4X6AI

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4x6aI02
1TWAI 3EERA 3RZOI 3GCFA 1SFOI 1ML8A 3VMGA 2DE6A 5C4JI 3I4NI 1DL6A 1USPB 1TWFI 2B63I 1Y1WI 3PO3I 4BY1I 2E2JI 5IP7I 3S17I 1TFIA 2JNYA 3GTKI 1X3ZA 2JR6A 1ZB9A 1WCMI 3S1MI 3S15I 3M4OI 4NBAA 4BBRI 3PO3S 1I3QI 2NVYI 2E2HI 1TWCI 4NB8A 5C44I 1QYPA 2AKLA 2JS4A 2K5RA 1NUIA 4QTUA 2R93I 2JA5I 3S2HI 3I07A 5C4XI 1LQLA 1WW9A 2YU9I 1R9TI 3Q87A 1RLYA 2DE7A 3U50C 4NBFA 2VUMI 4BBSI 3HOUI 4BY7I 2F4OA 3GTOI 2BJOA 5C3EI 4BXXI 2JA8I 1USPA 1I50I 2NVTI 3HOVI 3VMHA 3S1QI 2HF1A 4XX2A 2NVXI 1N2FA 2RBLA 4A3DI 2DE5A 4Y7NI 4NBHA 4NBCA 3VB9A 1ZB8A 1Y1VI 4NOZA 4NBBA 3K7AI 1K83I 4A3KI 4NBEA 3GTGI 3RZDI 3I4MI 4X6AI 4Y52I 4A3LI 3GTJI 4A93I 3S1RI 3H3VJ 3GTMS 3H0GI 4A3GI 4A3BI 4A3II 5FLMI 3HOYI 2NVQI 5CM2M 3FKII 1Y1VS 1L1OC 4A3EI 4A3JI 2PK7A 1RO4A 4NBDA 1TWHI 3PO2I 3GTQI 2JA7I 3GTLI 2E2II 3LUSA 3CQZI 3VMIA 4NB9A 3GTMI 2J6AA 3M3YI 2KPIA 3ESWA 3S2DI 2F4MA 4MH4A 1YUAA 4A3CI 1TWGI 2JA6I 4A3FI 4NBGA 1PFTA 1VLAA 4A3MI 5IP9I 3HOXI 3D6WA 3HOZI 2R92I 3S16I 4QTTA 3S14I 1I6HI 1X3WA 3HOWI 2R7ZI 2P3YA 3GTPI 3S1NI 3GKQA
chains in the Genus database with same CATH superfamily
3NDIA 1RO0A 3RZOI 4MD9A 4CL1A 3CCSZ 1K732 4E2ZA 2OTJ1 2QREB 3OW2Z 1ML8A 1K8A2 2DE6A 1S72Z 1JWHC 4BY1I 3CCM1 1RQFA 3S17I 1X3ZA 2JR6A 5A2Qb 1ZB9A 1WIIA 2OTL1 4NBAA 5D1OB 3TDHB 2NVYI 4HGYA 2E2HI 3I561 5T67A 5C44I 1QYPA 2H85A 3I551 1KQSZ 3JAMb 2JA5I 4S1TA 4MD8A 1LQLA 1QF8A 3Q87A 3IFUA 4BBSI 2F4OA 2BJOA 2JA8I 1I50I 1NP6A 2OOXB 3HOVI 3EEDA 4NFRA 2VUGA 3VMHA 2HF1A 2QA4Z 1KRLA 2OZKA 5D1OA 3VB9A 3CCL1 1Y1VI 2QR1B 4NBBA 2QEX1 3CC2Z 2PMZA 4A3KI 4NBEA 3CXCZ 4Y52I 4A3LI 1YJW1 3D9XA 2VPWA 3HOYI 1YUKA 4RVGA 1M901 1Z02A 3MONA 1Q822 2NVQI 2I3CA 3CCS1 1L1OC 3P5JB 4A3JI 1Z03A 1RO4A 1TWHI 1AA6A 3LUSA 3VMIA 3GTMI 1S721 3M3YI 2QLVB 4HH4A 1NJI2 5AN9F 2JMOA 2M6NA 4MH4A 5FLXb 2G2KA 4MRIA 4E30A 1VQNZ 3OW2Y 5T6BA 3I55Z 1YIT1 3S14I 2VF1A 2GTIA 4RVFA 2R7ZI 3CD6Z 2LFUA 2WAQA 3EERA 1KD12 3CC7Z 3I4NI 4MD7A 3VTNA 3NFZA 3CCLZ 1KQSY 2E2JI 2IV2X 3CC41 1TFIA 2JIPA 3GTKI 3MZKB 3KIFA 2QA41 1WCMI 3S1MI 2V8IA 3S15I 1Q862 4RS4A 4BBRI 3PO3S 3CC21 3G4SZ 1N8R1 4E2XA 1VQ91 2V8KA 2JIOA 1NUIA 4NH1C 3NH8A 