3CC2Z

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc2Z00
1Q7Y2 1QVGZ 1YJN1 3CCM1 3G6EZ 3CXCZ 3CCE1 1N8R2 1VQM1 3CME1 1VQ8Z 1VQOZ 1Q811 1VQ5Z 2QEX1 1YJ91 3CCJZ 1Q812 1VQK1 3CMA1 3CC71 1YI21 1KD11 2OTLZ 1VQ4Z 3CCRZ 1NJI2 1VQ71 1VQLZ 1KD12 1K8A1 3CCQZ 1YIJ1 1N8R1 1K8A2 1VQ81 1VQ51 2OTJ1 3CCVZ 3CD6Z 1YITZ 3CCJ1 3CC21 3CCS1 1W2BY 3OW2Y 3G71Z 1K9M1 1JJ2Y 2OTL1 1Q862 3CCLZ 1VQ41 3CCR1 3CC41 1VQN1 3CCUZ 1NJI1 1KQSY 1K9M2 1W2BZ 3OW2Z 3I56Z 1JJ2Z 3G6E1 1VQPZ 3CCMZ 1KQSZ 3CCV1 1YHQZ 1YJWZ 1M1K2 1YIT1 1VQ9Z 1VQO1 1VQ6Z 1Q821 3G711 3CMEZ 1Q861 1Q822 3I55Z 3CCU1 1S72Z 1QVFY 3G4SZ 3CMAZ 1KC81 3CC7Z 1VQL1 3CCQ1 2QA4Z 1VQP1 1K731 1QVFZ 1KC82 1VQ7Z 1M901 1YHQ1 1YJW1 1M1K1 1VQ91 1K732 1VQ61 1YJNZ 1YIJZ 1M902 3CD61 2OTJZ 3CCEZ 3I551 1S721 3G4S1 1VQMZ 3CCL1 3CC2Z 3CCSZ 3CPWY 2QEXZ 1QVGY 1YJ9Z 2QA41 1Q7Y1 1VQKZ 3I561 3CC4Z 1VQNZ 3CXCY 1YI2Z 3CPWZ
chains in the Genus database with same CATH superfamily
1QVGZ 1Y1VI 4BY7I 2NVXI 3PO3S 2QRDB 3G6EZ 3JAMf 3CXCZ 4A93I 3CCE1 1N8R2 1VQM1 1VQ8Z 4BY1I 4MD7A 1JWHC 3HOZI 4NBGA 4HGYA 5A2Qb 2JA7I 3S15I 1Z01A 1VQLZ 1QXFA 1K8A1 1AA6A 5C4XI 1N8R1 2BJOA 3J80f 5T67A 2JIMA 3F3FC 1VQ51 2OTJ1 1FDIA 1QF8A 4DK1A 3G71Z 1K9M1 3CCLZ 1VQ41 3CC41 1R9TI 3CCUZ 3EERA 1KQSY 3I56Z 3EEDA 1JJ2Z 3GTJI 5C44I 1S7MA 4E31A 3FQQA 3PO2I 1M1K2 3S14I 3HOWI 3PO3I 3H0GI 4E33A 1VQ6Z 1Q821 4BXXI 2PMZA 4MRIA 2JMOA 3Q87A 3CMEZ 2IV2X 4NH1C 2EGTA 3I55Z 1FDOA 3IFUA 4NBDA 2YU9I 2RPRA 3CMAZ 4NBFA 2OZKA 4QTUA 2YADA 2QR1B 3GKQA 2E2JI 1SIWA 1VQP1 2LIYA 2WAQA 4CL1A 1KC82 1VQ7Z 4RS4A 1M901 1YHQ1 1ZB8A 1YJW1 1M1K1 1RNIA 3GTPI 1VQ91 1K732 2JIPA 2VPZA 1RO4A 2E9HA 2VUGA 2R6MA 3K7AI 3MZLB 5T64A 1USPB 3BG0B 3RZOI 3S2DI 4A3EI 4A3KI 5IT9b 2RT9A 4MONA 2E2II 1YUKA 2V45A 2VPXA 2Q4ZA 1YI2Z 1YJN1 3CCM1 4XX2A 2W04A 2K3RA 1X0TA 2V8KA 3NH8A 2QKDA 5FLMI 1Z03A 1ML8A 1VQOZ 2V3VA 4E2YA 5C4JI 2OOYB 2HU9A 1X3ZA 3CC71 1TWAI 2OTLZ 2JNYA 5LL6f 3CCRZ 3VTNA 3D9XA 2RHBA 3IR7A 3BG1B 4A3DI 1PFTA 1USPA 1LQLA 4A3LI 4NB9A 1K8A2 1VQ81 3CCVZ 3CD6Z 1YITZ 1TWGI 5D1PA 3CC21 3OW2Y 2JUBA 2QLVB 4DQYB 3D2LA 3CQZI 1VLAA 1RO2A 2I3CA 2RBLA 2PK7A 