1Q821

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82100
1M1K2 1VQO1 3OW2Z 1VQ9Z 1YJWZ 1KC82 3CME1 2QA4Z 1YJN1 1W2BY 1VQL1 1VQM1 1K8A2 3CXCZ 3CMA1 1JJ2Y 1VQK1 1YI21 1W2BZ 1NJI2 3CC41 3CCLZ 3CCRZ 3CCJ1 1Q7Y2 1Q822 1K9M1 1VQ81 1N8R1 1VQP1 1JJ2Z 1VQ7Z 1VQ41 1YJNZ 1KD12 1YJ91 3CC7Z 1Q862 3CCUZ 1VQNZ 3CCS1 1K732 1KQSY 1YIT1 3CCV1 1VQ61 3CCQ1 1S721 1VQ51 3G71Z 3CCEZ 1QVFY 2OTL1 1YI2Z 3I561 1YHQ1 3G6E1 1QVGY 3G4SZ 1Q811 1KQSZ 2OTJ1 2QEXZ 3CD6Z 1YIJ1 1QVFZ 1M1K1 1VQOZ 1YJW1 1VQ91 1KC81 3CMEZ 2QA41 1VQLZ 1VQMZ 1M901 1YITZ 1K8A1 3CCQZ 1VQ5Z 2OTLZ 3CMAZ 3I56Z 3CC21 3OW2Y 1VQKZ 1NJI1 3CC4Z 3CCJZ 3CCL1 3CCR1 3CCM1 1K9M2 1VQ8Z 3CXCY 3I551 1VQPZ 1N8R2 1VQ4Z 1VQ71 1KD11 1YJ9Z 3CPWY 3CC71 1Q861 1M902 1QVGZ 3CCU1 3CCSZ 1VQN1 1K731 3CCVZ 1VQ6Z 1S72Z 3G711 3CC2Z 3CCE1 3CPWZ 1YHQZ 3CCMZ 3G6EZ 1Q812 3G4S1 2OTJZ 1Q7Y1 2QEX1 1Q821 3CD61 1YIJZ 3I55Z
chains in the Genus database with same CATH superfamily
1DL6A 1WZNA 1QF8A 2O53A 4E33A 2HU9A 1X0TA 1M1K2 1VQ9Z 2V8KA 1W2BY 2G2KA 2E2JI 2RBLA 3NH8A 4X6AI 2HF1A 1X3WA 1JJ2Y 3M3YI 2BJOA 3F3FC 2OOXB 1TWFI 4A3CI 5LL6f 1KRLA 1Q822 3K7AI 3S15I 4NBGA 3PO2I 2P28A 3CC7Z 2LFUA 2B63I 4QTUA 1PFTA 2J6AA 3CCQ1 3M4OI 1RLYA 5AN9F 3G71Z 3KIHA 3PO3I 5T6BA 4DGLA 2PM9A 2LEXA 1YHQ1 1KQSZ 2OTJ1 3CD6Z 2OZKA 4NBFA 2NVYI 1YIJ1 2JA5I 1QVFZ 1YJW1 1KC81 3QWUA 2JA6I 1RO2A 2QREB 2QLVB 4EWCA 4MRIA 3J81b 5CM2M 4NBHA 4BXXI 3CC21 1VQKZ 1NJI1 2PMZA 3HOWI 5C4JI 3CCJZ 3CCL1 3CCR1 2NVTI 1Z01A 3LUSA 4E2WA 1QYPA 1RNIA 3I551 2DE5A 3CXCY 1ML8A 4E2XA 3S17I 4MXUA 1Y1WI 1YJ9Z 3HKZA 5T67A 1Q861 3CCU1 2QKDA 1VQN1 4XX2A 3S2DI 5T64A 2VF1A 3JAMb 4RVFA 2Q4ZA 2VPYA 4BY7I 3S1MI 3CCMZ 3G6EZ 3T4NB 1I3QI 2PK7A 2E2HI 1Q821 5FLXf 4RS4A 2VUGA 2WB1A 2Y0SA 3HOXI 2LIYA 1VQO1 1KC82 3IX0A 2QA4Z 4NOZA 1VQL1 4NBBA 1S7MA 1VQM1 2YADA 5D1OB 2O4HA 2JR6A 3F3PC 2P3YA 3CMA1 3EEDA 4HGYA 1YI21 1W2BZ 1NJI2 3CC41 2JIMA 1Q7Y2 1JWHC 1ZH1A 1VQ81 2KPIA 1JJ2Z 3S1QI 1VQ7Z 3GTQI 3FKII 4RVGA 2OOYB 2VPXA 3J81f 3ESWA 3VB9A 1Q862 2JIPA 1X3ZA 1TWHI 3D9XA 3GTKI 3CCS1 1I50I 1YIT1 3CCV1 5IT9f 1S721 4NBEA 3CCEZ 3BG0B 2OTL1 3HOVI 1Z02A 4NH1C 