1WW9A 4DK1A 2JIRA 1RLYA 4NBFA 3J81b 4BY7I 3GTOI 4BXXI 3CXCY 1K9M1 1VQL1 1M1K1 1FDIA 1S7MA 3S1QI 4XX2A 1YITZ 4RVHA 3FQMA 4A3DI 2QRDB 1VQN1 2DE5A 3NDJA 3KIHA 3K7AI 1K83I 3RZDI 3I4MI 3F3FC 3S1RI 3H3VJ 3GTMS 4A3GI 1W2BY 5FLMI 3CD61 3FKII 1X0TA 2PK7A 2RPRA 4NBDA 4EWCA 3GTQI 2QKDA 1RO2A 3CC4Z 3CC71 1VQ81 2E2II 2IZ3A 1JJ2Y 3S2DI 1YJNZ 1YUAA 4RVDA 4HGZA 1VQ9Z 4A3FI 2VPZA 4NBGA 4A3MI 3D6WA 1YJ9Z 2R92I 3G4S1 3J80f 2KI7B 2ZAEB 1M902 2AYDA 2RIQA 2RT9A 1P9NA 4E2YA 1VQLZ 3MZLB 4E32A 1YIJZ 3VMGA 3FQQA 1VQ6Z 1Q811 2LIYA 1DL6A 1USPB 2LEXA 3NH4A 1YI2Z 1VQPZ 2B63I 3IX0A 1SIWA 3CMEZ 2JNYA 1RNIA 1FDOA 2JIQA 4AYBA 1QVGZ 1I3QI 1TWCI 4NB8A 2OOYB 4E33A 5D1PA 1Z01A 2AKLA 1VQO1 4QTUA 5LL6f 3S2HI 1VQ8Z 2YU9I 1R9TI 3BG1B 3U50C 2VUMI 3HOUI 5C3EI 1USPA 1VQ4Z 3CCE1 4DGLA 1YJN1 5A2Qf 5IT9b 1N2FA 2RBLA 2JIMA 2W03A 1VQMZ 4Y7NI 3BG0B 4NBCA 1QVFZ 1ZB8A 1N8R2 1Q7Y1 3J7A4 3D2LA 1YJ91 3GTGI 3CCRZ 3JAMf 2V45A 4MXUA 5CM2M 1Y1VS 1K731 2R6MA 3G71Z 1YIJ1 1K8A1 1VQ61 1K9M2 3GTLI 2E7ZA 3F3PC 1VQP1 1YI21 5T64A 1M1K2 3ESWA 2M48A 3CMAZ 3CCU1 2K3RA 3CME1 2JUBA 3G6EZ 1TWGI 1ZH1A 3HKZA 1PFTA 1VLAA 1VQOZ 5IP9I 3HOXI 2P28A 1YHQZ 3HOZI 2V3VA 1I6HI 1QXFA 3GTPI 3CCJZ 4RV9A 3S1NI 3GKQA 2Q4ZA 3CPWZ 1TWAI 3NH5A 1VQ7Z 3GCFA 2NAPA 1SFOI 3QWUA 3T4NB 1VQKZ 5C4JI 1QVGY 3CCEZ 3CCVZ 1TWFI 2GTHA 1Y1WI 3PO3I 1VQ41 5FLXf 5IP7I 2HU9A 1VQM1 3M4OI 2WB1A 3CCQ1 4E2WA 1Y8CA 3IR7A 2K5RA 2JS4A 3CCR1 4DQYB 2R93I 3IF8A 3I07A 2OTJZ 5C4XI 2V8JA 1Q821 1KC81 2DE7A 3G711 1QVFY 3CCUZ 1VQ51 1Q812 1WZNA 2O4HA 1KC82 2GU2A 2VPXA 2NVTI 3CCMZ 3CMA1 1NJI1 1WJ2A 2YADA 2NVXI 3TE5B 3G6E1 2E9HA 1W2BZ 4NBHA 2OTLZ 4NOZA 1YHQ1 5IT9f 3I56Z 4X6AI 1Q16A 4TNUA 3GTJI 4A93I 3H0GI 3J80b 4A3BI 4A3II 3CCJ1 2Q51A 1VQ71 4A3EI 1JJ2Z 2IZ4A 3J81f 2Y0SA 3PO2I 2JA7I 1VQK1 1KD11 3CCV1 3CQZI 4MONA 4NB9A 2W04A 2J6AA 2KPIA 4E31A 2O53A 3CCQZ 3CPWY 2F4MA 2EGTA 4A3CI 2JA6I 2VPYA 2QEXZ 1Q7Y2 1Q861 2QRCB 3S16I 4QTTA 2RHBA 2PM9A 1YJWZ 1X3WA 3HOWI 2P3YA 1VQ5Z
chains in the Genus database with same CATH topology
