1Q821

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82100
1Q811 3CPWY 1VQ4Z 1VQ91 3I55Z 1YJW1 1Q822 3CCV1 1K8A2 1NJI1 1KD12 1YI2Z 1JJ2Y 1YJN1 3CC21 3CC71 3I56Z 3CD61 1S72Z 3CCQZ 3CC41 1VQNZ 3CCSZ 1N8R2 3OW2Z 1K9M2 1KQSY 1K732 1Q862 3G6E1 1QVFY 1Q7Y1 1VQKZ 3CCQ1 1VQO1 3CCM1 1VQN1 1VQM1 1VQ8Z 1M901 2QA41 1YIJ1 3CCJ1 1VQ6Z 1KQSZ 1QVGY 1VQL1 2QEXZ 3G4S1 3CXCZ 1VQK1 3CCEZ 2OTLZ 1VQ51 3G71Z 1W2BZ 2OTJZ 1VQ41 3CCLZ 3CCUZ 3I551 3CPWZ 1VQ61 1YI21 1Q821 1YITZ 1K8A1 1JJ2Z 3I561 1M1K2 1S721 3G711 1KC82 3CMEZ 1VQPZ 3CCS1 1YHQZ 1N8R1 1VQ7Z 1Q812 1K731 1Q861 1QVFZ 1VQ9Z 1VQP1 1NJI2 3CCRZ 1YJWZ 1VQ81 3CCVZ 1YJNZ 3CC2Z 1VQ71 1YJ9Z 2QEX1 1KD11 3OW2Y 3CCE1 1QVGZ 2OTL1 3CC4Z 2OTJ1 3CCR1 3CCL1 3CCU1 1Q7Y2 3CMAZ 3G6EZ 1YJ91 1K9M1 1YIT1 1VQOZ 1M902 3CCMZ 1VQMZ 3CME1 1M1K1 2QA4Z 1YIJZ 3CCJZ 1KC81 3CXCY 3CMA1 1YHQ1 1VQLZ 3G4SZ 3CC7Z 1W2BY 3CD6Z 1VQ5Z
chains in the Genus database with same CATH superfamily
3CPWY 5IP9I 5T64A 4E32A 1YJW1 3CCV1 1JWHC 1JJ2Y 2E2HI 1YI2Z 1YJN1 2PK7A 2GU2A 3J81b 5T67A 3S2DI 3CD61 3GTLI 3J80f 4DGLA 3CC41 2K3RA 3MONA 3OW2Z 2VPWA 4CL1A 1K9M2 3HOWI 1I3QI 2LFUA 1ZH1A 2VPYA 2V45A 2LEXA 2J6AA 1M901 4NFRA 3I4NI 2JIMA 2V3VA 2JNYA 1QVGY 2QEXZ 4NBEA 2OTLZ 1DL6A 4NBBA 2OTJZ 3S14I 3HOYI 4NB9A 3CCUZ 4A3BI 3FQMA 1RQFA 3CPWZ 4A3JI 1Q821 4A3DI 1K8A1 1JJ2Z 2AKLA 3GTOI 3EEDA 2JIQA 1KC82 3VMIA 2QRDB 5D1PA 1Y8CA 2E2JI 1N8R1 2M48A 1K731 2G2KA 3U50C 4A93I 5LL6f 3CCRZ 2QKDA 4MH4A 1YUKA 4TNUA 2R92I 2VF1A 1QVGZ 2R6MA 4MONA 3CCR1 2HF1A 1ZB9A 3G6EZ 2NAPA 3EERA 4AYBA 1K9M1 2RIQA 3FKII 1Y1WI 1VQOZ 1M902 2NVQI 4A3LI 2NVTI 1I50I 1VQMZ 3CME1 3S15I 3F3FC 2QA4Z 3CCJZ 1YIJZ 3S1NI 1RO2A 1YHQ1 4EWCA 2JA5I 2Q51A 2GTIA 3KIFA 1VQLZ 2E2II 3G4SZ 3CC7Z 1W2BY 1VQ4Z 3GTGI 2QR1B 1Q822 1K8A2 1KD12 5T6BA 4HH4A 3HOVI 2YADA 3CC71 3I56Z 1TWGI 1VLAA 3BG1B 2R93I 2YU9I 5FLXb 5A2Qf 3CCSZ 1N8R2 4A3CI 2V8IA 1K732 2KI7B 3S1MI 1SIWA 2RHBA 1FDOA 2RT9A 3CCM1 1VQ8Z 3S2HI 1TWFI 2P3YA 3IFUA 1VQ6Z 1KQSZ 2HU9A 3CCEZ 3TDHB 1VQ51 3GTKI 2O4HA 3LUSA 3G71Z 1W2BZ 3CCLZ 1WIIA 2OOYB 4NBCA 3VMHA 3GTQI 3S16I 1K83I 4A3FI 3GCFA 1VQ61 4E2ZA 1YI21 