3CC2Z

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc2Z00
2QA4Z 3CCE1 1YITZ 3CME1 1KQSZ 1K731 1VQ71 1K9M2 3CCL1 3CCRZ 3I561 3CD6Z 3OW2Z 1VQ41 1S721 3CCU1 1VQ51 3CCMZ 1YI2Z 1Q821 1VQNZ 3CMA1 1Q7Y1 1KQSY 1VQMZ 1YJWZ 3I551 1VQ9Z 3CXCZ 1VQ61 3CCQ1 1YIT1 3OW2Y 3G6EZ 3CC71 3G4SZ 1VQLZ 1YJN1 1K8A1 1JJ2Y 1YIJZ 1VQOZ 1KC81 3CXCY 3CCSZ 1NJI2 1QVGZ 2OTJ1 1YHQ1 1Q861 2QEXZ 1KD11 1Q811 1VQK1 3CPWY 3CC4Z 1VQP1 3G711 1VQ81 2QA41 3CCVZ 1QVGY 3CCR1 3CCJZ 1M1K2 3CC2Z 2OTLZ 3CD61 1N8R2 1YJ9Z 3CCEZ 1K732 3CMEZ 3CCM1 1YI21 1VQ7Z 1VQN1 1M901 3CCLZ 3I56Z 1VQM1 1YJW1 1QVFZ 1VQ91 1VQ4Z 1S72Z 3G6E1 3CCUZ 1VQ5Z 1Q822 1Q7Y2 3CMAZ 3G4S1 1VQL1 3I55Z 1YIJ1 3CCQZ 1VQ6Z 1QVFY 1K9M1 1VQO1 3CC7Z 3CCS1 1W2BZ 1NJI1 2QEX1 1YJNZ 1K8A2 3CC41 1KC82 1M902 2OTJZ 1JJ2Z 1Q862 1YHQZ 1KD12 1Q812 3CCV1 1W2BY 1VQKZ 3CCJ1 1M1K1 3CC21 1VQPZ 2OTL1 3G71Z 1VQ8Z 1YJ91 1N8R1 3CPWZ
chains in the Genus database with same CATH superfamily
1RNIA 1K731 1Y1VS 3CCL1 5A2Qf 2QREB 3I561 3MZKB 3S1MI 1X0TA 2NVTI 1S721 2NVYI 2QRCB 4E2WA 1VQ51 2E9HA 1YI2Z 2DE6A 1Q7Y1 1Y8CA 3CMA1 5CM2M 3S1RI 2K3RA 1RLYA 2E2II 3D2LA 4BBSI 1KRLA 1YIT1 3HOVI 3G6EZ 3NDIA 3M3YI 1Z03A 1VQLZ 4NOZA 3K7AI 1JJ2Y 2QR1B 2H85A 1KC81 3CCSZ 5C3EI 1YHQ1 3VMIA 1Q811 1VLAA 1ZH1A 3CPWY 4E32A 2V8KA 2QRDB 5T64A 1QVGY 4E30A 2P28A 4NBEA 2I3CA 2V8IA 3HOUI 1QXFA 3S2DI 3CMEZ 1YI21 3VB9A 4MRIA 3S2HI 3S14I 4BY7I 3G6E1 3GTOI 2LEXA 3TDHB 5A2Qb 4E2XA 4AYBA 1VQL1 5C4XI 5T67A 1NUIA 1K83I 1VQ6Z 1QF8A 5C44I 3J7A4 2M6NA 1QYPA 1RO4A 1WIIA 3CCS1 2R7ZI 4NBDA 3S17I 1FDOA 2B63I 1K8A2 4E31A 2W03A 4X6AI 2F4OA 2V45A 1ML8A 2OTJZ 4DK1A 1JJ2Z 2JIPA 1WCMI 2HU9A 4RVGA 1M1K1 4A3DI 4A3BI 3IF8A 2JS4A 1ZB8A 3IR7A 3CPWZ 2JIOA 3FQMA 1YITZ 4EWCA 3CME1 1KQSZ 1X3ZA 3CCRZ 2Q4ZA 4RVHA 3CD6Z 3PO3I 4A3GI 2RPRA 3IX0A 1Q821 3RZOI 3KIHA 2VPXA 1R9TI 1YJWZ 2KPIA 2JA7I 1TWGI 1VQ61 3BG1B 2RHBA 3OW2Y 3I07A 3IFUA 2E2HI 2VF1A 4NBBA 3GTKI 1YIJZ 3NH5A 3CXCY 3HOWI 4HH4A 2PK7A 1NJI2 5AN9F 2OTJ1 2BJOA 2M48A 1Q861 1KD11 1SFOI 3GTJI 2YADA 3CC4Z 5T6BA 2Q51A 4A3LI 3EERA 3EEDA 3NH8A 2VPWA 3GTLI 3CCJZ 2JUBA 3CCR1 2JIRA 3LUSA 5C4JI 3CD61 