3NDIA 1RO0A 3RZOI 4MD9A 4CL1A 3CCSZ 1K732 4E2ZA 2OTJ1 2QREB 3OW2Z 1ML8A 1K8A2 2DE6A 1S72Z 1JWHC 4BY1I 3CCM1 1RQFA 3S17I 2JR6A 1X3ZA 5A2Qb 1ZB9A 1WIIA 2OTL1 4NBAA 5D1OB 3TDHB 2NVYI 4HGYA 2E2HI 3I561 5T67A 5C44I 1QYPA 2H85A 3I551 1KQSZ 3JAMb 2JA5I 4S1TA 4MD8A 1LQLA 1QF8A 3Q87A 3IFUA 4BBSI 2F4OA 2BJOA 2JA8I 1I50I 1NP6A 2OOXB 3HOVI 3EEDA 4NFRA 2VUGA 3VMHA 2HF1A 2QA4Z 1KRLA 2OZKA 5D1OA 3VB9A 3CCL1 1Y1VI 2QR1B 4NBBA 2QEX1 3CC2Z 2PMZA 4A3KI 4NBEA 3CXCZ 4Y52I 4A3LI 1YJW1 3D9XA 3HOYI 1YUKA 4RVGA 1M901 1Z02A 3MONA 1Q822 2NVQI 2I3CA 3CCS1 1L1OC 3P5JB 4A3JI 1Z03A 1RO4A 1TWHI 3LUSA 3VMIA 3GTMI 1S721 3M3YI 2QLVB 4HH4A 1NJI2 5AN9F 2JMOA 2M6NA 4MH4A 5FLXb 2G2KA 4MRIA 4E30A 1VQNZ 3OW2Y 5T6BA 3I55Z 1YIT1 3S14I 2VF1A 2GTIA 4RVFA 2R7ZI 3CD6Z 2LFUA 2WAQA 3EERA 1KD12 3CC7Z 3I4NI 4MD7A 3VTNA 3NFZA 3CCLZ 1KQSY 2E2JI 3CC41 1TFIA 3GTKI 3MZKB 3KIFA 2QA41 1WCMI 3S1MI 2V8IA 3S15I 1Q862 4RS4A 4BBRI 3PO3S 3CC21 3G4SZ 1N8R1 4E2XA 1VQ91 2V8KA 1NUIA 4NH1C 3NH8A 1WW9A 4DK1A 1RLYA 4NBFA 3J81b 4BY7I 3GTOI 4BXXI 3CXCY 1K9M1 1VQL1 1M1K1 1S7MA 3S1QI 4XX2A 1YITZ 4RVHA 3FQMA 4A3DI 2QRDB 1VQN1 2DE5A 3NDJA 3KIHA 3K7AI 1K83I 3RZDI 3I4MI 3F3FC 3S1RI 3H3VJ 3GTMS 4A3GI 1W2BY 5FLMI 3CD61 3FKII 1X0TA 2PK7A 2RPRA 4NBDA 4EWCA 3GTQI 2QKDA 1RO2A 3CC4Z 3CC71 1VQ81 2E2II 2IZ3A 1JJ2Y 3S2DI 1YJNZ 1YUAA 4RVDA 4HGZA 1VQ9Z 4A3FI 4NBGA 4A3MI 3D6WA 1YJ9Z 2R92I 3G4S1 3J80f 2KI7B 2ZAEB 1M902 2RIQA 2RT9A 1P9NA 4E2YA 1VQLZ 3MZLB 4E32A 1YIJZ 3VMGA 3FQQA 1VQ6Z 1Q811 2LIYA 1DL6A 1USPB 1YI2Z 3NH4A 1VQPZ 2B63I 3IX0A 3CMEZ 2JNYA 1RNIA 4AYBA 1QVGZ 1I3QI 1TWCI 4NB8A 2OOYB 4E33A 5D1PA 1Z01A 2AKLA 1VQO1 4QTUA 5LL6f 3S2HI 1VQ8Z 2YU9I 1R9TI 3BG1B 3U50C 2VUMI 3HOUI 5C3EI 1USPA 1VQ4Z 3CCE1 4DGLA 1YJN1 5A2Qf 5IT9b 1N2FA 2RBLA 2W03A 1VQMZ 4Y7NI 3BG0B 4NBCA 1QVFZ 1ZB8A 1N8R2 1Q7Y1 3J7A4 1YJ91 3GTGI 3CCRZ 3JAMf 4MXUA 5CM2M 1Y1VS 1K731 2R6MA 3G71Z 1YIJ1 1K8A1 1VQ61 1K9M2 3GTLI 3F3PC 1VQP1 1YI21 5T64A 1M1K2 3ESWA 2M48A 3CMAZ 3CCU1 2K3RA 3CME1 2JUBA 3G6EZ 1TWGI 1ZH1A 3HKZA 1PFTA 1VLAA 1VQOZ 5IP9I 3HOXI 2P28A 1YHQZ 3HOZI 1I6HI 3GTPI 3CCJZ 4RV9A 3S1NI 3GKQA 2Q4ZA 3CPWZ 1TWAI 3NH5A 1VQ7Z 3GCFA 1SFOI 3QWUA 3T4NB 1VQKZ 5C4JI 1QVGY 3CCEZ 3CCVZ 1TWFI 2GTHA 1Y1WI 3PO3I 1VQ41 5FLXf 5IP7I 2HU9A 1VQM1 3M4OI 2WB1A 3CCQ1 4E2WA 2K5RA 2JS4A 3CCR1 4DQYB 2R93I 3IF8A 3I07A 2OTJZ 5C4XI 2V8JA 1Q821 1KC81 