1M1K2

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m1k200
2QEX1 1VQK1 1VQNZ 1VQ51 1VQ81 1Q812 2OTLZ 3CPWY 1YJW1 1VQN1 1Q7Y2 1W2BY 3CCJ1 1VQMZ 1YIT1 1K732 3G6EZ 1NJI2 1KD11 1YI21 3G4S1 1KC81 3I561 3CMAZ 2QA4Z 3CCV1 3CC7Z 1QVGZ 3CXCZ 3I55Z 1VQL1 1VQM1 3CMA1 2QA41 3CCU1 3CC71 1VQPZ 3I551 1M901 3CCMZ 1YJ91 1VQ71 3CD6Z 1Q822 1VQOZ 1M1K1 1S721 3CCM1 1K8A2 3CCQZ 1K9M2 3CCLZ 2OTJZ 3CC4Z 1N8R1 2OTL1 3CCRZ 1VQ6Z 3CCQ1 3CCL1 3CC41 1QVFY 3G6E1 3CCR1 3CMEZ 3CPWZ 3OW2Y 1KC82 1JJ2Y 1W2BZ 3CCSZ 1VQP1 1VQ9Z 1QVGY 3G71Z 3CC2Z 1Q862 3CCS1 1VQ91 3CD61 1VQO1 1Q821 1M902 1Q811 2QEXZ 1VQKZ 1VQ5Z 2OTJ1 1Q7Y1 1M1K2 3CCEZ 1VQ61 1K731 1NJI1 3CXCY 1YJWZ 1KQSY 1YHQZ 1KD12 3CCE1 1VQ4Z 1N8R2 3CCJZ 1YITZ 1YJNZ 1YIJZ 1YI2Z 3G4SZ 3I56Z 3CME1 3CCVZ 1YHQ1 1VQ41 1VQLZ 1YJN1 1YIJ1 1QVFZ 3CCUZ 3G711 3CC21 1KQSZ 1K8A1 1YJ9Z 3OW2Z 1VQ7Z 1VQ8Z 1Q861 1K9M1 1JJ2Z 1S72Z
chains in the Genus database with same CATH superfamily
3S17I 4NH1C 3D2LA 3H0GI 3MZLB 3HKZA 3EEDA 1X3ZA 2AKLA 2OTLZ 3CPWY 1YJW1 2F4OA 3S2DI 4HGZA 1VQMZ 1NJI2 1ZH1A 3CMAZ 2QA4Z 3CC7Z 2IV2X 3CXCZ 3CQZI 1N2FA 3TE5B 3S1MI 1SFOI 2ZAEB 2R7ZI 5IT9b 4NBAA 2QRCB 4Y7NI 2JIMA 2QR1B 4BXXI 3K7AI 2JIOA 1VQ71 4A93I 3CD6Z 1Q822 1VQOZ 4E2ZA 3CCM1 1K8A2 3CCLZ 2DE5A 3I4MI 5D1PA 4A3DI 3T4NB 1VQ6Z 2M6NA 4E30A 3KIFA 4CL1A 3CC41 2KI7B 3G6E1 3CCR1 1Z01A 4E31A 4A3CI 3IR7A 1JJ2Y 2Y0SA 1K83I 2NVYI 2QKDA 2V8IA 2WB1A 3S16I 2QEXZ 1VQKZ 4QTTA 2PM9A 3GTKI 2RT9A 5IT9f 3QWUA 1NJI1 2RBLA 1QYPA 2VF1A 1TFIA 1FDOA 2JNYA 3CCE1 1VQ4Z 4S1TA 1ZB8A 4QTUA 1X3WA 1TWGI 3CME1 2RIQA 1TWFI 1VQLZ 1WIIA 1YJN1 3J81b 1PFTA 1K8A1 3RZOI 2IZ3A 3GTPI 1Y8CA 3OW2Z 4X6AI 3TDHB 3RZDI 4A3KI 4NB9A 2JS4A 3GTLI 4RVFA 2E7ZA 3MZKB 2E2II 2BJOA 4E2YA 3GKQA 2DE7A 1NP6A 2O4HA 3CCJ1 1KD11 2QREB 3F3PC 4RVDA 3G4S1 1KRLA 3CCV1 4MD9A 2JIQA 1RO0A 1WCMI 1VQM1 3CMA1 2QA41 2OZKA 2EGTA 3CC71 1VQPZ 3FKII 1RNIA 4NBFA 5IP7I 4E32A 4NBBA 1Z03A 2DE6A 2Q4ZA 3I4NI 3P5JB 3GTJI 1ZB9A 1K9M2 2R6MA 4A3GI 2OTJZ 4BBRI 3HOUI 4RVGA 3IFUA 1FDIA 3GTOI 3CCL1 3BG1B 3PO2I 2V8KA 1QXFA 4A3JI 3S1RI 2VPXA 4MH4A 3KIHA 3CPWZ 2O53A 5A2Qf 2KPIA 1Y1VI 1KC82 