3CCR1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccr100
1N8R2 3G711 1YI2Z 1YJWZ 3CCE1 1Q821 3CXCY 1VQPZ 1Q811 3I55Z 3OW2Y 3CME1 1VQ91 1VQOZ 1NJI1 1QVFY 3CCQ1 1VQ5Z 1S72Z 3CMA1 3CC21 1VQ6Z 1QVGZ 1KD12 2OTJZ 1M1K1 1KQSZ 3G4SZ 1VQN1 3CC71 3G6EZ 1Q861 1YHQZ 3CCU1 1VQ4Z 2QEX1 3CCRZ 1YJNZ 1YITZ 1YI21 1K731 1M901 1VQKZ 1VQP1 3I551 2OTLZ 3CC41 1VQO1 1Q7Y2 3CD6Z 1VQ51 3CCMZ 2QA4Z 3CCJZ 1Q822 3CCVZ 1VQLZ 1JJ2Z 1Q812 1VQ61 1K8A1 2OTJ1 1W2BZ 1KC81 1VQMZ 3G4S1 1VQ81 3I56Z 3G6E1 3CCSZ 1YHQ1 1K9M1 1M1K2 3CCLZ 1QVFZ 1VQ41 1YJW1 3CCR1 1YJN1 1YIT1 1Q862 1VQK1 2OTL1 1VQ7Z 3CD61 1S721 3CCM1 2QA41 1N8R1 3CCJ1 1YIJZ 3CPWZ 1YJ9Z 3CCV1 1VQL1 1QVGY 1NJI2 3CCUZ 1KQSY 1VQM1 3G71Z 3CCEZ 3CXCZ 3I561 3OW2Z 1K8A2 1KD11 3CMEZ 3CCS1 1VQ9Z 3CC4Z 3CCQZ 1KC82 3CCL1 3CMAZ 3CC2Z 1K9M2 1VQ71 1VQ8Z 1K732 1M902 1YIJ1 1VQNZ 3CC7Z 1YJ91 3CPWY 1JJ2Y 1Q7Y1 1W2BY 2QEXZ
chains in the Genus database with same CATH superfamily
3G711 1YJWZ 1Q821 3S1NI 3S15I 2LFUA 5CM2M 3EEDA 2PK7A 1WJ2A 1KQSZ 3K7AI 4XX2A 4EWCA 1VQN1 1N2FA 3NH5A 1YHQZ 2JA6I 1I3QI 4NB9A 1FDOA 4NBCA 3TE5B 1PFTA 3CCRZ 3FQQA 4RS4A 3U50C 3CC41 5D1OB 1Q7Y2 2OOXB 3CCMZ 4MONA 1TFIA 2JIOA 3CCJZ 2VPXA 3MZLB 2IZ4A 1VQLZ 2IZ3A 1Z01A 3J80f 4MD8A 4E31A 1VQ81 2QREB 4HGZA 2LIYA 2W04A 3IX0A 2K3RA 1YHQ1 2JA5I 1M1K2 5A2Qf 3CCLZ 1QVFZ 3PO3I 3CCR1 3JAMf 1WCMI 2R7ZI 4A3II 1Q862 3VB9A 1Z02A 3MONA 2VPYA 3CCM1 1N8R1 2V8KA 2F4MA 3CCJ1 3FKII 3CPWZ 2E7ZA 1YJ9Z 4NBAA 1VQL1 1NJI2 2JIQA 1RO0A 1X3ZA 4E2WA 4DGLA 4A3DI 3CCEZ 3CXCZ 2J6AA 2V3VA 3OW2Z 1KD11 3HOYI 4AYBA 3CCL1 1TWHI 3S1RI 3EERA 4QTTA 5A2Qb 4HH4A 3CMAZ 5C4XI 2GTHA 3HOVI 1YUAA 1K9M2 1DL6A 3J81f 5FLMI 3HOWI 1YJ91 4NB8A 1JJ2Y 1L1OC 2F4OA 1USPA 1JWHC 2OOYB 1Y1VI 1K83I 4Y52I 3CCE1 2RPRA 1VQPZ 1Q811 1S7MA 1NJI1 2YADA 2PMZA 2R93I 1S72Z 4BY7I 4A3BI 3CMA1 3F3PC 2QLVB 3GTJI 1RLYA 3S16I 2AKLA 2OTJZ 3PO2I 5T64A 3J81b 5T6BA 1VQ4Z 3H0GI 2PM9A 3Q87A 5FLXf 4A3FI 1YUKA 1TWFI 3VMHA 1VQKZ 1VQP1 2RHBA 2QA4Z 2YU9I 3VMGA 4MD7A 3CCVZ 1K8A1 3I4NI 2OTJ1 1KC81 2E2HI 3S17I 3IR7A 1WIIA 1WZNA 1USPB 2V8JA 3NDIA 4E2XA 3D6WA 2JMOA 2V8IA 1VQ41 1WW9A 4CL1A 1YJW1 5FLXb 2QRCB 