2DE7A 3G711 1QVFY 3CCUZ 1VQ51 1Q812 2O4HA 1KC82 2GU2A 2NVTI 3CCMZ 3CMA1 1NJI1 2NVXI 2YADA 3TE5B 3G6E1 2E9HA 1W2BZ 4NBHA 2OTLZ 4NOZA 1YHQ1 5IT9f 3I56Z 4X6AI 4TNUA 3GTJI 4A93I 3H0GI 3J80b 4A3BI 4A3II 3CCJ1 2Q51A 1VQ71 4A3EI 1JJ2Z 2IZ4A 3J81f 2Y0SA 3PO2I 2JA7I 1VQK1 1KD11 3CCV1 3CQZI 4MONA 4NB9A 2W04A 2J6AA 2KPIA 4E31A 2O53A 3CCQZ 3CPWY 2F4MA 2EGTA 4A3CI 2JA6I 2QEXZ 1Q7Y2 1Q861 2QRCB 3S16I 4QTTA 2RHBA 2PM9A 1YJWZ 1X3WA 3HOWI 2P3YA 1VQ5Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  3EER A;  3RZO I;  3GCF A;  1SFO I;  1ML8 A;  3VMG A;  2DE6 A;  5C4J I;  3I4N I;  1DL6 A;  1USP B;  1TWF I;  2B63 I;  1Y1W I;  3PO3 I;  4BY1 I;  2E2J I;  5IP7 I;  3S17 I;  1TFI A;  2JNY A;  3GTK I;  1X3Z A;  2JR6 A;  1ZB9 A;  1WCM I;  3S1M I;  3S15 I;  3M4O I;  4NBA A;  4BBR I;  3PO3 S;  1I3Q I;  2NVY I;  2E2H I;  1TWC I;  4NB8 A;  5C44 I;  1QYP A;  2AKL A;  2JS4 A;  2K5R A;  1NUI A;  4QTU A;  2R93 I;  2JA5 I;  3S2H I;  3I07 A;  5C4X I;  1LQL A;  1WW9 A;  2YU9 I;  1R9T I;  3Q87 A;  1RLY A;  2DE7 A;  3U50 C;  4NBF A;  2VUM I;  4BBS I;  3HOU I;  4BY7 I;  2F4O A;  3GTO I;  2BJO A;  5C3E I;  4BXX I;  2JA8 I;  1USP A;  1I50 I;  2NVT I;  3HOV I;  3VMH A;  3S1Q I;  2HF1 A;  4XX2 A;  2NVX I;  1N2F A;  2RBL A;  4A3D I;  2DE5 A;  4Y7N I;  4NBH A;  4NBC A;  3VB9 A;  1ZB8 A;  1Y1V I;  4NOZ A;  4NBB A;  3K7A I;  1K83 I;  4A3K I;  4NBE A;  3GTG I;  3RZD I;  3I4M I;  4X6A I;  4Y52 I;  4A3L I;  3GTJ I;  4A93 I;  3S1R I;  3H3V J;  3GTM S;  3H0G I;  4A3G I;  4A3B I;  4A3I I;  5FLM I;  3HOY I;  2NVQ I;  5CM2 M;  3FKI I;  1Y1V S;  1L1O C;  4A3E I;  4A3J I;  2PK7 A;  1RO4 A;  4NBD A;  1TWH I;  3PO2 I;  3GTQ I;  2JA7 I;  3GTL I;  2E2I I;  3LUS A;  3CQZ I;  3VMI A;  4NB9 A;  3GTM I;  2J6A A;  3M3Y I;  2KPI A;  3ESW A;  3S2D I;  2F4M A;  4MH4 A;  1YUA A;  4A3C I;  1TWG I;  2JA6 I;  4A3F I;  4NBG A;  1PFT A;  1VLA A;  4A3M I;  5IP9 I;  3HOX I;  3D6W A;  3HOZ I;  2R92 I;  3S16 I;  4QTT A;  3S14 I;  1I6H I;  1X3W A;  3HOW I;  2R7Z I;  2P3Y A;  3GTP I;  3S1N I;  3GKQ A; 
#chains in the Genus database with same CATH topology
