  3I07 A;  3S2H I;  1KC8 1;  4NOZ A;  4MD7 A;  1Q81 2;  2R93 I;  2HF1 A;  3CCL Z;  2HU9 A;  1USP B;  4BXX I;  5T64 A;  1K73 2;  3HKZ A;  2NVY I;  1S72 Z;  1Q86 2;  4A3K I;  3GTK I;  2I3C A;  4Y7N I;  2WAQ A;  3G6E Z;  1I6H I;  1K9M 1;  4HH4 A;  4A93 I;  2LIY A;  3OW2 Y;  2RHB A;  3S1N I;  5T67 A;  4A3M I;  4NBF A;  2Q4Z A;  1YI2 Z;  3G4S Z;  2QEX 1;  3NFZ A;  5CM2 M;  1YUA A;  3CCM 1;  2R6M A;  3J80 f;  3I55 Z;  1TWA I;  2VF1 A;  1RQF A;  1Y1V S;  2E2H I;  4E31 A;  3EER A;  4NBH A;  3GKQ A;  1Q82 2;  5FLX f;  1K83 I;  1VQK 1;  5A2Q f;  3I56 1;  1ZB8 A;  2NVX I;  3CCE 1;  3J7A 4;  1K8A 2;  3BG0 B;  5FLM I;  4HGZ A;  3PO3 I;  2QRC B;  3KIF A;  1TWG I;  3GTP I;  1RNI A;  3J80 b;  2RBL A;  1WCM I;  3I4N I;  1VQ7 1;  3HOY I;  3LUS A;  4TNU A;  4A3I I;  1JWH C;  1NP6 A;  1VQ5 1;  1I3Q I;  3CCS Z;  1YIT Z;  4RVF A;  1VLA A;  3CXC Y;  1VQM Z;  3H0G I;  1YJ9 Z;  2IZ3 A;  4A3E I;  4E2X A;  2KI7 B;  2GU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...