3HOZI 4NOZA 3VMGA 5FLXf 5IP9I 3VMIA 2JIPA 2VUGA 1M902 2PMZA 3GTMS 4Y52I 4BY7I 5T6BA 2IZ4A 2P3YA 2JA7I 2B63I 2LIYA 3NH5A 1YJWZ 3S1QI 2I3CA 1YHQZ 3NDJA 1KD12 1YIJZ 5CM2M 2OOXB 1VQ41 3M3YI 3GTQI 2R93I 5C3EI 3G711 3CC21 3NH4A 3M4OI 2V45A 4A3MI 2VPYA 1VQ7Z 1VQ8Z 1Q861 1K9M1 1JJ2Z 4TNUA 2E2JI 2JR6A 4A3BI 1AA6A 1VQNZ 2G2KA 4E2WA 1VQ51 2QRDB 2JIRA 1Q7Y2 3HOYI 1W2BY 1YIT1 3J80b 1K732 3G6EZ 3S14I 3GCFA 1YI21 1KC81 3I561 2J6AA 2JUBA 2JA5I 3I55Z 4RS4A 1TWAI 4RV9A 2LFUA 3CCU1 1I6HI 2PK7A 4NBDA 1Y1WI 1M901 3PO3S 1YJ91 2Q51A 3I07A 1S721 5LL6f 3CCQZ 5D1OA 4MRIA 2HU9A 3NDIA 4E2XA 2RPRA 2OTL1 1RO2A 1TWCI 2AYDA 1QF8A 2W03A 1Q16A 3S15I 3S1NI 1QVFY 3CMEZ 3VB9A 3GTGI 2NVTI 2H85A 2WAQA 3CCSZ 1VQ9Z 3F3FC 1TWHI 2GTIA 3NH8A 1RLYA 4EWCA 3J80f 1Q862 5T64A 3CD61 4NBGA 1I3QI 3J81f 1VQO1 2V8JA 2JMOA 5FLMI 3FQQA 3JAMb 4MD8A 3D9XA 4AYBA 1Q7Y1 1M1K2 4DK1A 1VQ61 4NBEA 1K731 3CXCY 4DGLA 3HOXI 1N8R2 3CCJZ 3S2HI 3G4SZ 2GU2A 3CCVZ 1YHQ1 1L1OC 1YUAA 1YIJ1 4NFRA 2NVQI 3VMHA 1SIWA 2E2HI 1RQFA 3H3VJ 4MXUA 1QVGY 2QLVB 2QEX1 1VQK1 2E9HA 1VQ81 2VUMI 3VTNA 2R92I 1Q812 1VLAA 1R9TI 4NBCA 3PO3I 1VQN1 3HOWI 2P28A 4E33A 2YADA 3U50C 2LEXA 2VPWA 1QVGZ 3JAMf 2YU9I 1VQL1 5AN9F 2W04A 3FQMA 1I50I 4MONA 3HOVI 4BBSI 3I551 2RHBA 3CCMZ 5C4XI 1NUIA 2JA6I 1M1K1 4HH4A 2M48A 1P9NA 3LUSA 2JA8I 1WW9A 1Z02A 3CC4Z 1N8R1 1YUKA 1LQLA 3CCRZ 3CCQ1 1WJ2A 4NBHA 3J7A4 1USPB 1Y1VS 2NAPA 2V3VA 5D1OB 4A3FI 1S7MA 2HF1A 2NVXI 4XX2A 3OW2Y 4HGYA 1W2BZ 1VQP1 4A3LI 1DL6A 3G71Z 2K3RA 3CC2Z 5C44I 5T67A 1USPA 3MONA 1JWHC 4MD7A 4DQYB 3CCS1 1VQ91 1X0TA 4A3EI 2OOYB 1WZNA 4A3II 1Q821 2F4MA 1ML8A 1Q811 3D6WA 1RO4A 2GTHA 1VQ5Z 2OTJ1 3CCEZ 3GTMI 2VPZA 1KQSY 5A2Qb 3ESWA 1YITZ 1YJNZ 1YI2Z 3I56Z 5FLXb 4BY1I 4RVHA 3EERA 5C4JI 1QVFZ 3IX0A 4NB8A 3CCUZ 2K5RA 1KQSZ 1YJ9Z 3BG0B 3Q87A 3NFZA 1S72Z 3IF8A
chains in the Genus database with same CATH topology
