3CC2Z

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc2Z00
3CC41 3CCUZ 1W2BY 1YIJZ 3CC21 3I55Z 3I551 1K9M2 3CCLZ 1QVGY 1QVFZ 3OW2Y 1YJW1 2OTLZ 3G6EZ 1KC81 1VQK1 1VQM1 3CCSZ 3CD6Z 2QEX1 1VQ4Z 1KQSZ 2QA4Z 3G4SZ 1YI2Z 1VQ71 1Q812 3CPWZ 3I56Z 1YJ91 1M901 1Q7Y2 3CC4Z 1M1K1 3CC7Z 1VQN1 3CC71 1YHQ1 1JJ2Z 3CC2Z 1VQP1 1YJNZ 1YJN1 1YJWZ 3CCV1 1VQO1 1Q811 3G711 1M902 1VQKZ 1VQMZ 1M1K2 1Q7Y1 1QVFY 3CMEZ 2QEXZ 3CME1 1W2BZ 1Q821 1K732 1VQ7Z 1VQ51 1YJ9Z 1Q861 3CCQ1 1QVGZ 3CCE1 1VQNZ 1VQ91 1YHQZ 1VQ61 1VQPZ 1N8R1 1Q822 1K731 3CXCZ 1VQL1 3CCR1 3CCVZ 1JJ2Y 1VQOZ 1Q862 1KD12 3G71Z 1K8A2 1N8R2 3CMA1 3CCJ1 1YIT1 1S721 2OTJ1 1VQ5Z 3CCQZ 3CCU1 1KQSY 1KD11 1YIJ1 3CCEZ 3OW2Z 1K8A1 1VQ9Z 1VQ6Z 3CPWY 3CCL1 1VQLZ 3CCRZ 1NJI1 2OTL1 3G6E1 3CCS1 3CD61 3CXCY 1VQ8Z 3CMAZ 3CCMZ 1VQ41 1VQ81 2QA41 3CCM1 3CCJZ 1YITZ 1K9M1 3G4S1 1YI21 1S72Z 2OTJZ 3I561 1NJI2 1KC82
chains in the Genus database with same CATH superfamily
1FDIA 3CC41 2PK7A 3I55Z 1YUAA 4QTTA 2J6AA 1K9M2 2Y0SA 4NH1C 5D1PA 3J81f 2OTLZ 1VQK1 1VQM1 3CCSZ 4QTUA 3GTMI 2QEX1 1VQ4Z 1L1OC 4A3II 4A3CI 3S14I 2K3RA 3G4SZ 1YI2Z 4A3DI 2V8IA 4A3KI 1FDOA 3CPWZ 3NH4A 3S17I 1LQLA 3HOWI 3CC4Z 3CC7Z 3M3YI 4XX2A 2HU9A 1JJ2Z 2NVYI 1VQP1 1YJNZ 3TDHB 2OZKA 3PO3S 1USPB 1N2FA 2KI7B 3F3FC 4A3EI 2BJOA 4AYBA 3CCV1 3D9XA 3G711 1M902 3H0GI 4NBBA 1VQKZ 1VQMZ 4DGLA 3GTGI 2QEXZ 2JS4A 2QREB 1Q821 2R7ZI 2O53A 1ZH1A 2V45A 3CCQ1 3NDJA 2LEXA 1Q861 3IX0A 1NP6A 4BY1I 1VQPZ 1N8R1 3FQQA 4E32A 3CXCZ 2E2II 3CCVZ 3G71Z 2OOYB 1Y1VS 3K7AI 3S16I 1Q16A 2H85A 4E33A 3CMA1 4HGZA 4NBHA 3CCJ1 3J7A4 1I50I 4MONA 2JIMA 4BBRI 4NBDA 4X6AI 3CCQZ 3CCU1 3GTQI 1KQSY 4RVHA 1YIJ1 2RPRA 1TWHI 2R92I 2PMZA 3NH8A 2NVTI 3PO3I 3RZDI 3RZOI 2P28A 3CMAZ 4RVGA 4HGYA 2M6NA 3CCJZ 1K9M1 4NBAA 2JIPA 1WW9A 3GKQA 3I561 1NJI2 3NH5A 3GTOI 3CCUZ 1YIJZ 1WZNA 1DL6A 1KRLA 3I551 4NBFA 2E9HA 2RT9A 1QVGY 1QVFZ 1X3ZA 3OW2Y 1TWCI 1X3WA 2IV2X 2V3VA 2DE5A 1KC81 2EGTA 4RV9A 1Y1VI 5IP9I 3HOZI 3IFUA 3J80b 2IZ3A 2W04A 4DK1A 1USPA 4A3FI 3I56Z 3S2HI 2QLVB 3LUSA 1M901 3CC71 2E7ZA 2W03A 1YJN1 3HOVI 4TNUA 1Y1WI 2E2HI 2YADA 1VQO1 2P3YA 4MD8A 1Q811 