2F4MA 4HH4A 3G4SZ 1Q811 3NFZA 3I07A 2EGTA 4A3GI 3IF8A 1Y1VS 1VQ91 3CMEZ 3JAMf 4BY1I 5FLXb 2DE7A 1K8A1 1NP6A 3CCQZ 2IZ4A 1FDOA 3S16I 3H0GI 4Y52I 2NAPA 2ZAEB 4TNUA 2E9HA 2VPZA 3VMIA 2Q51A 2F4OA 3GTMS 1ZB8A 4MD7A 2VPWA 1VQPZ 3MZLB 2YU9I 2QRCB 3P5JB 1VQ4Z 1KD11 5IP7I 3FQQA 3CC71 3U50C 1M902 1QVGZ 2JA7I 4E30A 1K731 2JS4A 1VQ6Z 2JA8I 2M6NA 1RQFA 4NB8A 4MD8A 3TE5B 3G711 3CC2Z 4A3EI 3HOZI 1WW9A 2JMOA 3S1RI 4A93I 1Q812 5IT9b 1Q7Y1 3CD61 3I55Z 4E2YA 4NBCA 3GTGI 3S14I 5D1PA 2V3VA 3D6WA 1SFOI 3OW2Z 4A3FI 2GTIA 1YJN1 1K8A2 4HGZA 3D2LA 2R6MA 2K3RA 2W04A 1VQK1 3GCFA 3CCJ1 1R9TI 3HOUI 4A3II 3NDJA 2JIOA 1P9NA 1ZB9A 4NFRA 1N8R1 2R93I 1Q16A 1KD12 1YJ91 3VMGA 1I6HI 4A3DI 4DQYB 1K732 4Y7NI 1VQ51 5C44I 4A3KI 4E31A 1YI2Z 3I561 4RVDA 4RV9A 1N2FA 3G6E1 3GKQA 2QEXZ 1USPA 3FQMA 4A3LI 3PO3S 3VTNA 4S1TA 3KIFA 3GTPI 1K83I 3HOYI 2RT9A 1LQLA 2IZ3A 2QA41 1M901 2VUMI 1YITZ 2R92I 1QXFA 2OTLZ 2RHBA 1WCMI 4A3JI 1SIWA 1TWCI 2NVQI 2I3CA 2V8IA 4E2ZA 3CQZI 1FDIA 1N8R2 1VQ71 3CPWY 5IP9I 4RVHA 4MONA 2KI7B 3S1NI 2V45A 4QTTA 1YUKA 3CCE1 5C4XI 5C3EI 1YHQZ 4A3BI 4NBAA 3G4S1 4CL1A 2OTJZ 2DE6A 1YIJZ 3J80f 5A2Qf 3TDHB 1NUIA 1VLAA 4MH4A 1YJWZ 2NVXI 1Z03A 2AYDA 3CME1 4BBRI 4NB9A 3CXCZ 3IR7A 3S2HI 3MZKB 2AKLA 3CCLZ 3CCRZ 2GU2A 4MD9A 1K9M1 3RZDI 1VQP1 2WAQA 3I4NI 3I4MI 1TWAI 3EERA 1VQ41 1YJNZ 1AA6A 3IFUA 3NH5A 4BBSI 3CCUZ 1VQNZ 2JUBA 1KQSY 1VQ61 1Y8CA 2V8JA 1QVFY 2M48A 3GTJI 2RPRA 2GTHA 2QRDB 1Y1VI 1QVGY 1YUAA 3NDIA 1WJ2A 3Q87A 2W03A 1VQOZ 1M1K1 2E2II 3BG1B 1RO4A 1VQLZ 3GTLI 1VQMZ 1L1OC 3J80b 5A2Qb 3VMHA 2K5RA 2E7ZA 3MONA 3H3VJ 1VQ5Z 3GTMI 3RZOI 2RIQA 2JIRA 3GTOI 3CMAZ 2JIQA 2JNYA 3I56Z 3OW2Y 2R7ZI 3CC4Z 4DK1A 1USPB 3CCM1 1K9M2 1VQ8Z 4AYBA 2H85A 1RO0A 1TFIA 3NH4A 3CCSZ 3CCVZ 1TWGI 5D1OA 1S72Z 4NBDA 5FLMI 1WIIA 3J7A4 4E32A 3CPWZ 2IV2X 4A3MI 2QR1B 2QEX1
chains in the Genus database with same CATH topology