1YITZ 4E2XA 3G711 2JR6A 5C4XI 4NH1C 1X0TA 3VTNA 5IT9f 1RO4A 3S1QI 4Y52I 1VQ7Z 1Q861 1AA6A 1VQ9Z 3VMGA 1LQLA 1USPB 3PO2I 3CC2Z 1TWAI 3T4NB 4RVDA 1VQ71 2R7ZI 2QEX1 1KD11 2OTL1 3J80b 3NDIA 2OTJ1 3CCU1 3CMAZ 3JAMf 3D2LA 3J7A4 4X6AI 3PO3I 2V8JA 1M1K1 2P28A 2IZ3A 5IT9b 2KPIA 1USPA 3D6WA 3CMA1 1WW9A 2PM9A 4S1TA 3GKQA 1YUAA 3P5JB 1X3ZA 4BBSI 3TE5B 2I3CA 1Q811 3GTMS 3NFZA 3QWUA 3I55Z 2JIOA 1QXFA 2RBLA 3FQQA 5D1OB 3PO3S 2EGTA 1S72Z 3I4MI 3CCQZ 2NVXI 1VQNZ 4MD9A 3M3YI 4HGZA 2H85A 4NBFA 1KQSY 2W04A 1Q862 2DE7A 2E7ZA 3G6E1 2OZKA 3CQZI 3Q87A 2JUBA 3CCQ1 1VQO1 4A3EI 3H0GI 1VQN1 2BJOA 1VQM1 3MZKB 4HGYA 2GTHA 2QA41 3CCJ1 1YIJ1 2JA7I 5AN9F 1P9NA 3IF8A 5C44I 5IP7I 5D1OA 2B63I 2VUGA 1VQL1 1RLYA 1S7MA 3G4S1 2F4MA 4A3MI 2VPXA 2JA8I 2JS4A 3K7AI 1VQ41 3S1RI 4A3KI 3J81f 4A3GI 3HOZI 4NBDA 3I561 4NBGA 1M1K2 4MD8A 4DQYB 2O53A 2W03A 4RS4A 3CCS1 2RPRA 2QRCB 4MD7A 3HOXI 1Q812 2QREB 4Y7NI 3VB9A 1YJWZ 1VQ81 1WCMI 1Y1VI 4QTUA 3CCVZ 1KRLA 1Z03A 4DK1A 4BY7I 1YJNZ 2DE5A 1YJ9Z 4NB8A 2ZAEB 2V8KA 3CCE1 3CC4Z 4BBRI 3CCL1 1N2FA 5A2Qb 1FDIA 5FLMI 4BY1I 1YJ91 1YIT1 3GTJI 1Y1VS 3F3PC 1NUIA 2VUMI 3CXCY 1QYPA 2Q4ZA 3IX0A 3RZDI 3MZLB 2LIYA 4MXUA 3H3VJ 1VQ91 1WZNA 4E31A 2DE6A 3GTMI 1ML8A 2OOXB 2WAQA 4E30A 1NJI1 1Z01A 3CC21 2AYDA 2IV2X 1Q16A 4QTTA 3I07A 3RZOI 2VPZA 4MRIA 5C3EI 1QVFY 2K5RA 1Q7Y1 3ESWA 2F4OA 1TWCI 1VQKZ 3BG0B 1NP6A 2M6NA 2Y0SA 3D9XA 1I6HI 4E33A 3GTPI 1R9TI 3CXCZ 1VQK1 3KIHA 5C4JI 3HKZA 3I551 3HOUI 1TFIA 3IR7A 5CM2M 3NDJA 3JAMb 1RO0A 2E9HA 5FLXf 1S721 4NBAA 3CMEZ 4A3II 1RNIA 1TWHI 1VQPZ 2QLVB 1L1OC 3NH4A 1YHQZ 2PMZA 4NOZA 4BXXI 1ZB8A 1QF8A 2JIPA 1QVFZ 4RVFA 1VQP1 1NJI2 3S17I 1PFTA 2WB1A 4E2WA 1WJ2A 4NBHA 3OW2Y 4RVGA 1X3WA 1SFOI 1Z02A 4RV9A 2JIRA 1Q7Y2 3M4OI 4XX2A 2JMOA 3CCMZ 2JA6I 2NVYI 1KC81 4E2YA 4RVHA 3NH5A 2IZ4A 3NH8A 3CD6Z 1VQ5Z
chains in the Genus database with same CATH topology