3U50C 1YJ9Z 4RV9A 3F3FC 4BY1I 3CCEZ 1K732 3S1QI 5IT9f 3GTMS 1YJW1 3GTPI 2RBLA 2W04A 3ESWA 3D6WA 3CCUZ 3MONA 1Q7Y2 2VUMI 2JA5I 4DGLA 3I55Z 5FLMI 1TWAI 1YIJ1 3CCQZ 1QVFY 3JAMf 2EGTA 1W2BZ 1USPA 2LIYA 3VTNA 3CC41 1KC82 3MZLB 4A3JI 4A93I 1Q812 4MD7A 1VQKZ 4MD9A 4XX2A 3CCJ1 1WW9A 2GTHA 4TNUA 2OOXB 1NP6A 1S7MA 4RVDA 5FLXf 1YJ91 1N8R1 1DL6A 2QA4Z 2NAPA 3CCE1 2WAQA 4HGYA 2E7ZA 1FDIA 2Y0SA 3GKQA 4RS4A 3CCU1 2AKLA 2P3YA 3CCMZ 2PM9A 4NBAA 3Q87A 4NB8A 2OOYB 1VQMZ 2AYDA 3VMHA 3I551 1VQ9Z 2NVXI 3CCQ1 3P5JB 4DQYB 4A3FI 5IT9b 2VPZA 4A3MI 4NBGA 3J80f 3FQQA 4BXXI 2GTIA 3GCFA 1Y1VI 4RVFA 1TWCI 4MD8A 4S1TA 3NDJA 1QVGZ 2E2JI 2F4MA 4MXUA 2DE5A 4A3KI 3TE5B 2RT9A 4QTUA 1VQK1 2QLVB 3JAMb 2O53A 1RQFA 1USPB 3HOZI 2QA41 3CCVZ 1I6HI 1M1K2 3CC2Z 4Y7NI 2JA6I 4NB9A 2IZ3A 3CCM1 3HKZA 1VQ7Z 4NFRA 1M901 5D1PA 3H3VJ 1VQM1 5FLXb 2ZAEB 1L1OC 1VQ91 1VQ4Z 2KI7B 5LL6f 1Q822 3D9XA 2J6AA 2V3VA 1K9M1 2JMOA 2V8JA 3M4OI 3CC7Z 2OZKA 4QTTA 2JIMA 2WB1A 2QKDA 3PO3S 1YJNZ 5D1OA 2VUGA 1I50I 1M902 3PO2I 2R6MA 4MONA 4CL1A 1JWHC 2YU9I 3I4NI 1Q862 1KD12 3RZDI 3J80b 1Q16A 3HOXI 3CCV1 4E2ZA 1PFTA 3S16I 3CC21 1VQPZ 3NH4A 3G71Z 1VQ8Z 3QWUA 5IP7I 1VQ71 1K9M2 4A3II 3OW2Z 1X3WA 1VQ41 3NFZA 1VQNZ 3H0GI 3HOYI 3T4NB 1Z02A 2JIQA 1KQSY 1LQLA 1RO0A 3CXCZ 2VPYA 2DE7A 1AA6A 2R93I 2LFUA 3CC71 2JA8I 4E2YA 1Y1WI 2IZ4A 3G4SZ 1YJN1 1K8A1 3S15I 4NH1C 1ZB9A 2RIQA 1VQOZ 3J81f 1N2FA 2NVQI 2QEXZ 3KIFA 3VMGA 2R92I 2JNYA 1VQP1 1P9NA 3G711 1VQ81 1TWFI 3S1NI 5D1OB 1WZNA 4BBRI 3GTGI 2OTLZ 2GU2A 5IP9I 4Y52I 1N8R2 3F3PC 2JR6A 4MH4A 3GTQI 4NBHA 4HGZA 1VQN1 3CCLZ 2G2KA 3I56Z 1QVFZ 3CQZI 1S72Z 1VQ5Z 2O4HA 3CMAZ 4E33A 3G4S1 1YUAA 2HF1A 1TFIA 1VQO1 4NBFA 4A3CI 1NJI1 2K5RA 2QEX1 1WJ2A 3BG0B 3FKII 4A3EI 1I3QI 1TWHI 3GTMI 1Z01A 2PMZA 1RO2A 1YHQZ 1YUKA 2IV2X 1W2BY 4NBCA 1SIWA 3I4MI 2OTL1 3J81b
chains in the Genus database with same CATH topology