4NBCA 1Q7Y1 2NVQI 1QF8A 2JR6A 1K732 3S1MI 3PO2I 1Y8CA 1VQ51 1TWFI 2AYDA 3S15I 5D1OA 3CCE1 2VPZA 4MXUA 1AA6A 1RO0A 2QKDA 5FLXb 4BBSI 1VQL1 1JJ2Y 5AN9F 1VQOZ 1TFIA 1KD12 3IR7A 3FQMA 1K8A2 2JMOA 3VMIA 1P9NA 5C3EI 2NAPA 2VPWA 1YIT1 1RO4A 4A3BI 1VQ5Z 4MD7A 1QYPA 4MH4A 4A3JI 3KIHA 2V8JA 2ZAEB 3HOUI 3CCEZ 3I4NI 2RBLA 1WJ2A 3J81b 1WIIA 3I07A 3GTPI 1Z01A 1VQLZ 4E31A 1NJI1 2HF1A 5D1OB 3CXCY 4BY7I 1VQ8Z 2JIRA 3CCMZ 2VPYA 2QA41 5IT9f 1YITZ 3S1QI 1ZB8A 1W2BY 4MRIA 4E2XA 2K5RA 5A2Qf 2M48A 2F4MA 4A93I 3FKII 3BG0B 1YJW1 3S2DI 5C44I 3JAMf 1ML8A 5LL6f 2YU9I 1KQSZ 2QA4Z 3GCFA 5C4JI 1VQ71 3MONA 4E2ZA 1YJ91 4NBEA 4RVDA 1I3QI 3MZLB 1VQN1 1X0TA 1YHQ1 2I3CA 1SFOI 1YJWZ 4RS4A 3VB9A 3F3PC 3HOXI 3GTMS 5T64A 1M1K2 2VUGA 1Z02A 1QVFY 2R6MA 3CMEZ 3D2LA 1VLAA 3VTNA 1VQ7Z 2VUMI 2G2KA 1RO2A 3EERA 2JA8I 1YJ9Z 2Q51A 2JIOA 4NBGA 4E30A 1RLYA 2RIQA 1QVGZ 3M4OI 4NB8A 1VQNZ 1YHQZ 4DQYB 2RHBA 4MD9A 3TE5B 3NDIA 2OTJ1 2PM9A 2GU2A 4Y7NI 2JNYA 4HH4A 1TWGI 3I4MI 3CPWY 5T6BA 3U50C 4A3GI 3CCL1 3P5JB 1YUKA 2F4OA 3G6E1 1PFTA 2JA5I 4E2WA 4NFRA 3CD61 3IF8A 2GTHA 2AKLA 4EWCA 1VQ81 3CCM1 2OTJZ 2GTIA 5FLMI 3KIFA 1SIWA 4RVFA 1WCMI 1KC82 1RQFA 2V8KA 2WAQA 2JA6I 2JIQA 2NVXI 3CC21 2DE7A 4NOZA 3CCLZ 2DE6A 3VMHA 5C4XI 2LFUA 3T4NB 2LIYA 3GTLI 4A3MI 3G6EZ 1I6HI 4BXXI 3CD6Z 3H3VJ 3MZKB 4A3LI 2B63I 5IP7I 3HKZA 2JA7I 1Q812 4S1TA 1JWHC 1K83I 1Q7Y2 1M1K1 3Q87A 3CC2Z 3CQZI 2VPXA 2Q4ZA 2QR1B 2R93I 3CME1 1W2BZ 1ZB9A 3D6WA 3J80f 3GTKI 2IZ4A 5CM2M 4NB9A 2OOXB 1VQ91 1VQ61 2WB1A 1S7MA 3BG1B 4CL1A 1Q822 1R9TI 3NFZA 1K731 3CCR1 1RNIA 5T67A 3S1RI 1Q862 3S1NI 5IT9b 3GTJI 1N8R2 1Z03A 2QRCB 1S721 2QRDB 2JUBA 2VF1A 5A2Qb 2O4HA 3EEDA 1KD11 3HOYI 3ESWA 3OW2Z 1TWAI 1K8A1 1VQ9Z 1VQ6Z 1NUIA 2E2JI 3CCRZ 3JAMb 2OTL1 4Y52I 5FLXf 3CCS1 3VMGA 1VQ41 2KPIA 3G4S1 1YI21 3QWUA 1S72Z 4E2YA 1QXFA
chains in the Genus database with same CATH topology