 3NDI A;  1RO0 A;  3RZO I;  4MD9 A;  4CL1 A;  3CCS Z;  1K73 2;  4E2Z A;  2OTJ 1;  2QRE B;  3OW2 Z;  1ML8 A;  1K8A 2;  2DE6 A;  1S72 Z;  1JWH C;  4BY1 I;  3CCM 1;  1RQF A;  3S17 I;  1X3Z A;  2JR6 A;  5A2Q b;  1ZB9 A;  1WII A;  2OTL 1;  4NBA A;  5D1O B;  3TDH B;  2NVY I;  4HGY A;  2E2H I;  3I56 1;  5T67 A;  5C44 I;  1QYP A;  2H85 A;  3I55 1;  1KQS Z;  3JAM b;  2JA5 I;  4S1T A;  4MD8 A;  1LQL A;  1QF8 A;  3Q87 A;  3IFU A;  4BBS I;  2F4O A;  2BJO A;  2JA8 I;  1I50 I;  1NP6 A;  2OOX B;  3HOV I;  3EED A;  4NFR A;  2VUG A;  3VMH A;  2HF1 A;  2QA4 Z;  1KRL A;  2OZK A;  5D1O A;  3VB9 A;  3CCL 1;  1Y1V I;  2QR1 B;  4NBB A;  2QEX 1;  3CC2 Z;  2PMZ A;  4A3K I;  4NBE A;  3CXC Z;  4Y52 I;  4A3L I;  1YJW 1;  3D9X A;  2VPW A;  3HOY I;  1YUK A;  4RVG A;  1M90 1;  1Z02 A;  3MON A;  1Q82 2;  2NVQ I;  2I3C A;  3CCS 1;  1L1O C;  3P5J B;  4A3J I;  1Z03 A;  1RO4 A;  1TWH I;  1AA6 A;  3LUS A;  3VMI A;  3GTM I;  1S72 1;  3M3Y I;  2QLV B;  4HH4 A;  1NJI 2;  5AN9 F;  2JMO A;  2M6N A;  4MH4 A;  5FLX b;  2G2K A;  4MRI A;  4E30 A;  1VQN Z;  3OW2 Y;  5T6B A;  3I55 Z;  1YIT 1;  3S14 I;  2VF1 A;  2GTI A;  4RVF A;  2R7Z I;  3CD6 Z;  2LFU A;  2WAQ A;  3EER A;  1KD1 2;  3CC7 Z;  3I4N I;  4MD7 A;  3VTN A;  3NFZ A;  3CCL Z;  1KQS Y;  2E2J I;  2IV2 X;  3CC4 1;  1TFI A;  2JIP A;  3GTK I;  3MZK B;  3KIF A;  2QA4 1;  1WCM I;  3S1M I;  2V8I A;  3S15 I;  1Q86 2;  4RS4 A;  4BBR I;  3PO3 S;  3CC2 1;  3G4S Z;  1N8R 1;  4E2X A;  1VQ9 1;  2V8K A;  2JIO A;  1NUI A;  4NH1 C;  3NH8 A;  1WW9 A;  4DK1 A;  2JIR A;  1RLY A;  4NBF A;  3J81 b;  4BY7 I;  3GTO I;  4BXX I;  3CXC Y;  1K9M 1;  1VQL 1;  1M1K 1;  1FDI A;  1S7M A;  3S1Q I;  4XX2 A;  1YIT Z;  4RVH A;  3FQM A;  4A3D I;  2QRD B;  1VQN 1;  2DE5 A;  3NDJ A;  3KIH A;  3K7A I;  1K83 I;  3RZD I;  3I4M I;  3F3F C;  3S1R I;  3H3V J;  3GTM S;  4A3G I;  1W2B Y;  5FLM I;  3CD6 1;  3FKI I;  1X0T A;  2PK7 A;  2RPR A;  4NBD A;  4EWC A;  3GTQ I;  2QKD A;  1RO2 A;  3CC4 Z;  3CC7 1;  1VQ8 1;  2E2I I;  2IZ3 A;  1JJ2 Y;  3S2D I;  1YJN Z;  1YUA A;  4RVD A;  4HGZ A;  1VQ9 Z;  4A3F I;  2VPZ A;  4NBG A;  4A3M I;  3D6W A;  1YJ9 Z;  2R92 I;  3G4S 1;  3J80 f;  2KI7 B;  2ZAE B;  1M90 2;  2AYD A;  2RIQ A;  2RT9 A;  1P9N A;  4E2Y A;  