1RNIA 1K731 1Y1VS 3CCL1 5A2Qf 2QREB 3I561 3MZKB 3S1MI 1X0TA 2NVTI 1S721 2NVYI 2QRCB 4E2WA 1VQ51 2E9HA 1YI2Z 2DE6A 1Q7Y1 3CMA1 5CM2M 3S1RI 2K3RA 1RLYA 2E2II 4BBSI 1KRLA 1YIT1 3HOVI 3G6EZ 3NDIA 3M3YI 1Z03A 1VQLZ 4NOZA 3K7AI 1JJ2Y 2QR1B 2H85A 1KC81 3CCSZ 5C3EI 1YHQ1 3VMIA 1Q811 1VLAA 1ZH1A 3CPWY 4E32A 2V8KA 2QRDB 5T64A 1QVGY 4E30A 2P28A 4NBEA 2I3CA 2V8IA 3HOUI 3S2DI 3CMEZ 1YI21 3VB9A 4MRIA 3S2HI 3S14I 4BY7I 3G6E1 3GTOI 3TDHB 5A2Qb 4E2XA 4AYBA 1VQL1 5C4XI 5T67A 1NUIA 1K83I 1VQ6Z 1QF8A 5C44I 3J7A4 2M6NA 1QYPA 1RO4A 1WIIA 3CCS1 2R7ZI 4NBDA 3S17I 2B63I 1K8A2 4E31A 2W03A 4X6AI 2F4OA 1ML8A 2OTJZ 4DK1A 1JJ2Z 1WCMI 2HU9A 4RVGA 1M1K1 4A3DI 4A3BI 3IF8A 2JS4A 1ZB8A 3CPWZ 3FQMA 1YITZ 4EWCA 3CME1 1KQSZ 1X3ZA 3CCRZ 2Q4ZA 4RVHA 3CD6Z 3PO3I 4A3GI 2RPRA 3IX0A 1Q821 3RZOI 3KIHA 1R9TI 1YJWZ 2KPIA 2JA7I 1TWGI 1VQ61 3BG1B 2RHBA 3OW2Y 3I07A 3IFUA 2E2HI 2VF1A 4NBBA 3GTKI 1YIJZ 3NH5A 3CXCY 3HOWI 4HH4A 2PK7A 1NJI2 5AN9F 2OTJ1 2BJOA 2M48A 1Q861 1KD11 1SFOI 3GTJI 2YADA 3CC4Z 5T6BA 2Q51A 4A3LI 3EERA 3EEDA 3NH8A 3GTLI 3CCJZ 2JUBA 3CCR1 3LUSA 5C4JI 3CD61 3U50C 1YJ9Z 4RV9A 3F3FC 4BY1I 3CCEZ 1K732 3S1QI 5IT9f 3GTMS 1YJW1 3GTPI 2RBLA 2W04A 3ESWA 3D6WA 3CCUZ 3MONA 1Q7Y2 2VUMI 2JA5I 4DGLA 3I55Z 5FLMI 1TWAI 1YIJ1 3CCQZ 1QVFY 3JAMf 2EGTA 1W2BZ 1USPA 2LIYA 3VTNA 3CC41 1KC82 3MZLB 4A3JI 4A93I 1Q812 4MD7A 1VQKZ 4MD9A 4XX2A 3CCJ1 1WW9A 2GTHA 4TNUA 2OOXB 1NP6A 1S7MA 4RVDA 5FLXf 1YJ91 1N8R1 1DL6A 2QA4Z 3CCE1 2WAQA 4HGYA 2Y0SA 3GKQA 4RS4A 3CCU1 2AKLA 2P3YA 3CCMZ 2PM9A 4NBAA 3Q87A 4NB8A 2OOYB 1VQMZ 3VMHA 3I551 1VQ9Z 2NVXI 3CCQ1 3P5JB 4DQYB 4A3FI 5IT9b 4A3MI 4NBGA 3J80f 3FQQA 4BXXI 2GTIA 3GCFA 1Y1VI 4RVFA 1TWCI 4MD8A 4S1TA 3NDJA 1QVGZ 2E2JI 2F4MA 4MXUA 2DE5A 4A3KI 3TE5B 2RT9A 4QTUA 1VQK1 2QLVB 3JAMb 2O53A 1RQFA 1USPB 3HOZI 2QA41 3CCVZ 1I6HI 1M1K2 3CC2Z 4Y7NI 2JA6I 4NB9A 2IZ3A 3CCM1 3HKZA 1VQ7Z 4NFRA 1M901 5D1PA 3H3VJ 1VQM1 5FLXb 2ZAEB 1L1OC 1VQ91 1VQ4Z 2KI7B 5LL6f 1Q822 3D9XA 2J6AA 1K9M1 2JMOA 2V8JA 3M4OI 3CC7Z 2OZKA 4QTTA 2WB1A 2QKDA 3PO3S 1YJNZ 5D1OA 2VUGA 1I50I 1M902 3PO2I 2R6MA 4MONA 4CL1A 1JWHC 2YU9I 3I4NI 1Q862 1KD12 3RZDI 3J80b 3HOXI 3CCV1 4E2ZA 1PFTA 3S16I 3CC21 1VQPZ 3NH4A 3G71Z 1VQ8Z 3QWUA 5IP7I 1VQ71 1K9M2 4A3II 3OW2Z 1X3WA 1VQ41 3NFZA 1VQNZ 3H0GI 3HOYI 3T4NB 1Z02A 1KQSY 1LQLA 1RO0A 3CXCZ 2DE7A 2R93I 2LFUA 3CC71 2JA8I 4E2YA 1Y1WI 2IZ4A 3G4SZ 1YJN1 