3CC41 2PK7A 3I55Z 1YUAA 4QTTA 2J6AA 1K9M2 2Y0SA 4NH1C 5D1PA 3J81f 2OTLZ 1VQK1 1VQM1 3CCSZ 4QTUA 3GTMI 2QEX1 1VQ4Z 1L1OC 4A3II 4A3CI 3S14I 2K3RA 3G4SZ 1YI2Z 4A3DI 2V8IA 4A3KI 3CPWZ 3NH4A 3S17I 1LQLA 3HOWI 3CC4Z 3CC7Z 3M3YI 4XX2A 2HU9A 1JJ2Z 2NVYI 1VQP1 1YJNZ 3TDHB 2OZKA 3PO3S 1USPB 1N2FA 2KI7B 3F3FC 4A3EI 2BJOA 4AYBA 3CCV1 3D9XA 3G711 1M902 3H0GI 4NBBA 1VQKZ 1VQMZ 4DGLA 3GTGI 2QEXZ 2JS4A 2QREB 1Q821 2R7ZI 2O53A 1ZH1A 3NDJA 3CCQ1 1Q861 3IX0A 1NP6A 4BY1I 1VQPZ 1N8R1 3FQQA 4E32A 3CXCZ 2E2II 3CCVZ 3G71Z 2OOYB 1Y1VS 3K7AI 3S16I 2H85A 4E33A 3CMA1 4HGZA 4NBHA 3CCJ1 3J7A4 1I50I 4MONA 4BBRI 4NBDA 4X6AI 3CCQZ 3CCU1 3GTQI 1KQSY 4RVHA 1YIJ1 2RPRA 1TWHI 2R92I 2PMZA 3NH8A 2NVTI 3PO3I 3RZDI 3RZOI 2P28A 3CMAZ 4RVGA 4HGYA 2M6NA 3CCJZ 1K9M1 4NBAA 1WW9A 3GKQA 3I561 1NJI2 3NH5A 3GTOI 3CCUZ 1YIJZ 1DL6A 1KRLA 3I551 4NBFA 2E9HA 2RT9A 1QVGY 1QVFZ 1X3ZA 3OW2Y 1TWCI 1X3WA 1KC81 2DE5A 2EGTA 4RV9A 1Y1VI 5IP9I 3HOZI 3IFUA 3J80b 2IZ3A 2W04A 4DK1A 1USPA 4A3FI 3I56Z 3S2HI 2QLVB 3LUSA 1M901 3CC71 2W03A 1YJN1 3HOVI 4TNUA 1Y1WI 2E2HI 2YADA 1VQO1 2P3YA 4MD8A 1Q811 4NBCA 1Q7Y1 2NVQI 1QF8A 2JR6A 1K732 3S1MI 3PO2I 1VQ51 1TWFI 3S15I 5D1OA 3CCE1 4MXUA 1RO0A 2QKDA 5FLXb 4BBSI 1VQL1 1JJ2Y 5AN9F 1VQOZ 1TFIA 1KD12 3FQMA 1K8A2 2JMOA 3VMIA 1P9NA 5C3EI 1YIT1 1RO4A 4A3BI 1VQ5Z 4MD7A 1QYPA 4MH4A 4A3JI 3KIHA 2V8JA 2ZAEB 3HOUI 3CCEZ 3I4NI 2RBLA 3J81b 1WIIA 3I07A 3GTPI 1Z01A 1VQLZ 4E31A 1NJI1 2HF1A 5D1OB 3CXCY 4BY7I 1VQ8Z 3CCMZ 2QA41 5IT9f 1YITZ 3S1QI 1ZB8A 1W2BY 4MRIA 4E2XA 2K5RA 5A2Qf 2M48A 2F4MA 4A93I 3FKII 3BG0B 1YJW1 3S2DI 5C44I 3JAMf 1ML8A 5LL6f 2YU9I 1KQSZ 2QA4Z 3GCFA 5C4JI 1VQ71 3MONA 4E2ZA 1YJ91 4NBEA 4RVDA 1I3QI 3MZLB 1VQN1 1X0TA 1YHQ1 2I3CA 1SFOI 1YJWZ 4RS4A 3VB9A 3F3PC 3HOXI 3GTMS 5T64A 1M1K2 2VUGA 1Z02A 1QVFY 2R6MA 3CMEZ 1VLAA 3VTNA 1VQ7Z 2VUMI 2G2KA 1RO2A 3EERA 2JA8I 1YJ9Z 2Q51A 4NBGA 4E30A 1RLYA 2RIQA 1QVGZ 3M4OI 4NB8A 1VQNZ 1YHQZ 4DQYB 2RHBA 4MD9A 3TE5B 3NDIA 2OTJ1 2PM9A 2GU2A 4Y7NI 2JNYA 4HH4A 1TWGI 3I4MI 3CPWY 5T6BA 3U50C 4A3GI 3CCL1 3P5JB 1YUKA 2F4OA 3G6E1 1PFTA 2JA5I 4E2WA 4NFRA 3CD61 3IF8A 2GTHA 2AKLA 4EWCA 1VQ81 3CCM1 2OTJZ 2GTIA 5FLMI 3KIFA 4RVFA 1WCMI 1KC82 1RQFA 2V8KA 2WAQA 2JA6I 2NVXI 3CC21 2DE7A 4NOZA 3CCLZ 2DE6A 3VMHA 5C4XI 2LFUA 3T4NB 2LIYA 3GTLI 4A3MI 3G6EZ 1I6HI 4BXXI 3CD6Z 3H3VJ 3MZKB 4A3LI 2B63I 5IP7I 3HKZA 2JA7I 1Q812 4S1TA 1JWHC 