1VQL Z;  3MZL B;  4E32 A;  1YIJ Z;  3VMG A;  3FQQ A;  1VQ6 Z;  1Q81 1;  2LIY A;  1DL6 A;  1USP B;  2LEX A;  3NH4 A;  1YI2 Z;  1VQP Z;  2B63 I;  3IX0 A;  1SIW A;  3CME Z;  2JNY A;  1RNI A;  1FDO A;  2JIQ A;  4AYB A;  1QVG Z;  1I3Q I;  1TWC I;  4NB8 A;  2OOY B;  4E33 A;  5D1P A;  1Z01 A;  2AKL A;  1VQO 1;  4QTU A;  5LL6 f;  3S2H I;  1VQ8 Z;  2YU9 I;  1R9T I;  3BG1 B;  3U50 C;  2VUM I;  3HOU I;  5C3E I;  1USP A;  1VQ4 Z;  3CCE 1;  4DGL A;  1YJN 1;  5A2Q f;  5IT9 b;  1N2F A;  2RBL A;  2JIM A;  2W03 A;  1VQM Z;  4Y7N I;  3BG0 B;  4NBC A;  1QVF Z;  1ZB8 A;  1N8R 2;  1Q7Y 1;  3J7A 4;  3D2L A;  1YJ9 1;  3GTG I;  3CCR Z;  3JAM f;  2V45 A;  4MXU A;  5CM2 M;  1Y1V S;  1K73 1;  2R6M A;  3G71 Z;  1YIJ 1;  1K8A 1;  1VQ6 1;  1K9M 2;  3GTL I;  2E7Z A;  3F3P C;  1VQP 1;  1YI2 1;  5T64 A;  1M1K 2;  3ESW A;  2M48 A;  3CMA Z;  3CCU 1;  2K3R A;  3CME 1;  2JUB A;  3G6E Z;  1TWG I;  1ZH1 A;  3HKZ A;  1PFT A;  1VLA A;  1VQO Z;  5IP9 I;  3HOX I;  2P28 A;  1YHQ Z;  3HOZ I;  2V3V A;  1I6H I;  1QXF A;  3GTP I;  3CCJ Z;  4RV9 A;  3S1N I;  3GKQ A;  2Q4Z A;  3CPW Z;  1TWA I;  3NH5 A;  1VQ7 Z;  3GCF A;  2NAP A;  1SFO I;  3QWU A;  3T4N B;  1VQK Z;  5C4J I;  1QVG Y;  3CCE Z;  3CCV Z;  1TWF I;  2GTH A;  1Y1W I;  3PO3 I;  1VQ4 1;  5FLX f;  5IP7 I;  2HU9 A;  1VQM 1;  3M4O I;  2WB1 A;  3CCQ 1;  4E2W A;  1Y8C A;  3IR7 A;  2K5R A;  2JS4 A;  3CCR 1;  4DQY B;  2R93 I;  3IF8 A;  3I07 A;  2OTJ Z;  5C4X I;  2V8J A;  1Q82 1;  1KC8 1;  2DE7 A;  3G71 1;  1QVF Y;  3CCU Z;  1VQ5 1;  1Q81 2;  1WZN A;  2O4H A;  1KC8 2;  2GU2 A;  2VPX A;  2NVT I;  3CCM Z;  3CMA 1;  1NJI 1;  1WJ2 A;  2YAD A;  2NVX I;  3TE5 B;  3G6E 1;  2E9H A;  1W2B Z;  4NBH A;  2OTL Z;  4NOZ A;  1YHQ 1;  5IT9 f;  3I56 Z;  4X6A I;  1Q16 A;  4TNU A;  3GTJ I;  4A93 I;  3H0G I;  3J80 b;  4A3B I;  4A3I I;  3CCJ 1;  2Q51 A;  1VQ7 1;  4A3E I;  1JJ2 Z;  2IZ4 A;  3J81 f;  2Y0S A;  3PO2 I;  2JA7 I;  1VQK 1;  1KD1 1;  3CCV 1;  3CQZ I;  4MON A;  4NB9 A;  2W04 A;  2J6A A;  2KPI A;  4E31 A;  2O53 A;  3CCQ Z;  3CPW Y;  2F4M A;  2EGT A;  4A3C I;  2JA6 I;  2VPY A;  2QEX Z;  1Q7Y 2;  1Q86 1;  2QRC B;  3S16 I;  4QTT A;  2RHB A;  2PM9 A;  1YJW Z;  1X3W A;  3HOW I;  2P3Y A;  1VQ5 Z; 
