1Q821

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82100
1YITZ 1YHQ1 3I56Z 3CMAZ 3CC7Z 1VQL1 1K9M2 1VQ9Z 3CC4Z 3I551 3CCSZ 1Q861 3OW2Y 3CXCZ 1KC82 3CD61 3G6E1 1Q7Y2 2OTJ1 1YIJ1 1VQ71 1S72Z 1W2BY 1K8A1 3CCMZ 1VQ41 3CPWZ 3G4S1 1M1K2 1VQPZ 1NJI1 2OTL1 1VQ51 1YI2Z 1KD12 1M901 3CMEZ 3CXCY 1YJN1 1VQK1 1N8R1 3G711 1Q811 3CCL1 2QEXZ 3CC2Z 2QA41 3CPWY 1VQOZ 1Q822 3CCVZ 3CCJ1 1VQ8Z 1QVGY 1YHQZ 1QVFY 1VQLZ 1VQM1 3CCU1 3I55Z 1QVGZ 3CCR1 1Q862 1QVFZ 3CD6Z 1YJ91 3G6EZ 3CCQ1 2OTJZ 1YIJZ 1VQN1 1VQ7Z 1VQ61 1YI21 1K8A2 1VQ81 1VQ4Z 1YJW1 3G4SZ 1YIT1 3I561 3CMA1 1NJI2 2OTLZ 3CC71 1VQ5Z 1K9M1 1VQ91 3CC41 3CCEZ 1M902 3CCS1 1KC81 1YJNZ 1VQKZ 1N8R2 3G71Z 1K731 1Q7Y1 1Q812 3CCLZ 1S721 3CCM1 1M1K1 2QA4Z 1VQP1 1JJ2Z 3CCJZ 1KD11 1K732 3CME1 1VQMZ 3CCUZ 3CCRZ 3OW2Z 1KQSY 2QEX1 1YJ9Z 3CC21 3CCQZ 1VQO1 1VQNZ 1VQ6Z 1JJ2Y 3CCE1 1W2BZ 1Q821 3CCV1 1KQSZ 1YJWZ
chains in the Genus database with same CATH superfamily
1YHQ1 3I56Z 1K9M2 3CC4Z 4NBEA 5AN9F 3I551 5T67A 4MD7A 3HOXI 3GTOI 4RVHA 2P3YA 1YIJ1 3FKII 1VQ41 2VPWA 2OTL1 4A3LI 4X6AI 3CMEZ 2K5RA 2KPIA 4NH1C 3T4NB 5FLMI 1Z02A 3NDJA 2JA5I 5D1OA 1VQOZ 4A3DI 3GTQI 2RPRA 5C4XI 3CCVZ 2IV2X 3CCJ1 1YHQZ 3S1MI 1QVFY 4E2YA 3S1NI 3NH8A 4NBDA 1RO4A 2AKLA 3I55Z 1WCMI 5FLXf 2GTIA 4A3CI 1YIJZ 1K8A2 1VQ4Z 1YJW1 4HH4A 1TWHI 1ZH1A 1NJI2 2OTLZ 4E32A 1QXFA 1VQ91 5C3EI 3VMIA 4MONA 1KC81 5A2Qb 2QLVB 2VPZA 2VPXA 1Q812 5IT9f 2E2II 1Q16A 1S721 2Y0SA 2V8IA 3HOVI 4A3MI 1DL6A 3GTJI 1USPB 1M1K1 2WB1A 4A3GI 1N2FA 3QWUA 5C4JI 3CCJZ 1KD11 2E7ZA 1K732 2GTHA 2VUGA 4EWCA 2LIYA 4A3JI 3VMHA 3OW2Z 2NAPA 2QEX1 4MXUA 3CC21 1Z03A 2VUMI 3JAMf 2V8KA 4A3II 3CCE1 1W2BZ 1Q821 3NDIA 1YJWZ 3FQQA 2VF1A 3F3PC 3HOWI 3TDHB 1S7MA 1I50I 1VQ9Z 4NOZA 3J81f 2R7ZI 3GKQA 3OW2Y 3GTMS 1RLYA 1RNIA 3P5JB 3VB9A 3D9XA 2JA7I 2LFUA 1RO2A 4A93I 1VQ71 3S16I 1S72Z 4DQYB 1W2BY 4A3BI 4BXXI 1Y1WI 3G4S1 1VQ51 2PM9A 5T64A 1YI2Z 5LL6f 1M901 4A3EI 3IX0A 1N8R1 2QEXZ 2IZ3A 4XX2A 3CC2Z 2E9HA 2OOXB 3VMGA 1I3QI 1K83I 2Q51A 1QVGY 3M4OI 3PO3S 1VLAA 2M6NA 4E31A 5C44I 4Y7NI 1VQM1 1PFTA 3D2LA 3EERA 1RO0A 3CCR1 1Q862 1QVFZ 4NBAA 1I6HI 2DE6A 