1K83I 1Q7Y2 1M1K1 3Q87A 3CC2Z 3CQZI 2Q4ZA 2QR1B 2R93I 3CME1 1W2BZ 1ZB9A 3D6WA 3J80f 3GTKI 2IZ4A 5CM2M 4NB9A 2OOXB 1VQ91 1VQ61 2WB1A 1S7MA 3BG1B 4CL1A 1Q822 1R9TI 3NFZA 1K731 3CCR1 1RNIA 5T67A 3S1RI 1Q862 3S1NI 5IT9b 3GTJI 1N8R2 1Z03A 2QRCB 1S721 2QRDB 2JUBA 2VF1A 5A2Qb 2O4HA 3EEDA 1KD11 3HOYI 3ESWA 3OW2Z 1TWAI 1K8A1 1VQ9Z 1VQ6Z 1NUIA 2E2JI 3CCRZ 3JAMb 2OTL1 4Y52I 5FLXf 3CCS1 3VMGA 1VQ41 2KPIA 3G4S1 1YI21 3QWUA 1S72Z 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 1;  3CCU Z;  1W2B Y;  1YIJ Z;  3CC2 1;  3I55 Z;  3I55 1;  1K9M 2;  3CCL Z;  1QVG Y;  1QVF Z;  3OW2 Y;  1YJW 1;  2OTL Z;  3G6E Z;  1KC8 1;  1VQK 1;  1VQM 1;  3CCS Z;  3CD6 Z;  2QEX 1;  1VQ4 Z;  1KQS Z;  2QA4 Z;  3G4S Z;  1YI2 Z;  1VQ7 1;  1Q81 2;  3CPW Z;  3I56 Z;  1YJ9 1;  1M90 1;  1Q7Y 2;  3CC4 Z;  1M1K 1;  3CC7 Z;  1VQN 1;  3CC7 1;  1YHQ 1;  1JJ2 Z;  3CC2 Z;  1VQP 1;  1YJN Z;  1YJN 1;  1YJW Z;  3CCV 1;  1VQO 1;  1Q81 1;  3G71 1;  1M90 2;  1VQK Z;  1VQM Z;  1M1K 2;  1Q7Y 1;  1QVF Y;  3CME Z;  2QEX Z;  3CME 1;  1W2B Z;  1Q82 1;  1K73 2;  1VQ7 Z;  1VQ5 1;  1YJ9 Z;  1Q86 1;  3CCQ 1;  1QVG Z;  3CCE 1;  1VQN Z;  1VQ9 1;  1YHQ Z;  1VQ6 1;  1VQP Z;  1N8R 1;  1Q82 2;  1K73 1;  3CXC Z;  1VQL 1;  3CCR 1;  3CCV Z;  1JJ2 Y;  1VQO Z;  1Q86 2;  1KD1 2;  3G71 Z;  1K8A 2;  1N8R 2;  3CMA 1;  3CCJ 1;  1YIT 1;  1S72 1;  2OTJ 1;  1VQ5 Z;  3CCQ Z;  3CCU 1;  1KQS Y;  1KD1 1;  1YIJ 1;  3CCE Z;  3OW2 Z;  1K8A 1;  1VQ9 Z;  1VQ6 Z;  3CPW Y;  3CCL 1;  1VQL Z;  3CCR Z;  1NJI 1;  2OTL 1;  3G6E 1;  3CCS 1;  3CD6 1;  3CXC Y;  1VQ8 Z;  3CMA Z;  3CCM Z;  1VQ4 1;  1VQ8 1;  2QA4 1;  3CCM 1;  3CCJ Z;  1YIT Z;  1K9M 1;  3G4S 1;  1YI2 1;  1S72 Z;  2OTJ Z;  3I56 1;  1NJI 2;  1KC8 2; 
#chains in the Genus database with same CATH topology
 1FDI A;  3CC4 1;  2PK7 A;  3I55 Z;  1YUA A;  4QTT A;  2J6A A;  1K9M 2;  2Y0S A;  4NH1 C;  5D1P A;  3J81 f;  2OTL Z;  1VQK 1;  1VQM 1;  3CCS Z;  4QTU A;  3GTM I;  2QEX 1;  1VQ4 Z;  1L1O C;  4A3I I;  4A3C I;  3S14 I;  2K3R A;  3G4S Z;  1YI2 Z;  4A3D I;  2V8I A;  4A3K I;  1FDO A;  3CPW Z;  3NH4 A;  3S17 I;  1LQL A;  