3S17I 4NH1C 3H0GI 3MZLB 3HKZA 3EEDA 1X3ZA 2AKLA 2OTLZ 3CPWY 1YJW1 2F4OA 3S2DI 4HGZA 1VQMZ 1NJI2 1ZH1A 3CMAZ 2QA4Z 3CC7Z 3CXCZ 3CQZI 1N2FA 3TE5B 3S1MI 1SFOI 2ZAEB 2R7ZI 5IT9b 4NBAA 2QRCB 4Y7NI 2QR1B 4BXXI 3K7AI 1VQ71 4A93I 3CD6Z 1Q822 1VQOZ 4E2ZA 3CCM1 1K8A2 3CCLZ 2DE5A 3I4MI 5D1PA 4A3DI 3T4NB 1VQ6Z 2M6NA 4E30A 3KIFA 4CL1A 3CC41 2KI7B 3G6E1 3CCR1 1Z01A 4E31A 4A3CI 1JJ2Y 2Y0SA 1K83I 2NVYI 2QKDA 2V8IA 2WB1A 3S16I 2QEXZ 1VQKZ 4QTTA 2PM9A 3GTKI 2RT9A 5IT9f 3QWUA 1NJI1 2RBLA 1QYPA 2VF1A 1TFIA 2JNYA 3CCE1 1VQ4Z 4S1TA 1ZB8A 4QTUA 1X3WA 1TWGI 3CME1 2RIQA 1TWFI 1VQLZ 1WIIA 1YJN1 3J81b 1PFTA 1K8A1 3RZOI 2IZ3A 3GTPI 3OW2Z 4X6AI 3TDHB 3RZDI 4A3KI 4NB9A 2JS4A 3GTLI 4RVFA 3MZKB 2E2II 2BJOA 4E2YA 3GKQA 2DE7A 1NP6A 2O4HA 3CCJ1 1KD11 2QREB 3F3PC 4RVDA 3G4S1 1KRLA 3CCV1 4MD9A 1RO0A 1WCMI 1VQM1 3CMA1 2QA41 2OZKA 2EGTA 3CC71 1VQPZ 3FKII 1RNIA 4NBFA 5IP7I 4E32A 4NBBA 1Z03A 2DE6A 2Q4ZA 3I4NI 3P5JB 3GTJI 1ZB9A 1K9M2 2R6MA 4A3GI 2OTJZ 4BBRI 3HOUI 4RVGA 3IFUA 3GTOI 3CCL1 3BG1B 3PO2I 2V8KA 4A3JI 3S1RI 4MH4A 3KIHA 3CPWZ 2O53A 5A2Qf 2KPIA 1Y1VI 1KC82 3HOZI 4NOZA 3VMGA 5FLXf 5IP9I 3VMIA 2VUGA 1M902 2PMZA 3GTMS 4Y52I 4BY7I 5T6BA 2IZ4A 2P3YA 2JA7I 2B63I 2LIYA 3NH5A 1YJWZ 3S1QI 2I3CA 1YHQZ 3NDJA 1KD12 1YIJZ 5CM2M 2OOXB 1VQ41 3M3YI 3GTQI 2R93I 5C3EI 3G711 3CC21 3NH4A 3M4OI 4A3MI 1VQ7Z 1VQ8Z 1Q861 1K9M1 1JJ2Z 4TNUA 2E2JI 2JR6A 4A3BI 1VQNZ 2G2KA 4E2WA 1VQ51 2QRDB 1Q7Y2 3HOYI 1W2BY 1YIT1 3J80b 1K732 3G6EZ 3S14I 3GCFA 1YI21 1KC81 3I561 2J6AA 2JUBA 2JA5I 3I55Z 4RS4A 1TWAI 4RV9A 2LFUA 3CCU1 1I6HI 2PK7A 4NBDA 1Y1WI 1M901 3PO3S 1YJ91 2Q51A 3I07A 1S721 5LL6f 3CCQZ 5D1OA 4MRIA 2HU9A 3NDIA 4E2XA 2RPRA 2OTL1 1RO2A 1TWCI 1QF8A 2W03A 3S15I 3S1NI 1QVFY 3CMEZ 3VB9A 3GTGI 2NVTI 2H85A 2WAQA 3CCSZ 1VQ9Z 3F3FC 1TWHI 2GTIA 3NH8A 1RLYA 4EWCA 3J80f 1Q862 5T64A 3CD61 4NBGA 1I3QI 3J81f 1VQO1 2V8JA 2JMOA 5FLMI 3FQQA 3JAMb 4MD8A 3D9XA 4AYBA 1Q7Y1 1M1K2 4DK1A 1VQ61 4NBEA 1K731 3CXCY 4DGLA 3HOXI 1N8R2 3CCJZ 3S2HI 3G4SZ 2GU2A 3CCVZ 1YHQ1 1L1OC 1YUAA 1YIJ1 4NFRA 2NVQI 3VMHA 2E2HI 1RQFA 3H3VJ 4MXUA 1QVGY 2QLVB 2QEX1 1VQK1 2E9HA 1VQ81 2VUMI 3VTNA 2R92I 1Q812 1VLAA 1R9TI 4NBCA 3PO3I 1VQN1 3HOWI 2P28A 4E33A 2YADA 3U50C 1QVGZ 3JAMf 2YU9I 1VQL1 5AN9F 2W04A 3FQMA 1I50I 4MONA 3HOVI 4BBSI 3I551 2RHBA 3CCMZ 5C4XI 1NUIA 2JA6I 1M1K1 4HH4A 2M48A 1P9NA 3LUSA 2JA8I 1WW9A 1Z02A 3CC4Z 1N8R1 