3PO2I 3CCQ1 4NB9A 1VQ7Z 1VQ61 1AA6A 3G4SZ 4E2WA 2F4MA 3NH4A 3MZKB 1VQ5Z 4AYBA 2I3CA 2JR6A 1K9M1 2BJOA 4A3KI 3ESWA 3GTPI 3S2DI 4NBBA 3CCS1 1TWAI 3J80b 3RZOI 5D1OB 2QREB 2JUBA 2ZAEB 3CCM1 2QR1B 3HOZI 1VQP1 2RHBA 5T6BA 1TFIA 1VQMZ 2QRDB 2EGTA 3CCRZ 1KQSY 3U50C 3CCQZ 3M3YI 1Y1VI 2O53A 1VQ6Z 3RZDI 1VQL1 2E2JI 1Z01A 3S14I 2PMZA 1JWHC 1RQFA 3MONA 3NH5A 2R92I 3CCSZ 2DE7A 3TE5B 3IR7A 3CD61 3G6E1 1Q7Y2 2OTJ1 2P28A 2PK7A 1K8A1 2V3VA 3CCMZ 1Y8CA 3CPWZ 3I4NI 1VQPZ 5A2Qf 1NJI1 4TNUA 1SFOI 4RV9A 5CM2M 2K3RA 1YUKA 2HU9A 2JA6I 3HOUI 1WIIA 1Q811 2JIPA 3CCL1 2JIOA 4NBHA 2YU9I 3KIFA 3CPWY 4E2XA 3MZLB 2JMOA 1VQLZ 1QF8A 4BY1I 1WW9A 5IP9I 4QTUA 1X0TA 1QVGZ 3GTLI 3CD6Z 3G6EZ 2JIQA 2OTJZ 1NP6A 2Q4ZA 2M48A 2JNYA 1YIT1 3CMA1 3BG1B 3K7AI 3CC71 1KRLA 4QTTA 3CCEZ 3Q87A 3S1RI 2NVXI 1TWCI 2NVYI 2JIMA 1SIWA 3BG0B 3CCLZ 1ZB9A 2HF1A 3D6WA 3IF8A 1YUAA 2LEXA 3H3VJ 4Y52I 3HKZA 1WZNA 4NBCA 4RVGA 3I4MI 3NFZA 2IZ4A 4RVDA 5D1PA 1FDOA 2QKDA 1KQSZ 1VQ81 5FLXb 4RS4A 1YITZ 3CMAZ 4BY7I 3CC7Z 2GU2A 3FQMA 3HOYI 2RT9A 1LQLA 3KIHA 2WAQA 3VTNA 1Q861 3CXCZ 1KC82 3IFUA 4HGZA 3I07A 4BBSI 2NVTI 3GCFA 3S15I 2R93I 1M1K2 2B63I 3J80f 2W04A 3EEDA 4NFRA 5IT9b 2KI7B 3S2HI 4E30A 2OOYB 2YADA 1KD12 1TWFI 3S17I 3CXCY 1YJN1 4MD8A 1VQK1 3GTMI 3G711 1X3WA 2F4OA 1FDIA 2JIRA 4E33A 1ZB8A 2QRCB 2E2HI 1WJ2A 2QA41 1L1OC 1Q822 2RBLA 1VQ8Z 4DGLA 2O4HA 1USPA 4BBRI 3JAMb 3CCU1 2AYDA 4MD9A 2R6MA 3LUSA 2H85A 4HGYA 4NBGA 4A3FI 1QYPA 1YJ91 1R9TI 1ML8A 4NBFA 2V45A 1VQN1 1TWGI 3J81b 1YI21 3H0GI 4E2ZA 3I561 3PO3I 3CC41 2V8JA 3F3FC 1M902 3GTGI 3J7A4 1YJNZ 1VQKZ 2NVQI 1N8R2 3G71Z 1NUIA 1K731 1P9NA 2JS4A 1Q7Y1 3CQZI 2OZKA 2JA8I 1Y1VS 2QA4Z 2RIQA 4RVFA 1JJ2Z 1X3ZA 4DK1A 4S1TA 4NB8A 3CME1 3GTKI 3CCUZ 3S1QI 4CL1A 2G2KA 5IP7I 2DE5A 2J6AA 1YJ9Z 4MH4A 2W03A 1VQO1 1VQNZ 1JJ2Y 4MRIA 3CCV1 2VPYA
chains in the Genus database with same CATH topology
1YHQ1 3I56Z 1K9M2 3CC4Z 4NBEA 5AN9F 3I551 5T67A 4MD7A 3HOXI 3GTOI 4RVHA 2P3YA 1YIJ1 3FKII 1VQ41 2OTL1 4A3LI 4X6AI 3CMEZ 2K5RA 2KPIA 4NH1C 3T4NB 5FLMI 1Z02A 3NDJA 2JA5I 5D1OA 1VQOZ 4A3DI 3GTQI 2RPRA 5C4XI 3CCVZ 3CCJ1 1YHQZ 3S1MI 1QVFY 4E2YA 3S1NI 3NH8A 4NBDA 1RO4A 2AKLA 3I55Z 1WCMI 5FLXf 2GTIA 4A3CI 1YIJZ 1K8A2 1VQ4Z 1YJW1 4HH4A 1TWHI 1ZH1A 1NJI2 2OTLZ 4E32A 1VQ91 5C3EI 3VMIA 4MONA 1KC81 5A2Qb 2QLVB 1Q812 5IT9f 2E2II 1S721 2Y0SA 2V8IA 3HOVI 4A3MI 1DL6A 3GTJI 1USPB 1M1K1 2WB1A 4A3GI 1N2FA 3QWUA 5C4JI 3CCJZ 1KD11 1K732 2GTHA 2VUGA 4EWCA 2LIYA 4A3JI 3VMHA 3OW2Z 2QEX1 4MXUA 3CC21 1Z03A 2VUMI 3JAMf 2V8KA 4A3II 3CCE1 1W2BZ 1Q821 3NDIA 1YJWZ 3FQQA 2VF1A 3F3PC 3HOWI 3TDHB 1S7MA 1I50I 1VQ9Z 4NOZA 3J81f 2R7ZI 3GKQA 3OW2Y 3GTMS 1RLYA 1RNIA 3P5JB 3VB9A 3D9XA 2JA7I 2LFUA 1RO2A 4A93I 1VQ71 3S16I 1S72Z 4DQYB 1W2BY 4A3BI 4BXXI 1Y1WI 3G4S1 1VQ51 2PM9A 5T64A 1YI2Z 5LL6f 1M901 4A3EI 3IX0A 1N8R1 2QEXZ 2IZ3A 4XX2A 3CC2Z 2E9HA 2OOXB 3VMGA 1I3QI 1K83I 2Q51A 1QVGY 3M4OI 3PO3S 1VLAA 2M6NA 4E31A 5C44I 4Y7NI 1VQM1 1PFTA 3EERA 1RO0A 3CCR1 1Q862 1QVFZ 4NBAA 1I6HI 2DE6A 3PO2I 3CCQ1 4NB9A 1VQ7Z 1VQ61 3G4SZ 4E2WA 2F4MA 3NH4A 3MZKB 1VQ5Z 4AYBA 2I3CA 2JR6A 1K9M1 2BJOA 4A3KI 3ESWA 3GTPI 3S2DI 4NBBA 3CCS1 1TWAI 3J80b 3RZOI 5D1OB 2QREB 2JUBA 2ZAEB 3CCM1 2QR1B 3HOZI 1VQP1 2RHBA 5T6BA 1TFIA 1VQMZ 2QRDB 2EGTA 3CCRZ 1KQSY 3U50C 3CCQZ 3M3YI 1Y1VI 2O53A 1VQ6Z 3RZDI 1VQL1 2E2JI 1Z01A 3S14I 2PMZA 1JWHC 1RQFA 3MONA 3NH5A 2R92I 3CCSZ 2DE7A 3TE5B 3CD61 3G6E1 1Q7Y2 2OTJ1 2P28A 2PK7A 1K8A1 3CCMZ 3CPWZ 3I4NI 1VQPZ 5A2Qf 1NJI1 4TNUA 1SFOI 4RV9A 5CM2M 2K3RA 1YUKA 2HU9A 2JA6I 3HOUI 1WIIA 1Q811 3CCL1 4NBHA 2YU9I 3KIFA 3CPWY 4E2XA 3MZLB 2JMOA 1VQLZ 1QF8A 4BY1I 1WW9A 5IP9I 4QTUA 1X0TA 1QVGZ 3GTLI 3CD6Z 3G6EZ 2OTJZ 1NP6A 2Q4ZA 2M48A 2JNYA 1YIT1 3CMA1 3BG1B 3K7AI 3CC71 1KRLA 4QTTA 3CCEZ 3Q87A 3S1RI 2NVXI 1TWCI 2NVYI 3BG0B 3CCLZ 1ZB9A 2HF1A 3D6WA 3IF8A 1YUAA 3H3VJ 4Y52I 3HKZA 4NBCA 4RVGA 3I4MI 3NFZA 2IZ4A 4RVDA 5D1PA 2QKDA 1KQSZ 1VQ81 5FLXb 4RS4A 1YITZ 3CMAZ 4BY7I 3CC7Z 2GU2A 3FQMA 3HOYI 2RT9A 1LQLA 3KIHA 2WAQA 3VTNA 1Q861 3CXCZ 1KC82 3IFUA 4HGZA 3I07A 4BBSI 2NVTI 3GCFA 3S15I 2R93I 1M1K2 2B63I 3J80f 2W04A 3EEDA 4NFRA 5IT9b 2KI7B 3S2HI 4E30A 2OOYB 2YADA 1KD12 1TWFI 3S17I 3CXCY 1YJN1 4MD8A 1VQK1 3GTMI 3G711 1X3WA 2F4OA 4E33A 1ZB8A 2QRCB 2E2HI 2QA41 1L1OC 1Q822 2RBLA 1VQ8Z 