1DL6A 1QF8A 2O53A 4E33A 2HU9A 1X0TA 1M1K2 1VQ9Z 2V8KA 1W2BY 2G2KA 2E2JI 2RBLA 3NH8A 4X6AI 2HF1A 1X3WA 1JJ2Y 3M3YI 2BJOA 3F3FC 2OOXB 1TWFI 4A3CI 5LL6f 1KRLA 1Q822 3K7AI 3S15I 4NBGA 3PO2I 2P28A 3CC7Z 2LFUA 2B63I 4QTUA 1PFTA 2J6AA 3CCQ1 3M4OI 1RLYA 5AN9F 3G71Z 3KIHA 3PO3I 5T6BA 4DGLA 2PM9A 1YHQ1 1KQSZ 2OTJ1 3CD6Z 2OZKA 4NBFA 2NVYI 1YIJ1 2JA5I 1QVFZ 1YJW1 1KC81 3QWUA 2JA6I 1RO2A 2QREB 2QLVB 4EWCA 4MRIA 3J81b 5CM2M 4NBHA 4BXXI 3CC21 1VQKZ 1NJI1 2PMZA 3HOWI 5C4JI 3CCJZ 3CCL1 3CCR1 2NVTI 1Z01A 3LUSA 4E2WA 1QYPA 1RNIA 3I551 2DE5A 3CXCY 1ML8A 4E2XA 3S17I 4MXUA 1Y1WI 1YJ9Z 3HKZA 5T67A 1Q861 3CCU1 2QKDA 1VQN1 4XX2A 3S2DI 5T64A 2VF1A 3JAMb 4RVFA 2Q4ZA 4BY7I 3S1MI 3CCMZ 3G6EZ 3T4NB 1I3QI 2PK7A 2E2HI 1Q821 5FLXf 4RS4A 2VUGA 2WB1A 2Y0SA 3HOXI 2LIYA 1VQO1 1KC82 3IX0A 2QA4Z 4NOZA 1VQL1 4NBBA 1S7MA 1VQM1 2YADA 5D1OB 2O4HA 2JR6A 3F3PC 2P3YA 3CMA1 3EEDA 4HGYA 1YI21 1W2BZ 1NJI2 3CC41 1Q7Y2 1JWHC 1ZH1A 1VQ81 2KPIA 1JJ2Z 3S1QI 1VQ7Z 3GTQI 3FKII 4RVGA 2OOYB 3J81f 3ESWA 3VB9A 1Q862 1X3ZA 1TWHI 3D9XA 3GTKI 3CCS1 1I50I 1YIT1 3CCV1 5IT9f 1S721 4NBEA 3CCEZ 3BG0B 2OTL1 3HOVI 1Z02A 4NH1C 2F4MA 4HH4A 3G4SZ 1Q811 3NFZA 3I07A 2EGTA 4A3GI 3IF8A 1Y1VS 1VQ91 3CMEZ 3JAMf 4BY1I 5FLXb 2DE7A 1K8A1 1NP6A 3CCQZ 2IZ4A 3S16I 3H0GI 4Y52I 2ZAEB 4TNUA 2E9HA 3VMIA 2Q51A 2F4OA 3GTMS 1ZB8A 4MD7A 1VQPZ 3MZLB 2YU9I 2QRCB 3P5JB 1VQ4Z 1KD11 5IP7I 3FQQA 3CC71 3U50C 1M902 1QVGZ 2JA7I 4E30A 1K731 2JS4A 1VQ6Z 2JA8I 2M6NA 1RQFA 4NB8A 4MD8A 3TE5B 3G711 3CC2Z 4A3EI 3HOZI 1WW9A 2JMOA 3S1RI 4A93I 1Q812 5IT9b 1Q7Y1 3CD61 3I55Z 4E2YA 4NBCA 3GTGI 3S14I 5D1PA 3D6WA 1SFOI 3OW2Z 4A3FI 2GTIA 1YJN1 1K8A2 4HGZA 2R6MA 2K3RA 2W04A 1VQK1 3GCFA 3CCJ1 1R9TI 3HOUI 4A3II 3NDJA 1P9NA 1ZB9A 4NFRA 1N8R1 2R93I 1KD12 1YJ91 3VMGA 1I6HI 4A3DI 4DQYB 1K732 4Y7NI 1VQ51 5C44I 4A3KI 4E31A 1YI2Z 3I561 4RVDA 4RV9A 1N2FA 3G6E1 3GKQA 2QEXZ 1USPA 3FQMA 4A3LI 3PO3S 3VTNA 4S1TA 3KIFA 3GTPI 1K83I 3HOYI 2RT9A 1LQLA 2IZ3A 2QA41 1M901 2VUMI 1YITZ 2R92I 2OTLZ 2RHBA 1WCMI 4A3JI 1TWCI 2NVQI 2I3CA 2V8IA 4E2ZA 3CQZI 1N8R2 1VQ71 3CPWY 5IP9I 4RVHA 4MONA 2KI7B 3S1NI 4QTTA 1YUKA 3CCE1 5C4XI 5C3EI 1YHQZ 4A3BI 4NBAA 3G4S1 4CL1A 2OTJZ 2DE6A 1YIJZ 3J80f 5A2Qf 3TDHB 1NUIA 1VLAA 4MH4A 1YJWZ 2NVXI 1Z03A 3CME1 4BBRI 4NB9A 3CXCZ 3S2HI 3MZKB 2AKLA 3CCLZ 3CCRZ 2GU2A 4MD9A 1K9M1 3RZDI 1VQP1 2WAQA 3I4NI 3I4MI 1TWAI 3EERA 1VQ41 1YJNZ 