1M1K2

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k200
1KQSZ 3CCE1 3CCEZ 3G4SZ 1KC81 3CME1 3CMEZ 1YHQ1 1YHQZ 3CC2Z 1M902 1VQN1 1QVGY 1VQNZ 1VQO1 1JJ2Z 3G711 1VQOZ 3G71Z 1VQ41 1QVFY 1YJW1 1YIJ1 1VQ61 1VQ4Z 1VQ6Z 1YJWZ 1YIJZ 3CCM1 1VQKZ 3CCMZ 1N8R2 1NJI1 3CPWY 3G4S1 1VQL1 1VQLZ 3CMA1 3CD61 2OTL1 3CMAZ 3CD6Z 2OTLZ 1K731 1Q861 1KC82 1YJ91 1YJ9Z 3CC21 2OTJ1 3CPWZ 1W2BY 2OTJZ 3CC71 3CCR1 3CC7Z 1S721 3CCRZ 1S72Z 1K9M1 1VQK1 3I561 1W2BZ 1Q811 3I56Z 1VQ81 1VQ8Z 1VQM1 3OW2Y 1VQMZ 1QVGZ 2QA41 3CCV1 2QA4Z 3CCVZ 1QVFZ 1NJI2 1VQP1 1VQPZ 1YIT1 1YITZ 3CXCY 3CCJ1 3CCJZ 1Q7Y1 1K732 1KD11 1M1K1 1Q862 1YJN1 1KD12 1YJNZ 3CCQ1 3CXCZ 3CCQZ 1K8A1 1VQ51 1VQ5Z 3G6E1 3CCS1 3CCSZ 3G6EZ 1K9M2 1K8A2 1M901 1JJ2Y 1Q812 1VQ71 3CCL1 1VQ7Z 3CCLZ 1YI21 1YI2Z 3CCU1 3I551 3CCUZ 3I55Z 3OW2Z 1KQSY 1Q821 1VQ91 1N8R1 1VQ9Z 1Q7Y2 2QEX1 1M1K2 2QEXZ 3CC41 1Q822 3CC4Z
chains in the Genus database with same CATH superfamily
4HGYA 1ML8A 4RVDA 2RPRA 3PO3I 3S1NI 3LUSA 1Y1VS 2PM9A 1Z03A 4NBEA 1VQO1 1JJ2Z 3G711 1VQ61 1YJW1 1YIJ1 1VQ4Z 1TWGI 2KPIA 2V3VA 3VB9A 4NBDA 2V8JA 1LQLA 2E2JI 3KIHA 4BY1I 4E2WA 2VPYA 2JIPA 3CPWY 1VQLZ 3CMA1 3I07A 3J80f 3CD6Z 3J7A4 2OTLZ 2VUGA 1Q861 1TWCI 1YJ9Z 3GTOI 4EWCA 3F3PC 2Y0SA 2JA8I 2JIOA 5FLXb 1S72Z 5FLMI 1K9M1 3NDIA 2QRCB 1Q811 1VQ8Z 1DL6A 3QWUA 1QVGZ 4BY7I 2I3CA 2JR6A 1QVFZ 1NUIA 1VQP1 2RHBA 1YIT1 2K3RA 4E2XA 3CCJZ 2G2KA 3CCQ1 3CXCZ 4MONA 1K8A1 3G6E1 3CCS1 2NVXI 2F4OA 4MD8A 2NVQI 3IR7A 2NAPA 2ZAEB 2O4HA 1K8A2 4DK1A 2OZKA 1M901 1WJ2A 3ESWA 3I4MI 4A3MI 2NVYI 3K7AI 4E2YA 3I551 3CCUZ 3P5JB 2QREB 5T64A 1I3QI 1VQ9Z 2DE5A 3VTNA 3CC41 3NFZA 2JUBA 4NB8A 1Y1VI 1AA6A 3S16I 4XX2A 2IZ4A 4DGLA 3G4SZ 2VPXA 1KC81 4QTUA 1Z02A 3VMGA 1QXFA 1YHQ1 3VMHA 3CC2Z 4A3LI 2JA7I 1R9TI 2WAQA 3F3FC 4Y7NI 3NH4A 1VQOZ 3G71Z 1VQ6Z 1YJWZ 1YIJZ 4Y52I 3CCM1 1X0TA 1VQKZ 2E2II 1N8R2 1NJI1 2GTIA 3HKZA 3G4S1 3CMAZ 2JA6I 5C3EI 5FLXf 1WZNA 2RBLA 4E32A 2W03A 3CC21 3GTQI 3CPWZ 4A3II 1W2BY 3GTKI 1QF8A 3CC71 3CCR1 1RO0A 4MD9A 5D1OB 2M48A 1N2FA 1KRLA 2P3YA 2W04A 4MH4A 1VQK1 3J81f 2NVTI 1FDOA 1VQM1 3OW2Y 1P9NA 2Q51A 3CCV1 1I6HI 4A3BI 3HOVI 