1K9M2 1W2BZ 2H85A 3RZDI 2AYDA 1Y8CA 2VPYA 4RVFA 2IZ4A 4NBBA 3I07A 2NVYI 1WZNA 5CM2M 3G711 1RQFA 4HH4A 2R92I 1Q822 4BBSI 3CCU1 1S72Z 3GTOI 1QVFY 4RVHA 3G4SZ 5FLXf 1I50I 2WB1A 4NB8A 4BBRI 3CCQ1 2QA4Z 4E30A 5IP9I 4A3CI 3VMGA 1K83I 5C3EI 1VQ61 1M902 1L1OC 1TWFI 2AKLA 3J81b 2JIQA 2OTJZ 3D6WA 3I551 1DL6A 2JA8I 2JA5I 3CPWY 3IF8A 2QEXZ 1QVGY 1Q16A 1YJ9Z 1Q7Y1 1VQKZ 3VB9A 3CC4Z 2RIQA 3CXCY 5IT9f 1N2FA 1QYPA 3KIHA 2GTHA 2JS4A 4A3JI 4NBAA 1Q811 2O53A 1TWHI 1RLYA 3CCJZ 2PM9A 5D1OB 1YI21 1KD11 1Y1VS 4A3II 2VF1A 1WIIA 3HKZA 3TDHB 3VMIA 1YIJ1 3QWUA 2O4HA 4NBCA 3H3VJ 2F4OA 3GTMS 4MD8A 3CCS1 4TNUA 2GTIA 3T4NB 1JJ2Y 4Y52I 2OTL1 1Q862 4E32A 1WJ2A 3CCR1 5IP7I 1VQN1 1NUIA 2JR6A 4MH4A 3S1NI 3I4NI 4NOZA 5A2Qf 2Y0SA 3S1QI 3G6E1 3CCMZ 1KQSZ 5D1OA 3CCV1 2NVTI 1YIT1 3HOVI 2VPWA 1Q861 2G2KA 4NBEA 2R7ZI 5AN9F 2JA6I 1KRLA 4A3GI 3CC7Z 1VQL1 3F3PC 1Y1WI 2E2HI 3LUSA 1WW9A 1I3QI 4S1TA 4NBHA 3NDIA 3P5JB 2ZAEB 3CCEZ 3J81f 1S721 3GTMI 4E2XA 3G4S1 1VQMZ 3CCL1 3CC2Z 2E7ZA 4X6AI 2QREB 3KIFA 4Y7NI 2QA41 3I561 4DGLA 3NH5A 2IZ3A 1Q7Y2 3GCFA 3JAMb 3GTKI 4RV9A 3S1RI 2JIRA 4MXUA 1NP6A 2J6AA 3CME1 1VQ5Z 2QEX1 1YJ91 4AYBA 1Q812 1VQK1 3CMA1 2LFUA 5T6BA 4RVGA 1VQ4Z 1TWCI 3NH4A 1NJI2 1VQ71 2LEXA 1RO0A 1KD12 3J80b 2QRCB 3CCQZ 4NFRA 2DE5A 3IX0A 4A3MI 2DE7A 2JIOA 3S16I 3M3YI 4E2WA 2OOXB 3S17I 3MZKB 3FQMA 3GTGI 3CCJ1 3S1MI 1W2BY 5FLXb 4A3BI 1Z02A 2M48A 3S2HI 3HOYI 4EWCA 2NAPA 1NJI1 4MD9A 3HOXI 2R93I 3OW2Z 1WCMI 2F4MA 2GU2A 3I4MI 2B63I 2KPIA 3MONA 1X3WA 1VQPZ 3GTLI 3TE5B 1YHQZ 1YJWZ 4E2ZA 4A3FI 1VQ9Z 1VQO1 3FKII 2K5RA 1I6HI 1SFOI 2V8JA 2NVQI 2DE6A 4RVDA 2Q51A 2P3YA 3M4OI 1P9NA 1KC81 3VMHA 2W03A 1K731 1QVFZ 3NDJA 2KI7B 2M6NA 3HOUI 1YJNZ 1YIJZ 3U50C 4QTTA 3CD61 3GTQI 3NFZA 3ESWA 3CCSZ 2V8IA 2P28A 1TFIA 1ZH1A 2VUMI 2HF1A 1ZB9A 1VQNZ 3J7A4 4HGZA 3CPWZ 1YUAA
chains in the Genus database with same CATH topology