3IFUA 3NH5A 4BBSI 3CCUZ 1VQNZ 2JUBA 1KQSY 1VQ61 2V8JA 1QVFY 2M48A 3GTJI 2RPRA 2GTHA 2QRDB 1Y1VI 1QVGY 1YUAA 3NDIA 3Q87A 2W03A 1VQOZ 1M1K1 2E2II 3BG1B 1RO4A 1VQLZ 3GTLI 1VQMZ 1L1OC 3J80b 5A2Qb 3VMHA 2K5RA 3MONA 3H3VJ 1VQ5Z 3GTMI 3RZOI 2RIQA 3GTOI 3CMAZ 2JNYA 3I56Z 3OW2Y 2R7ZI 3CC4Z 4DK1A 1USPB 3CCM1 1K9M2 1VQ8Z 4AYBA 2H85A 1RO0A 1TFIA 3NH4A 3CCSZ 3CCVZ 1TWGI 5D1OA 1S72Z 4NBDA 5FLMI 1WIIA 3J7A4 4E32A 3CPWZ 4A3MI 2QR1B 2QEX1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 2;  1VQO 1;  3OW2 Z;  1VQ9 Z;  1YJW Z;  1KC8 2;  3CME 1;  2QA4 Z;  1YJN 1;  1W2B Y;  1VQL 1;  1VQM 1;  1K8A 2;  3CXC Z;  3CMA 1;  1JJ2 Y;  1VQK 1;  1YI2 1;  1W2B Z;  1NJI 2;  3CC4 1;  3CCL Z;  3CCR Z;  3CCJ 1;  1Q7Y 2;  1Q82 2;  1K9M 1;  1VQ8 1;  1N8R 1;  1VQP 1;  1JJ2 Z;  1VQ7 Z;  1VQ4 1;  1YJN Z;  1KD1 2;  1YJ9 1;  3CC7 Z;  1Q86 2;  3CCU Z;  1VQN Z;  3CCS 1;  1K73 2;  1KQS Y;  1YIT 1;  3CCV 1;  1VQ6 1;  3CCQ 1;  1S72 1;  1VQ5 1;  3G71 Z;  3CCE Z;  1QVF Y;  2OTL 1;  1YI2 Z;  3I56 1;  1YHQ 1;  3G6E 1;  1QVG Y;  3G4S Z;  1Q81 1;  1KQS Z;  2OTJ 1;  2QEX Z;  3CD6 Z;  1YIJ 1;  1QVF Z;  1M1K 1;  1VQO Z;  1YJW 1;  1VQ9 1;  1KC8 1;  3CME Z;  2QA4 1;  1VQL Z;  1VQM Z;  1M90 1;  1YIT Z;  1K8A 1;  3CCQ Z;  1VQ5 Z;  2OTL Z;  3CMA Z;  3I56 Z;  3CC2 1;  3OW2 Y;  1VQK Z;  1NJI 1;  3CC4 Z;  3CCJ Z;  3CCL 1;  3CCR 1;  3CCM 1;  1K9M 2;  1VQ8 Z;  3CXC Y;  3I55 1;  1VQP Z;  1N8R 2;  1VQ4 Z;  1VQ7 1;  1KD1 1;  1YJ9 Z;  3CPW Y;  3CC7 1;  1Q86 1;  1M90 2;  1QVG Z;  3CCU 1;  3CCS Z;  1VQN 1;  1K73 1;  3CCV Z;  1VQ6 Z;  1S72 Z;  3G71 1;  3CC2 Z;  3CCE 1;  3CPW Z;  1YHQ Z;  3CCM Z;  3G6E Z;  1Q81 2;  3G4S 1;  2OTJ Z;  1Q7Y 1;  2QEX 1;  1Q82 1;  3CD6 1;  1YIJ Z;  3I55 Z; 
#chains in the Genus database with same CATH topology
 1DL6 A;  1WZN A;  1QF8 A;  2O53 A;  4E33 A;  2HU9 A;  1X0T A;  1M1K 2;  1VQ9 Z;  2V8K A;  1W2B Y;  2G2K A;  2E2J I;  2RBL A;  3NH8 A;  4X6A I;  2HF1 A;  1X3W A;  1JJ2 Y;  3M3Y I;  2BJO A;  3F3F C;  2OOX B;  1TWF I;  4A3C I;  5LL6 f;  1KRL A;  1Q82 2;  3K7A I;  3S15 I;  4NBG A;  3PO2 I;  2P28 A;  3CC7 Z;  2LFU A;  2B63 