3CPWY 5IP9I 5T64A 4E32A 1YJW1 3CCV1 1JWHC 1JJ2Y 2E2HI 1YI2Z 1YJN1 2PK7A 2GU2A 3J81b 5T67A 3S2DI 3CD61 3GTLI 3J80f 4DGLA 3CC41 2K3RA 3MONA 3OW2Z 4CL1A 1K9M2 3HOWI 1I3QI 2LFUA 1ZH1A 2J6AA 1M901 4NFRA 3I4NI 2JNYA 1QVGY 2QEXZ 4NBEA 2OTLZ 1DL6A 4NBBA 2OTJZ 3S14I 3HOYI 4NB9A 3CCUZ 4A3BI 3FQMA 1RQFA 3CPWZ 4A3JI 1Q821 4A3DI 1K8A1 1JJ2Z 2AKLA 3GTOI 3EEDA 1KC82 3VMIA 2QRDB 5D1PA 2E2JI 1N8R1 2M48A 1K731 2G2KA 3U50C 4A93I 5LL6f 3CCRZ 2QKDA 4MH4A 1YUKA 4TNUA 2R92I 2VF1A 1QVGZ 2R6MA 4MONA 3CCR1 2HF1A 1ZB9A 3G6EZ 3EERA 4AYBA 1K9M1 2RIQA 3FKII 1Y1WI 1VQOZ 1M902 2NVQI 4A3LI 2NVTI 1I50I 1VQMZ 3CME1 3S15I 3F3FC 2QA4Z 3CCJZ 1YIJZ 3S1NI 1RO2A 1YHQ1 4EWCA 2JA5I 2Q51A 2GTIA 3KIFA 1VQLZ 2E2II 3G4SZ 3CC7Z 1W2BY 1VQ4Z 3GTGI 2QR1B 1Q822 1K8A2 1KD12 5T6BA 4HH4A 3HOVI 2YADA 3CC71 3I56Z 1TWGI 1VLAA 3BG1B 2R93I 2YU9I 5FLXb 5A2Qf 3CCSZ 1N8R2 4A3CI 2V8IA 1K732 2KI7B 3S1MI 2RHBA 2RT9A 3CCM1 1VQ8Z 3S2HI 1TWFI 2P3YA 3IFUA 1VQ6Z 1KQSZ 2HU9A 3CCEZ 3TDHB 1VQ51 3GTKI 2O4HA 3LUSA 3G71Z 1W2BZ 3CCLZ 1WIIA 2OOYB 4NBCA 3VMHA 3GTQI 3S16I 1K83I 4A3FI 3GCFA 1VQ61 4E2ZA 1YI21 1YITZ 4E2XA 3G711 2JR6A 5C4XI 4NH1C 1X0TA 3VTNA 5IT9f 1RO4A 3S1QI 4Y52I 1VQ7Z 1Q861 1VQ9Z 3VMGA 1LQLA 1USPB 3PO2I 3CC2Z 1TWAI 3T4NB 4RVDA 1VQ71 2R7ZI 2QEX1 1KD11 2OTL1 3J80b 3NDIA 2OTJ1 3CCU1 3CMAZ 3JAMf 3J7A4 4X6AI 3PO3I 2V8JA 1M1K1 2P28A 2IZ3A 5IT9b 2KPIA 1USPA 3D6WA 3CMA1 1WW9A 2PM9A 4S1TA 3GKQA 1YUAA 3P5JB 1X3ZA 4BBSI 3TE5B 2I3CA 1Q811 3GTMS 3NFZA 3QWUA 3I55Z 2RBLA 3FQQA 5D1OB 3PO3S 2EGTA 1S72Z 3I4MI 3CCQZ 2NVXI 1VQNZ 4MD9A 3M3YI 4HGZA 2H85A 4NBFA 1KQSY 2W04A 1Q862 2DE7A 3G6E1 2OZKA 3CQZI 3Q87A 2JUBA 3CCQ1 1VQO1 4A3EI 3H0GI 1VQN1 2BJOA 1VQM1 3MZKB 4HGYA 2GTHA 2QA41 3CCJ1 1YIJ1 2JA7I 5AN9F 1P9NA 3IF8A 5C44I 5IP7I 5D1OA 2B63I 2VUGA 1VQL1 1RLYA 1S7MA 3G4S1 2F4MA 4A3MI 2JA8I 2JS4A 3K7AI 1VQ41 3S1RI 4A3KI 3J81f 4A3GI 3HOZI 4NBDA 3I561 4NBGA 1M1K2 4MD8A 4DQYB 2O53A 2W03A 4RS4A 3CCS1 2RPRA 2QRCB 4MD7A 3HOXI 1Q812 2QREB 4Y7NI 3VB9A 1YJWZ 1VQ81 1WCMI 1Y1VI 4QTUA 3CCVZ 1KRLA 1Z03A 4DK1A 4BY7I 1YJNZ 2DE5A 1YJ9Z 4NB8A 2ZAEB 2V8KA 3CCE1 3CC4Z 4BBRI 3CCL1 1N2FA 5A2Qb 5FLMI 4BY1I 1YJ91 1YIT1 3GTJI 1Y1VS 3F3PC 1NUIA 2VUMI 3CXCY 1QYPA 2Q4ZA 3IX0A 3RZDI 3MZLB 2LIYA 4MXUA 3H3VJ 1VQ91 4E31A 2DE6A 3GTMI 1ML8A 2OOXB 2WAQA 4E30A 1NJI1 1Z01A 3CC21 4QTTA 3I07A 3RZOI 4MRIA 5C3EI 1QVFY 2K5RA 1Q7Y1 3ESWA 2F4OA 