1YUKA 1LQLA 3CCRZ 3CCQ1 4NBHA 3J7A4 1USPB 1Y1VS 5D1OB 4A3FI 1S7MA 2HF1A 2NVXI 4XX2A 3OW2Y 4HGYA 1W2BZ 1VQP1 4A3LI 1DL6A 3G71Z 2K3RA 3CC2Z 5C44I 5T67A 1USPA 3MONA 1JWHC 4MD7A 4DQYB 3CCS1 1VQ91 1X0TA 4A3EI 2OOYB 4A3II 1Q821 2F4MA 1ML8A 1Q811 3D6WA 1RO4A 2GTHA 1VQ5Z 2OTJ1 3CCEZ 3GTMI 1KQSY 5A2Qb 3ESWA 1YITZ 1YJNZ 1YI2Z 3I56Z 5FLXb 4BY1I 4RVHA 3EERA 5C4JI 1QVFZ 3IX0A 4NB8A 3CCUZ 2K5RA 1KQSZ 1YJ9Z 3BG0B 3Q87A 3NFZA 1S72Z 3IF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 1;  1VQK 1;  1VQN Z;  1VQ5 1;  1VQ8 1;  1Q81 2;  2OTL Z;  3CPW Y;  1YJW 1;  1VQN 1;  1Q7Y 2;  1W2B Y;  3CCJ 1;  1VQM Z;  1YIT 1;  1K73 2;  3G6E Z;  1NJI 2;  1KD1 1;  1YI2 1;  3G4S 1;  1KC8 1;  3I56 1;  3CMA Z;  2QA4 Z;  3CCV 1;  3CC7 Z;  1QVG Z;  3CXC Z;  3I55 Z;  1VQL 1;  1VQM 1;  3CMA 1;  2QA4 1;  3CCU 1;  3CC7 1;  1VQP Z;  3I55 1;  1M90 1;  3CCM Z;  1YJ9 1;  1VQ7 1;  3CD6 Z;  1Q82 2;  1VQO Z;  1M1K 1;  1S72 1;  3CCM 1;  1K8A 2;  3CCQ Z;  1K9M 2;  3CCL Z;  2OTJ Z;  3CC4 Z;  1N8R 1;  2OTL 1;  3CCR Z;  1VQ6 Z;  3CCQ 1;  3CCL 1;  3CC4 1;  1QVF Y;  3G6E 1;  3CCR 1;  3CME Z;  3CPW Z;  3OW2 Y;  1KC8 2;  1JJ2 Y;  1W2B Z;  3CCS Z;  1VQP 1;  1VQ9 Z;  1QVG Y;  3G71 Z;  3CC2 Z;  1Q86 2;  3CCS 1;  1VQ9 1;  3CD6 1;  1VQO 1;  1Q82 1;  1M90 2;  1Q81 1;  2QEX Z;  1VQK Z;  1VQ5 Z;  2OTJ 1;  1Q7Y 1;  1M1K 2;  3CCE Z;  1VQ6 1;  1K73 1;  1NJI 1;  3CXC Y;  1YJW Z;  1KQS Y;  1YHQ Z;  1KD1 2;  3CCE 1;  1VQ4 Z;  1N8R 2;  3CCJ Z;  1YIT Z;  1YJN Z;  1YIJ Z;  1YI2 Z;  3G4S Z;  3I56 Z;  3CME 1;  3CCV Z;  1YHQ 1;  1VQ4 1;  1VQL Z;  1YJN 1;  1YIJ 1;  1QVF Z;  3CCU Z;  3G71 1;  3CC2 1;  1KQS Z;  1K8A 1;  1YJ9 Z;  3OW2 Z;  1VQ7 Z;  1VQ8 Z;  1Q86 1;  1K9M 1;  1JJ2 Z;  1S72 Z; 
#chains in the Genus database with same CATH topology
 3S17 I;  4NH1 C;  3D2L A;  3H0G I;  3MZL B;  3HKZ A;  3EED A;  1X3Z A;  2AKL A;  2OTL Z;  3CPW Y;  1YJW 1;  2F4O A;  3S2D I;  4HGZ A;  1VQM Z;  1NJI 2;  1ZH1 A;  3CMA Z;  2QA4 Z;  3CC7 Z;  2IV2 X;  3CXC Z;  3CQZ I;  1N2F A;  3TE5 B;  3S1M I;  1SFO I;  2ZAE B;  2R7Z I;  5IT9 b;  4NBA A;  2QRC B;  4Y7N I;  2JIM A;  