I;  4QTU A;  1PFT A;  2J6A A;  3CCQ 1;  3M4O I;  1RLY A;  5AN9 F;  3G71 Z;  3KIH A;  3PO3 I;  5T6B A;  4DGL A;  2PM9 A;  2LEX A;  1YHQ 1;  1KQS Z;  2OTJ 1;  3CD6 Z;  2OZK A;  4NBF A;  2NVY I;  1YIJ 1;  2JA5 I;  1QVF Z;  1YJW 1;  1KC8 1;  3QWU A;  2JA6 I;  1RO2 A;  2QRE B;  2QLV B;  4EWC A;  4MRI A;  3J81 b;  5CM2 M;  4NBH A;  4BXX I;  3CC2 1;  1VQK Z;  1NJI 1;  2PMZ A;  3HOW I;  5C4J I;  3CCJ Z;  3CCL 1;  3CCR 1;  2NVT I;  1Z01 A;  3LUS A;  4E2W A;  1QYP A;  1RNI A;  3I55 1;  2DE5 A;  3CXC Y;  1ML8 A;  4E2X A;  3S17 I;  4MXU A;  1Y1W I;  1YJ9 Z;  3HKZ A;  5T67 A;  1Q86 1;  3CCU 1;  2QKD A;  1VQN 1;  4XX2 A;  3S2D I;  5T64 A;  2VF1 A;  3JAM b;  4RVF A;  2Q4Z A;  2VPY A;  4BY7 I;  3S1M I;  3CCM Z;  3G6E Z;  3T4N B;  1I3Q I;  2PK7 A;  2E2H I;  1Q82 1;  5FLX f;  4RS4 A;  2VUG A;  2WB1 A;  2Y0S A;  3HOX I;  2LIY A;  1VQO 1;  1KC8 2;  3IX0 A;  2QA4 Z;  4NOZ A;  1VQL 1;  4NBB A;  1S7M A;  1VQM 1;  2YAD A;  5D1O B;  2O4H A;  2JR6 A;  3F3P C;  2P3Y A;  3CMA 1;  3EED A;  4HGY A;  1YI2 1;  1W2B Z;  1NJI 2;  3CC4 1;  2JIM A;  1Q7Y 2;  1JWH C;  1ZH1 A;  1VQ8 1;  2KPI A;  1JJ2 Z;  3S1Q I;  1VQ7 Z;  3GTQ I;  3FKI I;  4RVG A;  2OOY B;  2VPX A;  3J81 f;  3ESW A;  3VB9 A;  1Q86 2;  2JIP A;  1X3Z A;  1TWH I;  3D9X A;  3GTK I;  3CCS 1;  1I50 I;  1YIT 1;  3CCV 1;  5IT9 f;  1S72 1;  4NBE A;  3CCE Z;  3BG0 B;  2OTL 1;  3HOV I;  1Z02 A;  4NH1 C;  2F4M A;  4HH4 A;  3G4S Z;  1Q81 1;  3NFZ A;  3I07 A;  2EGT A;  4A3G I;  3IF8 A;  1Y1V S;  1VQ9 1;  3CME Z;  3JAM f;  4BY1 I;  5FLX b;  2DE7 A;  1K8A 1;  1NP6 A;  3CCQ Z;  2IZ4 A;  1FDO A;  3S16 I;  3H0G I;  4Y52 I;  2NAP A;  2ZAE B;  4TNU A;  2E9H A;  2VPZ A;  3VMI A;  2Q51 A;  2F4O A;  3GTM S;  1ZB8 A;  4MD7 A;  2VPW A;  1VQP Z;  3MZL B;  2YU9 I;  2QRC B;  3P5J B;  1VQ4 Z;  1KD1 1;  5IP7 I;  3FQQ A;  3CC7 1;  3U50 C;  1M90 2;  1QVG Z;  2JA7 I;  4E30 A;  1K73 1;  2JS4 A;  1VQ6 Z;  2JA8 I;  2M6N A;  1RQF A;  4NB8 A;  4MD8 A;  3TE5 B;  3G71 1;  3CC2 Z;  4A3E I;  3HOZ I;  1WW9 A;  2JMO A;  3S1R I;  4A93 I;  1Q81 2;  5IT9 b;  1Q7Y 1;  3CD6 1;  3I55 Z;  4E2Y A;  