1QVGZ 1Y1VI 4BY7I 2NVXI 3PO3S 2QRDB 3G6EZ 3JAMf 3CXCZ 4A93I 3CCE1 1N8R2 1VQM1 1VQ8Z 4BY1I 4MD7A 1JWHC 3HOZI 4NBGA 4HGYA 5A2Qb 2JA7I 3S15I 1Z01A 1VQLZ 1K8A1 5C4XI 1N8R1 2BJOA 3J80f 5T67A 3F3FC 1VQ51 2OTJ1 1QF8A 4DK1A 3G71Z 1K9M1 3CCLZ 1VQ41 3CC41 1R9TI 3CCUZ 3EERA 1KQSY 3I56Z 3EEDA 1JJ2Z 3GTJI 5C44I 1S7MA 4E31A 3FQQA 3PO2I 1M1K2 3S14I 3HOWI 3PO3I 3H0GI 4E33A 1VQ6Z 1Q821 4BXXI 2PMZA 4MRIA 2JMOA 3Q87A 3CMEZ 4NH1C 2EGTA 3I55Z 4NBDA 3IFUA 2YU9I 2RPRA 3CMAZ 4NBFA 2OZKA 4QTUA 2YADA 2QR1B 3GKQA 2E2JI 1VQP1 2LIYA 2WAQA 4CL1A 1KC82 1VQ7Z 4RS4A 1M901 1YHQ1 1ZB8A 1YJW1 1M1K1 1RNIA 3GTPI 1VQ91 1K732 1RO4A 2E9HA 2VUGA 2R6MA 3K7AI 3MZLB 5T64A 1USPB 3BG0B 3RZOI 3S2DI 4A3EI 4A3KI 5IT9b 2RT9A 4MONA 2E2II 1YUKA 1YI2Z 2Q4ZA 1YJN1 3CCM1 4XX2A 2W04A 2K3RA 1X0TA 2V8KA 3NH8A 2QKDA 5FLMI 1Z03A 1ML8A 1VQOZ 4E2YA 5C4JI 2OOYB 2HU9A 1X3ZA 3CC71 1TWAI 2OTLZ 2JNYA 5LL6f 3CCRZ 3VTNA 3D9XA 2RHBA 3BG1B 4A3DI 1PFTA 1USPA 1LQLA 4A3LI 4NB9A 1K8A2 1VQ81 3CCVZ 3CD6Z 1YITZ 1TWGI 5D1PA 3CC21 3OW2Y 2JUBA 2QLVB 4DQYB 3CQZI 1VLAA 1RO2A 2I3CA 2RBLA 2PK7A 1K9M2 1W2BZ 2H85A 3RZDI 4RVFA 2IZ4A 4NBBA 3I07A 2NVYI 5CM2M 3G711 1RQFA 4HH4A 2R92I 1Q822 4BBSI 3CCU1 1S72Z 3GTOI 1QVFY 4RVHA 3G4SZ 5FLXf 1I50I 2WB1A 4NB8A 4BBRI 3CCQ1 2QA4Z 4E30A 5IP9I 4A3CI 3VMGA 1K83I 5C3EI 1VQ61 1M902 1L1OC 1TWFI 2AKLA 3J81b 2OTJZ 3D6WA 3I551 1DL6A 2JA8I 2JA5I 3CPWY 3IF8A 2QEXZ 1QVGY 1YJ9Z 1Q7Y1 1VQKZ 3VB9A 3CC4Z 2RIQA 3CXCY 5IT9f 1N2FA 1QYPA 3KIHA 2GTHA 2JS4A 4A3JI 4NBAA 1Q811 2O53A 1TWHI 1RLYA 3CCJZ 2PM9A 5D1OB 1YI21 1KD11 1Y1VS 4A3II 2VF1A 1WIIA 3HKZA 3TDHB 3VMIA 1YIJ1 3QWUA 2O4HA 4NBCA 3H3VJ 2F4OA 3GTMS 4MD8A 3CCS1 4TNUA 2GTIA 3T4NB 1JJ2Y 4Y52I 2OTL1 1Q862 4E32A 3CCR1 5IP7I 1VQN1 1NUIA 2JR6A 4MH4A 3S1NI 3I4NI 4NOZA 5A2Qf 2Y0SA 3S1QI 3G6E1 3CCMZ 1KQSZ 5D1OA 3CCV1 2NVTI 1YIT1 3HOVI 1Q861 2G2KA 4NBEA 2R7ZI 5AN9F 2JA6I 1KRLA 4A3GI 3CC7Z 1VQL1 3F3PC 1Y1WI 2E2HI 3LUSA 1WW9A 1I3QI 4S1TA 4NBHA 3NDIA 3P5JB 2ZAEB 3CCEZ 3J81f 1S721 3GTMI 4E2XA 3G4S1 1VQMZ 3CCL1 3CC2Z 4X6AI 2QREB 3KIFA 4Y7NI 2QA41 3I561 4DGLA 3NH5A 2IZ3A 1Q7Y2 3GCFA 3JAMb 3GTKI 4RV9A 3S1RI 4MXUA 1NP6A 2J6AA 3CME1 1VQ5Z 2QEX1 1YJ91 4AYBA 1Q812 1VQK1 3CMA1 2LFUA 5T6BA 4RVGA 1VQ4Z 1TWCI 3NH4A 1NJI2 1VQ71 1RO0A 1KD12 3J80b 2QRCB 3CCQZ 4NFRA 2DE5A 3IX0A 4A3MI 2DE7A 3S16I 3M3YI 4E2WA 2OOXB 3S17I 3MZKB 3FQMA 3GTGI 3CCJ1 3S1MI 1W2BY 