1M1K2

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k200
2QA4Z 1VQ61 1Q862 3CD61 1YJ9Z 1Q861 1Q812 3G71Z 1NJI2 1Q811 1VQNZ 1Q7Y2 3CPWZ 3OW2Z 1KQSZ 1NJI1 2OTJZ 3CC7Z 1Q7Y1 1VQ9Z 1YJ91 3I56Z 1VQPZ 3G711 3G6EZ 1YJWZ 1YI21 3I551 2OTJ1 3CC71 1VQ91 3I561 1QVGZ 1VQP1 3CCRZ 3G6E1 1KC82 3CMA1 1W2BZ 3CCUZ 1KC81 3CCEZ 1K9M2 1YHQZ 3CC4Z 3CXCZ 1K9M1 3CCR1 2QA41 1Q822 3CCSZ 1JJ2Z 3CCU1 3CCE1 1Q821 3CCJZ 1YHQ1 3CC41 1VQN1 3CCS1 3OW2Y 3CPWY 1KQSY 3CCJ1 3G4SZ 3CCVZ 1K732 1M1K2 1K731 1YJW1 1M1K1 1YITZ 1VQ4Z 3G4S1 3CCV1 1QVGY 1VQKZ 1S72Z 1QVFZ 1N8R2 1VQOZ 3CMEZ 1W2BY 1N8R1 3CCLZ 1YIT1 1VQ41 3CXCY 2QEXZ 1VQ7Z 2OTLZ 3CCMZ 1S721 3CD6Z 1JJ2Y 3CME1 3CCL1 1M902 2QEX1 1VQ71 1YJNZ 2OTL1 1M901 3CCM1 1VQ8Z 3CCQZ 1VQMZ 1KD12 1YI2Z 1YIJZ 3CC2Z 3I55Z 1YJN1 1KD11 1VQ5Z 1VQ81 3CCQ1 1VQLZ 1VQM1 1VQ6Z 1YIJ1 3CMAZ 3CC21 1QVFY 1VQK1 1K8A2 1VQ51 1VQL1 1VQO1 1K8A1
chains in the Genus database with same CATH superfamily
1VQ61 1Q862 1Q861 1NP6A 2M6NA 3CQZI 4NBCA 1TWCI 1Q7Y2 1KQSZ 1SIWA 4A93I 1ML8A 1Q7Y1 3J80f 1VQ9Z 1YJ91 4A3CI 1VQPZ 2P3YA 5T67A 2IZ4A 3S2DI 3VMHA 5C3EI 2DE7A 3GTGI 3J80b 2DE6A 2V8JA 3CC71 1R9TI 2RPRA 3IFUA 3I4MI 3CCRZ 3VTNA 3CCUZ 1S7MA 1QYPA 2K5RA 2OOXB 1K9M2 3CC4Z 3HOWI 4RV9A 5FLMI 1K9M1 3CCSZ 2E2HI 5T6BA 1PFTA 3I07A 2IZ3A 1KRLA 4NOZA 2JA5I 4QTUA 1KQSY 3D9XA 4A3DI 2NAPA 1WIIA 1K732 2VPWA 1K731 4DQYB 2DE5A 1YITZ 2QRDB 1TFIA 3CCV1 4RVGA 1P9NA 2Y0SA 3Q87A 1QVFZ 5CM2M 3IF8A 4RVHA 1VQOZ 1YUKA 1Q16A 4DGLA 1VQ41 2JNYA 2RBLA 2OTLZ 4RVFA 3CCMZ 5FLXf 1RO0A 1S721 3VMIA 1Y1VS 2JMOA 3H3VJ 2LFUA 3CCL1 4MH4A 2E7ZA 5FLXb 2QEX1 2JIPA 2QLVB 1QXFA 2V45A 3K7AI 3F3PC 3TDHB 3S17I 2QKDA 3JAMf 1YIJZ 1I3QI 2HU9A 3MONA 1VQ81 3QWUA 3NDJA 3JAMb 2J6AA 1VQM1 1Y1VI 4E2XA 1VQ6Z 3S1MI 2NVQI 3FQMA 3CMAZ 2WB1A 1QVFY 1K8A2 1VQ51 3GTMS 1X0TA 1VQO1 1K8A1 2QA4Z 2Q4ZA 4NBBA 2PMZA 1AA6A 1YJ9Z 1Q812 4A3JI 1YUAA 1NJI2 1Q811 1N2FA 4NBFA 1ZH1A 3CPWZ 1NJI1 3CC7Z 3GTMI 3MZLB 2JIRA 3G711 2LEXA 1L1OC 3KIFA 3GTPI 3I561 4NBGA 1QVGZ 3G6E1 3HOUI 3FQQA 4QTTA 1TWAI 3CMA1 1W2BZ 2ZAEB 3S15I 5T64A 2QA41 1JJ2Z 2NVTI 2KPIA 3S2HI 2W04A 3CCE1 1YHQ1 3HKZA 2GTHA 