4NBC A;  3GTG I;  3S14 I;  5D1P A;  2V3V A;  3D6W A;  1SFO I;  3OW2 Z;  4A3F I;  2GTI A;  1YJN 1;  1K8A 2;  4HGZ A;  3D2L A;  2R6M A;  2K3R A;  2W04 A;  1VQK 1;  3GCF A;  3CCJ 1;  1R9T I;  3HOU I;  4A3I I;  3NDJ A;  2JIO A;  1P9N A;  1ZB9 A;  4NFR A;  1N8R 1;  2R93 I;  1Q16 A;  1KD1 2;  1YJ9 1;  3VMG A;  1I6H I;  4A3D I;  4DQY B;  1K73 2;  4Y7N I;  1VQ5 1;  5C44 I;  4A3K I;  4E31 A;  1YI2 Z;  3I56 1;  4RVD A;  4RV9 A;  1N2F A;  3G6E 1;  3GKQ A;  2QEX Z;  1USP A;  3FQM A;  4A3L I;  3PO3 S;  3VTN A;  4S1T A;  3KIF A;  3GTP I;  1K83 I;  3HOY I;  2RT9 A;  1LQL A;  2IZ3 A;  2QA4 1;  1M90 1;  2VUM I;  1YIT Z;  2R92 I;  1QXF A;  2OTL Z;  2RHB A;  1WCM I;  4A3J I;  1SIW A;  1TWC I;  2NVQ I;  2I3C A;  2V8I A;  4E2Z A;  3CQZ I;  1FDI A;  1N8R 2;  1VQ7 1;  3CPW Y;  5IP9 I;  4RVH A;  4MON A;  2KI7 B;  3S1N I;  2V45 A;  4QTT A;  1YUK A;  3CCE 1;  5C4X I;  5C3E I;  1YHQ Z;  4A3B I;  4NBA A;  3G4S 1;  4CL1 A;  2OTJ Z;  2DE6 A;  1YIJ Z;  3J80 f;  5A2Q f;  3TDH B;  1NUI A;  1VLA A;  4MH4 A;  1YJW Z;  2NVX I;  1Z03 A;  2AYD A;  3CME 1;  4BBR I;  4NB9 A;  3CXC Z;  3IR7 A;  3S2H I;  3MZK B;  2AKL A;  3CCL Z;  3CCR Z;  2GU2 A;  4MD9 A;  1K9M 1;  3RZD I;  1VQP 1;  2WAQ A;  3I4N I;  3I4M I;  1TWA I;  3EER A;  1VQ4 1;  1YJN Z;  1AA6 A;  3IFU A;  3NH5 A;  4BBS I;  3CCU Z;  1VQN Z;  2JUB A;  1KQS Y;  1VQ6 1;  1Y8C A;  2V8J A;  1QVF Y;  2M48 A;  3GTJ I;  2RPR A;  2GTH A;  2QRD B;  1Y1V I;  1QVG Y;  1YUA A;  3NDI A;  1WJ2 A;  3Q87 A;  2W03 A;  1VQO Z;  1M1K 1;  2E2I I;  3BG1 B;  1RO4 A;  1VQL Z;  3GTL I;  1VQM Z;  1L1O C;  3J80 b;  5A2Q b;  3VMH A;  2K5R A;  2E7Z A;  3MON A;  3H3V J;  1VQ5 Z;  3GTM I;  3RZO I;  2RIQ A;  2JIR A;  3GTO I;  3CMA Z;  2JIQ A;  2JNY A;  3I56 Z;  3OW2 Y;  2R7Z I;  3CC4 Z;  4DK1 A;  1USP B;  3CCM 1;  1K9M 2;  1VQ8 Z;  4AYB A;  2H85 A;  1RO0 A;  1TFI A;  3NH4 A;  3CCS Z;  3CCV Z;  1TWG I;  5D1O A;  1S72 Z;  4NBD A;  5FLM I;  1WII A;  3J7A 4;  4E32 A;  3CPW Z;  2IV2 X;  4A3M I;  2QR1 B;  2QEX 1; 
#chains in the Genus database with same CATH homology