1YUAA 3JAMf 1VQPZ 4BBRI 1YITZ 4TNUA 3T4NB 1Q7Y1 1M1K1 3S14I 4CL1A 1Q862 3KIFA 3GTGI 2QR1B 3FKII 3CCQZ 4NBGA 4HH4A 4E31A 3G6EZ 3CCSZ 1K9M2 2F4MA 2KI7B 2OOYB 2VPWA 5LL6f 2AYDA 1JJ2Y 4NFRA 1Q812 3CCL1 2WB1A 3FQQA 1WIIA 3J81b 4NBAA 3I55Z 2VF1A 3TDHB 1RNIA 1TFIA 2JA5I 4E30A 1KQSY 1RLYA 3H0GI 3JAMb 2O53A 2H85A 5D1PA 1RO4A 3CC4Z 1RO2A 3S1MI 1TWHI 4A3KI 3M4OI 3RZOI 3CCE1 2YADA 3CME1 1K83I 2PK7A 1YHQZ 3IF8A 1M902 2R93I 4NBBA 1VQN1 3H3VJ 1QVGY 5IP9I 1PFTA 1QVFY 2R7ZI 3GTPI 2R92I 1SIWA 1WCMI 2V8KA 3CCMZ 1RQFA 5T6BA 5IP7I 1TWAI 1K731 3I4NI 1KC82 1NP6A 2OTJ1 3S1RI 1Y1WI 2V45A 3CC7Z 3CCRZ 2DE6A 2E2HI 4A3JI 3GCFA 4NBCA 3I561 1W2BZ 3S2HI 2GTHA 4RVFA 1USPA 4MD7A 1VQMZ 2QA41 3EEDA 4RV9A 3CCVZ 1NJI2 2K5RA 2RIQA 4BXXI 1TWFI 3GTJI 4MXUA 1YJN1 3U50C 5C4XI 3HOUI 1VQ51 4NBFA 3S2DI 1Y8CA 2PMZA 4X6AI 3M3YI 5CM2M 2JS4A 5C44I 1ZB9A 5D1OA 2R6MA 3NH5A 2J6AA 3D9XA 1VQ71 4E33A 1FDIA 2OOXB 4HGZA 3CCLZ 1YI21 2HU9A 3MZKB 1S7MA 3MONA 2LEXA 2Q4ZA 3GTMS 3CQZI 3NH8A 2VPZA 4E2ZA 1ZB8A 4NBHA 1Q821 4A3DI 1Q7Y2 2QEX1 2BJOA 2DE7A 1M1K2 3EERA 1Q822 2V8IA 1JWHC 3GKQA 1KQSZ 3CCEZ 3HOYI 2P28A 4QTTA 3BG0B 3RZDI 2JIRA 3CMEZ 1I50I 4DQYB 1L1OC 3D2LA 2QKDA 5T67A 4NB9A 4RVHA 1VQNZ 2E9HA 1VQ41 3TE5B 2QLVB 4AYBA 5A2Qf 3PO3S 3S1QI 3HOZI 1VQL1 4BBSI 3CD61 4S1TA 1Z01A 1Q16A 4A3EI 2OTL1 2LIYA 1X3WA 3HOXI 3MZLB 1YJ91 2M6NA 3S15I 2VUMI 4NH1C 5AN9F 2B63I 2E7ZA 1SFOI 2OTJZ 2EGTA 3J80b 1S721 2IZ3A 4RS4A 3PO2I 3I56Z 1VQ81 2AKLA 2HF1A 3IX0A 2LFUA 3IFUA 2RT9A 2QA4Z 1VLAA 1ZH1A 2IV2X 5IT9f 3HOWI 4A3FI 5A2Qb 3CXCY 3CCJ1 1K732 1KD11 4NOZA 4RVGA 2JIQA 2JIMA 1KD12 1YJNZ 2JNYA 4MRIA 3GTMI 3VMIA 1VQ5Z 1WW9A 3FQMA 1VQ7Z 3S17I 1YI2Z 3CCU1 2GU2A 1YUKA 1QYPA 4A3CI 3D6WA 3OW2Z 2YU9I 1USPB 3GTLI 1VQ91 1N8R1 5IT9b 4A3GI 5C4JI 2QEXZ 3NDJA 3Q87A 2QRDB 3BG1B 4A93I 2JMOA 1X3ZA
chains in the Genus database with same CATH topology