#chains in the Genus database with same CATH homology
 3NDI A;  1RO0 A;  3RZO I;  4MD9 A;  4CL1 A;  3CCS Z;  1K73 2;  4E2Z A;  2OTJ 1;  2QRE B;  3OW2 Z;  1ML8 A;  1K8A 2;  2DE6 A;  1S72 Z;  1JWH C;  4BY1 I;  3CCM 1;  1RQF A;  3S17 I;  2JR6 A;  1X3Z A;  5A2Q b;  1ZB9 A;  1WII A;  2OTL 1;  4NBA A;  5D1O B;  3TDH B;  2NVY I;  4HGY A;  2E2H I;  3I56 1;  5T67 A;  5C44 I;  1QYP A;  2H85 A;  3I55 1;  1KQS Z;  3JAM b;  2JA5 I;  4S1T A;  4MD8 A;  1LQL A;  1QF8 A;  3Q87 A;  3IFU A;  4BBS I;  2F4O A;  2BJO A;  2JA8 I;  1I50 I;  1NP6 A;  2OOX B;  3HOV I;  3EED A;  4NFR A;  2VUG A;  3VMH A;  2HF1 A;  2QA4 Z;  1KRL A;  2OZK A;  5D1O A;  3VB9 A;  3CCL 1;  1Y1V I;  2QR1 B;  4NBB A;  2QEX 1;  3CC2 Z;  2PMZ A;  4A3K I;  4NBE A;  3CXC Z;  4Y52 I;  4A3L I;  1YJW 1;  3D9X A;  3HOY I;  1YUK A;  4RVG A;  1M90 1;  1Z02 A;  3MON A;  1Q82 2;  2NVQ I;  2I3C A;  3CCS 1;  1L1O C;  3P5J B;  4A3J I;  1Z03 A;  1RO4 A;  1TWH I;  3LUS A;  3VMI A;  3GTM I;  1S72 1;  3M3Y I;  2QLV B;  4HH4 A;  1NJI 2;  5AN9 F;  2JMO A;  2M6N A;  4MH4 A;  5FLX b;  2G2K A;  4MRI A;  4E30 A;  1VQN Z;  3OW2 Y;  5T6B A;  3I55 Z;  1YIT 1;  3S14 I;  2VF1 A;  2GTI A;  4RVF A;  2R7Z I;  3CD6 Z;  2LFU A;  2WAQ A;  3EER A;  1KD1 2;  3CC7 Z;  3I4N I;  4MD7 A;  3VTN A;  3NFZ A;  3CCL Z;  1KQS Y;  2E2J I;  3CC4 1;  1TFI A;  3GTK I;  3MZK B;  3KIF A;  2QA4 1;  1WCM I;  3S1M I;  2V8I A;  3S15 I;  1Q86 2;  4RS4 A;  4BBR I;  3PO3 S;  3CC2 1;  3G4S Z;  1N8R 1;  4E2X A;  1VQ9 1;  2V8K A;  1NUI A;  4NH1 C;  3NH8 A;  1WW9 A;  4DK1 A;  1RLY A;  4NBF A;  3J81 b;  4BY7 I;  3GTO I;  4BXX I;  3CXC Y;  1K9M 1;  1VQL 1;  1M1K 1;  1S7M A;  3S1Q I;  4XX2 A;  1YIT Z;  4RVH A;  3FQM A;  4A3D I;  2QRD B;  1VQN 1;  2DE5 A;  3NDJ A;  3KIH A;  3K7A I;  1K83 I;  3RZD I;  3I4M I;  3F3F C;  3S1R I;  3H3V J;  3GTM S;  4A3G I;  1W2B Y;  5FLM I;  3CD6 1;  3FKI I;  1X0T A;  2PK7 A;  2RPR A;  4NBD A;  4EWC A;  3GTQ I;  2QKD A;  1RO2 A;  3CC4 Z;  3CC7 1;  1VQ8 1;  2E2I I;  2IZ3 A;  1JJ2 Y;  3S2D I;  1YJN Z;  1YUA A;  4RVD A;  4HGZ A;  1VQ9 Z;  4A3F I;  4NBG A;  4A3M I;  3D6W A;  1YJ9 Z;  2R92 I;  3G4S 1;  