2QR1 B;  4BXX I;  3K7A I;  2JIO A;  1VQ7 1;  4A93 I;  3CD6 Z;  1Q82 2;  1VQO Z;  4E2Z A;  3CCM 1;  1K8A 2;  3CCL Z;  2DE5 A;  3I4M I;  5D1P A;  4A3D I;  3T4N B;  1VQ6 Z;  2M6N A;  4E30 A;  3KIF A;  4CL1 A;  3CC4 1;  2KI7 B;  3G6E 1;  3CCR 1;  1Z01 A;  4E31 A;  4A3C I;  3IR7 A;  1JJ2 Y;  2Y0S A;  1K83 I;  2NVY I;  2QKD A;  2V8I A;  2WB1 A;  3S16 I;  2QEX Z;  1VQK Z;  4QTT A;  2PM9 A;  3GTK I;  2RT9 A;  5IT9 f;  3QWU A;  1NJI 1;  2RBL A;  1QYP A;  2VF1 A;  1TFI A;  1FDO A;  2JNY A;  3CCE 1;  1VQ4 Z;  4S1T A;  1ZB8 A;  4QTU A;  1X3W A;  1TWG I;  3CME 1;  2RIQ A;  1TWF I;  1VQL Z;  1WII A;  1YJN 1;  3J81 b;  1PFT A;  1K8A 1;  3RZO I;  2IZ3 A;  3GTP I;  1Y8C A;  3OW2 Z;  4X6A I;  3TDH B;  3RZD I;  4A3K I;  4NB9 A;  2JS4 A;  3GTL I;  4RVF A;  2E7Z A;  3MZK B;  2E2I I;  2BJO A;  4E2Y A;  3GKQ A;  2DE7 A;  1NP6 A;  2O4H A;  3CCJ 1;  1KD1 1;  2QRE B;  3F3P C;  4RVD A;  3G4S 1;  1KRL A;  3CCV 1;  4MD9 A;  2JIQ A;  1RO0 A;  1WCM I;  1VQM 1;  3CMA 1;  2QA4 1;  2OZK A;  2EGT A;  3CC7 1;  1VQP Z;  3FKI I;  1RNI A;  4NBF A;  5IP7 I;  4E32 A;  4NBB A;  1Z03 A;  2DE6 A;  2Q4Z A;  3I4N I;  3P5J B;  3GTJ I;  1ZB9 A;  1K9M 2;  2R6M A;  4A3G I;  2OTJ Z;  4BBR I;  3HOU I;  4RVG A;  3IFU A;  1FDI A;  3GTO I;  3CCL 1;  3BG1 B;  3PO2 I;  2V8K A;  1QXF A;  4A3J I;  3S1R I;  2VPX A;  4MH4 A;  3KIH A;  3CPW Z;  2O53 A;  5A2Q f;  2KPI A;  1Y1V I;  1KC8 2;  3HOZ I;  4NOZ A;  3VMG A;  5FLX f;  5IP9 I;  3VMI A;  2JIP A;  2VUG A;  1M90 2;  2PMZ A;  3GTM S;  4Y52 I;  4BY7 I;  5T6B A;  2IZ4 A;  2P3Y A;  2JA7 I;  2B63 I;  2LIY A;  3NH5 A;  1YJW Z;  3S1Q I;  2I3C A;  1YHQ Z;  3NDJ A;  1KD1 2;  1YIJ Z;  5CM2 M;  2OOX B;  1VQ4 1;  3M3Y I;  3GTQ I;  2R93 I;  5C3E I;  3G71 1;  3CC2 1;  3NH4 A;  3M4O I;  2V45 A;  4A3M I;  2VPY A;  1VQ7 Z;  1VQ8 Z;  1Q86 1;  1K9M 1;  1JJ2 Z;  4TNU A;  2E2J I;  2JR6 A;  4A3B I;  1AA6 A;  1VQN Z;  2G2K A;  4E2W A;  1VQ5 1;  2QRD B;  2JIR A;  1Q7Y 2;  3HOY I;  1W2B Y;  1YIT 1;  3J80 b;  1K73 2;  3G6E Z;  3S14 I;  3GCF A;  1YI2 1;  1KC8 1;  3I56 1;  2J6A A;  2JUB A;  2JA5 I;  3I55 Z;  4RS4 A;  