5FLXb 4A3BI 1Z02A 2M48A 3S2HI 3HOYI 4EWCA 1NJI1 4MD9A 3HOXI 2R93I 3OW2Z 1WCMI 2F4MA 2GU2A 3I4MI 2B63I 2KPIA 3MONA 1X3WA 1VQPZ 3GTLI 3TE5B 1YHQZ 1YJWZ 4E2ZA 4A3FI 1VQ9Z 1VQO1 3FKII 2K5RA 1I6HI 1SFOI 2V8JA 2NVQI 2DE6A 4RVDA 2Q51A 2P3YA 3M4OI 1P9NA 1KC81 3VMHA 2W03A 1K731 1QVFZ 3NDJA 2KI7B 2M6NA 3HOUI 1YJNZ 1YIJZ 3U50C 4QTTA 3CD61 3GTQI 3NFZA 3ESWA 3CCSZ 2V8IA 2P28A 1TFIA 1ZH1A 2VUMI 2HF1A 1ZB9A 1VQNZ 3J7A4 4HGZA 3CPWZ 1YUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 2;  1QVG Z;  1YJN 1;  3CCM 1;  3G6E Z;  3CXC Z;  3CCE 1;  1N8R 2;  1VQM 1;  3CME 1;  1VQ8 Z;  1VQO Z;  1Q81 1;  1VQ5 Z;  2QEX 1;  1YJ9 1;  3CCJ Z;  1Q81 2;  1VQK 1;  3CMA 1;  3CC7 1;  1YI2 1;  1KD1 1;  2OTL Z;  1VQ4 Z;  3CCR Z;  1NJI 2;  1VQ7 1;  1VQL Z;  1KD1 2;  1K8A 1;  3CCQ Z;  1YIJ 1;  1N8R 1;  1K8A 2;  1VQ8 1;  1VQ5 1;  2OTJ 1;  3CCV Z;  3CD6 Z;  1YIT Z;  3CCJ 1;  3CC2 1;  3CCS 1;  1W2B Y;  3OW2 Y;  3G71 Z;  1K9M 1;  1JJ2 Y;  2OTL 1;  1Q86 2;  3CCL Z;  1VQ4 1;  3CCR 1;  3CC4 1;  1VQN 1;  3CCU Z;  1NJI 1;  1KQS Y;  1K9M 2;  1W2B Z;  3OW2 Z;  3I56 Z;  1JJ2 Z;  3G6E 1;  1VQP Z;  3CCM Z;  1KQS Z;  3CCV 1;  1YHQ Z;  1YJW Z;  1M1K 2;  1YIT 1;  1VQ9 Z;  1VQO 1;  1VQ6 Z;  1Q82 1;  3G71 1;  3CME Z;  1Q86 1;  1Q82 2;  3I55 Z;  3CCU 1;  1S72 Z;  1QVF Y;  3G4S Z;  3CMA Z;  1KC8 1;  3CC7 Z;  1VQL 1;  3CCQ 1;  2QA4 Z;  1VQP 1;  1K73 1;  1QVF Z;  1KC8 2;  1VQ7 Z;  1M90 1;  1YHQ 1;  1YJW 1;  1M1K 1;  1VQ9 1;  1K73 2;  1VQ6 1;  1YJN Z;  1YIJ Z;  1M90 2;  3CD6 1;  2OTJ Z;  3CCE Z;  3I55 1;  1S72 1;  3G4S 1;  1VQM Z;  3CCL 1;  3CC2 Z;  3CCS Z;  3CPW Y;  2QEX Z;  1QVG Y;  1YJ9 Z;  2QA4 1;  1Q7Y 1;  1VQK Z;  3I56 1;  3CC4 Z;  1VQN Z;  3CXC Y;  1YI2 Z;  3CPW Z; 
#chains in the Genus database with same CATH topology
 1QVG Z;  1Y1V I;  4BY7 I;  2NVX I;  3PO3 S;  2QRD B;  3G6E Z;  3JAM f;  3CXC Z;  4A93 I;  3CCE 1;  1N8R 2;  1VQM 1;  1VQ8 Z;  4BY1 I;  4MD7 A;  1JWH C;  3HOZ I;  4NBG A;  4HGY A;  5A2Q b;  2JA7 I;  3S15 I;  1Z01 A;  1VQL Z;  1QXF A;  1K8A 1;  1AA6 A;  5C4X I;  1N8R 1;  2BJO A;  3J80 f;  5T67 A;  2JIM A;  3F3F C;  1VQ5 