2OZKA 5IP9I 4AYBA 3HOYI 3CPWY 1FDOA 3P5JB 2RT9A 2R92I 3CCVZ 3PO2I 5IP7I 3RZDI 1M1K2 2WAQA 3S1RI 3IR7A 2PM9A 2YADA 1M1K1 1VQ4Z 4NBHA 4RS4A 1SFOI 4HGYA 1QVGY 3NH8A 1S72Z 3BG1B 3LUSA 1N8R2 4E31A 2LIYA 3GTOI 2QRCB 1W2BY 2YU9I 3M4OI 5AN9F 4Y7NI 1N8R1 2JR6A 3CCLZ 2QEXZ 3CD6Z 1JJ2Y 3CME1 2JA6I 1ZB8A 4TNUA 1VQ71 3NDIA 3GTKI 1VQ8Z 4RVDA 1VLAA 1TWFI 2GU2A 3NH4A 1VQMZ 1YI2Z 2JIOA 3RZOI 3I55Z 1YJN1 2KI7B 4S1TA 3EERA 1VQ5Z 2RIQA 2O53A 2P28A 4MD8A 3HOZI 1NUIA 4NB8A 3TE5B 3KIHA 4HGZA 2W03A 4E30A 4X6AI 4A3II 1TWHI 2VPZA 2QREB 1RO2A 1Z01A 3CD61 4A3LI 2E9HA 1FDIA 2M48A 3G71Z 4E2WA 1Z03A 1JWHC 2G2KA 2O4HA 2VUGA 1RNIA 3I56Z 3BG0B 3IX0A 3G6EZ 1YI21 3I551 2OTJ1 2R93I 3PO3S 3VB9A 2VPXA 4MD7A 2RHBA 3CCEZ 3S14I 5C4JI 1YHQZ 3NFZA 5D1OB 3HOXI 3J7A4 1RQFA 5A2Qf 1I50I 2VUMI 5C44I 3F3FC 4MXUA 3PO3I 5A2Qb 1Z02A 2PK7A 3CCJ1 4A3KI 2NVXI 3ESWA 3I4NI 4HH4A 2F4OA 4A3MI 2V3VA 2OOYB 3G4S1 3M3YI 1VQKZ 1Y8CA 3GTJI 3CMEZ 4BBRI 3J81f 2B63I 1VQ7Z 3J81b 2VPYA 4A3FI 1M902 2R7ZI 1USPB 1YJNZ 1M901 2JA7I 2Q51A 4NFRA 1RLYA 1ZB9A 1KD12 4BXXI 1I6HI 2AKLA 1KD11 4NBDA 3CCQ1 1LQLA 1K83I 2V8IA 3CC21 1VQK1 2VF1A 1VQL1 4BY1I 4CL1A 2JS4A 1Y1WI 4MD9A 2BJOA 2JA8I 4NBEA 2IV2X 1DL6A 1VQNZ 4XX2A 3OW2Z 3NH5A 2OTJZ 4E2ZA 2E2II 2JIMA 3H0GI 1YJWZ 1TWGI 2R6MA 1VQ91 2NVYI 3GCFA 1VQP1 1KC82 1KC81 4NBAA 3CXCZ 3CCR1 3D6WA 1Q822 4MONA 3CCU1 1Q821 3HOVI 3CCJZ 3CC41 1X3WA 5IT9f 2JIQA 3EEDA 2HF1A 3S1NI 1VQN1 3CCS1 3OW2Y 5C4XI 4A3BI 5IT9b 3G4SZ 2JUBA 4NB9A 2EGTA 1YJW1 5D1OA 3VMGA 2K3RA 1QF8A 1RO4A 3GKQA 3FKII 2I3CA 4DK1A 4BBSI 4E33A 1YIT1 4Y52I 3CXCY 4EWCA 3S1QI 4BY7I 3MZKB 3D2LA 2V8KA 4NH1C 2E2JI 4A3EI 5D1PA 1WW9A 2OTL1 3GTQI 3CCM1 1WCMI 2QR1B 3CCQZ 2F4MA 2H85A 3T4NB 4E2YA 3GTLI 4A3GI 1WJ2A 3CC2Z 4E32A 5LL6f 1VQLZ 1X3ZA 1WZNA 4MRIA 1YIJ1 2GTIA 3U50C 1USPA 2AYDA 3S16I
chains in the Genus database with same CATH topology