1TWA I;  4RV9 A;  2LFU A;  3CCU 1;  1I6H I;  2PK7 A;  4NBD A;  1Y1W I;  1M90 1;  3PO3 S;  1YJ9 1;  2Q51 A;  3I07 A;  1S72 1;  5LL6 f;  3CCQ Z;  5D1O A;  4MRI A;  2HU9 A;  3NDI A;  4E2X A;  2RPR A;  2OTL 1;  1RO2 A;  1TWC I;  2AYD A;  1QF8 A;  2W03 A;  1Q16 A;  3S15 I;  3S1N I;  1QVF Y;  3CME Z;  3VB9 A;  3GTG I;  2NVT I;  2H85 A;  2WAQ A;  3CCS Z;  1VQ9 Z;  3F3F C;  1TWH I;  2GTI A;  3NH8 A;  1RLY A;  4EWC A;  3J80 f;  1Q86 2;  5T64 A;  3CD6 1;  4NBG A;  1I3Q I;  3J81 f;  1VQO 1;  2V8J A;  2JMO A;  5FLM I;  3FQQ A;  3JAM b;  4MD8 A;  3D9X A;  4AYB A;  1Q7Y 1;  1M1K 2;  4DK1 A;  1VQ6 1;  4NBE A;  1K73 1;  3CXC Y;  4DGL A;  3HOX I;  1N8R 2;  3CCJ Z;  3S2H I;  3G4S Z;  2GU2 A;  3CCV Z;  1YHQ 1;  1L1O C;  1YUA A;  1YIJ 1;  4NFR A;  2NVQ I;  3VMH A;  1SIW A;  2E2H I;  1RQF A;  3H3V J;  4MXU A;  1QVG Y;  2QLV B;  2QEX 1;  1VQK 1;  2E9H A;  1VQ8 1;  2VUM I;  3VTN A;  2R92 I;  1Q81 2;  1VLA A;  1R9T I;  4NBC A;  3PO3 I;  1VQN 1;  3HOW I;  2P28 A;  4E33 A;  2YAD A;  3U50 C;  2LEX A;  2VPW A;  1QVG Z;  3JAM f;  2YU9 I;  1VQL 1;  5AN9 F;  2W04 A;  3FQM A;  1I50 I;  4MON A;  3HOV I;  4BBS I;  3I55 1;  2RHB A;  3CCM Z;  5C4X I;  1NUI A;  2JA6 I;  1M1K 1;  4HH4 A;  2M48 A;  1P9N A;  3LUS A;  2JA8 I;  1WW9 A;  1Z02 A;  3CC4 Z;  1N8R 1;  1YUK A;  1LQL A;  3CCR Z;  3CCQ 1;  1WJ2 A;  4NBH A;  3J7A 4;  1USP B;  1Y1V S;  2NAP A;  2V3V A;  5D1O B;  4A3F I;  1S7M A;  2HF1 A;  2NVX I;  4XX2 A;  3OW2 Y;  4HGY A;  1W2B Z;  1VQP 1;  4A3L I;  1DL6 A;  3G71 Z;  2K3R A;  3CC2 Z;  5C44 I;  5T67 A;  1USP A;  3MON A;  1JWH C;  4MD7 A;  4DQY B;  3CCS 1;  1VQ9 1;  1X0T A;  4A3E I;  2OOY B;  1WZN A;  4A3I I;  1Q82 1;  2F4M A;  1ML8 A;  1Q81 1;  3D6W A;  1RO4 A;  2GTH A;  1VQ5 Z;  2OTJ 1;  3CCE Z;  3GTM I;  2VPZ A;  1KQS Y;  5A2Q b;  3ESW A;  1YIT Z;  1YJN Z;  1YI2 Z;  3I56 Z;  5FLX b;  4BY1 I;  4RVH A;  3EER A;  5C4J I;  1QVF Z;  3IX0 A;  4NB8 A;  3CCU Z;  2K5R A;  1KQS Z;  1YJ9 Z;  3BG0 B;  3Q87 A;  3NFZ A;  1S72 Z;  3IF8 A; 
#chains in the Genus database with same CATH homology