4DGLA 2O4HA 1USPA 4BBRI 3JAMb 3CCU1 4MD9A 2R6MA 3LUSA 2H85A 4HGYA 4NBGA 4A3FI 1QYPA 1YJ91 1R9TI 1ML8A 4NBFA 1VQN1 1TWGI 3J81b 1YI21 3H0GI 4E2ZA 3I561 3PO3I 3CC41 2V8JA 3F3FC 1M902 3GTGI 3J7A4 1YJNZ 1VQKZ 2NVQI 1N8R2 3G71Z 1NUIA 1K731 1P9NA 2JS4A 1Q7Y1 3CQZI 2OZKA 2JA8I 1Y1VS 2QA4Z 2RIQA 4RVFA 1JJ2Z 1X3ZA 4DK1A 4S1TA 4NB8A 3CME1 3GTKI 3CCUZ 3S1QI 4CL1A 2G2KA 5IP7I 2DE5A 2J6AA 1YJ9Z 4MH4A 2W03A 1VQO1 1VQNZ 1JJ2Y 4MRIA 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT Z;  1YHQ 1;  3I56 Z;  3CMA Z;  3CC7 Z;  1VQL 1;  1K9M 2;  1VQ9 Z;  3CC4 Z;  3I55 1;  3CCS Z;  1Q86 1;  3OW2 Y;  3CXC Z;  1KC8 2;  3CD6 1;  3G6E 1;  1Q7Y 2;  2OTJ 1;  1YIJ 1;  1VQ7 1;  1S72 Z;  1W2B Y;  1K8A 1;  3CCM Z;  1VQ4 1;  3CPW Z;  3G4S 1;  1M1K 2;  1VQP Z;  1NJI 1;  2OTL 1;  1VQ5 1;  1YI2 Z;  1KD1 2;  1M90 1;  3CME Z;  3CXC Y;  1YJN 1;  1VQK 1;  1N8R 1;  3G71 1;  1Q81 1;  3CCL 1;  2QEX Z;  3CC2 Z;  2QA4 1;  3CPW Y;  1VQO Z;  1Q82 2;  3CCV Z;  3CCJ 1;  1VQ8 Z;  1QVG Y;  1YHQ Z;  1QVF Y;  1VQL Z;  1VQM 1;  3CCU 1;  3I55 Z;  1QVG Z;  3CCR 1;  1Q86 2;  1QVF Z;  3CD6 Z;  1YJ9 1;  3G6E Z;  3CCQ 1;  2OTJ Z;  1YIJ Z;  1VQN 1;  1VQ7 Z;  1VQ6 1;  1YI2 1;  1K8A 2;  1VQ8 1;  1VQ4 Z;  1YJW 1;  3G4S Z;  1YIT 1;  3I56 1;  3CMA 1;  1NJI 2;  2OTL Z;  3CC7 1;  1VQ5 Z;  1K9M 1;  1VQ9 1;  3CC4 1;  3CCE Z;  1M90 2;  3CCS 1;  1KC8 1;  1YJN Z;  1VQK Z;  1N8R 2;  3G71 Z;  1K73 1;  1Q7Y 1;  1Q81 2;  3CCL Z;  1S72 1;  3CCM 1;  1M1K 1;  2QA4 Z;  1VQP 1;  1JJ2 Z;  3CCJ Z;  1KD1 1;  1K73 2;  3CME 1;  1VQM Z;  3CCU Z;  3CCR Z;  3OW2 Z;  1KQS Y;  2QEX 1;  1YJ9 Z;  3CC2 1;  3CCQ Z;  1VQO 1;  1VQN Z;  1VQ6 Z;  1JJ2 Y;  3CCE 1;  1W2B Z;  1Q82 1;  3CCV 1;  1KQS Z;  1YJW Z; 
#chains in the Genus database with same CATH topology
 1YHQ 1;  3I56 Z;  1K9M 2;  3CC4 Z;  4NBE A;  5AN9 F;  3I55 1;  5T67 A;  4MD7 A;  3HOX I;  3GTO I;  4RVH A;  2P3Y A;  1YIJ 1;  3FKI I;  1VQ4 1;  2VPW A;  2OTL 1;  4A3L I;  4X6A I;  3CME Z;  2K5R A;  2KPI A;  4NH1 C;  3T4N B;  5FLM I;  1Z02 A;  3NDJ A;  2JA5 I;  5D1O A;  1VQO Z;  4A3D I;  3GTQ I;  2RPR A;  5C4X I;  