1VQ61 1Q862 1Q861 1NP6A 2M6NA 3CQZI 4NBCA 1TWCI 1Q7Y2 1KQSZ 4A93I 1ML8A 1Q7Y1 3J80f 1VQ9Z 1YJ91 4A3CI 1VQPZ 2P3YA 5T67A 2IZ4A 3S2DI 3VMHA 5C3EI 2DE7A 3GTGI 3J80b 2DE6A 2V8JA 3CC71 1R9TI 2RPRA 3IFUA 3I4MI 3CCRZ 3VTNA 3CCUZ 1S7MA 1QYPA 2K5RA 2OOXB 1K9M2 3CC4Z 3HOWI 4RV9A 5FLMI 1K9M1 3CCSZ 2E2HI 5T6BA 1PFTA 3I07A 2IZ3A 1KRLA 4NOZA 2JA5I 4QTUA 1KQSY 3D9XA 4A3DI 1WIIA 1K732 1K731 4DQYB 2DE5A 1YITZ 2QRDB 1TFIA 3CCV1 4RVGA 1P9NA 2Y0SA 3Q87A 1QVFZ 5CM2M 3IF8A 4RVHA 1VQOZ 1YUKA 4DGLA 1VQ41 2JNYA 2RBLA 2OTLZ 4RVFA 3CCMZ 5FLXf 1RO0A 1S721 3VMIA 1Y1VS 2JMOA 3H3VJ 2LFUA 3CCL1 4MH4A 5FLXb 2QEX1 2QLVB 3TDHB 3K7AI 3F3PC 3S17I 2QKDA 3JAMf 1YIJZ 1I3QI 2HU9A 3MONA 1VQ81 3QWUA 3NDJA 3JAMb 2J6AA 1VQM1 1Y1VI 4E2XA 1VQ6Z 3S1MI 2NVQI 3FQMA 3CMAZ 2WB1A 1QVFY 1K8A2 1VQ51 3GTMS 1X0TA 1VQO1 1K8A1 2QA4Z 2Q4ZA 4NBBA 2PMZA 1YJ9Z 1Q812 4A3JI 1YUAA 1NJI2 1Q811 1N2FA 4NBFA 1ZH1A 3CPWZ 1NJI1 3CC7Z 3GTMI 3MZLB 3G711 1L1OC 3KIFA 3GTPI 3I561 4NBGA 1QVGZ 3G6E1 3HOUI 3FQQA 4QTTA 1TWAI 3CMA1 1W2BZ 2ZAEB 3S15I 5T64A 2QA41 1JJ2Z 2NVTI 2KPIA 3S2HI 2W04A 3CCE1 1YHQ1 3HKZA 2GTHA 2OZKA 5IP9I 4AYBA 3HOYI 3CPWY 3P5JB 2RT9A 2R92I 3CCVZ 3PO2I 5IP7I 3RZDI 1M1K2 2WAQA 3S1RI 2PM9A 2YADA 1M1K1 1VQ4Z 4NBHA 4RS4A 1SFOI 4HGYA 1QVGY 3NH8A 1S72Z 3BG1B 3LUSA 1N8R2 4E31A 2LIYA 3GTOI 2QRCB 1W2BY 2YU9I 3M4OI 5AN9F 4Y7NI 1N8R1 2JR6A 3CCLZ 2QEXZ 3CD6Z 1JJ2Y 3CME1 2JA6I 1ZB8A 4TNUA 1VQ71 3NDIA 3GTKI 1VQ8Z 4RVDA 1VLAA 1TWFI 2GU2A 3NH4A 1VQMZ 1YI2Z 3RZOI 3I55Z 1YJN1 2KI7B 4S1TA 3EERA 1VQ5Z 2RIQA 2O53A 2P28A 4MD8A 3HOZI 1NUIA 4NB8A 3TE5B 3KIHA 4HGZA 2W03A 4E30A 4X6AI 4A3II 1TWHI 2QREB 1RO2A 1Z01A 3CD61 4A3LI 2E9HA 2M48A 3G71Z 4E2WA 1Z03A 1JWHC 2G2KA 2O4HA 2VUGA 1RNIA 3I56Z 3BG0B 3IX0A 3G6EZ 1YI21 3I551 2OTJ1 2R93I 3PO3S 3VB9A 4MD7A 2RHBA 3CCEZ 3S14I 5C4JI 1YHQZ 3NFZA 5D1OB 3HOXI 3J7A4 1RQFA 5A2Qf 1I50I 2VUMI 5C44I 3F3FC 4MXUA 3PO3I 5A2Qb 1Z02A 2PK7A 3CCJ1 4A3KI 2NVXI 3ESWA 3I4NI 4HH4A 2F4OA 4A3MI 2OOYB 3G4S1 3M3YI 1VQKZ 3GTJI 3CMEZ 4BBRI 3J81f 2B63I 1VQ7Z 3J81b 4A3FI 1M902 2R7ZI 1USPB 1YJNZ 1M901 2JA7I 2Q51A 4NFRA 1RLYA 1ZB9A 1KD12 4BXXI 1I6HI 2AKLA 1KD11 4NBDA 3CCQ1 1LQLA 1K83I 2V8IA 3CC21 1VQK1 2VF1A 1VQL1 4BY1I 4CL1A 2JS4A 1Y1WI 4MD9A 2BJOA 2JA8I 4NBEA 1DL6A 1VQNZ 4XX2A 3OW2Z 3NH5A 2OTJZ 4E2ZA 2E2II 1YJWZ 3H0GI 1TWGI 2R6MA 1VQ91 2NVYI 3GCFA 1VQP1 1KC82 1KC81 4NBAA 3CXCZ 3CCR1 