 3S17 I;  4NH1 C;  3H0G I;  3MZL B;  3HKZ A;  3EED A;  1X3Z A;  2AKL A;  2OTL Z;  3CPW Y;  1YJW 1;  2F4O A;  3S2D I;  4HGZ A;  1VQM Z;  1NJI 2;  1ZH1 A;  3CMA Z;  2QA4 Z;  3CC7 Z;  3CXC Z;  3CQZ I;  1N2F A;  3TE5 B;  3S1M I;  1SFO I;  2ZAE B;  2R7Z I;  5IT9 b;  4NBA A;  2QRC B;  4Y7N I;  2QR1 B;  4BXX I;  3K7A I;  1VQ7 1;  4A93 I;  3CD6 Z;  1Q82 2;  1VQO Z;  4E2Z A;  3CCM 1;  1K8A 2;  3CCL Z;  2DE5 A;  3I4M I;  5D1P A;  4A3D I;  3T4N B;  1VQ6 Z;  2M6N A;  4E30 A;  3KIF A;  4CL1 A;  3CC4 1;  2KI7 B;  3G6E 1;  3CCR 1;  1Z01 A;  4E31 A;  4A3C I;  1JJ2 Y;  2Y0S A;  1K83 I;  2NVY I;  2QKD A;  2V8I A;  2WB1 A;  3S16 I;  2QEX Z;  1VQK Z;  4QTT A;  2PM9 A;  3GTK I;  2RT9 A;  5IT9 f;  3QWU A;  1NJI 1;  2RBL A;  1QYP A;  2VF1 A;  1TFI A;  2JNY A;  3CCE 1;  1VQ4 Z;  4S1T A;  1ZB8 A;  4QTU A;  1X3W A;  1TWG I;  3CME 1;  2RIQ A;  1TWF I;  1VQL Z;  1WII A;  1YJN 1;  3J81 b;  1PFT A;  1K8A 1;  3RZO I;  2IZ3 A;  3GTP I;  3OW2 Z;  4X6A I;  3TDH B;  3RZD I;  4A3K I;  4NB9 A;  2JS4 A;  3GTL I;  4RVF A;  3MZK B;  2E2I I;  2BJO A;  4E2Y A;  3GKQ A;  2DE7 A;  1NP6 A;  2O4H A;  3CCJ 1;  1KD1 1;  2QRE B;  3F3P C;  4RVD A;  3G4S 1;  1KRL A;  3CCV 1;  4MD9 A;  1RO0 A;  1WCM I;  1VQM 1;  3CMA 1;  2QA4 1;  2OZK A;  2EGT A;  3CC7 1;  1VQP Z;  3FKI I;  1RNI A;  4NBF A;  5IP7 I;  4E32 A;  4NBB A;  1Z03 A;  2DE6 A;  2Q4Z A;  3I4N I;  3P5J B;  3GTJ I;  1ZB9 A;  1K9M 2;  2R6M A;  4A3G I;  2OTJ Z;  4BBR I;  3HOU I;  4RVG A;  3IFU A;  3GTO I;  3CCL 1;  3BG1 B;  3PO2 I;  2V8K A;  4A3J I;  3S1R I;  4MH4 A;  3KIH A;  3CPW Z;  2O53 A;  5A2Q f;  2KPI A;  1Y1V I;  1KC8 2;  3HOZ I;  4NOZ A;  3VMG A;  5FLX f;  5IP9 I;  3VMI A;  2VUG A;  1M90 2;  2PMZ A;  3GTM S;  4Y52 I;  4BY7 I;  5T6B A;  2IZ4 A;  2P3Y A;  2JA7 I;  2B63 I;  2LIY A;  3NH5 A;  1YJW Z;  3S1Q I;  2I3C A;  1YHQ Z;  3NDJ A;  1KD1 2;  1YIJ Z;  5CM2 M;  2OOX B;  1VQ4 1;  3M3Y I;  3GTQ I;  2R93 I;  5C3E I;  3G71 1;  3CC2 1;  3NH4 A;  3M4O I;  4A3M I;  1VQ7 Z;  1VQ8 Z;  1Q86 1;  1K9M 1;  1JJ2 Z;  4TNU A;  2E2J I;  2JR6 A;  4A3B I;  1VQN Z;  2G2K A;  4E2W A;  1VQ5 1;  2QRD B;  1Q7Y 2;  3HOY I;  1W2B