4HGYA 1ML8A 4RVDA 2RPRA 3PO3I 3S1NI 3LUSA 1Y1VS 2PM9A 1Z03A 4NBEA 1VQO1 1JJ2Z 3G711 1VQ61 1YJW1 1YIJ1 1VQ4Z 1TWGI 2KPIA 3VB9A 4NBDA 2V8JA 1LQLA 2E2JI 3KIHA 4BY1I 4E2WA 3CPWY 1VQLZ 3CMA1 3I07A 3J80f 3CD6Z 3J7A4 2OTLZ 2VUGA 1Q861 1TWCI 1YJ9Z 3GTOI 4EWCA 3F3PC 2Y0SA 2JA8I 5FLXb 1S72Z 5FLMI 1K9M1 3NDIA 2QRCB 1Q811 1VQ8Z 1DL6A 3QWUA 1QVGZ 4BY7I 2I3CA 2JR6A 1QVFZ 1NUIA 1VQP1 2RHBA 1YIT1 2K3RA 4E2XA 3CCJZ 2G2KA 3CCQ1 3CXCZ 4MONA 1K8A1 3G6E1 3CCS1 2NVXI 2F4OA 4MD8A 2NVQI 2ZAEB 2O4HA 1K8A2 4DK1A 2OZKA 1M901 3ESWA 3I4MI 4A3MI 2NVYI 3K7AI 4E2YA 3I551 3CCUZ 3P5JB 2QREB 5T64A 1I3QI 1VQ9Z 2DE5A 3VTNA 3CC41 3NFZA 2JUBA 4NB8A 1Y1VI 3S16I 4XX2A 2IZ4A 4DGLA 3G4SZ 1KC81 4QTUA 1Z02A 3VMGA 1YHQ1 3VMHA 3CC2Z 4A3LI 2JA7I 1R9TI 2WAQA 3F3FC 4Y7NI 3NH4A 1VQOZ 3G71Z 1VQ6Z 1YJWZ 1YIJZ 4Y52I 3CCM1 1X0TA 1VQKZ 2E2II 1N8R2 1NJI1 2GTIA 3HKZA 3G4S1 3CMAZ 2JA6I 5C3EI 5FLXf 2RBLA 4E32A 2W03A 3CC21 3GTQI 3CPWZ 4A3II 1W2BY 3GTKI 1QF8A 3CC71 3CCR1 1RO0A 4MD9A 5D1OB 2M48A 1N2FA 1KRLA 2P3YA 2W04A 4MH4A 1VQK1 3J81f 2NVTI 1VQM1 3OW2Y 1P9NA 2Q51A 3CCV1 1I6HI 4A3BI 3HOVI 1YUAA 3JAMf 1VQPZ 4BBRI 1YITZ 4TNUA 3T4NB 1Q7Y1 1M1K1 3S14I 4CL1A 1Q862 3KIFA 3GTGI 2QR1B 3FKII 3CCQZ 4NBGA 4HH4A 4E31A 3G6EZ 3CCSZ 1K9M2 2KI7B 2F4MA 2OOYB 5LL6f 1JJ2Y 4NFRA 1Q812 3CCL1 2WB1A 3FQQA 1WIIA 3J81b 4NBAA 3I55Z 2VF1A 3TDHB 1RNIA 1TFIA 2JA5I 4E30A 1KQSY 1RLYA 3H0GI 3JAMb 2O53A 2H85A 5D1PA 1RO4A 3CC4Z 1RO2A 3S1MI 1TWHI 4A3KI 3M4OI 3RZOI 3CCE1 2YADA 3CME1 1K83I 2PK7A 1YHQZ 3IF8A 1M902 2R93I 4NBBA 1VQN1 3H3VJ 1QVGY 5IP9I 1PFTA 1QVFY 2R7ZI 3GTPI 2R92I 1WCMI 2V8KA 3CCMZ 1RQFA 5T6BA 5IP7I 1TWAI 1K731 3I4NI 1KC82 1NP6A 2OTJ1 3S1RI 1Y1WI 3CC7Z 3CCRZ 2DE6A 2E2HI 4A3JI 3GCFA 4NBCA 3I561 1W2BZ 3S2HI 2GTHA 4RVFA 1USPA 4MD7A 1VQMZ 2QA41 3EEDA 4RV9A 3CCVZ 1NJI2 2K5RA 2RIQA 4BXXI 1TWFI 3GTJI 4MXUA 1YJN1 3U50C 5C4XI 3HOUI 1VQ51 4NBFA 3S2DI 2PMZA 4X6AI 3M3YI 5CM2M 2JS4A 5C44I 1ZB9A 5D1OA 2R6MA 3NH5A 2J6AA 3D9XA 1VQ71 4E33A 2OOXB 4HGZA 3CCLZ 1YI21 2HU9A 3MZKB 1S7MA 3MONA 2Q4ZA 3GTMS 3CQZI 3NH8A 4E2ZA 1ZB8A 4NBHA 1Q821 4A3DI 1Q7Y2 2QEX1 2BJOA 2DE7A 1M1K2 3EERA 1Q822 2V8IA 1JWHC 3GKQA 1KQSZ 3CCEZ 3HOYI 2P28A 4QTTA 3BG0B 3RZDI 3CMEZ 1I50I 4DQYB 1L1OC 2QKDA 5T67A 4NB9A 4RVHA 1VQNZ 2E9HA 1VQ41 3TE5B 2QLVB 4AYBA 5A2Qf 3PO3S 3S1QI 3HOZI 1VQL1 4BBSI 3CD61 4S1TA 1Z01A 4A3EI 2OTL1 2LIYA 1X3WA 3HOXI 3MZLB 