3HOW I;  3CC4 Z;  3CC7 Z;  3M3Y I;  4XX2 A;  2HU9 A;  1JJ2 Z;  2NVY I;  1VQP 1;  1YJN Z;  3TDH B;  2OZK A;  3PO3 S;  1USP B;  1N2F A;  2KI7 B;  3F3F C;  4A3E I;  2BJO A;  4AYB A;  3CCV 1;  3D9X A;  3G71 1;  1M90 2;  3H0G I;  4NBB A;  1VQK Z;  1VQM Z;  4DGL A;  3GTG I;  2QEX Z;  2JS4 A;  2QRE B;  1Q82 1;  2R7Z I;  2O53 A;  1ZH1 A;  2V45 A;  3CCQ 1;  3NDJ A;  2LEX A;  1Q86 1;  3IX0 A;  1NP6 A;  4BY1 I;  1VQP Z;  1N8R 1;  3FQQ A;  4E32 A;  3CXC Z;  2E2I I;  3CCV Z;  3G71 Z;  2OOY B;  1Y1V S;  3K7A I;  3S16 I;  1Q16 A;  2H85 A;  4E33 A;  3CMA 1;  4HGZ A;  4NBH A;  3CCJ 1;  3J7A 4;  1I50 I;  4MON A;  2JIM A;  4BBR I;  4NBD A;  4X6A I;  3CCQ Z;  3CCU 1;  3GTQ I;  1KQS Y;  4RVH A;  1YIJ 1;  2RPR A;  1TWH I;  2R92 I;  2PMZ A;  3NH8 A;  2NVT I;  3PO3 I;  3RZD I;  3RZO I;  2P28 A;  3CMA Z;  4RVG A;  4HGY A;  2M6N A;  3CCJ Z;  1K9M 1;  4NBA A;  2JIP A;  1WW9 A;  3GKQ A;  3I56 1;  1NJI 2;  3NH5 A;  3GTO I;  3CCU Z;  1YIJ Z;  1WZN A;  1DL6 A;  1KRL A;  3I55 1;  4NBF A;  2E9H A;  2RT9 A;  1QVG Y;  1QVF Z;  1X3Z A;  3OW2 Y;  1TWC I;  1X3W A;  2IV2 X;  2V3V A;  2DE5 A;  1KC8 1;  2EGT A;  4RV9 A;  1Y1V I;  5IP9 I;  3HOZ I;  3IFU A;  3J80 b;  2IZ3 A;  2W04 A;  4DK1 A;  1USP A;  4A3F I;  3I56 Z;  3S2H I;  2QLV B;  3LUS A;  1M90 1;  3CC7 1;  2E7Z A;  2W03 A;  1YJN 1;  3HOV I;  4TNU A;  1Y1W I;  2E2H I;  2YAD A;  1VQO 1;  2P3Y A;  4MD8 A;  1Q81 1;  4NBC A;  1Q7Y 1;  2NVQ I;  1QF8 A;  2JR6 A;  1K73 2;  3S1M I;  3PO2 I;  1Y8C A;  1VQ5 1;  1TWF I;  2AYD A;  3S15 I;  5D1O A;  3CCE 1;  2VPZ A;  4MXU A;  1AA6 A;  1RO0 A;  2QKD A;  5FLX b;  4BBS I;  1VQL 1;  1JJ2 Y;  5AN9 F;  1VQO Z;  1TFI A;  1KD1 2;  3IR7 A;  3FQM A;  1K8A 2;  2JMO A;  3VMI A;  1P9N A;  5C3E I;  2NAP A;  2VPW A;  1YIT 1;  1RO4 A;  4A3B I;  1VQ5 Z;  4MD7 A;  1QYP A;  4MH4 A;  4A3J I;  3KIH A;  2V8J A;  2ZAE B;  3HOU I;  3CCE Z;  3I4N I;  2RBL A;  1WJ2 A;  3J81 b;  1WII A;  3I07 A;  3GTP I;  1Z01 A;  1VQL Z;  4E31 A;  1NJI 1;  2HF1 A;  5D1O B;  3CXC Y;  4BY7 I;  1VQ8 Z;  2JIR A;  3CCM Z;  2VPY A;  2QA4 1;  5IT9 f;  1YIT Z;  3S1Q I;  1ZB8 A;  1W2B Y;  4MRI A;  4E2X A;  2K5R A;  5A2Q f;  2M48 A;  2F4M A;  4A93 I;  3FKI I;  3BG0 B;  1YJW 1;  3S2D I;  5C44 I;  3JAM f;  1ML8 A;  5LL6 f;  2YU9 I;  1KQS Z;  2QA4 Z;  3GCF A;  5C4J I;  1VQ7 1;  3MON A;  4E2Z A;  1YJ9 1;  4NBE A;  4RVD A;  1I3Q I;  3MZL B;  1VQN 1;  1X0T A;  1YHQ 1;  2I3C A;  1SFO I;  1YJW Z;  4RS4 A;  3VB9 A;  3F3P C;  3HOX I;  3GTM S;  5T64 A;  1M1K 2;  2VUG A;  1Z02 A;  1QVF Y;  2R6M A;  3CME Z;  3D2L A;  1VLA A;  3VTN A;  1VQ7 Z;  2VUM I;  2G2K A;  1RO2 A;  3EER A;  2JA8 I;  1YJ9 Z;  2Q51 A;  2JIO A;  4NBG A;  4E30 A;  1RLY A;  2RIQ A;  1QVG Z;  3M4O I;  4NB8 A;  1VQN Z;  1YHQ Z;  4DQY B;  2RHB A;  4MD9 A;  3TE5 B;  3NDI A;  2OTJ 1;  2PM9 A;  2GU2 A;  4Y7N I;  2JNY A;  4HH4 A;  1TWG I;  3I4M I;  3CPW Y;  5T6B A;  3U50 C;  4A3G I;  3CCL 1;  3P5J B;  1YUK A;  2F4O A;  3G6E 1;  1PFT A;  2JA5 I;  4E2W A;  4NFR A;  3CD6 1;  3IF8 A;  2GTH A;  2AKL A;  4EWC A;  1VQ8 1;  3CCM 1;  2OTJ Z;  2GTI A;  5FLM I;  3KIF A;  1SIW A;  4RVF A;  1WCM I;  1KC8 2;  1RQF A;  2V8K A;  2WAQ A;  2JA6 I;  2JIQ A;  2NVX I;  3CC2 1;  2DE7 A;  4NOZ A;  3CCL Z;  2DE6 A;  3VMH A;  5C4X I;  2LFU A;  3T4N B;  2LIY A;  3GTL I;  4A3M I;  3G6E Z;  1I6H I;  4BXX I;  3CD6 Z;  3H3V J;  3MZK B;  4A3L I;  2B63 I;  5IP7 I;  3HKZ A;  2JA7 I;  1Q81 2;  4S1T A;  1JWH C;  1K83 I;  1Q7Y 2;  1M1K 1;  3Q87 A;  3CC2 Z;  3CQZ I;  2VPX A;  2Q4Z A;  2QR1 B;  2R93 I;  3CME 1;  1W2B Z;  1ZB9 A;  3D6W A;  3J80 f;  3GTK I;  2IZ4 A;  5CM2 M;  4NB9 A;  2OOX B;  1VQ9 1;  1VQ6 1;  2WB1 A;  1S7M A;  3BG1 B;  4CL1 A;  1Q82 2;  1R9T I;  3NFZ A;  1K73 1;  3CCR 1;  1RNI A;  5T67 A;  3S1R I;  1Q86 2;  3S1N I;  5IT9 b;  3GTJ I;  1N8R 2;  1Z03 A;  2QRC B;  1S72 1;  2QRD B;  2JUB A;  2VF1 A;  5A2Q b;  2O4H A;  3EED A;  1KD1 1;  3HOY I;  3ESW A;  3OW2 Z;  1TWA I;  1K8A 1;  1VQ9 Z;  1VQ6 Z;  1NUI A;  2E2J I;  3CCR Z;  3JAM b;  2OTL 1;  4Y52 I;  5FLX f;  3CCS 1;  3VMG A;  1VQ4 1;  2KPI A;  3G4S 1;  1YI2 1;  3QWU A;  1S72 Z;  4E2Y A;  1QXF A; 
#chains in the Genus database with same CATH homology