1TWCI 1VQKZ 3BG0B 1NP6A 2M6NA 2Y0SA 3D9XA 1I6HI 4E33A 3GTPI 1R9TI 3CXCZ 1VQK1 3KIHA 5C4JI 3HKZA 3I551 3HOUI 1TFIA 5CM2M 3NDJA 3JAMb 1RO0A 2E9HA 5FLXf 1S721 4NBAA 3CMEZ 4A3II 1RNIA 1TWHI 1VQPZ 2QLVB 1L1OC 3NH4A 1YHQZ 2PMZA 4NOZA 4BXXI 1ZB8A 1QF8A 1QVFZ 4RVFA 1VQP1 1NJI2 3S17I 1PFTA 2WB1A 4E2WA 4NBHA 3OW2Y 4RVGA 1X3WA 1SFOI 1Z02A 4RV9A 1Q7Y2 3M4OI 4XX2A 2JMOA 3CCMZ 2JA6I 2NVYI 1KC81 4E2YA 4RVHA 3NH5A 2IZ4A 3NH8A 3CD6Z 1VQ5Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 1;  3CPW Y;  1VQ4 Z;  1VQ9 1;  3I55 Z;  1YJW 1;  1Q82 2;  3CCV 1;  1K8A 2;  1NJI 1;  1KD1 2;  1YI2 Z;  1JJ2 Y;  1YJN 1;  3CC2 1;  3CC7 1;  3I56 Z;  3CD6 1;  1S72 Z;  3CCQ Z;  3CC4 1;  1VQN Z;  3CCS Z;  1N8R 2;  3OW2 Z;  1K9M 2;  1KQS Y;  1K73 2;  1Q86 2;  3G6E 1;  1QVF Y;  1Q7Y 1;  1VQK Z;  3CCQ 1;  1VQO 1;  3CCM 1;  1VQN 1;  1VQM 1;  1VQ8 Z;  1M90 1;  2QA4 1;  1YIJ 1;  3CCJ 1;  1VQ6 Z;  1KQS Z;  1QVG Y;  1VQL 1;  2QEX Z;  3G4S 1;  3CXC Z;  1VQK 1;  3CCE Z;  2OTL Z;  1VQ5 1;  3G71 Z;  1W2B Z;  2OTJ Z;  1VQ4 1;  3CCL Z;  3CCU Z;  3I55 1;  3CPW Z;  1VQ6 1;  1YI2 1;  1Q82 1;  1YIT Z;  1K8A 1;  1JJ2 Z;  3I56 1;  1M1K 2;  1S72 1;  3G71 1;  1KC8 2;  3CME Z;  1VQP Z;  3CCS 1;  1YHQ Z;  1N8R 1;  1VQ7 Z;  1Q81 2;  1K73 1;  1Q86 1;  1QVF Z;  1VQ9 Z;  1VQP 1;  1NJI 2;  3CCR Z;  1YJW Z;  1VQ8 1;  3CCV Z;  1YJN Z;  3CC2 Z;  1VQ7 1;  1YJ9 Z;  2QEX 1;  1KD1 1;  3OW2 Y;  3CCE 1;  1QVG Z;  2OTL 1;  3CC4 Z;  2OTJ 1;  3CCR 1;  3CCL 1;  3CCU 1;  1Q7Y 2;  3CMA Z;  3G6E Z;  1YJ9 1;  1K9M 1;  1YIT 1;  1VQO Z;  1M90 2;  3CCM Z;  1VQM Z;  3CME 1;  1M1K 1;  2QA4 Z;  1YIJ Z;  3CCJ Z;  1KC8 1;  3CXC Y;  3CMA 1;  1YHQ 1;  1VQL Z;  3G4S Z;  3CC7 Z;  1W2B Y;  3CD6 Z;  1VQ5 Z; 
#chains in the Genus database with same CATH topology
 3CPW Y;  5IP9 I;  5T64 A;  4E32 A;  1YJW 1;  3CCV 1;  1JWH C;  1JJ2 Y;  2E2H I;  1YI2 Z;  1YJN 1;  2PK7 A;  2GU2 A;  3J81 b;  5T67 A;  3S2D I;  3CD6 1;  3GTL I;  3J80 f;  4DGL A;  3CC4 1;  2K3R A;  3MON A;  3OW2 Z;  2VPW A;  4CL1 A;  1K9M 2;  3HOW I;  1I3Q I;  2LFU A;  1ZH1 A;  2VPY A;  2V45 A;  2LEX A;  2J6A A;  1M90 