1;  2OTJ 1;  1FDI A;  1QF8 A;  4DK1 A;  3G71 Z;  1K9M 1;  3CCL Z;  1VQ4 1;  3CC4 1;  1R9T I;  3CCU Z;  3EER A;  1KQS Y;  3I56 Z;  3EED A;  1JJ2 Z;  3GTJ I;  5C44 I;  1S7M A;  4E31 A;  3FQQ A;  3PO2 I;  1M1K 2;  3S14 I;  3HOW I;  3PO3 I;  3H0G I;  4E33 A;  1VQ6 Z;  1Q82 1;  4BXX I;  2PMZ A;  4MRI A;  2JMO A;  3Q87 A;  3CME Z;  2IV2 X;  4NH1 C;  2EGT A;  3I55 Z;  1FDO A;  3IFU A;  4NBD A;  2YU9 I;  2RPR A;  3CMA Z;  4NBF A;  2OZK A;  4QTU A;  2YAD A;  2QR1 B;  3GKQ A;  2E2J I;  1SIW A;  1VQP 1;  2LIY A;  2WAQ A;  4CL1 A;  1KC8 2;  1VQ7 Z;  4RS4 A;  1M90 1;  1YHQ 1;  1ZB8 A;  1YJW 1;  1M1K 1;  1RNI A;  3GTP I;  1VQ9 1;  1K73 2;  2JIP A;  2VPZ A;  1RO4 A;  2E9H A;  2VUG A;  2R6M A;  3K7A I;  3MZL B;  5T64 A;  1USP B;  3BG0 B;  3RZO I;  3S2D I;  4A3E I;  4A3K I;  5IT9 b;  2RT9 A;  4MON A;  2E2I I;  1YUK A;  2V45 A;  2VPX A;  2Q4Z A;  1YI2 Z;  1YJN 1;  3CCM 1;  4XX2 A;  2W04 A;  2K3R A;  1X0T A;  2V8K A;  3NH8 A;  2QKD A;  5FLM I;  1Z03 A;  1ML8 A;  1VQO Z;  2V3V A;  4E2Y A;  5C4J I;  2OOY B;  2HU9 A;  1X3Z A;  3CC7 1;  1TWA I;  2OTL Z;  2JNY A;  5LL6 f;  3CCR Z;  3VTN A;  3D9X A;  2RHB A;  3IR7 A;  3BG1 B;  4A3D I;  1PFT A;  1USP A;  1LQL A;  4A3L I;  4NB9 A;  1K8A 2;  1VQ8 1;  3CCV Z;  3CD6 Z;  1YIT Z;  1TWG I;  5D1P A;  3CC2 1;  3OW2 Y;  2JUB A;  2QLV B;  4DQY B;  3D2L A;  3CQZ I;  1VLA A;  1RO2 A;  2I3C A;  2RBL A;  2PK7 A;  1K9M 2;  1W2B Z;  2H85 A;  3RZD I;  2AYD A;  1Y8C A;  2VPY A;  4RVF A;  2IZ4 A;  4NBB A;  3I07 A;  2NVY I;  1WZN A;  5CM2 M;  3G71 1;  1RQF A;  4HH4 A;  2R92 I;  1Q82 2;  4BBS I;  3CCU 1;  1S72 Z;  3GTO I;  1QVF Y;  4RVH A;  3G4S Z;  5FLX f;  1I50 I;  2WB1 A;  4NB8 A;  4BBR I;  3CCQ 1;  2QA4 Z;  4E30 A;  5IP9 I;  4A3C I;  3VMG A;  1K83 I;  5C3E I;  1VQ6 1;  1M90 2;  1L1O C;  1TWF I;  2AKL A;  3J81 b;  2JIQ A;  2OTJ Z;  3D6W A;  3I55 1;  1DL6 A;  2JA8 I;  2JA5 I;  3CPW Y;  3IF8 A;  2QEX Z;  1QVG Y;  1Q16 A;  1YJ9 Z;  1Q7Y 1;  1VQK Z;  3VB9 A;  3CC4 Z;  2RIQ A;  3CXC Y;  5IT9 f;  1N2F A;  1QYP A;  3KIH A;  2GTH A;  2JS4 A;  4A3J I;  4NBA A;  1Q81 1;  2O53 A;  