1YJ91 2M6NA 3S15I 2VUMI 4NH1C 5AN9F 2B63I 1SFOI 2OTJZ 2EGTA 3J80b 1S721 2IZ3A 4RS4A 3PO2I 3I56Z 1VQ81 2AKLA 2HF1A 3IX0A 2LFUA 3IFUA 2RT9A 2QA4Z 1VLAA 1ZH1A 5IT9f 3HOWI 4A3FI 5A2Qb 3CXCY 3CCJ1 1K732 1KD11 4NOZA 4RVGA 1KD12 1YJNZ 2JNYA 4MRIA 3GTMI 3VMIA 1VQ5Z 1WW9A 3FQMA 1VQ7Z 3S17I 1YI2Z 3CCU1 2GU2A 1YUKA 1QYPA 4A3CI 3D6WA 3OW2Z 2YU9I 1USPB 3GTLI 1VQ91 1N8R1 5IT9b 4A3GI 5C4JI 2QEXZ 3NDJA 3Q87A 2QRDB 3BG1B 4A93I 2JMOA 1X3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Z;  3CCE 1;  3CCE Z;  3G4S Z;  1KC8 1;  3CME 1;  3CME Z;  1YHQ 1;  1YHQ Z;  3CC2 Z;  1M90 2;  1VQN 1;  1QVG Y;  1VQN Z;  1VQO 1;  1JJ2 Z;  3G71 1;  1VQO Z;  3G71 Z;  1VQ4 1;  1QVF Y;  1YJW 1;  1YIJ 1;  1VQ6 1;  1VQ4 Z;  1VQ6 Z;  1YJW Z;  1YIJ Z;  3CCM 1;  1VQK Z;  3CCM Z;  1N8R 2;  1NJI 1;  3CPW Y;  3G4S 1;  1VQL 1;  1VQL Z;  3CMA 1;  3CD6 1;  2OTL 1;  3CMA Z;  3CD6 Z;  2OTL Z;  1K73 1;  1Q86 1;  1KC8 2;  1YJ9 1;  1YJ9 Z;  3CC2 1;  2OTJ 1;  3CPW Z;  1W2B Y;  2OTJ Z;  3CC7 1;  3CCR 1;  3CC7 Z;  1S72 1;  3CCR Z;  1S72 Z;  1K9M 1;  1VQK 1;  3I56 1;  1W2B Z;  1Q81 1;  3I56 Z;  1VQ8 1;  1VQ8 Z;  1VQM 1;  3OW2 Y;  1VQM Z;  1QVG Z;  2QA4 1;  3CCV 1;  2QA4 Z;  3CCV Z;  1QVF Z;  1NJI 2;  1VQP 1;  1VQP Z;  1YIT 1;  1YIT Z;  3CXC Y;  3CCJ 1;  3CCJ Z;  1Q7Y 1;  1K73 2;  1KD1 1;  1M1K 1;  1Q86 2;  1YJN 1;  1KD1 2;  1YJN Z;  3CCQ 1;  3CXC Z;  3CCQ Z;  1K8A 1;  1VQ5 1;  1VQ5 Z;  3G6E 1;  3CCS 1;  3CCS Z;  3G6E Z;  1K9M 2;  1K8A 2;  1M90 1;  1JJ2 Y;  1Q81 2;  1VQ7 1;  3CCL 1;  1VQ7 Z;  3CCL Z;  1YI2 1;  1YI2 Z;  3CCU 1;  3I55 1;  3CCU Z;  3I55 Z;  3OW2 Z;  1KQS Y;  1Q82 1;  1VQ9 1;  1N8R 1;  1VQ9 Z;  1Q7Y 2;  2QEX 1;  1M1K 2;  2QEX Z;  3CC4 1;  1Q82 2;  3CC4 Z; 
#chains in the Genus database with same CATH topology
 4HGY A;  1ML8 A;  4RVD A;  2RPR A;  3PO3 I;  3S1N I;  3LUS A;  1Y1V S;  2PM9 A;  1Z03 A;  4NBE A;  1VQO 1;  1JJ2 Z;  3G71 1;  1VQ6 1;  1YJW 1;  1YIJ 1;  1VQ4 Z;  1TWG I;  2KPI A;  2V3V A;  3VB9 A;  4NBD A;  2V8J A;  1LQL A;  2E2J I;  3KIH A;  4BY1 I;  4E2W A;  2VPY A;  2JIP A;  3CPW Y;  1VQL Z;  3CMA 1;  3I07 A;  3J80 