1;  4NFR A;  3I4N I;  2JIM A;  2V3V A;  2JNY A;  1QVG Y;  2QEX Z;  4NBE A;  2OTL Z;  1DL6 A;  4NBB A;  2OTJ Z;  3S14 I;  3HOY I;  4NB9 A;  3CCU Z;  4A3B I;  3FQM A;  1RQF A;  3CPW Z;  4A3J I;  1Q82 1;  4A3D I;  1K8A 1;  1JJ2 Z;  2AKL A;  3GTO I;  3EED A;  2JIQ A;  1KC8 2;  3VMI A;  2QRD B;  5D1P A;  1Y8C A;  2E2J I;  1N8R 1;  2M48 A;  1K73 1;  2G2K A;  3U50 C;  4A93 I;  5LL6 f;  3CCR Z;  2QKD A;  4MH4 A;  1YUK A;  4TNU A;  2R92 I;  2VF1 A;  1QVG Z;  2R6M A;  4MON A;  3CCR 1;  2HF1 A;  1ZB9 A;  3G6E Z;  2NAP A;  3EER A;  4AYB A;  1K9M 1;  2RIQ A;  3FKI I;  1Y1W I;  1VQO Z;  1M90 2;  2NVQ I;  4A3L I;  2NVT I;  1I50 I;  1VQM Z;  3CME 1;  3S15 I;  3F3F C;  2QA4 Z;  3CCJ Z;  1YIJ Z;  3S1N I;  1RO2 A;  1YHQ 1;  4EWC A;  2JA5 I;  2Q51 A;  2GTI A;  3KIF A;  1VQL Z;  2E2I I;  3G4S Z;  3CC7 Z;  1W2B Y;  1VQ4 Z;  3GTG I;  2QR1 B;  1Q82 2;  1K8A 2;  1KD1 2;  5T6B A;  4HH4 A;  3HOV I;  2YAD A;  3CC7 1;  3I56 Z;  1TWG I;  1VLA A;  3BG1 B;  2R93 I;  2YU9 I;  5FLX b;  5A2Q f;  3CCS Z;  1N8R 2;  4A3C I;  2V8I A;  1K73 2;  2KI7 B;  3S1M I;  1SIW A;  2RHB A;  1FDO A;  2RT9 A;  3CCM 1;  1VQ8 Z;  3S2H I;  1TWF I;  2P3Y A;  3IFU A;  1VQ6 Z;  1KQS Z;  2HU9 A;  3CCE Z;  3TDH B;  1VQ5 1;  3GTK I;  2O4H A;  3LUS A;  3G71 Z;  1W2B Z;  3CCL Z;  1WII A;  2OOY B;  4NBC A;  3VMH A;  3GTQ I;  3S16 I;  1K83 I;  4A3F I;  3GCF A;  1VQ6 1;  4E2Z A;  1YI2 1;  1YIT Z;  4E2X A;  3G71 1;  2JR6 A;  5C4X I;  4NH1 C;  1X0T A;  3VTN A;  5IT9 f;  1RO4 A;  3S1Q I;  4Y52 I;  1VQ7 Z;  1Q86 1;  1AA6 A;  1VQ9 Z;  3VMG A;  1LQL A;  1USP B;  3PO2 I;  3CC2 Z;  1TWA I;  3T4N B;  4RVD A;  1VQ7 1;  2R7Z I;  2QEX 1;  1KD1 1;  2OTL 1;  3J80 b;  3NDI A;  2OTJ 1;  3CCU 1;  3CMA Z;  3JAM f;  3D2L A;  3J7A 4;  4X6A I;  3PO3 I;  2V8J A;  1M1K 1;  2P28 A;  2IZ3 A;  5IT9 b;  2KPI A;  1USP A;  3D6W A;  3CMA 1;  1WW9 A;  2PM9 A;  4S1T A;  3GKQ A;  1YUA A;  3P5J B;  1X3Z A;  4BBS I;  3TE5 B;  2I3C A;  1Q81 1;  3GTM S;  3NFZ A;  3QWU A;  3I55 Z;  2JIO A;  1QXF A;  2RBL A;  3FQQ A;  5D1O B;  3PO3 S;  2EGT A;  1S72 Z;  3I4M I;  3CCQ Z;  2NVX I;  