3CCV Z;  2IV2 X;  3CCJ 1;  1YHQ Z;  3S1M I;  1QVF Y;  4E2Y A;  3S1N I;  3NH8 A;  4NBD A;  1RO4 A;  2AKL A;  3I55 Z;  1WCM I;  5FLX f;  2GTI A;  4A3C I;  1YIJ Z;  1K8A 2;  1VQ4 Z;  1YJW 1;  4HH4 A;  1TWH I;  1ZH1 A;  1NJI 2;  2OTL Z;  4E32 A;  1QXF A;  1VQ9 1;  5C3E I;  3VMI A;  4MON A;  1KC8 1;  5A2Q b;  2QLV B;  2VPZ A;  2VPX A;  1Q81 2;  5IT9 f;  2E2I I;  1Q16 A;  1S72 1;  2Y0S A;  2V8I A;  3HOV I;  4A3M I;  1DL6 A;  3GTJ I;  1USP B;  1M1K 1;  2WB1 A;  4A3G I;  1N2F A;  3QWU A;  5C4J I;  3CCJ Z;  1KD1 1;  2E7Z A;  1K73 2;  2GTH A;  2VUG A;  4EWC A;  2LIY A;  4A3J I;  3VMH A;  3OW2 Z;  2NAP A;  2QEX 1;  4MXU A;  3CC2 1;  1Z03 A;  2VUM I;  3JAM f;  2V8K A;  4A3I I;  3CCE 1;  1W2B Z;  1Q82 1;  3NDI A;  1YJW Z;  3FQQ A;  2VF1 A;  3F3P C;  3HOW I;  3TDH B;  1S7M A;  1I50 I;  1VQ9 Z;  4NOZ A;  3J81 f;  2R7Z I;  3GKQ A;  3OW2 Y;  3GTM S;  1RLY A;  1RNI A;  3P5J B;  3VB9 A;  3D9X A;  2JA7 I;  2LFU A;  1RO2 A;  4A93 I;  1VQ7 1;  3S16 I;  1S72 Z;  4DQY B;  1W2B Y;  4A3B I;  4BXX I;  1Y1W I;  3G4S 1;  1VQ5 1;  2PM9 A;  5T64 A;  1YI2 Z;  5LL6 f;  1M90 1;  4A3E I;  3IX0 A;  1N8R 1;  2QEX Z;  2IZ3 A;  4XX2 A;  3CC2 Z;  2E9H A;  2OOX B;  3VMG A;  1I3Q I;  1K83 I;  2Q51 A;  1QVG Y;  3M4O I;  3PO3 S;  1VLA A;  2M6N A;  4E31 A;  5C44 I;  4Y7N I;  1VQM 1;  1PFT A;  3D2L A;  3EER A;  1RO0 A;  3CCR 1;  1Q86 2;  1QVF Z;  4NBA A;  1I6H I;  2DE6 A;  3PO2 I;  3CCQ 1;  4NB9 A;  1VQ7 Z;  1VQ6 1;  1AA6 A;  3G4S Z;  4E2W A;  2F4M A;  3NH4 A;  3MZK B;  1VQ5 Z;  4AYB A;  2I3C A;  2JR6 A;  1K9M 1;  2BJO A;  4A3K I;  3ESW A;  3GTP I;  3S2D I;  4NBB A;  3CCS 1;  1TWA I;  3J80 b;  3RZO I;  5D1O B;  2QRE B;  2JUB A;  2ZAE B;  3CCM 1;  2QR1 B;  3HOZ I;  1VQP 1;  2RHB A;  5T6B A;  1TFI A;  1VQM Z;  2QRD B;  2EGT A;  3CCR Z;  1KQS Y;  3U50 C;  3CCQ Z;  3M3Y I;  1Y1V I;  2O53 A;  1VQ6 Z;  3RZD I;  1VQL 1;  2E2J I;  1Z01 A;  3S14 I;  2PMZ A;  1JWH C;  1RQF A;  3MON A;  3NH5 A;  2R92 I;  3CCS Z;  2DE7 A;  3TE5 B;  3IR7 A;  3CD6 1;  3G6E 1;  1Q7Y 2;  2OTJ 1;  2P28 A;  2PK7 A;  1K8A 1;  2V3V A;  3CCM Z;  1Y8C A;  3CPW Z;  