 3CC4 1;  2PK7 A;  3I55 Z;  1YUA A;  4QTT A;  2J6A A;  1K9M 2;  2Y0S A;  4NH1 C;  5D1P A;  3J81 f;  2OTL Z;  1VQK 1;  1VQM 1;  3CCS Z;  4QTU A;  3GTM I;  2QEX 1;  1VQ4 Z;  1L1O C;  4A3I I;  4A3C I;  3S14 I;  2K3R A;  3G4S Z;  1YI2 Z;  4A3D I;  2V8I A;  4A3K I;  3CPW Z;  3NH4 A;  3S17 I;  1LQL A;  3HOW I;  3CC4 Z;  3CC7 Z;  3M3Y I;  4XX2 A;  2HU9 A;  1JJ2 Z;  2NVY I;  1VQP 1;  1YJN Z;  3TDH B;  2OZK A;  3PO3 S;  1USP B;  1N2F A;  2KI7 B;  3F3F C;  4A3E I;  2BJO A;  4AYB A;  3CCV 1;  3D9X A;  3G71 1;  1M90 2;  3H0G I;  4NBB A;  1VQK Z;  1VQM Z;  4DGL A;  3GTG I;  2QEX Z;  2JS4 A;  2QRE B;  1Q82 1;  2R7Z I;  2O53 A;  1ZH1 A;  3NDJ A;  3CCQ 1;  1Q86 1;  3IX0 A;  1NP6 A;  4BY1 I;  1VQP Z;  1N8R 1;  3FQQ A;  4E32 A;  3CXC Z;  2E2I I;  3CCV Z;  3G71 Z;  2OOY B;  1Y1V S;  3K7A I;  3S16 I;  2H85 A;  4E33 A;  3CMA 1;  4HGZ A;  4NBH A;  3CCJ 1;  3J7A 4;  1I50 I;  4MON A;  4BBR I;  4NBD A;  4X6A I;  3CCQ Z;  3CCU 1;  3GTQ I;  1KQS Y;  4RVH A;  1YIJ 1;  2RPR A;  1TWH I;  2R92 I;  2PMZ A;  3NH8 A;  2NVT I;  3PO3 I;  3RZD I;  3RZO I;  2P28 A;  3CMA Z;  4RVG A;  4HGY A;  2M6N A;  3CCJ Z;  1K9M 1;  4NBA A;  1WW9 A;  3GKQ A;  3I56 1;  1NJI 2;  3NH5 A;  3GTO I;  3CCU Z;  1YIJ Z;  1DL6 A;  1KRL A;  3I55 1;  4NBF A;  2E9H A;  2RT9 A;  1QVG Y;  1QVF Z;  1X3Z A;  3OW2 Y;  1TWC I;  1X3W A;  1KC8 1;  2DE5 A;  2EGT A;  4RV9 A;  1Y1V I;  5IP9 I;  3HOZ I;  3IFU A;  3J80 b;  2IZ3 A;  2W04 A;  4DK1 A;  1USP A;  4A3F I;  3I56 Z;  3S2H I;  2QLV B;  3LUS A;  1M90 1;  3CC7 1;  2W03 A;  1YJN 1;  3HOV I;  4TNU A;  1Y1W I;  2E2H I;  2YAD A;  1VQO 1;  2P3Y A;  4MD8 A;  1Q81 1;  4NBC A;  1Q7Y 1;  2NVQ I;  1QF8 A;  2JR6 A;  1K73 2;  3S1M I;  3PO2 I;  1VQ5 1;  1TWF I;  3S15 I;  5D1O A;  3CCE 1;  4MXU A;  1RO0 A;  2QKD A;  5FLX b;  4BBS I;  1VQL 1;  1JJ2 Y;  5AN9 F;  1VQO Z;  1TFI A;  1KD1 2;  3FQM A;  1K8A 2;  2JMO A;  3VMI A;  1P9N A;  5C3E I;  1YIT 1;  1RO4 A;  4A3B I;  1VQ5 Z;  4MD7 A;  1QYP A;  4MH4 A;  4A3J I;  3KIH A;  2V8J A;  2ZAE B;  3HOU I;  3CCE Z;  3I4N I;  2RBL A;  3J81 b;  1WII A;  3I07 A;  3GTP I;  1Z01 A;  1VQL Z;  4E31 A;  1NJI 1;  