1VQN Z;  4MD9 A;  3M3Y I;  4HGZ A;  2H85 A;  4NBF A;  1KQS Y;  2W04 A;  1Q86 2;  2DE7 A;  2E7Z A;  3G6E 1;  2OZK A;  3CQZ I;  3Q87 A;  2JUB A;  3CCQ 1;  1VQO 1;  4A3E I;  3H0G I;  1VQN 1;  2BJO A;  1VQM 1;  3MZK B;  4HGY A;  2GTH A;  2QA4 1;  3CCJ 1;  1YIJ 1;  2JA7 I;  5AN9 F;  1P9N A;  3IF8 A;  5C44 I;  5IP7 I;  5D1O A;  2B63 I;  2VUG A;  1VQL 1;  1RLY A;  1S7M A;  3G4S 1;  2F4M A;  4A3M I;  2VPX A;  2JA8 I;  2JS4 A;  3K7A I;  1VQ4 1;  3S1R I;  4A3K I;  3J81 f;  4A3G I;  3HOZ I;  4NBD A;  3I56 1;  4NBG A;  1M1K 2;  4MD8 A;  4DQY B;  2O53 A;  2W03 A;  4RS4 A;  3CCS 1;  2RPR A;  2QRC B;  4MD7 A;  3HOX I;  1Q81 2;  2QRE B;  4Y7N I;  3VB9 A;  1YJW Z;  1VQ8 1;  1WCM I;  1Y1V I;  4QTU A;  3CCV Z;  1KRL A;  1Z03 A;  4DK1 A;  4BY7 I;  1YJN Z;  2DE5 A;  1YJ9 Z;  4NB8 A;  2ZAE B;  2V8K A;  3CCE 1;  3CC4 Z;  4BBR I;  3CCL 1;  1N2F A;  5A2Q b;  1FDI A;  5FLM I;  4BY1 I;  1YJ9 1;  1YIT 1;  3GTJ I;  1Y1V S;  3F3P C;  1NUI A;  2VUM I;  3CXC Y;  1QYP A;  2Q4Z A;  3IX0 A;  3RZD I;  3MZL B;  2LIY A;  4MXU A;  3H3V J;  1VQ9 1;  1WZN A;  4E31 A;  2DE6 A;  3GTM I;  1ML8 A;  2OOX B;  2WAQ A;  4E30 A;  1NJI 1;  1Z01 A;  3CC2 1;  2AYD A;  2IV2 X;  1Q16 A;  4QTT A;  3I07 A;  3RZO I;  2VPZ A;  4MRI A;  5C3E I;  1QVF Y;  2K5R A;  1Q7Y 1;  3ESW A;  2F4O A;  1TWC I;  1VQK Z;  3BG0 B;  1NP6 A;  2M6N A;  2Y0S A;  3D9X A;  1I6H I;  4E33 A;  3GTP I;  1R9T I;  3CXC Z;  1VQK 1;  3KIH A;  5C4J I;  3HKZ A;  3I55 1;  3HOU I;  1TFI A;  3IR7 A;  5CM2 M;  3NDJ A;  3JAM b;  1RO0 A;  2E9H A;  5FLX f;  1S72 1;  4NBA A;  3CME Z;  4A3I I;  1RNI A;  1TWH I;  1VQP Z;  2QLV B;  1L1O C;  3NH4 A;  1YHQ Z;  2PMZ A;  4NOZ A;  4BXX I;  1ZB8 A;  1QF8 A;  2JIP A;  1QVF Z;  4RVF A;  1VQP 1;  1NJI 2;  3S17 I;  1PFT A;  2WB1 A;  4E2W A;  1WJ2 A;  4NBH A;  3OW2 Y;  4RVG A;  1X3W A;  1SFO I;  1Z02 A;  4RV9 A;  2JIR A;  1Q7Y 2;  3M4O I;  4XX2 A;  2JMO A;  3CCM Z;  2JA6 I;  2NVY I;  1KC8 1;  4E2Y A;  4RVH A;  3NH5 A;  2IZ4 A;  3NH8 A;  3CD6 Z;  1VQ5 Z; 
#chains in the Genus database with same CATH homology