1K8A1 3S15I 4NH1C 1ZB9A 2RIQA 1VQOZ 3J81f 1N2FA 2NVQI 2QEXZ 3KIFA 3VMGA 2R92I 2JNYA 1VQP1 1P9NA 3G711 1VQ81 1TWFI 3S1NI 5D1OB 4BBRI 3GTGI 2OTLZ 2GU2A 5IP9I 4Y52I 1N8R2 3F3PC 2JR6A 4MH4A 3GTQI 4NBHA 4HGZA 1VQN1 3CCLZ 2G2KA 3I56Z 1QVFZ 3CQZI 1S72Z 1VQ5Z 2O4HA 3CMAZ 4E33A 3G4S1 1YUAA 2HF1A 1TFIA 1VQO1 4NBFA 4A3CI 1NJI1 2K5RA 2QEX1 3BG0B 3FKII 4A3EI 1I3QI 1TWHI 3GTMI 1Z01A 2PMZA 1RO2A 1YHQZ 1YUKA 1W2BY 4NBCA 3I4MI 2OTL1 3J81b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  3CCE 1;  1YIT Z;  3CME 1;  1KQS Z;  1K73 1;  1VQ7 1;  1K9M 2;  3CCL 1;  3CCR Z;  3I56 1;  3CD6 Z;  3OW2 Z;  1VQ4 1;  1S72 1;  3CCU 1;  1VQ5 1;  3CCM Z;  1YI2 Z;  1Q82 1;  1VQN Z;  3CMA 1;  1Q7Y 1;  1KQS Y;  1VQM Z;  1YJW Z;  3I55 1;  1VQ9 Z;  3CXC Z;  1VQ6 1;  3CCQ 1;  1YIT 1;  3OW2 Y;  3G6E Z;  3CC7 1;  3G4S Z;  1VQL Z;  1YJN 1;  1K8A 1;  1JJ2 Y;  1YIJ Z;  1VQO Z;  1KC8 1;  3CXC Y;  3CCS Z;  1NJI 2;  1QVG Z;  2OTJ 1;  1YHQ 1;  1Q86 1;  2QEX Z;  1KD1 1;  1Q81 1;  1VQK 1;  3CPW Y;  3CC4 Z;  1VQP 1;  3G71 1;  1VQ8 1;  2QA4 1;  3CCV Z;  1QVG Y;  3CCR 1;  3CCJ Z;  1M1K 2;  3CC2 Z;  2OTL Z;  3CD6 1;  1N8R 2;  1YJ9 Z;  3CCE Z;  1K73 2;  3CME Z;  3CCM 1;  1YI2 1;  1VQ7 Z;  1VQN 1;  1M90 1;  3CCL Z;  3I56 Z;  1VQM 1;  1YJW 1;  1QVF Z;  1VQ9 1;  1VQ4 Z;  1S72 Z;  3G6E 1;  3CCU Z;  1VQ5 Z;  1Q82 2;  1Q7Y 2;  3CMA Z;  3G4S 1;  1VQL 1;  3I55 Z;  1YIJ 1;  3CCQ Z;  1VQ6 Z;  1QVF Y;  1K9M 1;  1VQO 1;  3CC7 Z;  3CCS 1;  1W2B Z;  1NJI 1;  2QEX 1;  1YJN Z;  1K8A 2;  3CC4 1;  1KC8 2;  1M90 2;  2OTJ Z;  1JJ2 Z;  1Q86 2;  1YHQ Z;  1KD1 2;  1Q81 2;  3CCV 1;  1W2B Y;  1VQK Z;  3CCJ 1;  1M1K 1;  3CC2 1;  1VQP Z;  2OTL 1;  3G71 Z;  1VQ8 Z;  1YJ9 1;  1N8R 1;  3CPW Z; 
#chains in the Genus database with same CATH topology
 1RNI A;  1K73 1;  1Y1V S;  3CCL 1;  5A2Q f;  2QRE B;  3I56 1;  3MZK B;  3S1M I;  1X0T A;  2NVT I;  1S72 1;  2NVY I;  2QRC B;  4E2W A;  1VQ5 1;  2E9H A;  1YI2 Z;  2DE6 A;  1Q7Y 1;  1Y8C A;  3CMA 1;  5CM2 M;  3S1R I;  2K3R A;  1RLY A;  2E2I I;  3D2L A;  4BBS I;  1KRL A;  1YIT 1;  3HOV I;  3G6E Z;  3NDI A;  3M3Y I;  1Z03 