1TWH I;  1RLY A;  3CCJ Z;  2PM9 A;  5D1O B;  1YI2 1;  1KD1 1;  1Y1V S;  4A3I I;  2VF1 A;  1WII A;  3HKZ A;  3TDH B;  3VMI A;  1YIJ 1;  3QWU A;  2O4H A;  4NBC A;  3H3V J;  2F4O A;  3GTM S;  4MD8 A;  3CCS 1;  4TNU A;  2GTI A;  3T4N B;  1JJ2 Y;  4Y52 I;  2OTL 1;  1Q86 2;  4E32 A;  1WJ2 A;  3CCR 1;  5IP7 I;  1VQN 1;  1NUI A;  2JR6 A;  4MH4 A;  3S1N I;  3I4N I;  4NOZ A;  5A2Q f;  2Y0S A;  3S1Q I;  3G6E 1;  3CCM Z;  1KQS Z;  5D1O A;  3CCV 1;  2NVT I;  1YIT 1;  3HOV I;  2VPW A;  1Q86 1;  2G2K A;  4NBE A;  2R7Z I;  5AN9 F;  2JA6 I;  1KRL A;  4A3G I;  3CC7 Z;  1VQL 1;  3F3P C;  1Y1W I;  2E2H I;  3LUS A;  1WW9 A;  1I3Q I;  4S1T A;  4NBH A;  3NDI A;  3P5J B;  2ZAE B;  3CCE Z;  3J81 f;  1S72 1;  3GTM I;  4E2X A;  3G4S 1;  1VQM Z;  3CCL 1;  3CC2 Z;  2E7Z A;  4X6A I;  2QRE B;  3KIF A;  4Y7N I;  2QA4 1;  3I56 1;  4DGL A;  3NH5 A;  2IZ3 A;  1Q7Y 2;  3GCF A;  3JAM b;  3GTK I;  4RV9 A;  3S1R I;  2JIR A;  4MXU A;  1NP6 A;  2J6A A;  3CME 1;  1VQ5 Z;  2QEX 1;  1YJ9 1;  4AYB A;  1Q81 2;  1VQK 1;  3CMA 1;  2LFU A;  5T6B A;  4RVG A;  1VQ4 Z;  1TWC I;  3NH4 A;  1NJI 2;  1VQ7 1;  2LEX A;  1RO0 A;  1KD1 2;  3J80 b;  2QRC B;  3CCQ Z;  4NFR A;  2DE5 A;  3IX0 A;  4A3M I;  2DE7 A;  2JIO A;  3S16 I;  3M3Y I;  4E2W A;  2OOX B;  3S17 I;  3MZK B;  3FQM A;  3GTG I;  3CCJ 1;  3S1M I;  1W2B Y;  5FLX b;  4A3B I;  1Z02 A;  2M48 A;  3S2H I;  3HOY I;  4EWC A;  2NAP A;  1NJI 1;  4MD9 A;  3HOX I;  2R93 I;  3OW2 Z;  1WCM I;  2F4M A;  2GU2 A;  3I4M I;  2B63 I;  2KPI A;  3MON A;  1X3W A;  1VQP Z;  3GTL I;  3TE5 B;  1YHQ Z;  1YJW Z;  4E2Z A;  4A3F I;  1VQ9 Z;  1VQO 1;  3FKI I;  2K5R A;  1I6H I;  1SFO I;  2V8J A;  2NVQ I;  2DE6 A;  4RVD A;  2Q51 A;  2P3Y A;  3M4O I;  1P9N A;  1KC8 1;  3VMH A;  2W03 A;  1K73 1;  1QVF Z;  3NDJ A;  2KI7 B;  2M6N A;  3HOU I;  1YJN Z;  1YIJ Z;  3U50 C;  4QTT A;  3CD6 1;  3GTQ I;  3NFZ A;  3ESW A;  3CCS Z;  2V8I A;  2P28 A;  1TFI A;  1ZH1 A;  2VUM I;  2HF1 A;  1ZB9 A;  1VQN Z;  3J7A 4;  4HGZ A;  3CPW Z;  1YUA A; 
#chains in the Genus database with same CATH homology