3J80 f;  2KI7 B;  2ZAE B;  1M90 2;  2RIQ A;  2RT9 A;  1P9N A;  4E2Y A;  1VQL Z;  3MZL B;  4E32 A;  1YIJ Z;  3VMG A;  3FQQ A;  1VQ6 Z;  1Q81 1;  2LIY A;  1DL6 A;  1USP B;  1YI2 Z;  3NH4 A;  1VQP Z;  2B63 I;  3IX0 A;  3CME Z;  2JNY A;  1RNI A;  4AYB A;  1QVG Z;  1I3Q I;  1TWC I;  4NB8 A;  2OOY B;  4E33 A;  5D1P A;  1Z01 A;  2AKL A;  1VQO 1;  4QTU A;  5LL6 f;  3S2H I;  1VQ8 Z;  2YU9 I;  1R9T I;  3BG1 B;  3U50 C;  2VUM I;  3HOU I;  5C3E I;  1USP A;  1VQ4 Z;  3CCE 1;  4DGL A;  1YJN 1;  5A2Q f;  5IT9 b;  1N2F A;  2RBL A;  2W03 A;  1VQM Z;  4Y7N I;  3BG0 B;  4NBC A;  1QVF Z;  1ZB8 A;  1N8R 2;  1Q7Y 1;  3J7A 4;  1YJ9 1;  3GTG I;  3CCR Z;  3JAM f;  4MXU A;  5CM2 M;  1Y1V S;  1K73 1;  2R6M A;  3G71 Z;  1YIJ 1;  1K8A 1;  1VQ6 1;  1K9M 2;  3GTL I;  3F3P C;  1VQP 1;  1YI2 1;  5T64 A;  1M1K 2;  3ESW A;  2M48 A;  3CMA Z;  3CCU 1;  2K3R A;  3CME 1;  2JUB A;  3G6E Z;  1TWG I;  1ZH1 A;  3HKZ A;  1PFT A;  1VLA A;  1VQO Z;  5IP9 I;  3HOX I;  2P28 A;  1YHQ Z;  3HOZ I;  1I6H I;  3GTP I;  3CCJ Z;  4RV9 A;  3S1N I;  3GKQ A;  2Q4Z A;  3CPW Z;  1TWA I;  3NH5 A;  1VQ7 Z;  3GCF A;  1SFO I;  3QWU A;  3T4N B;  1VQK Z;  5C4J I;  1QVG Y;  3CCE Z;  3CCV Z;  1TWF I;  2GTH A;  1Y1W I;  3PO3 I;  1VQ4 1;  5FLX f;  5IP7 I;  2HU9 A;  1VQM 1;  3M4O I;  2WB1 A;  3CCQ 1;  4E2W A;  2K5R A;  2JS4 A;  3CCR 1;  4DQY B;  2R93 I;  3IF8 A;  3I07 A;  2OTJ Z;  5C4X I;  2V8J A;  1Q82 1;  1KC8 1;  2DE7 A;  3G71 1;  1QVF Y;  3CCU Z;  1VQ5 1;  1Q81 2;  2O4H A;  1KC8 2;  2GU2 A;  2NVT I;  3CCM Z;  3CMA 1;  1NJI 1;  2NVX I;  2YAD A;  3TE5 B;  3G6E 1;  2E9H A;  1W2B Z;  4NBH A;  2OTL Z;  4NOZ A;  1YHQ 1;  5IT9 f;  3I56 Z;  4X6A I;  4TNU A;  3GTJ I;  4A93 I;  3H0G I;  3J80 b;  4A3B I;  4A3I I;  3CCJ 1;  2Q51 A;  1VQ7 1;  4A3E I;  1JJ2 Z;  2IZ4 A;  3J81 f;  2Y0S A;  3PO2 I;  2JA7 I;  1VQK 1;  1KD1 1;  3CCV 1;  3CQZ I;  4MON A;  4NB9 A;  2W04 A;  2J6A A;  2KPI A;  4E31 A;  2O53 A;  3CCQ Z;  3CPW Y;  2F4M A;  2EGT A;  4A3C I;  2JA6 I;  2QEX Z;  1Q7Y 2;  1Q86 1;  2QRC B;  3S16 I;  4QTT A;  2RHB A;  2PM9 A;  1YJW Z;  1X3W A;  3HOW I;  2P3Y A;  1VQ5 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...