A;  1VQL Z;  4NOZ A;  3K7A I;  1JJ2 Y;  2QR1 B;  2H85 A;  1KC8 1;  3CCS Z;  5C3E I;  1YHQ 1;  3VMI A;  1Q81 1;  1VLA A;  1ZH1 A;  3CPW Y;  4E32 A;  2V8K A;  2QRD B;  5T64 A;  1QVG Y;  4E30 A;  2P28 A;  4NBE A;  2I3C A;  2V8I A;  3HOU I;  1QXF A;  3S2D I;  3CME Z;  1YI2 1;  3VB9 A;  4MRI A;  3S2H I;  3S14 I;  4BY7 I;  3G6E 1;  3GTO I;  2LEX A;  3TDH B;  5A2Q b;  4E2X A;  4AYB A;  1VQL 1;  5C4X I;  5T67 A;  1NUI A;  1K83 I;  1VQ6 Z;  1QF8 A;  5C44 I;  3J7A 4;  2M6N A;  1QYP A;  1RO4 A;  1WII A;  3CCS 1;  2R7Z I;  4NBD A;  3S17 I;  1FDO A;  2B63 I;  1K8A 2;  4E31 A;  2W03 A;  4X6A I;  2F4O A;  2V45 A;  1ML8 A;  2OTJ Z;  4DK1 A;  1JJ2 Z;  2JIP A;  1WCM I;  2HU9 A;  4RVG A;  1M1K 1;  4A3D I;  4A3B I;  3IF8 A;  2JS4 A;  1ZB8 A;  3IR7 A;  3CPW Z;  2JIO A;  3FQM A;  1YIT Z;  4EWC A;  3CME 1;  1KQS Z;  1X3Z A;  3CCR Z;  2Q4Z A;  4RVH A;  3CD6 Z;  3PO3 I;  4A3G I;  2RPR A;  3IX0 A;  1Q82 1;  3RZO I;  3KIH A;  2VPX A;  1R9T I;  1YJW Z;  2KPI A;  2JA7 I;  1TWG I;  1VQ6 1;  3BG1 B;  2RHB A;  3OW2 Y;  3I07 A;  3IFU A;  2E2H I;  2VF1 A;  4NBB A;  3GTK I;  1YIJ Z;  3NH5 A;  3CXC Y;  3HOW I;  4HH4 A;  2PK7 A;  1NJI 2;  5AN9 F;  2OTJ 1;  2BJO A;  2M48 A;  1Q86 1;  1KD1 1;  1SFO I;  3GTJ I;  2YAD A;  3CC4 Z;  5T6B A;  2Q51 A;  4A3L I;  3EER A;  3EED A;  3NH8 A;  2VPW A;  3GTL I;  3CCJ Z;  2JUB A;  3CCR 1;  2JIR A;  3LUS A;  5C4J I;  3CD6 1;  3U50 C;  1YJ9 Z;  4RV9 A;  3F3F C;  4BY1 I;  3CCE Z;  1K73 2;  3S1Q I;  5IT9 f;  3GTM S;  1YJW 1;  3GTP I;  2RBL A;  2W04 A;  3ESW A;  3D6W A;  3CCU Z;  3MON A;  1Q7Y 2;  2VUM I;  2JA5 I;  4DGL A;  3I55 Z;  5FLM I;  1TWA I;  1YIJ 1;  3CCQ Z;  1QVF Y;  3JAM f;  2EGT A;  1W2B Z;  1USP A;  2LIY A;  3VTN A;  3CC4 1;  1KC8 2;  3MZL B;  4A3J I;  4A93 I;  1Q81 2;  4MD7 A;  1VQK Z;  4MD9 A;  4XX2 A;  3CCJ 1;  1WW9 A;  2GTH A;  4TNU A;  2OOX B;  1NP6 A;  1S7M A;  4RVD A;  5FLX f;  1YJ9 1;  1N8R 1;  1DL6 A;  2QA4 Z;  2NAP A;  3CCE 1;  2WAQ A;  4HGY A;  2E7Z A;  1FDI A;  2Y0S A;  3GKQ A;  4RS4 A;  3CCU 1;  2AKL A;  2P3Y A;  3CCM Z;  2PM9 A;  4NBA A;  3Q87 A;  4NB8 A;  2OOY