 1DL6 A;  1QF8 A;  2O53 A;  4E33 A;  2HU9 A;  1X0T A;  1M1K 2;  1VQ9 Z;  2V8K A;  1W2B Y;  2G2K A;  2E2J I;  2RBL A;  3NH8 A;  4X6A I;  2HF1 A;  1X3W A;  1JJ2 Y;  3M3Y I;  2BJO A;  3F3F C;  2OOX B;  1TWF I;  4A3C I;  5LL6 f;  1KRL A;  1Q82 2;  3K7A I;  3S15 I;  4NBG A;  3PO2 I;  2P28 A;  3CC7 Z;  2LFU A;  2B63 I;  4QTU A;  1PFT A;  2J6A A;  3CCQ 1;  3M4O I;  1RLY A;  5AN9 F;  3G71 Z;  3KIH A;  3PO3 I;  5T6B A;  4DGL A;  2PM9 A;  1YHQ 1;  1KQS Z;  2OTJ 1;  3CD6 Z;  2OZK A;  4NBF A;  2NVY I;  1YIJ 1;  2JA5 I;  1QVF Z;  1YJW 1;  1KC8 1;  3QWU A;  2JA6 I;  1RO2 A;  2QRE B;  2QLV B;  4EWC A;  4MRI A;  3J81 b;  5CM2 M;  4NBH A;  4BXX I;  3CC2 1;  1VQK Z;  1NJI 1;  2PMZ A;  3HOW I;  5C4J I;  3CCJ Z;  3CCL 1;  3CCR 1;  2NVT I;  1Z01 A;  3LUS A;  4E2W A;  1QYP A;  1RNI A;  3I55 1;  2DE5 A;  3CXC Y;  1ML8 A;  4E2X A;  3S17 I;  4MXU A;  1Y1W I;  1YJ9 Z;  3HKZ A;  5T67 A;  1Q86 1;  3CCU 1;  2QKD A;  1VQN 1;  4XX2 A;  3S2D I;  5T64 A;  2VF1 A;  3JAM b;  4RVF A;  2Q4Z A;  4BY7 I;  3S1M I;  3CCM Z;  3G6E Z;  3T4N B;  1I3Q I;  2PK7 A;  2E2H I;  1Q82 1;  5FLX f;  4RS4 A;  2VUG A;  2WB1 A;  2Y0S A;  3HOX I;  2LIY A;  1VQO 1;  1KC8 2;  3IX0 A;  2QA4 Z;  4NOZ A;  1VQL 1;  4NBB A;  1S7M A;  1VQM 1;  2YAD A;  5D1O B;  2O4H A;  2JR6 A;  3F3P C;  2P3Y A;  3CMA 1;  3EED A;  4HGY A;  1YI2 1;  1W2B Z;  1NJI 2;  3CC4 1;  1Q7Y 2;  1JWH C;  1ZH1 A;  1VQ8 1;  2KPI A;  1JJ2 Z;  3S1Q I;  1VQ7 Z;  3GTQ I;  3FKI I;  4RVG A;  2OOY B;  3J81 f;  3ESW A;  3VB9 A;  1Q86 2;  1X3Z A;  1TWH I;  3D9X A;  3GTK I;  3CCS 1;  1I50 I;  1YIT 1;  3CCV 1;  5IT9 f;  1S72 1;  4NBE A;  3CCE Z;  3BG0 B;  2OTL 1;  3HOV I;  1Z02 A;  4NH1 C;  2F4M A;  4HH4 A;  3G4S Z;  1Q81 1;  3NFZ A;  3I07 A;  2EGT A;  4A3G I;  3IF8 A;  1Y1V S;  1VQ9 1;  3CME Z;  3JAM f;  4BY1 I;  5FLX b;  2DE7 A;  1K8A 1;  1NP6 A;  3CCQ Z;  2IZ4 A;  3S16 I;  3H0G I;  4Y52 I;  2ZAE B;  4TNU A;  2E9H A;  3VMI A;  2Q51 A;  2F4O A;  3GTM S;  1ZB8 A;  4MD7 A;  1VQP Z;  3MZL B;  2YU9 I;  2QRC B;  3P5J B;  1VQ4 Z;  1KD1 1;  5IP7 I;  3FQQ A;  3CC7 1;  3U50 C;  1M90 2;  1QVG Z;  2JA7 I;  4E30 A;  1K73 1;  2JS4 A;  