3I4N I;  1VQP Z;  5A2Q f;  1NJI 1;  4TNU A;  1SFO I;  4RV9 A;  5CM2 M;  2K3R A;  1YUK A;  2HU9 A;  2JA6 I;  3HOU I;  1WII A;  1Q81 1;  2JIP A;  3CCL 1;  2JIO A;  4NBH A;  2YU9 I;  3KIF A;  3CPW Y;  4E2X A;  3MZL B;  2JMO A;  1VQL Z;  1QF8 A;  4BY1 I;  1WW9 A;  5IP9 I;  4QTU A;  1X0T A;  1QVG Z;  3GTL I;  3CD6 Z;  3G6E Z;  2JIQ A;  2OTJ Z;  1NP6 A;  2Q4Z A;  2M48 A;  2JNY A;  1YIT 1;  3CMA 1;  3BG1 B;  3K7A I;  3CC7 1;  1KRL A;  4QTT A;  3CCE Z;  3Q87 A;  3S1R I;  2NVX I;  1TWC I;  2NVY I;  2JIM A;  1SIW A;  3BG0 B;  3CCL Z;  1ZB9 A;  2HF1 A;  3D6W A;  3IF8 A;  1YUA A;  2LEX A;  3H3V J;  4Y52 I;  3HKZ A;  1WZN A;  4NBC A;  4RVG A;  3I4M I;  3NFZ A;  2IZ4 A;  4RVD A;  5D1P A;  1FDO A;  2QKD A;  1KQS Z;  1VQ8 1;  5FLX b;  4RS4 A;  1YIT Z;  3CMA Z;  4BY7 I;  3CC7 Z;  2GU2 A;  3FQM A;  3HOY I;  2RT9 A;  1LQL A;  3KIH A;  2WAQ A;  3VTN A;  1Q86 1;  3CXC Z;  1KC8 2;  3IFU A;  4HGZ A;  3I07 A;  4BBS I;  2NVT I;  3GCF A;  3S15 I;  2R93 I;  1M1K 2;  2B63 I;  3J80 f;  2W04 A;  3EED A;  4NFR A;  5IT9 b;  2KI7 B;  3S2H I;  4E30 A;  2OOY B;  2YAD A;  1KD1 2;  1TWF I;  3S17 I;  3CXC Y;  1YJN 1;  4MD8 A;  1VQK 1;  3GTM I;  3G71 1;  1X3W A;  2F4O A;  1FDI A;  2JIR A;  4E33 A;  1ZB8 A;  2QRC B;  2E2H I;  1WJ2 A;  2QA4 1;  1L1O C;  1Q82 2;  2RBL A;  1VQ8 Z;  4DGL A;  2O4H A;  1USP A;  4BBR I;  3JAM b;  3CCU 1;  2AYD A;  4MD9 A;  2R6M A;  3LUS A;  2H85 A;  4HGY A;  4NBG A;  4A3F I;  1QYP A;  1YJ9 1;  1R9T I;  1ML8 A;  4NBF A;  2V45 A;  1VQN 1;  1TWG I;  3J81 b;  1YI2 1;  3H0G I;  4E2Z A;  3I56 1;  3PO3 I;  3CC4 1;  2V8J A;  3F3F C;  1M90 2;  3GTG I;  3J7A 4;  1YJN Z;  1VQK Z;  2NVQ I;  1N8R 2;  3G71 Z;  1NUI A;  1K73 1;  1P9N A;  2JS4 A;  1Q7Y 1;  3CQZ I;  2OZK A;  2JA8 I;  1Y1V S;  2QA4 Z;  2RIQ A;  4RVF A;  1JJ2 Z;  1X3Z A;  4DK1 A;  4S1T A;  4NB8 A;  3CME 1;  3GTK I;  3CCU Z;  3S1Q I;  4CL1 A;  2G2K A;  5IP7 I;  2DE5 A;  2J6A A;  1YJ9 Z;  4MH4 A;  2W03 A;  1VQO 1;  1VQN Z;  1JJ2 Y;  4MRI A;  3CCV 1;  2VPY A; 
#chains in the Genus database with same CATH homology