f;  3CD6 Z;  3J7A 4;  2OTL Z;  2VUG A;  1Q86 1;  1TWC I;  1YJ9 Z;  3GTO I;  4EWC A;  3F3P C;  2Y0S A;  2JA8 I;  2JIO A;  5FLX b;  1S72 Z;  5FLM I;  1K9M 1;  3NDI A;  2QRC B;  1Q81 1;  1VQ8 Z;  1DL6 A;  3QWU A;  1QVG Z;  4BY7 I;  2I3C A;  2JR6 A;  1QVF Z;  1NUI A;  1VQP 1;  2RHB A;  1YIT 1;  2K3R A;  4E2X A;  3CCJ Z;  2G2K A;  3CCQ 1;  3CXC Z;  4MON A;  1K8A 1;  3G6E 1;  3CCS 1;  2NVX I;  2F4O A;  4MD8 A;  2NVQ I;  3IR7 A;  2NAP A;  2ZAE B;  2O4H A;  1K8A 2;  4DK1 A;  2OZK A;  1M90 1;  1WJ2 A;  3ESW A;  3I4M I;  4A3M I;  2NVY I;  3K7A I;  4E2Y A;  3I55 1;  3CCU Z;  3P5J B;  2QRE B;  5T64 A;  1I3Q I;  1VQ9 Z;  2DE5 A;  3VTN A;  3CC4 1;  3NFZ A;  2JUB A;  4NB8 A;  1Y1V I;  1AA6 A;  3S16 I;  4XX2 A;  2IZ4 A;  4DGL A;  3G4S Z;  2VPX A;  1KC8 1;  4QTU A;  1Z02 A;  3VMG A;  1QXF A;  1YHQ 1;  3VMH A;  3CC2 Z;  4A3L I;  2JA7 I;  1R9T I;  2WAQ A;  3F3F C;  4Y7N I;  3NH4 A;  1VQO Z;  3G71 Z;  1VQ6 Z;  1YJW Z;  1YIJ Z;  4Y52 I;  3CCM 1;  1X0T A;  1VQK Z;  2E2I I;  1N8R 2;  1NJI 1;  2GTI A;  3HKZ A;  3G4S 1;  3CMA Z;  2JA6 I;  5C3E I;  5FLX f;  1WZN A;  2RBL A;  4E32 A;  2W03 A;  3CC2 1;  3GTQ I;  3CPW Z;  4A3I I;  1W2B Y;  3GTK I;  1QF8 A;  3CC7 1;  3CCR 1;  1RO0 A;  4MD9 A;  5D1O B;  2M48 A;  1N2F A;  1KRL A;  2P3Y A;  2W04 A;  4MH4 A;  1VQK 1;  3J81 f;  2NVT I;  1FDO A;  1VQM 1;  3OW2 Y;  1P9N A;  2Q51 A;  3CCV 1;  1I6H I;  4A3B I;  3HOV I;  1YUA A;  3JAM f;  1VQP Z;  4BBR I;  1YIT Z;  4TNU A;  3T4N B;  1Q7Y 1;  1M1K 1;  3S14 I;  4CL1 A;  1Q86 2;  3KIF A;  3GTG I;  2QR1 B;  3FKI I;  3CCQ Z;  4NBG A;  4HH4 A;  4E31 A;  3G6E Z;  3CCS Z;  1K9M 2;  2F4M A;  2KI7 B;  2OOY B;  2VPW A;  5LL6 f;  2AYD A;  1JJ2 Y;  4NFR A;  1Q81 2;  3CCL 1;  2WB1 A;  3FQQ A;  1WII A;  3J81 b;  4NBA A;  3I55 Z;  2VF1 A;  3TDH B;  1RNI A;  1TFI A;  2JA5 I;  4E30 A;  1KQS Y;  1RLY A;  3H0G I;  3JAM b;  2O53 A;  2H85 A;  5D1P A;  1RO4 A;  3CC4 Z;  1RO2 A;  3S1M I;  1TWH I;  4A3K I;  3M4O I;  3RZO I;  3CCE 1;  2YAD A;  3CME 1;  1K83 I;  2PK7 A;  1YHQ Z;  3IF8 A;  1M90 2;  2R93 I;  4NBB A;  1VQN 1;  3H3V J;  1QVG Y;  