B;  1VQM Z;  2AYD A;  3VMH A;  3I55 1;  1VQ9 Z;  2NVX I;  3CCQ 1;  3P5J B;  4DQY B;  4A3F I;  5IT9 b;  2VPZ A;  4A3M I;  4NBG A;  3J80 f;  3FQQ A;  4BXX I;  2GTI A;  3GCF A;  1Y1V I;  4RVF A;  1TWC I;  4MD8 A;  4S1T A;  3NDJ A;  1QVG Z;  2E2J I;  2F4M A;  4MXU A;  2DE5 A;  4A3K I;  3TE5 B;  2RT9 A;  4QTU A;  1VQK 1;  2QLV B;  3JAM b;  2O53 A;  1RQF A;  1USP B;  3HOZ I;  2QA4 1;  3CCV Z;  1I6H I;  1M1K 2;  3CC2 Z;  4Y7N I;  2JA6 I;  4NB9 A;  2IZ3 A;  3CCM 1;  3HKZ A;  1VQ7 Z;  4NFR A;  1M90 1;  5D1P A;  3H3V J;  1VQM 1;  5FLX b;  2ZAE B;  1L1O C;  1VQ9 1;  1VQ4 Z;  2KI7 B;  5LL6 f;  1Q82 2;  3D9X A;  2J6A A;  2V3V A;  1K9M 1;  2JMO A;  2V8J A;  3M4O I;  3CC7 Z;  2OZK A;  4QTT A;  2JIM A;  2WB1 A;  2QKD A;  3PO3 S;  1YJN Z;  5D1O A;  2VUG A;  1I50 I;  1M90 2;  3PO2 I;  2R6M A;  4MON A;  4CL1 A;  1JWH C;  2YU9 I;  3I4N I;  1Q86 2;  1KD1 2;  3RZD I;  3J80 b;  1Q16 A;  3HOX I;  3CCV 1;  4E2Z A;  1PFT A;  3S16 I;  3CC2 1;  1VQP Z;  3NH4 A;  3G71 Z;  1VQ8 Z;  3QWU A;  5IP7 I;  1VQ7 1;  1K9M 2;  4A3I I;  3OW2 Z;  1X3W A;  1VQ4 1;  3NFZ A;  1VQN Z;  3H0G I;  3HOY I;  3T4N B;  1Z02 A;  2JIQ A;  1KQS Y;  1LQL A;  1RO0 A;  3CXC Z;  2VPY A;  2DE7 A;  1AA6 A;  2R93 I;  2LFU A;  3CC7 1;  2JA8 I;  4E2Y A;  1Y1W I;  2IZ4 A;  3G4S Z;  1YJN 1;  1K8A 1;  3S15 I;  4NH1 C;  1ZB9 A;  2RIQ A;  1VQO Z;  3J81 f;  1N2F A;  2NVQ I;  2QEX Z;  3KIF A;  3VMG A;  2R92 I;  2JNY A;  1VQP 1;  1P9N A;  3G71 1;  1VQ8 1;  1TWF I;  3S1N I;  5D1O B;  1WZN A;  4BBR I;  3GTG I;  2OTL Z;  2GU2 A;  5IP9 I;  4Y52 I;  1N8R 2;  3F3P C;  2JR6 A;  4MH4 A;  3GTQ I;  4NBH A;  4HGZ A;  1VQN 1;  3CCL Z;  2G2K A;  3I56 Z;  1QVF Z;  3CQZ I;  1S72 Z;  1VQ5 Z;  2O4H A;  3CMA Z;  4E33 A;  3G4S 1;  1YUA A;  2HF1 A;  1TFI A;  1VQO 1;  4NBF A;  4A3C I;  1NJI 1;  2K5R A;  2QEX 1;  1WJ2 A;  3BG0 B;  3FKI I;  4A3E I;  1I3Q I;  1TWH I;  3GTM I;  1Z01 A;  2PMZ A;  1RO2 A;  1YHQ Z;  1YUK A;  2IV2 X;  1W2B Y;  4NBC A;  1SIW A;  3I4M I;  2OTL 1;  3J81 b; 
#chains in the Genus database with same CATH homology