1VQ6 Z;  2JA8 I;  2M6N A;  1RQF A;  4NB8 A;  4MD8 A;  3TE5 B;  3G71 1;  3CC2 Z;  4A3E I;  3HOZ I;  1WW9 A;  2JMO A;  3S1R I;  4A93 I;  1Q81 2;  5IT9 b;  1Q7Y 1;  3CD6 1;  3I55 Z;  4E2Y A;  4NBC A;  3GTG I;  3S14 I;  5D1P A;  3D6W A;  1SFO I;  3OW2 Z;  4A3F I;  2GTI A;  1YJN 1;  1K8A 2;  4HGZ A;  2R6M A;  2K3R A;  2W04 A;  1VQK 1;  3GCF A;  3CCJ 1;  1R9T I;  3HOU I;  4A3I I;  3NDJ A;  1P9N A;  1ZB9 A;  4NFR A;  1N8R 1;  2R93 I;  1KD1 2;  1YJ9 1;  3VMG A;  1I6H I;  4A3D I;  4DQY B;  1K73 2;  4Y7N I;  1VQ5 1;  5C44 I;  4A3K I;  4E31 A;  1YI2 Z;  3I56 1;  4RVD A;  4RV9 A;  1N2F A;  3G6E 1;  3GKQ A;  2QEX Z;  1USP A;  3FQM A;  4A3L I;  3PO3 S;  3VTN A;  4S1T A;  3KIF A;  3GTP I;  1K83 I;  3HOY I;  2RT9 A;  1LQL A;  2IZ3 A;  2QA4 1;  1M90 1;  2VUM I;  1YIT Z;  2R92 I;  2OTL Z;  2RHB A;  1WCM I;  4A3J I;  1TWC I;  2NVQ I;  2I3C A;  2V8I A;  4E2Z A;  3CQZ I;  1N8R 2;  1VQ7 1;  3CPW Y;  5IP9 I;  4RVH A;  4MON A;  2KI7 B;  3S1N I;  4QTT A;  1YUK A;  3CCE 1;  5C4X I;  5C3E I;  1YHQ Z;  4A3B I;  4NBA A;  3G4S 1;  4CL1 A;  2OTJ Z;  2DE6 A;  1YIJ Z;  3J80 f;  5A2Q f;  3TDH B;  1NUI A;  1VLA A;  4MH4 A;  1YJW Z;  2NVX I;  1Z03 A;  3CME 1;  4BBR I;  4NB9 A;  3CXC Z;  3S2H I;  3MZK B;  2AKL A;  3CCL Z;  3CCR Z;  2GU2 A;  4MD9 A;  1K9M 1;  3RZD I;  1VQP 1;  2WAQ A;  3I4N I;  3I4M I;  1TWA I;  3EER A;  1VQ4 1;  1YJN Z;  3IFU A;  3NH5 A;  4BBS I;  3CCU Z;  1VQN Z;  2JUB A;  1KQS Y;  1VQ6 1;  2V8J A;  1QVF Y;  2M48 A;  3GTJ I;  2RPR A;  2GTH A;  2QRD B;  1Y1V I;  1QVG Y;  1YUA A;  3NDI A;  3Q87 A;  2W03 A;  1VQO Z;  1M1K 1;  2E2I I;  3BG1 B;  1RO4 A;  1VQL Z;  3GTL I;  1VQM Z;  1L1O C;  3J80 b;  5A2Q b;  3VMH A;  2K5R A;  3MON A;  3H3V J;  1VQ5 Z;  3GTM I;  3RZO I;  2RIQ A;  3GTO I;  3CMA Z;  2JNY A;  3I56 Z;  3OW2 Y;  2R7Z I;  3CC4 Z;  4DK1 A;  1USP B;  3CCM 1;  1K9M 2;  1VQ8 Z;  4AYB A;  2H85 A;  1RO0 A;  1TFI A;  3NH4 A;  3CCS Z;  3CCV Z;  1TWG I;  5D1O A;  1S72 Z;  4NBD A;  5FLM I;  1WII A;  3J7A 4;  4E32 A;  3CPW Z;  4A3M I;  2QR1 B;  2QEX 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...