 3CPW Y;  5IP9 I;  5T64 A;  4E32 A;  1YJW 1;  3CCV 1;  1JWH C;  1JJ2 Y;  2E2H I;  1YI2 Z;  1YJN 1;  2PK7 A;  2GU2 A;  3J81 b;  5T67 A;  3S2D I;  3CD6 1;  3GTL I;  3J80 f;  4DGL A;  3CC4 1;  2K3R A;  3MON A;  3OW2 Z;  4CL1 A;  1K9M 2;  3HOW I;  1I3Q I;  2LFU A;  1ZH1 A;  2J6A A;  1M90 1;  4NFR A;  3I4N I;  2JNY A;  1QVG Y;  2QEX Z;  4NBE A;  2OTL Z;  1DL6 A;  4NBB A;  2OTJ Z;  3S14 I;  3HOY I;  4NB9 A;  3CCU Z;  4A3B I;  3FQM A;  1RQF A;  3CPW Z;  4A3J I;  1Q82 1;  4A3D I;  1K8A 1;  1JJ2 Z;  2AKL A;  3GTO I;  3EED A;  1KC8 2;  3VMI A;  2QRD B;  5D1P A;  2E2J I;  1N8R 1;  2M48 A;  1K73 1;  2G2K A;  3U50 C;  4A93 I;  5LL6 f;  3CCR Z;  2QKD A;  4MH4 A;  1YUK A;  4TNU A;  2R92 I;  2VF1 A;  1QVG Z;  2R6M A;  4MON A;  3CCR 1;  2HF1 A;  1ZB9 A;  3G6E Z;  3EER A;  4AYB A;  1K9M 1;  2RIQ A;  3FKI I;  1Y1W I;  1VQO Z;  1M90 2;  2NVQ I;  4A3L I;  2NVT I;  1I50 I;  1VQM Z;  3CME 1;  3S15 I;  3F3F C;  2QA4 Z;  3CCJ Z;  1YIJ Z;  3S1N I;  1RO2 A;  1YHQ 1;  4EWC A;  2JA5 I;  2Q51 A;  2GTI A;  3KIF A;  1VQL Z;  2E2I I;  3G4S Z;  3CC7 Z;  1W2B Y;  1VQ4 Z;  3GTG I;  2QR1 B;  1Q82 2;  1K8A 2;  1KD1 2;  5T6B A;  4HH4 A;  3HOV I;  2YAD A;  3CC7 1;  3I56 Z;  1TWG I;  1VLA A;  3BG1 B;  2R93 I;  2YU9 I;  5FLX b;  5A2Q f;  3CCS Z;  1N8R 2;  4A3C I;  2V8I A;  1K73 2;  2KI7 B;  3S1M I;  2RHB A;  2RT9 A;  3CCM 1;  1VQ8 Z;  3S2H I;  1TWF I;  2P3Y A;  3IFU A;  1VQ6 Z;  1KQS Z;  2HU9 A;  3CCE Z;  3TDH B;  1VQ5 1;  3GTK I;  2O4H A;  3LUS A;  3G71 Z;  1W2B Z;  3CCL Z;  1WII A;  2OOY B;  4NBC A;  3VMH A;  3GTQ I;  3S16 I;  1K83 I;  4A3F I;  3GCF A;  1VQ6 1;  4E2Z A;  1YI2 1;  1YIT Z;  4E2X A;  3G71 1;  2JR6 A;  5C4X I;  4NH1 C;  1X0T A;  3VTN A;  5IT9 f;  1RO4 A;  3S1Q I;  4Y52 I;  1VQ7 Z;  1Q86 1;  1VQ9 Z;  3VMG A;  1LQL A;  1USP B;  3PO2 I;  3CC2 Z;  1TWA I;  3T4N B;  4RVD A;  1VQ7 1;  2R7Z I;  2QEX 1;  1KD1 1;  2OTL 1;  3J80 b;  3NDI A;  2OTJ 1;  3CCU 1;  3CMA Z;  3JAM f;  3J7A 4;  4X6A I;  3PO3 I;  2V8J A;  1M1K 1;  2P28 A;  2IZ3 A;  5IT9 b;  2KPI A;  1USP A;  3D6W A;  3CMA 1;  1WW9 A;  2PM9 A;  4S1T A;  3GKQ A;  1YUA A;  3P5J B;  1X3Z A;  4BBS I;  