3D6WA 1Q822 4MONA 3CCU1 1Q821 3HOVI 3CCJZ 3CC41 1X3WA 5IT9f 3EEDA 2HF1A 3S1NI 1VQN1 3CCS1 3OW2Y 5C4XI 4A3BI 5IT9b 3G4SZ 2JUBA 4NB9A 2EGTA 1YJW1 5D1OA 3VMGA 2K3RA 1QF8A 1RO4A 3GKQA 3FKII 2I3CA 4DK1A 4BBSI 4E33A 1YIT1 4Y52I 3CXCY 4EWCA 3S1QI 4BY7I 3MZKB 2V8KA 4NH1C 2E2JI 4A3EI 5D1PA 1WW9A 2OTL1 3GTQI 1WCMI 2QR1B 3CCM1 3CCQZ 2F4MA 2H85A 3T4NB 4E2YA 3GTLI 4A3GI 3CC2Z 4E32A 5LL6f 1VQLZ 1X3ZA 4MRIA 1YIJ1 2GTIA 3U50C 1USPA 3S16I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1VQ6 1;  1Q86 2;  3CD6 1;  1YJ9 Z;  1Q86 1;  1Q81 2;  3G71 Z;  1NJI 2;  1Q81 1;  1VQN Z;  1Q7Y 2;  3CPW Z;  3OW2 Z;  1KQS Z;  1NJI 1;  2OTJ Z;  3CC7 Z;  1Q7Y 1;  1VQ9 Z;  1YJ9 1;  3I56 Z;  1VQP Z;  3G71 1;  3G6E Z;  1YJW Z;  1YI2 1;  3I55 1;  2OTJ 1;  3CC7 1;  1VQ9 1;  3I56 1;  1QVG Z;  1VQP 1;  3CCR Z;  3G6E 1;  1KC8 2;  3CMA 1;  1W2B Z;  3CCU Z;  1KC8 1;  3CCE Z;  1K9M 2;  1YHQ Z;  3CC4 Z;  3CXC Z;  1K9M 1;  3CCR 1;  2QA4 1;  1Q82 2;  3CCS Z;  1JJ2 Z;  3CCU 1;  3CCE 1;  1Q82 1;  3CCJ Z;  1YHQ 1;  3CC4 1;  1VQN 1;  3CCS 1;  3OW2 Y;  3CPW Y;  1KQS Y;  3CCJ 1;  3G4S Z;  3CCV Z;  1K73 2;  1M1K 2;  1K73 1;  1YJW 1;  1M1K 1;  1YIT Z;  1VQ4 Z;  3G4S 1;  3CCV 1;  1QVG Y;  1VQK Z;  1S72 Z;  1QVF Z;  1N8R 2;  1VQO Z;  3CME Z;  1W2B Y;  1N8R 1;  3CCL Z;  1YIT 1;  1VQ4 1;  3CXC Y;  2QEX Z;  1VQ7 Z;  2OTL Z;  3CCM Z;  1S72 1;  3CD6 Z;  1JJ2 Y;  3CME 1;  3CCL 1;  1M90 2;  2QEX 1;  1VQ7 1;  1YJN Z;  2OTL 1;  1M90 1;  3CCM 1;  1VQ8 Z;  3CCQ Z;  1VQM Z;  1KD1 2;  1YI2 Z;  1YIJ Z;  3CC2 Z;  3I55 Z;  1YJN 1;  1KD1 1;  1VQ5 Z;  1VQ8 1;  3CCQ 1;  1VQL Z;  1VQM 1;  1VQ6 Z;  1YIJ 1;  3CMA Z;  3CC2 1;  1QVF Y;  1VQK 1;  1K8A 2;  1VQ5 1;  1VQL 1;  1VQO 1;  1K8A 1; 
#chains in the Genus database with same CATH topology
 1VQ6 1;  1Q86 2;  1Q86 1;  1NP6 A;  2M6N A;  3CQZ I;  4NBC A;  1TWC I;  1Q7Y 2;  1KQS Z;  1SIW A;  4A93 I;  1ML8 A;  1Q7Y 1;  3J80 f;  1VQ9 Z;  1YJ9 1;  4A3C I;  1VQP Z;  2P3Y A;  5T67 A;  2IZ4 A;  3S2D I;  3VMH A;  5C3E I;  2DE7 A;  3GTG I;  3J80 b;  2DE6 A;  2V8J A;  3CC7 1;  1R9T I;  2RPR A;  3IFU A;  3I4M I;  3CCR