 1RNI A;  1K73 1;  1Y1V S;  3CCL 1;  5A2Q f;  2QRE B;  3I56 1;  3MZK B;  3S1M I;  1X0T A;  2NVT I;  1S72 1;  2NVY I;  2QRC B;  4E2W A;  1VQ5 1;  2E9H A;  1YI2 Z;  2DE6 A;  1Q7Y 1;  3CMA 1;  5CM2 M;  3S1R I;  2K3R A;  1RLY A;  2E2I I;  4BBS I;  1KRL A;  1YIT 1;  3HOV I;  3G6E Z;  3NDI A;  3M3Y I;  1Z03 A;  1VQL Z;  4NOZ A;  3K7A I;  1JJ2 Y;  2QR1 B;  2H85 A;  1KC8 1;  3CCS Z;  5C3E I;  1YHQ 1;  3VMI A;  1Q81 1;  1VLA A;  1ZH1 A;  3CPW Y;  4E32 A;  2V8K A;  2QRD B;  5T64 A;  1QVG Y;  4E30 A;  2P28 A;  4NBE A;  2I3C A;  2V8I A;  3HOU I;  3S2D I;  3CME Z;  1YI2 1;  3VB9 A;  4MRI A;  3S2H I;  3S14 I;  4BY7 I;  3G6E 1;  3GTO I;  3TDH B;  5A2Q b;  4E2X A;  4AYB A;  1VQL 1;  5C4X I;  5T67 A;  1NUI A;  1K83 I;  1VQ6 Z;  1QF8 A;  5C44 I;  3J7A 4;  2M6N A;  1QYP A;  1RO4 A;  1WII A;  3CCS 1;  2R7Z I;  4NBD A;  3S17 I;  2B63 I;  1K8A 2;  4E31 A;  2W03 A;  4X6A I;  2F4O A;  1ML8 A;  2OTJ Z;  4DK1 A;  1JJ2 Z;  1WCM I;  2HU9 A;  4RVG A;  1M1K 1;  4A3D I;  4A3B I;  3IF8 A;  2JS4 A;  1ZB8 A;  3CPW Z;  3FQM A;  1YIT Z;  4EWC A;  3CME 1;  1KQS Z;  1X3Z A;  3CCR Z;  2Q4Z A;  4RVH A;  3CD6 Z;  3PO3 I;  4A3G I;  2RPR A;  3IX0 A;  1Q82 1;  3RZO I;  3KIH A;  1R9T I;  1YJW Z;  2KPI A;  2JA7 I;  1TWG I;  1VQ6 1;  3BG1 B;  2RHB A;  3OW2 Y;  3I07 A;  3IFU A;  2E2H I;  2VF1 A;  4NBB A;  3GTK I;  1YIJ Z;  3NH5 A;  3CXC Y;  3HOW I;  4HH4 A;  2PK7 A;  1NJI 2;  5AN9 F;  2OTJ 1;  2BJO A;  2M48 A;  1Q86 1;  1KD1 1;  1SFO I;  3GTJ I;  2YAD A;  3CC4 Z;  5T6B A;  2Q51 A;  4A3L I;  3EER A;  3EED A;  3NH8 A;  3GTL I;  3CCJ Z;  2JUB A;  3CCR 1;  3LUS A;  5C4J I;  3CD6 1;  3U50 C;  1YJ9 Z;  4RV9 A;  3F3F C;  4BY1 I;  3CCE Z;  1K73 2;  3S1Q I;  5IT9 f;  3GTM S;  1YJW 1;  3GTP I;  2RBL A;  2W04 A;  3ESW A;  3D6W A;  3CCU Z;  3MON A;  1Q7Y 2;  2VUM I;  2JA5 I;  4DGL A;  3I55 Z;  5FLM I;  1TWA I;  1YIJ 1;  3CCQ Z;  1QVF Y;  3JAM f;  2EGT A;  1W2B Z;  1USP A;  2LIY A;  3VTN A;  3CC4 1;  1KC8 2;  3MZL B;  4A3J I;  4A93 I;  1Q81 2;  4MD7 A;  1VQK Z;  4MD9 A;  4XX2 A;  3CCJ 1;  1WW9 A;  2GTH A;  4TNU A;  2OOX B;  1NP6 A;  1S7M A;  4RVD A;  5FLX f;  1YJ9 1;  1N8R 1;  