 1YHQ 1;  3I56 Z;  1K9M 2;  3CC4 Z;  4NBE A;  5AN9 F;  3I55 1;  5T67 A;  4MD7 A;  3HOX I;  3GTO I;  4RVH A;  2P3Y A;  1YIJ 1;  3FKI I;  1VQ4 1;  2OTL 1;  4A3L I;  4X6A I;  3CME Z;  2K5R A;  2KPI A;  4NH1 C;  3T4N B;  5FLM I;  1Z02 A;  3NDJ A;  2JA5 I;  5D1O A;  1VQO Z;  4A3D I;  3GTQ I;  2RPR A;  5C4X I;  3CCV Z;  3CCJ 1;  1YHQ Z;  3S1M I;  1QVF Y;  4E2Y A;  3S1N I;  3NH8 A;  4NBD A;  1RO4 A;  2AKL A;  3I55 Z;  1WCM I;  5FLX f;  2GTI A;  4A3C I;  1YIJ Z;  1K8A 2;  1VQ4 Z;  1YJW 1;  4HH4 A;  1TWH I;  1ZH1 A;  1NJI 2;  2OTL Z;  4E32 A;  1VQ9 1;  5C3E I;  3VMI A;  4MON A;  1KC8 1;  5A2Q b;  2QLV B;  1Q81 2;  5IT9 f;  2E2I I;  1S72 1;  2Y0S A;  2V8I A;  3HOV I;  4A3M I;  1DL6 A;  3GTJ I;  1USP B;  1M1K 1;  2WB1 A;  4A3G I;  1N2F A;  3QWU A;  5C4J I;  3CCJ Z;  1KD1 1;  1K73 2;  2GTH A;  2VUG A;  4EWC A;  2LIY A;  4A3J I;  3VMH A;  3OW2 Z;  2QEX 1;  4MXU A;  3CC2 1;  1Z03 A;  2VUM I;  3JAM f;  2V8K A;  4A3I I;  3CCE 1;  1W2B Z;  1Q82 1;  3NDI A;  1YJW Z;  3FQQ A;  2VF1 A;  3F3P C;  3HOW I;  3TDH B;  1S7M A;  1I50 I;  1VQ9 Z;  4NOZ A;  3J81 f;  2R7Z I;  3GKQ A;  3OW2 Y;  3GTM S;  1RLY A;  1RNI A;  3P5J B;  3VB9 A;  3D9X A;  2JA7 I;  2LFU A;  1RO2 A;  4A93 I;  1VQ7 1;  3S16 I;  1S72 Z;  4DQY B;  1W2B Y;  4A3B I;  4BXX I;  1Y1W I;  3G4S 1;  1VQ5 1;  2PM9 A;  5T64 A;  1YI2 Z;  5LL6 f;  1M90 1;  4A3E I;  3IX0 A;  1N8R 1;  2QEX Z;  2IZ3 A;  4XX2 A;  3CC2 Z;  2E9H A;  2OOX B;  3VMG A;  1I3Q I;  1K83 I;  2Q51 A;  1QVG Y;  3M4O I;  3PO3 S;  1VLA A;  2M6N A;  4E31 A;  5C44 I;  4Y7N I;  1VQM 1;  1PFT A;  3EER A;  1RO0 A;  3CCR 1;  1Q86 2;  1QVF Z;  4NBA A;  1I6H I;  2DE6 A;  3PO2 I;  3CCQ 1;  4NB9 A;  1VQ7 Z;  1VQ6 1;  3G4S Z;  4E2W A;  2F4M A;  3NH4 A;  3MZK B;  1VQ5 Z;  4AYB A;  2I3C A;  2JR6 A;  1K9M 1;  2BJO A;  4A3K I;  3ESW A;  3GTP I;  3S2D I;  4NBB A;  3CCS 1;  1TWA I;  3J80 b;  3RZO I;  5D1O B;  2QRE B;  2JUB A;  2ZAE B;  3CCM 1;  2QR1 B;  3HOZ I;  1VQP 1;  2RHB A;  5T6B A;  1TFI A;  1VQM Z;  2QRD B;  2EGT A;  3CCR Z;  1KQS Y;  3U50 C;  3CCQ Z;  3M3Y I;  1Y1V I;  2O53 A;  1VQ6 Z;  3RZD I;  1VQL 1;  2E2J I;  1Z01 A;  