Z;  3VTN A;  3CCU Z;  1S7M A;  1QYP A;  2K5R A;  2OOX B;  1K9M 2;  3CC4 Z;  3HOW I;  4RV9 A;  5FLM I;  1K9M 1;  3CCS Z;  2E2H I;  5T6B A;  1PFT A;  3I07 A;  2IZ3 A;  1KRL A;  4NOZ A;  2JA5 I;  4QTU A;  1KQS Y;  3D9X A;  4A3D I;  2NAP A;  1WII A;  1K73 2;  2VPW A;  1K73 1;  4DQY B;  2DE5 A;  1YIT Z;  2QRD B;  1TFI A;  3CCV 1;  4RVG A;  1P9N A;  2Y0S A;  3Q87 A;  1QVF Z;  5CM2 M;  3IF8 A;  4RVH A;  1VQO Z;  1YUK A;  1Q16 A;  4DGL A;  1VQ4 1;  2JNY A;  2RBL A;  2OTL Z;  4RVF A;  3CCM Z;  5FLX f;  1RO0 A;  1S72 1;  3VMI A;  1Y1V S;  2JMO A;  3H3V J;  2LFU A;  3CCL 1;  4MH4 A;  2E7Z A;  5FLX b;  2QEX 1;  2JIP A;  2QLV B;  1QXF A;  2V45 A;  3K7A I;  3F3P C;  3TDH B;  3S17 I;  2QKD A;  3JAM f;  1YIJ Z;  1I3Q I;  2HU9 A;  3MON A;  1VQ8 1;  3QWU A;  3NDJ A;  3JAM b;  2J6A A;  1VQM 1;  1Y1V I;  4E2X A;  1VQ6 Z;  3S1M I;  2NVQ I;  3FQM A;  3CMA Z;  2WB1 A;  1QVF Y;  1K8A 2;  1VQ5 1;  3GTM S;  1X0T A;  1VQO 1;  1K8A 1;  2QA4 Z;  2Q4Z A;  4NBB A;  2PMZ A;  1AA6 A;  1YJ9 Z;  1Q81 2;  4A3J I;  1YUA A;  1NJI 2;  1Q81 1;  1N2F A;  4NBF A;  1ZH1 A;  3CPW Z;  1NJI 1;  3CC7 Z;  3GTM I;  3MZL B;  2JIR A;  3G71 1;  2LEX A;  1L1O C;  3KIF A;  3GTP I;  3I56 1;  4NBG A;  1QVG Z;  3G6E 1;  3HOU I;  3FQQ A;  4QTT A;  1TWA I;  3CMA 1;  1W2B Z;  2ZAE B;  3S15 I;  5T64 A;  2QA4 1;  1JJ2 Z;  2NVT I;  2KPI A;  3S2H I;  2W04 A;  3CCE 1;  1YHQ 1;  3HKZ A;  2GTH A;  2OZK A;  5IP9 I;  4AYB A;  3HOY I;  3CPW Y;  1FDO A;  3P5J B;  2RT9 A;  2R92 I;  3CCV Z;  3PO2 I;  5IP7 I;  3RZD I;  1M1K 2;  2WAQ A;  3S1R I;  3IR7 A;  2PM9 A;  2YAD A;  1M1K 1;  1VQ4 Z;  4NBH A;  4RS4 A;  1SFO I;  4HGY A;  1QVG Y;  3NH8 A;  1S72 Z;  3BG1 B;  3LUS A;  1N8R 2;  4E31 A;  2LIY A;  3GTO I;  2QRC B;  1W2B Y;  2YU9 I;  3M4O I;  5AN9 F;  4Y7N I;  1N8R 1;  2JR6 A;  3CCL Z;  2QEX Z;  3CD6 Z;  1JJ2 Y;  3CME 1;  2JA6 I;  1ZB8 A;  4TNU A;  1VQ7 1;  3NDI A;  3GTK I;  1VQ8 Z;  4RVD A;  1VLA A;  1TWF I;  2GU2 A;  3NH4 A;  1VQM Z;  1YI2 Z;  2JIO A;  3RZO I;  3I55 Z;  1YJN 1;  2KI7 B;  4S1T A;  3EER A;  1VQ5 Z;  2RIQ A;  2O53 A;  2P28 A;  4MD8 A;  3HOZ I;  1NUI A;  4NB8 A;  3TE5 B;  3KIH A;  4HGZ A;  2W03 A;  4E30 A;  4X6A I;  4A3I I;  1TWH I;  2VPZ A;  2QRE B;  1RO2 A;  1Z01 A;  3CD6 1;  4A3L I;  2E9H A;  1FDI A;  2M48 A;  3G71 Z;  4E2W A;  1Z03 A;  1JWH C;  2G2K A;  2O4H A;  2VUG A;  1RNI A;  3I56 Z;  3BG0 B;  3IX0 A;  3G6E Z;  1YI2 1;  3I55 1;  2OTJ 1;  2R93 I;  3PO3 S;  3VB9 A;  2VPX A;  4MD7 A;  2RHB A;  3CCE Z;  3S14 I;  5C4J I;  1YHQ Z;  3NFZ A;  5D1O B;  3HOX I;  3J7A 4;  1RQF A;  5A2Q f;  1I50 I;  2VUM I;  5C44 I;  3F3F C;  4MXU A;  3PO3 I;  5A2Q b;  1Z02 A;  2PK7 A;  3CCJ 1;  4A3K I;  2NVX I;  3ESW A;  3I4N I;  4HH4 A;  2F4O A;  4A3M I;  2V3V A;  2OOY B;  3G4S 1;  3M3Y I;  1VQK Z;  1Y8C A;  3GTJ I;  3CME Z;  4BBR I;  3J81 f;  2B63 I;  1VQ7 Z;  3J81 b;  2VPY A;  4A3F I;  1M90 2;  2R7Z I;  1USP B;  1YJN Z;  1M90 1;  2JA7 I;  2Q51 A;  4NFR A;  1RLY A;  1ZB9 A;  1KD1 2;  4BXX I;  1I6H I;  2AKL A;  1KD1 1;  4NBD A;  3CCQ 1;  1LQL A;  1K83 I;  2V8I A;  3CC2 1;  1VQK 1;  2VF1 A;  1VQL 1;  4BY1 I;  4CL1 A;  2JS4 A;  1Y1W I;  4MD9 A;  2BJO A;  2JA8 I;  4NBE A;  2IV2 X;  1DL6 A;  1VQN Z;  4XX2 A;  3OW2 Z;  3NH5 A;  2OTJ Z;  4E2Z A;  2E2I I;  2JIM A;  3H0G I;  1YJW Z;  1TWG I;  2R6M A;  1VQ9 1;  2NVY I;  3GCF A;  1VQP 1;  1KC8 2;  1KC8 1;  4NBA A;  3CXC Z;  3CCR 1;  3D6W A;  1Q82 2;  4MON A;  3CCU 1;  1Q82 1;  3HOV I;  3CCJ Z;  3CC4 1;  1X3W A;  5IT9 f;  2JIQ A;  3EED A;  2HF1 A;  3S1N I;  1VQN 1;  3CCS 1;  3OW2 Y;  5C4X I;  4A3B I;  5IT9 b;  3G4S Z;  2JUB A;  4NB9 A;  2EGT A;  1YJW 1;  5D1O A;  3VMG A;  2K3R A;  1QF8 A;  1RO4 A;  3GKQ A;  3FKI I;  2I3C A;  4DK1 A;  4BBS I;  4E33 A;  1YIT 1;  4Y52 I;  3CXC Y;  4EWC A;  3S1Q I;  4BY7 I;  3MZK B;  3D2L A;  2V8K A;  4NH1 C;  2E2J I;  4A3E I;  5D1P A;  1WW9 A;  2OTL 1;  3GTQ I;  3CCM 1;  1WCM I;  2QR1 B;  3CCQ Z;  2F4M A;  2H85 A;  3T4N B;  4E2Y A;  3GTL I;  4A3G I;  1WJ2 A;  3CC2 Z;  4E32 A;  5LL6 f;  1VQL Z;  1X3Z A;  1WZN A;  4MRI A;  1YIJ 1;  2GTI A;  3U50 C;  1USP A;  2AYD A;  3S16 I; 
#chains in the Genus database with same CATH homology