5IP9 I;  1PFT A;  1QVF Y;  2R7Z I;  3GTP I;  2R92 I;  1SIW A;  1WCM I;  2V8K A;  3CCM Z;  1RQF A;  5T6B A;  5IP7 I;  1TWA I;  1K73 1;  3I4N I;  1KC8 2;  1NP6 A;  2OTJ 1;  3S1R I;  1Y1W I;  2V45 A;  3CC7 Z;  3CCR Z;  2DE6 A;  2E2H I;  4A3J I;  3GCF A;  4NBC A;  3I56 1;  1W2B Z;  3S2H I;  2GTH A;  4RVF A;  1USP A;  4MD7 A;  1VQM Z;  2QA4 1;  3EED A;  4RV9 A;  3CCV Z;  1NJI 2;  2K5R A;  2RIQ A;  4BXX I;  1TWF I;  3GTJ I;  4MXU A;  1YJN 1;  3U50 C;  5C4X I;  3HOU I;  1VQ5 1;  4NBF A;  3S2D I;  1Y8C A;  2PMZ A;  4X6A I;  3M3Y I;  5CM2 M;  2JS4 A;  5C44 I;  1ZB9 A;  5D1O A;  2R6M A;  3NH5 A;  2J6A A;  3D9X A;  1VQ7 1;  4E33 A;  1FDI A;  2OOX B;  4HGZ A;  3CCL Z;  1YI2 1;  2HU9 A;  3MZK B;  1S7M A;  3MON A;  2LEX A;  2Q4Z A;  3GTM S;  3CQZ I;  3NH8 A;  2VPZ A;  4E2Z A;  1ZB8 A;  4NBH A;  1Q82 1;  4A3D I;  1Q7Y 2;  2QEX 1;  2BJO A;  2DE7 A;  1M1K 2;  3EER A;  1Q82 2;  2V8I A;  1JWH C;  3GKQ A;  1KQS Z;  3CCE Z;  3HOY I;  2P28 A;  4QTT A;  3BG0 B;  3RZD I;  2JIR A;  3CME Z;  1I50 I;  4DQY B;  1L1O C;  3D2L A;  2QKD A;  5T67 A;  4NB9 A;  4RVH A;  1VQN Z;  2E9H A;  1VQ4 1;  3TE5 B;  2QLV B;  4AYB A;  5A2Q f;  3PO3 S;  3S1Q I;  3HOZ I;  1VQL 1;  4BBS I;  3CD6 1;  4S1T A;  1Z01 A;  1Q16 A;  4A3E I;  2OTL 1;  2LIY A;  1X3W A;  3HOX I;  3MZL B;  1YJ9 1;  2M6N A;  3S15 I;  2VUM I;  4NH1 C;  5AN9 F;  2B63 I;  2E7Z A;  1SFO I;  2OTJ Z;  2EGT A;  3J80 b;  1S72 1;  2IZ3 A;  4RS4 A;  3PO2 I;  3I56 Z;  1VQ8 1;  2AKL A;  2HF1 A;  3IX0 A;  2LFU A;  3IFU A;  2RT9 A;  2QA4 Z;  1VLA A;  1ZH1 A;  2IV2 X;  5IT9 f;  3HOW I;  4A3F I;  5A2Q b;  3CXC Y;  3CCJ 1;  1K73 2;  1KD1 1;  4NOZ A;  4RVG A;  2JIQ A;  2JIM A;  1KD1 2;  1YJN Z;  2JNY A;  4MRI A;  3GTM I;  3VMI A;  1VQ5 Z;  1WW9 A;  3FQM A;  1VQ7 Z;  3S17 I;  1YI2 Z;  3CCU 1;  2GU2 A;  1YUK A;  1QYP A;  4A3C I;  3D6W A;  3OW2 Z;  2YU9 I;  1USP B;  3GTL I;  1VQ9 1;  1N8R 1;  5IT9 b;  4A3G I;  5C4J I;  2QEX Z;  3NDJ A;  3Q87 A;  2QRD B;  3BG1 B;  4A93 I;  2JMO A;  1X3Z A; 
#chains in the Genus database with same CATH homology