2HF1 A;  5D1O B;  3CXC Y;  4BY7 I;  1VQ8 Z;  3CCM Z;  2QA4 1;  5IT9 f;  1YIT Z;  3S1Q I;  1ZB8 A;  1W2B Y;  4MRI A;  4E2X A;  2K5R A;  5A2Q f;  2M48 A;  2F4M A;  4A93 I;  3FKI I;  3BG0 B;  1YJW 1;  3S2D I;  5C44 I;  3JAM f;  1ML8 A;  5LL6 f;  2YU9 I;  1KQS Z;  2QA4 Z;  3GCF A;  5C4J I;  1VQ7 1;  3MON A;  4E2Z A;  1YJ9 1;  4NBE A;  4RVD A;  1I3Q I;  3MZL B;  1VQN 1;  1X0T A;  1YHQ 1;  2I3C A;  1SFO I;  1YJW Z;  4RS4 A;  3VB9 A;  3F3P C;  3HOX I;  3GTM S;  5T64 A;  1M1K 2;  2VUG A;  1Z02 A;  1QVF Y;  2R6M A;  3CME Z;  1VLA A;  3VTN A;  1VQ7 Z;  2VUM I;  2G2K A;  1RO2 A;  3EER A;  2JA8 I;  1YJ9 Z;  2Q51 A;  4NBG A;  4E30 A;  1RLY A;  2RIQ A;  1QVG Z;  3M4O I;  4NB8 A;  1VQN Z;  1YHQ Z;  4DQY B;  2RHB A;  4MD9 A;  3TE5 B;  3NDI A;  2OTJ 1;  2PM9 A;  2GU2 A;  4Y7N I;  2JNY A;  4HH4 A;  1TWG I;  3I4M I;  3CPW Y;  5T6B A;  3U50 C;  4A3G I;  3CCL 1;  3P5J B;  1YUK A;  2F4O A;  3G6E 1;  1PFT A;  2JA5 I;  4E2W A;  4NFR A;  3CD6 1;  3IF8 A;  2GTH A;  2AKL A;  4EWC A;  1VQ8 1;  3CCM 1;  2OTJ Z;  2GTI A;  5FLM I;  3KIF A;  4RVF A;  1WCM I;  1KC8 2;  1RQF A;  2V8K A;  2WAQ A;  2JA6 I;  2NVX I;  3CC2 1;  2DE7 A;  4NOZ A;  3CCL Z;  2DE6 A;  3VMH A;  5C4X I;  2LFU A;  3T4N B;  2LIY A;  3GTL I;  4A3M I;  3G6E Z;  1I6H I;  4BXX I;  3CD6 Z;  3H3V J;  3MZK B;  4A3L I;  2B63 I;  5IP7 I;  3HKZ A;  2JA7 I;  1Q81 2;  4S1T A;  1JWH C;  1K83 I;  1Q7Y 2;  1M1K 1;  3Q87 A;  3CC2 Z;  3CQZ I;  2Q4Z A;  2QR1 B;  2R93 I;  3CME 1;  1W2B Z;  1ZB9 A;  3D6W A;  3J80 f;  3GTK I;  2IZ4 A;  5CM2 M;  4NB9 A;  2OOX B;  1VQ9 1;  1VQ6 1;  2WB1 A;  1S7M A;  3BG1 B;  4CL1 A;  1Q82 2;  1R9T I;  3NFZ A;  1K73 1;  3CCR 1;  1RNI A;  5T67 A;  3S1R I;  1Q86 2;  3S1N I;  5IT9 b;  3GTJ I;  1N8R 2;  1Z03 A;  2QRC B;  1S72 1;  2QRD B;  2JUB A;  2VF1 A;  5A2Q b;  2O4H A;  3EED A;  1KD1 1;  3HOY I;  3ESW A;  3OW2 Z;  1TWA I;  1K8A 1;  1VQ9 Z;  1VQ6 Z;  1NUI A;  2E2J I;  3CCR Z;  3JAM b;  2OTL 1;  4Y52 I;  5FLX f;  3CCS 1;  3VMG A;  1VQ4 1;  2KPI A;  3G4S 1;  1YI2 1;  3QWU A;  1S72 Z;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...