 1VQ6 1;  1Q86 2;  1Q86 1;  1NP6 A;  2M6N A;  3CQZ I;  4NBC A;  1TWC I;  1Q7Y 2;  1KQS Z;  4A93 I;  1ML8 A;  1Q7Y 1;  3J80 f;  1VQ9 Z;  1YJ9 1;  4A3C I;  1VQP Z;  2P3Y A;  5T67 A;  2IZ4 A;  3S2D I;  3VMH A;  5C3E I;  2DE7 A;  3GTG I;  3J80 b;  2DE6 A;  2V8J A;  3CC7 1;  1R9T I;  2RPR A;  3IFU A;  3I4M I;  3CCR Z;  3VTN A;  3CCU Z;  1S7M A;  1QYP A;  2K5R A;  2OOX B;  1K9M 2;  3CC4 Z;  3HOW I;  4RV9 A;  5FLM I;  1K9M 1;  3CCS Z;  2E2H I;  5T6B A;  1PFT A;  3I07 A;  2IZ3 A;  1KRL A;  4NOZ A;  2JA5 I;  4QTU A;  1KQS Y;  3D9X A;  4A3D I;  1WII A;  1K73 2;  1K73 1;  4DQY B;  2DE5 A;  1YIT Z;  2QRD B;  1TFI A;  3CCV 1;  4RVG A;  1P9N A;  2Y0S A;  3Q87 A;  1QVF Z;  5CM2 M;  3IF8 A;  4RVH A;  1VQO Z;  1YUK A;  4DGL A;  1VQ4 1;  2JNY A;  2RBL A;  2OTL Z;  4RVF A;  3CCM Z;  5FLX f;  1RO0 A;  1S72 1;  3VMI A;  1Y1V S;  2JMO A;  3H3V J;  2LFU A;  3CCL 1;  4MH4 A;  5FLX b;  2QEX 1;  2QLV B;  3TDH B;  3K7A I;  3F3P C;  3S17 I;  2QKD A;  3JAM f;  1YIJ Z;  1I3Q I;  2HU9 A;  3MON A;  1VQ8 1;  3QWU A;  3NDJ A;  3JAM b;  2J6A A;  1VQM 1;  1Y1V I;  4E2X A;  1VQ6 Z;  3S1M I;  2NVQ I;  3FQM A;  3CMA Z;  2WB1 A;  1QVF Y;  1K8A 2;  1VQ5 1;  3GTM S;  1X0T A;  1VQO 1;  1K8A 1;  2QA4 Z;  2Q4Z A;  4NBB A;  2PMZ A;  1YJ9 Z;  1Q81 2;  4A3J I;  1YUA A;  1NJI 2;  1Q81 1;  1N2F A;  4NBF A;  1ZH1 A;  3CPW Z;  1NJI 1;  3CC7 Z;  3GTM I;  3MZL B;  3G71 1;  1L1O C;  3KIF A;  3GTP I;  3I56 1;  4NBG A;  1QVG Z;  3G6E 1;  3HOU I;  3FQQ A;  4QTT A;  1TWA I;  3CMA 1;  1W2B Z;  2ZAE B;  3S15 I;  5T64 A;  2QA4 1;  1JJ2 Z;  2NVT I;  2KPI A;  3S2H I;  2W04 A;  3CCE 1;  1YHQ 1;  3HKZ A;  2GTH A;  2OZK A;  5IP9 I;  4AYB A;  3HOY I;  3CPW Y;  3P5J B;  2RT9 A;  2R92 I;  3CCV Z;  3PO2 I;  5IP7 I;  3RZD I;  1M1K 2;  2WAQ A;  3S1R I;  2PM9 A;  2YAD A;  1M1K 1;  1VQ4 Z;  4NBH A;  4RS4 A;  1SFO I;  4HGY A;  1QVG Y;  3NH8 A;  1S72 Z;  3BG1 B;  3LUS A;  1N8R 2;  4E31 A;  2LIY A;  3GTO I;  2QRC B;  1W2B Y;  2YU9 I;  3M4O I;  5AN9 F;  4Y7N I;  1N8R 1;  2JR6 A;  3CCL Z;  2QEX Z;  3CD6 Z;  1JJ2 Y;  3CME 1;  2JA6 I;  1ZB8 A;  4TNU A;  1VQ7 1;  3NDI A;  3GTK I;  1VQ8 Z;  4RVD A;  