3S14 I;  2PMZ A;  1JWH C;  1RQF A;  3MON A;  3NH5 A;  2R92 I;  3CCS Z;  2DE7 A;  3TE5 B;  3CD6 1;  3G6E 1;  1Q7Y 2;  2OTJ 1;  2P28 A;  2PK7 A;  1K8A 1;  3CCM Z;  3CPW Z;  3I4N I;  1VQP Z;  5A2Q f;  1NJI 1;  4TNU A;  1SFO I;  4RV9 A;  5CM2 M;  2K3R A;  1YUK A;  2HU9 A;  2JA6 I;  3HOU I;  1WII A;  1Q81 1;  3CCL 1;  4NBH A;  2YU9 I;  3KIF A;  3CPW Y;  4E2X A;  3MZL B;  2JMO A;  1VQL Z;  1QF8 A;  4BY1 I;  1WW9 A;  5IP9 I;  4QTU A;  1X0T A;  1QVG Z;  3GTL I;  3CD6 Z;  3G6E Z;  2OTJ Z;  1NP6 A;  2Q4Z A;  2M48 A;  2JNY A;  1YIT 1;  3CMA 1;  3BG1 B;  3K7A I;  3CC7 1;  1KRL A;  4QTT A;  3CCE Z;  3Q87 A;  3S1R I;  2NVX I;  1TWC I;  2NVY I;  3BG0 B;  3CCL Z;  1ZB9 A;  2HF1 A;  3D6W A;  3IF8 A;  1YUA A;  3H3V J;  4Y52 I;  3HKZ A;  4NBC A;  4RVG A;  3I4M I;  3NFZ A;  2IZ4 A;  4RVD A;  5D1P A;  2QKD A;  1KQS Z;  1VQ8 1;  5FLX b;  4RS4 A;  1YIT Z;  3CMA Z;  4BY7 I;  3CC7 Z;  2GU2 A;  3FQM A;  3HOY I;  2RT9 A;  1LQL A;  3KIH A;  2WAQ A;  3VTN A;  1Q86 1;  3CXC Z;  1KC8 2;  3IFU A;  4HGZ A;  3I07 A;  4BBS I;  2NVT I;  3GCF A;  3S15 I;  2R93 I;  1M1K 2;  2B63 I;  3J80 f;  2W04 A;  3EED A;  4NFR A;  5IT9 b;  2KI7 B;  3S2H I;  4E30 A;  2OOY B;  2YAD A;  1KD1 2;  1TWF I;  3S17 I;  3CXC Y;  1YJN 1;  4MD8 A;  1VQK 1;  3GTM I;  3G71 1;  1X3W A;  2F4O A;  4E33 A;  1ZB8 A;  2QRC B;  2E2H I;  2QA4 1;  1L1O C;  1Q82 2;  2RBL A;  1VQ8 Z;  4DGL A;  2O4H A;  1USP A;  4BBR I;  3JAM b;  3CCU 1;  4MD9 A;  2R6M A;  3LUS A;  2H85 A;  4HGY A;  4NBG A;  4A3F I;  1QYP A;  1YJ9 1;  1R9T I;  1ML8 A;  4NBF A;  1VQN 1;  1TWG I;  3J81 b;  1YI2 1;  3H0G I;  4E2Z A;  3I56 1;  3PO3 I;  3CC4 1;  2V8J A;  3F3F C;  1M90 2;  3GTG I;  3J7A 4;  1YJN Z;  1VQK Z;  2NVQ I;  1N8R 2;  3G71 Z;  1NUI A;  1K73 1;  1P9N A;  2JS4 A;  1Q7Y 1;  3CQZ I;  2OZK A;  2JA8 I;  1Y1V S;  2QA4 Z;  2RIQ A;  4RVF A;  1JJ2 Z;  1X3Z A;  4DK1 A;  4S1T A;  4NB8 A;  3CME 1;  3GTK I;  3CCU Z;  3S1Q I;  4CL1 A;  2G2K A;  5IP7 I;  2DE5 A;  2J6A A;  1YJ9 Z;  4MH4 A;  2W03 A;  1VQO 1;  1VQN Z;  1JJ2 Y;  4MRI A;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...