Y;  1YIT 1;  3J80 b;  1K73 2;  3G6E Z;  3S14 I;  3GCF A;  1YI2 1;  1KC8 1;  3I56 1;  2J6A A;  2JUB A;  2JA5 I;  3I55 Z;  4RS4 A;  1TWA I;  4RV9 A;  2LFU A;  3CCU 1;  1I6H I;  2PK7 A;  4NBD A;  1Y1W I;  1M90 1;  3PO3 S;  1YJ9 1;  2Q51 A;  3I07 A;  1S72 1;  5LL6 f;  3CCQ Z;  5D1O A;  4MRI A;  2HU9 A;  3NDI A;  4E2X A;  2RPR A;  2OTL 1;  1RO2 A;  1TWC I;  1QF8 A;  2W03 A;  3S15 I;  3S1N I;  1QVF Y;  3CME Z;  3VB9 A;  3GTG I;  2NVT I;  2H85 A;  2WAQ A;  3CCS Z;  1VQ9 Z;  3F3F C;  1TWH I;  2GTI A;  3NH8 A;  1RLY A;  4EWC A;  3J80 f;  1Q86 2;  5T64 A;  3CD6 1;  4NBG A;  1I3Q I;  3J81 f;  1VQO 1;  2V8J A;  2JMO A;  5FLM I;  3FQQ A;  3JAM b;  4MD8 A;  3D9X A;  4AYB A;  1Q7Y 1;  1M1K 2;  4DK1 A;  1VQ6 1;  4NBE A;  1K73 1;  3CXC Y;  4DGL A;  3HOX I;  1N8R 2;  3CCJ Z;  3S2H I;  3G4S Z;  2GU2 A;  3CCV Z;  1YHQ 1;  1L1O C;  1YUA A;  1YIJ 1;  4NFR A;  2NVQ I;  3VMH A;  2E2H I;  1RQF A;  3H3V J;  4MXU A;  1QVG Y;  2QLV B;  2QEX 1;  1VQK 1;  2E9H A;  1VQ8 1;  2VUM I;  3VTN A;  2R92 I;  1Q81 2;  1VLA A;  1R9T I;  4NBC A;  3PO3 I;  1VQN 1;  3HOW I;  2P28 A;  4E33 A;  2YAD A;  3U50 C;  1QVG Z;  3JAM f;  2YU9 I;  1VQL 1;  5AN9 F;  2W04 A;  3FQM A;  1I50 I;  4MON A;  3HOV I;  4BBS I;  3I55 1;  2RHB A;  3CCM Z;  5C4X I;  1NUI A;  2JA6 I;  1M1K 1;  4HH4 A;  2M48 A;  1P9N A;  3LUS A;  2JA8 I;  1WW9 A;  1Z02 A;  3CC4 Z;  1N8R 1;  1YUK A;  1LQL A;  3CCR Z;  3CCQ 1;  4NBH A;  3J7A 4;  1USP B;  1Y1V S;  5D1O B;  4A3F I;  1S7M A;  2HF1 A;  2NVX I;  4XX2 A;  3OW2 Y;  4HGY A;  1W2B Z;  1VQP 1;  4A3L I;  1DL6 A;  3G71 Z;  2K3R A;  3CC2 Z;  5C44 I;  5T67 A;  1USP A;  3MON A;  1JWH C;  4MD7 A;  4DQY B;  3CCS 1;  1VQ9 1;  1X0T A;  4A3E I;  2OOY B;  4A3I I;  1Q82 1;  2F4M A;  1ML8 A;  1Q81 1;  3D6W A;  1RO4 A;  2GTH A;  1VQ5 Z;  2OTJ 1;  3CCE Z;  3GTM I;  1KQS Y;  5A2Q b;  3ESW A;  1YIT Z;  1YJN Z;  1YI2 Z;  3I56 Z;  5FLX b;  4BY1 I;  4RVH A;  3EER A;  5C4J I;  1QVF Z;  3IX0 A;  4NB8 A;  3CCU Z;  2K5R A;  1KQS Z;  1YJ9 Z;  3BG0 B;  3Q87 A;  3NFZ A;  1S72 Z;  3IF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...