1DL6 A;  2QA4 Z;  3CCE 1;  2WAQ A;  4HGY A;  2Y0S A;  3GKQ A;  4RS4 A;  3CCU 1;  2AKL A;  2P3Y A;  3CCM Z;  2PM9 A;  4NBA A;  3Q87 A;  4NB8 A;  2OOY B;  1VQM Z;  3VMH A;  3I55 1;  1VQ9 Z;  2NVX I;  3CCQ 1;  3P5J B;  4DQY B;  4A3F I;  5IT9 b;  4A3M I;  4NBG A;  3J80 f;  3FQQ A;  4BXX I;  2GTI A;  3GCF A;  1Y1V I;  4RVF A;  1TWC I;  4MD8 A;  4S1T A;  3NDJ A;  1QVG Z;  2E2J I;  2F4M A;  4MXU A;  2DE5 A;  4A3K I;  3TE5 B;  2RT9 A;  4QTU A;  1VQK 1;  2QLV B;  3JAM b;  2O53 A;  1RQF A;  1USP B;  3HOZ I;  2QA4 1;  3CCV Z;  1I6H I;  1M1K 2;  3CC2 Z;  4Y7N I;  2JA6 I;  4NB9 A;  2IZ3 A;  3CCM 1;  3HKZ A;  1VQ7 Z;  4NFR A;  1M90 1;  5D1P A;  3H3V J;  1VQM 1;  5FLX b;  2ZAE B;  1L1O C;  1VQ9 1;  1VQ4 Z;  2KI7 B;  5LL6 f;  1Q82 2;  3D9X A;  2J6A A;  1K9M 1;  2JMO A;  2V8J A;  3M4O I;  3CC7 Z;  2OZK A;  4QTT A;  2WB1 A;  2QKD A;  3PO3 S;  1YJN Z;  5D1O A;  2VUG A;  1I50 I;  1M90 2;  3PO2 I;  2R6M A;  4MON A;  4CL1 A;  1JWH C;  2YU9 I;  3I4N I;  1Q86 2;  1KD1 2;  3RZD I;  3J80 b;  3HOX I;  3CCV 1;  4E2Z A;  1PFT A;  3S16 I;  3CC2 1;  1VQP Z;  3NH4 A;  3G71 Z;  1VQ8 Z;  3QWU A;  5IP7 I;  1VQ7 1;  1K9M 2;  4A3I I;  3OW2 Z;  1X3W A;  1VQ4 1;  3NFZ A;  1VQN Z;  3H0G I;  3HOY I;  3T4N B;  1Z02 A;  1KQS Y;  1LQL A;  1RO0 A;  3CXC Z;  2DE7 A;  2R93 I;  2LFU A;  3CC7 1;  2JA8 I;  4E2Y A;  1Y1W I;  2IZ4 A;  3G4S Z;  1YJN 1;  1K8A 1;  3S15 I;  4NH1 C;  1ZB9 A;  2RIQ A;  1VQO Z;  3J81 f;  1N2F A;  2NVQ I;  2QEX Z;  3KIF A;  3VMG A;  2R92 I;  2JNY A;  1VQP 1;  1P9N A;  3G71 1;  1VQ8 1;  1TWF I;  3S1N I;  5D1O B;  4BBR I;  3GTG I;  2OTL Z;  2GU2 A;  5IP9 I;  4Y52 I;  1N8R 2;  3F3P C;  2JR6 A;  4MH4 A;  3GTQ I;  4NBH A;  4HGZ A;  1VQN 1;  3CCL Z;  2G2K A;  3I56 Z;  1QVF Z;  3CQZ I;  1S72 Z;  1VQ5 Z;  2O4H A;  3CMA Z;  4E33 A;  3G4S 1;  1YUA A;  2HF1 A;  1TFI A;  1VQO 1;  4NBF A;  4A3C I;  1NJI 1;  2K5R A;  2QEX 1;  3BG0 B;  3FKI I;  4A3E I;  1I3Q I;  1TWH I;  3GTM I;  1Z01 A;  2PMZ A;  1RO2 A;  1YHQ Z;  1YUK A;  1W2B Y;  4NBC A;  3I4M I;  2OTL 1;  3J81 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...