 1QVG Z;  1Y1V I;  4BY7 I;  2NVX I;  3PO3 S;  2QRD B;  3G6E Z;  3JAM f;  3CXC Z;  4A93 I;  3CCE 1;  1N8R 2;  1VQM 1;  1VQ8 Z;  4BY1 I;  4MD7 A;  1JWH C;  3HOZ I;  4NBG A;  4HGY A;  5A2Q b;  2JA7 I;  3S15 I;  1Z01 A;  1VQL Z;  1K8A 1;  5C4X I;  1N8R 1;  2BJO A;  3J80 f;  5T67 A;  3F3F C;  1VQ5 1;  2OTJ 1;  1QF8 A;  4DK1 A;  3G71 Z;  1K9M 1;  3CCL Z;  1VQ4 1;  3CC4 1;  1R9T I;  3CCU Z;  3EER A;  1KQS Y;  3I56 Z;  3EED A;  1JJ2 Z;  3GTJ I;  5C44 I;  1S7M A;  4E31 A;  3FQQ A;  3PO2 I;  1M1K 2;  3S14 I;  3HOW I;  3PO3 I;  3H0G I;  4E33 A;  1VQ6 Z;  1Q82 1;  4BXX I;  2PMZ A;  4MRI A;  2JMO A;  3Q87 A;  3CME Z;  4NH1 C;  2EGT A;  3I55 Z;  4NBD A;  3IFU A;  2YU9 I;  2RPR A;  3CMA Z;  4NBF A;  2OZK A;  4QTU A;  2YAD A;  2QR1 B;  3GKQ A;  2E2J I;  1VQP 1;  2LIY A;  2WAQ A;  4CL1 A;  1KC8 2;  1VQ7 Z;  4RS4 A;  1M90 1;  1YHQ 1;  1ZB8 A;  1YJW 1;  1M1K 1;  1RNI A;  3GTP I;  1VQ9 1;  1K73 2;  1RO4 A;  2E9H A;  2VUG A;  2R6M A;  3K7A I;  3MZL B;  5T64 A;  1USP B;  3BG0 B;  3RZO I;  3S2D I;  4A3E I;  4A3K I;  5IT9 b;  2RT9 A;  4MON A;  2E2I I;  1YUK A;  1YI2 Z;  2Q4Z A;  1YJN 1;  3CCM 1;  4XX2 A;  2W04 A;  2K3R A;  1X0T A;  2V8K A;  3NH8 A;  2QKD A;  5FLM I;  1Z03 A;  1ML8 A;  1VQO Z;  4E2Y A;  5C4J I;  2OOY B;  2HU9 A;  1X3Z A;  3CC7 1;  1TWA I;  2OTL Z;  2JNY A;  5LL6 f;  3CCR Z;  3VTN A;  3D9X A;  2RHB A;  3BG1 B;  4A3D I;  1PFT A;  1USP A;  1LQL A;  4A3L I;  4NB9 A;  1K8A 2;  1VQ8 1;  3CCV Z;  3CD6 Z;  1YIT Z;  1TWG I;  5D1P A;  3CC2 1;  3OW2 Y;  2JUB A;  2QLV B;  4DQY B;  3CQZ I;  1VLA A;  1RO2 A;  2I3C A;  2RBL A;  2PK7 A;  1K9M 2;  1W2B Z;  2H85 A;  3RZD I;  4RVF A;  2IZ4 A;  4NBB A;  3I07 A;  2NVY I;  5CM2 M;  3G71 1;  1RQF A;  4HH4 A;  2R92 I;  1Q82 2;  4BBS I;  3CCU 1;  1S72 Z;  3GTO I;  1QVF Y;  4RVH A;  3G4S Z;  5FLX f;  1I50 I;  2WB1 A;  4NB8 A;  4BBR I;  3CCQ 1;  2QA4 Z;  4E30 A;  5IP9 I;  4A3C I;  3VMG A;  1K83 I;  5C3E I;  1VQ6 1;  1M90 2;  1L1O C;  1TWF I;  2AKL A;  3J81 b;  2OTJ Z;  3D6W A;  3I55 1;  1DL6 A;  2JA8 I;  2JA5 I;  3CPW Y;  3IF8 A;  2QEX Z;  1QVG Y;  1YJ9 Z;  1Q7Y 1;  1VQK Z;  3VB9 A;  3CC4 Z;  2RIQ A;  3CXC Y;  5IT9 f;  1N2F A;  1QYP A;  3KIH A;  2GTH A;  2JS4 A;  4A3J I;  4NBA A;  1Q81 1;  2O53 A;  1TWH I;  1RLY A;  3CCJ Z;  2PM9 A;  5D1O B;  1YI2 1;  1KD1 1;  1Y1V S;  4A3I I;  2VF1 A;  1WII A;  3HKZ A;  3TDH B;  3VMI A;  1YIJ 1;  3QWU A;  2O4H A;  4NBC A;  3H3V J;  2F4O A;  3GTM S;  4MD8 A;  3CCS 1;  4TNU A;  2GTI A;  3T4N B;  1JJ2 Y;  4Y52 I;  2OTL 1;  1Q86 2;  4E32 A;  3CCR 1;  5IP7 I;  1VQN 1;  1NUI A;  2JR6 A;  4MH4 A;  3S1N I;  3I4N I;  4NOZ A;  5A2Q f;  2Y0S A;  3S1Q I;  3G6E 1;  3CCM Z;  1KQS Z;  5D1O A;  3CCV 1;  2NVT I;  1YIT 1;  3HOV I;  1Q86 1;  2G2K A;  4NBE A;  2R7Z I;  5AN9 F;  2JA6 I;  1KRL A;  4A3G I;  3CC7 Z;  1VQL 1;  3F3P C;  1Y1W I;  2E2H I;  3LUS A;  1WW9 A;  1I3Q I;  4S1T A;  4NBH A;  3NDI A;  3P5J B;  2ZAE B;  3CCE Z;  3J81 f;  1S72 1;  3GTM I;  4E2X A;  3G4S 1;  1VQM Z;  3CCL 1;  3CC2 Z;  4X6A I;  2QRE B;  3KIF A;  4Y7N I;  2QA4 1;  3I56 1;  4DGL A;  3NH5 A;  2IZ3 A;  1Q7Y 2;  3GCF A;  3JAM b;  3GTK I;  4RV9 A;  3S1R I;  4MXU A;  1NP6 A;  2J6A A;  3CME 1;  1VQ5 Z;  2QEX 1;  1YJ9 1;  4AYB A;  1Q81 2;  1VQK 1;  3CMA 1;  2LFU A;  5T6B A;  4RVG A;  1VQ4 Z;  1TWC I;  3NH4 A;  1NJI 2;  1VQ7 1;  1RO0 A;  1KD1 2;  3J80 b;  2QRC B;  3CCQ Z;  4NFR A;  2DE5 A;  3IX0 A;  4A3M I;  2DE7 A;  3S16 I;  3M3Y I;  4E2W A;  2OOX B;  3S17 I;  3MZK B;  3FQM A;  3GTG I;  3CCJ 1;  3S1M I;  1W2B Y;  5FLX b;  4A3B I;  1Z02 A;  2M48 A;  3S2H I;  3HOY I;  4EWC A;  1NJI 1;  4MD9 A;  3HOX I;  2R93 I;  3OW2 Z;  1WCM I;  2F4M A;  2GU2 A;  3I4M I;  2B63 I;  2KPI A;  3MON A;  1X3W A;  1VQP Z;  3GTL I;  3TE5 B;  1YHQ Z;  1YJW Z;  4E2Z A;  4A3F I;  1VQ9 Z;  1VQO 1;  3FKI I;  2K5R A;  1I6H I;  1SFO I;  2V8J A;  2NVQ I;  2DE6 A;  4RVD A;  2Q51 A;  2P3Y A;  3M4O I;  1P9N A;  1KC8 1;  3VMH A;  2W03 A;  1K73 1;  1QVF Z;  3NDJ A;  2KI7 B;  2M6N A;  3HOU I;  1YJN Z;  1YIJ Z;  3U50 C;  4QTT A;  3CD6 1;  3GTQ I;  3NFZ A;  3ESW A;  3CCS Z;  2V8I A;  2P28 A;  1TFI A;  1ZH1 A;  2VUM I;  2HF1 A;  1ZB9 A;  1VQN Z;  3J7A 4;  4HGZ A;  3CPW Z;  1YUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...