 4HGY A;  1ML8 A;  4RVD A;  2RPR A;  3PO3 I;  3S1N I;  3LUS A;  1Y1V S;  2PM9 A;  1Z03 A;  4NBE A;  1VQO 1;  1JJ2 Z;  3G71 1;  1VQ6 1;  1YJW 1;  1YIJ 1;  1VQ4 Z;  1TWG I;  2KPI A;  3VB9 A;  4NBD A;  2V8J A;  1LQL A;  2E2J I;  3KIH A;  4BY1 I;  4E2W A;  3CPW Y;  1VQL Z;  3CMA 1;  3I07 A;  3J80 f;  3CD6 Z;  3J7A 4;  2OTL Z;  2VUG A;  1Q86 1;  1TWC I;  1YJ9 Z;  3GTO I;  4EWC A;  3F3P C;  2Y0S A;  2JA8 I;  5FLX b;  1S72 Z;  5FLM I;  1K9M 1;  3NDI A;  2QRC B;  1Q81 1;  1VQ8 Z;  1DL6 A;  3QWU A;  1QVG Z;  4BY7 I;  2I3C A;  2JR6 A;  1QVF Z;  1NUI A;  1VQP 1;  2RHB A;  1YIT 1;  2K3R A;  4E2X A;  3CCJ Z;  2G2K A;  3CCQ 1;  3CXC Z;  4MON A;  1K8A 1;  3G6E 1;  3CCS 1;  2NVX I;  2F4O A;  4MD8 A;  2NVQ I;  2ZAE B;  2O4H A;  1K8A 2;  4DK1 A;  2OZK A;  1M90 1;  3ESW A;  3I4M I;  4A3M I;  2NVY I;  3K7A I;  4E2Y A;  3I55 1;  3CCU Z;  3P5J B;  2QRE B;  5T64 A;  1I3Q I;  1VQ9 Z;  2DE5 A;  3VTN A;  3CC4 1;  3NFZ A;  2JUB A;  4NB8 A;  1Y1V I;  3S16 I;  4XX2 A;  2IZ4 A;  4DGL A;  3G4S Z;  1KC8 1;  4QTU A;  1Z02 A;  3VMG A;  1YHQ 1;  3VMH A;  3CC2 Z;  4A3L I;  2JA7 I;  1R9T I;  2WAQ A;  3F3F C;  4Y7N I;  3NH4 A;  1VQO Z;  3G71 Z;  1VQ6 Z;  1YJW Z;  1YIJ Z;  4Y52 I;  3CCM 1;  1X0T A;  1VQK Z;  2E2I I;  1N8R 2;  1NJI 1;  2GTI A;  3HKZ A;  3G4S 1;  3CMA Z;  2JA6 I;  5C3E I;  5FLX f;  2RBL A;  4E32 A;  2W03 A;  3CC2 1;  3GTQ I;  3CPW Z;  4A3I I;  1W2B Y;  3GTK I;  1QF8 A;  3CC7 1;  3CCR 1;  1RO0 A;  4MD9 A;  5D1O B;  2M48 A;  1N2F A;  1KRL A;  2P3Y A;  2W04 A;  4MH4 A;  1VQK 1;  3J81 f;  2NVT I;  1VQM 1;  3OW2 Y;  1P9N A;  2Q51 A;  3CCV 1;  1I6H I;  4A3B I;  3HOV I;  1YUA A;  3JAM f;  1VQP Z;  4BBR I;  1YIT Z;  4TNU A;  3T4N B;  1Q7Y 1;  1M1K 1;  3S14 I;  4CL1 A;  1Q86 2;  3KIF A;  3GTG I;  2QR1 B;  3FKI I;  3CCQ Z;  4NBG A;  4HH4 A;  4E31 A;  3G6E Z;  3CCS Z;  1K9M 2;  2KI7 B;  2F4M A;  2OOY B;  5LL6 f;  1JJ2 Y;  4NFR A;  1Q81 2;  3CCL 1;  2WB1 A;  3FQQ A;  1WII A;  3J81 b;  4NBA A;  3I55 Z;  2VF1 A;  3TDH B;  1RNI A;  1TFI A;  2JA5 I;  4E30 A;  1KQS Y;  1RLY A;  3H0G I;  3JAM b;  2O53 A;  2H85 A;  5D1P A;  1RO4 A;  3CC4 Z;  1RO2 A;  3S1M