3TE5 B;  2I3C A;  1Q81 1;  3GTM S;  3NFZ A;  3QWU A;  3I55 Z;  2RBL A;  3FQQ A;  5D1O B;  3PO3 S;  2EGT A;  1S72 Z;  3I4M I;  3CCQ Z;  2NVX I;  1VQN Z;  4MD9 A;  3M3Y I;  4HGZ A;  2H85 A;  4NBF A;  1KQS Y;  2W04 A;  1Q86 2;  2DE7 A;  3G6E 1;  2OZK A;  3CQZ I;  3Q87 A;  2JUB A;  3CCQ 1;  1VQO 1;  4A3E I;  3H0G I;  1VQN 1;  2BJO A;  1VQM 1;  3MZK B;  4HGY A;  2GTH A;  2QA4 1;  3CCJ 1;  1YIJ 1;  2JA7 I;  5AN9 F;  1P9N A;  3IF8 A;  5C44 I;  5IP7 I;  5D1O A;  2B63 I;  2VUG A;  1VQL 1;  1RLY A;  1S7M A;  3G4S 1;  2F4M A;  4A3M I;  2JA8 I;  2JS4 A;  3K7A I;  1VQ4 1;  3S1R I;  4A3K I;  3J81 f;  4A3G I;  3HOZ I;  4NBD A;  3I56 1;  4NBG A;  1M1K 2;  4MD8 A;  4DQY B;  2O53 A;  2W03 A;  4RS4 A;  3CCS 1;  2RPR A;  2QRC B;  4MD7 A;  3HOX I;  1Q81 2;  2QRE B;  4Y7N I;  3VB9 A;  1YJW Z;  1VQ8 1;  1WCM I;  1Y1V I;  4QTU A;  3CCV Z;  1KRL A;  1Z03 A;  4DK1 A;  4BY7 I;  1YJN Z;  2DE5 A;  1YJ9 Z;  4NB8 A;  2ZAE B;  2V8K A;  3CCE 1;  3CC4 Z;  4BBR I;  3CCL 1;  1N2F A;  5A2Q b;  5FLM I;  4BY1 I;  1YJ9 1;  1YIT 1;  3GTJ I;  1Y1V S;  3F3P C;  1NUI A;  2VUM I;  3CXC Y;  1QYP A;  2Q4Z A;  3IX0 A;  3RZD I;  3MZL B;  2LIY A;  4MXU A;  3H3V J;  1VQ9 1;  4E31 A;  2DE6 A;  3GTM I;  1ML8 A;  2OOX B;  2WAQ A;  4E30 A;  1NJI 1;  1Z01 A;  3CC2 1;  4QTT A;  3I07 A;  3RZO I;  4MRI A;  5C3E I;  1QVF Y;  2K5R A;  1Q7Y 1;  3ESW A;  2F4O A;  1TWC I;  1VQK Z;  3BG0 B;  1NP6 A;  2M6N A;  2Y0S A;  3D9X A;  1I6H I;  4E33 A;  3GTP I;  1R9T I;  3CXC Z;  1VQK 1;  3KIH A;  5C4J I;  3HKZ A;  3I55 1;  3HOU I;  1TFI A;  5CM2 M;  3NDJ A;  3JAM b;  1RO0 A;  2E9H A;  5FLX f;  1S72 1;  4NBA A;  3CME Z;  4A3I I;  1RNI A;  1TWH I;  1VQP Z;  2QLV B;  1L1O C;  3NH4 A;  1YHQ Z;  2PMZ A;  4NOZ A;  4BXX I;  1ZB8 A;  1QF8 A;  1QVF Z;  4RVF A;  1VQP 1;  1NJI 2;  3S17 I;  1PFT A;  2WB1 A;  4E2W A;  4NBH A;  3OW2 Y;  4RVG A;  1X3W A;  1SFO I;  1Z02 A;  4RV9 A;  1Q7Y 2;  3M4O I;  4XX2 A;  2JMO A;  3CCM Z;  2JA6 I;  2NVY I;  1KC8 1;  4E2Y A;  4RVH A;  3NH5 A;  2IZ4 A;  3NH8 A;  3CD6 Z;  1VQ5 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...