1VLA A;  1TWF I;  2GU2 A;  3NH4 A;  1VQM Z;  1YI2 Z;  3RZO I;  3I55 Z;  1YJN 1;  2KI7 B;  4S1T A;  3EER A;  1VQ5 Z;  2RIQ A;  2O53 A;  2P28 A;  4MD8 A;  3HOZ I;  1NUI A;  4NB8 A;  3TE5 B;  3KIH A;  4HGZ A;  2W03 A;  4E30 A;  4X6A I;  4A3I I;  1TWH I;  2QRE B;  1RO2 A;  1Z01 A;  3CD6 1;  4A3L I;  2E9H A;  2M48 A;  3G71 Z;  4E2W A;  1Z03 A;  1JWH C;  2G2K A;  2O4H A;  2VUG A;  1RNI A;  3I56 Z;  3BG0 B;  3IX0 A;  3G6E Z;  1YI2 1;  3I55 1;  2OTJ 1;  2R93 I;  3PO3 S;  3VB9 A;  4MD7 A;  2RHB A;  3CCE Z;  3S14 I;  5C4J I;  1YHQ Z;  3NFZ A;  5D1O B;  3HOX I;  3J7A 4;  1RQF A;  5A2Q f;  1I50 I;  2VUM I;  5C44 I;  3F3F C;  4MXU A;  3PO3 I;  5A2Q b;  1Z02 A;  2PK7 A;  3CCJ 1;  4A3K I;  2NVX I;  3ESW A;  3I4N I;  4HH4 A;  2F4O A;  4A3M I;  2OOY B;  3G4S 1;  3M3Y I;  1VQK Z;  3GTJ I;  3CME Z;  4BBR I;  3J81 f;  2B63 I;  1VQ7 Z;  3J81 b;  4A3F I;  1M90 2;  2R7Z I;  1USP B;  1YJN Z;  1M90 1;  2JA7 I;  2Q51 A;  4NFR A;  1RLY A;  1ZB9 A;  1KD1 2;  4BXX I;  1I6H I;  2AKL A;  1KD1 1;  4NBD A;  3CCQ 1;  1LQL A;  1K83 I;  2V8I A;  3CC2 1;  1VQK 1;  2VF1 A;  1VQL 1;  4BY1 I;  4CL1 A;  2JS4 A;  1Y1W I;  4MD9 A;  2BJO A;  2JA8 I;  4NBE A;  1DL6 A;  1VQN Z;  4XX2 A;  3OW2 Z;  3NH5 A;  2OTJ Z;  4E2Z A;  2E2I I;  1YJW Z;  3H0G I;  1TWG I;  2R6M A;  1VQ9 1;  2NVY I;  3GCF A;  1VQP 1;  1KC8 2;  1KC8 1;  4NBA A;  3CXC Z;  3CCR 1;  3D6W A;  1Q82 2;  4MON A;  3CCU 1;  1Q82 1;  3HOV I;  3CCJ Z;  3CC4 1;  1X3W A;  5IT9 f;  3EED A;  2HF1 A;  3S1N I;  1VQN 1;  3CCS 1;  3OW2 Y;  5C4X I;  4A3B I;  5IT9 b;  3G4S Z;  2JUB A;  4NB9 A;  2EGT A;  1YJW 1;  5D1O A;  3VMG A;  2K3R A;  1QF8 A;  1RO4 A;  3GKQ A;  3FKI I;  2I3C A;  4DK1 A;  4BBS I;  4E33 A;  1YIT 1;  4Y52 I;  3CXC Y;  4EWC A;  3S1Q I;  4BY7 I;  3MZK B;  2V8K A;  4NH1 C;  2E2J I;  4A3E I;  5D1P A;  1WW9 A;  2OTL 1;  3GTQ I;  1WCM I;  2QR1 B;  3CCM 1;  3CCQ Z;  2F4M A;  2H85 A;  3T4N B;  4E2Y A;  3GTL I;  4A3G I;  3CC2 Z;  4E32 A;  5LL6 f;  1VQL Z;  1X3Z A;  4MRI A;  1YIJ 1;  2GTI A;  3U50 C;  1USP A;  3S16 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...