I;  1TWH I;  4A3K I;  3M4O I;  3RZO I;  3CCE 1;  2YAD A;  3CME 1;  1K83 I;  2PK7 A;  1YHQ Z;  3IF8 A;  1M90 2;  2R93 I;  4NBB A;  1VQN 1;  3H3V J;  1QVG Y;  5IP9 I;  1PFT A;  1QVF Y;  2R7Z I;  3GTP I;  2R92 I;  1WCM I;  2V8K A;  3CCM Z;  1RQF A;  5T6B A;  5IP7 I;  1TWA I;  1K73 1;  3I4N I;  1KC8 2;  1NP6 A;  2OTJ 1;  3S1R I;  1Y1W I;  3CC7 Z;  3CCR Z;  2DE6 A;  2E2H I;  4A3J I;  3GCF A;  4NBC A;  3I56 1;  1W2B Z;  3S2H I;  2GTH A;  4RVF A;  1USP A;  4MD7 A;  1VQM Z;  2QA4 1;  3EED A;  4RV9 A;  3CCV Z;  1NJI 2;  2K5R A;  2RIQ A;  4BXX I;  1TWF I;  3GTJ I;  4MXU A;  1YJN 1;  3U50 C;  5C4X I;  3HOU I;  1VQ5 1;  4NBF A;  3S2D I;  2PMZ A;  4X6A I;  3M3Y I;  5CM2 M;  2JS4 A;  5C44 I;  1ZB9 A;  5D1O A;  2R6M A;  3NH5 A;  2J6A A;  3D9X A;  1VQ7 1;  4E33 A;  2OOX B;  4HGZ A;  3CCL Z;  1YI2 1;  2HU9 A;  3MZK B;  1S7M A;  3MON A;  2Q4Z A;  3GTM S;  3CQZ I;  3NH8 A;  4E2Z A;  1ZB8 A;  4NBH A;  1Q82 1;  4A3D I;  1Q7Y 2;  2QEX 1;  2BJO A;  2DE7 A;  1M1K 2;  3EER A;  1Q82 2;  2V8I A;  1JWH C;  3GKQ A;  1KQS Z;  3CCE Z;  3HOY I;  2P28 A;  4QTT A;  3BG0 B;  3RZD I;  3CME Z;  1I50 I;  4DQY B;  1L1O C;  2QKD A;  5T67 A;  4NB9 A;  4RVH A;  1VQN Z;  2E9H A;  1VQ4 1;  3TE5 B;  2QLV B;  4AYB A;  5A2Q f;  3PO3 S;  3S1Q I;  3HOZ I;  1VQL 1;  4BBS I;  3CD6 1;  4S1T A;  1Z01 A;  4A3E I;  2OTL 1;  2LIY A;  1X3W A;  3HOX I;  3MZL B;  1YJ9 1;  2M6N A;  3S15 I;  2VUM I;  4NH1 C;  5AN9 F;  2B63 I;  1SFO I;  2OTJ Z;  2EGT A;  3J80 b;  1S72 1;  2IZ3 A;  4RS4 A;  3PO2 I;  3I56 Z;  1VQ8 1;  2AKL A;  2HF1 A;  3IX0 A;  2LFU A;  3IFU A;  2RT9 A;  2QA4 Z;  1VLA A;  1ZH1 A;  5IT9 f;  3HOW I;  4A3F I;  5A2Q b;  3CXC Y;  3CCJ 1;  1K73 2;  1KD1 1;  4NOZ A;  4RVG A;  1KD1 2;  1YJN Z;  2JNY A;  4MRI A;  3GTM I;  3VMI A;  1VQ5 Z;  1WW9 A;  3FQM A;  1VQ7 Z;  3S17 I;  1YI2 Z;  3CCU 1;  2GU2 A;  1YUK A;  1QYP A;  4A3C I;  3D6W A;  3OW2 Z;  2YU9 I;  1USP B;  3GTL I;  1VQ9 1;  1N8R 1;  5IT9 b;  4A3G I;  5C4J I;  2QEX Z;  3NDJ A;  3Q87 A;  2QRD B;  3BG1 B;  4A93 I;  2JMO A;  1X3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...