2HU9A 2RT9A 1VQK1 2RIQA 1VQ7Z 3J7A4 2QA41 3F3FC 3CCV1 1QVGY 3I07A 2LEXA 1NUIA 3VMIA 3CCUZ 5IT9b 4E30A 4RVGA 2WAQA 3CMEZ 5AN9F 3CCQZ 2VUGA 2AYDA 4QTUA 1QYPA 3CC2Z 3CQZI 3RZOI 3ESWA 3IF8A 4BY1I 2R6MA 4MD9A 3S14I 2Q51A 3S2DI 1VQ71 2GTIA 2RBLA 1M902 3D9XA 3CC7Z 3CPWY 4A3GI 1X0TA 3P5JB 4MRIA 5D1PA 1Q7Y1 1W2BY 4TNUA 2E2JI 2KI7B 2V45A 2QRDB 3CXCY 3I55Z 3OW2Y 3CME1 1Y1WI 3GTQI 3CCQ1 3GTGI 2E2II 3NH4A 2VUMI 4Y7NI 4NBDA 3CC21 1TWAI 1TWGI 2JR6A 5LL6f 4RV9A 2JIRA 1M1K1 3G4SZ 3D2LA 1AA6A 3NDJA 3CC71 2E9HA 1Q861 2NVXI 4NBFA 1RNIA 1YJNZ 2JIPA 1YITZ 3RZDI 1M901 3I551 3GTOI 1I6HI 3CD6Z 2P3YA 4HGYA 2NAPA 1Q822 3HOUI 3GTMS 1JJ2Z 4S1TA 2JNYA 1ZB9A 4RVHA 3G4S1 2NVQI 2B63I 1TWCI 3HOXI 3M3YI 3I56Z 3CCSZ 4DK1A 3VTNA 1K9M1 2KPIA 4MXUA 1YJN1 1YIT1 1SFOI 3MZKB 2DE5A 2VPWA 3CD61 2GU2A 1S721 1FDIA 4A3JI 4BBSI 3NFZA 5IT9f 4NOZA 4NH1C 4A3CI 1KQSY 3KIFA 1P9NA 3M4OI 2IV2X 3I561 1ZB8A 2ZAEB 4RVDA 3CCS1 1VQ9Z 1I50I 3CC4Z 2G2KA 3HOZI 5IP9I 2JA7I 4NFRA 4NBBA 3I4MI 3S1MI 2Q4ZA 4NBEA 1RO4A 1VQ8Z 1K732 1QF8A 2K5RA 3FQMA 3IFUA 4E33A 2BJOA 2JIMA 1X3WA 2QEXZ 2P28A 1N8R2 1Y8CA 2WB1A 3KIHA 5IP7I 1YI2Z 1QXFA 4A93I 1RO2A 5C44I 2JS4A 3QWUA 1VQ91 1VQOZ 1QVFY 3S1QI 1VQ5Z 3PO3S 1ZH1A 3NH8A 1VQ6Z 1QVGZ 1KD12 4MH4A 2VPZA 4NBGA 5T67A 1Q16A 1KRLA 3T4NB 2Y0SA 2I3CA 3G6EZ 3GTPI 3BG0B 3CCU1 1NP6A 1RQFA 2QEX1 4A3LI 2O4HA 1YI21 4BBRI 1K731 3S2HI 2OZKA 2DE7A 3BG1B 2OTLZ 4X6AI 1VQO1 1VQ51 2DE6A 2O53A 1Q812 1VQ61 2VF1A 3TDHB 1W2BZ 1VQMZ 3GKQA 3J80b 2JA8I 2NVYI 2QR1B 2H85A 2R92I 4E2YA 3G6E1 3LUSA 4RVFA 3H3VJ 3GTLI 1Y1VS 4A3EI 1LQLA 3JAMb 2OTL1 1YIJZ 2HF1A 4NBHA 2NVTI 2QKDA 1VQM1 4A3MI 3G71Z 2M6NA 4E2ZA 1K8A2 1Z03A 5C3EI 1KC82 5C4JI 1ML8A 2M48A 5D1OA 2JUBA 1R9TI 3GTMI 4A3KI 1VLAA 3GCFA 1YIJ1 1VQNZ 3HKZA 2W03A 1SIWA 3GTKI 4BXXI 2EGTA 4E32A 4DQYB
chains in the Genus database with same CATH topology
3G711 1YJWZ 1Q821 3S1NI 3S15I 2LFUA 5CM2M 3EEDA 2PK7A 1KQSZ 3K7AI 4XX2A 4EWCA 1VQN1 1N2FA 3NH5A 1YHQZ 2JA6I 1I3QI 4NB9A 4NBCA 3TE5B 1PFTA 3CCRZ 3FQQA 4RS4A 3U50C 3CC41 5D1OB 1Q7Y2 2OOXB 3CCMZ 4MONA 1TFIA 3CCJZ 3MZLB 2IZ4A 1VQLZ 2IZ3A 1Z01A 3J80f 4MD8A 4E31A 1VQ81 2QREB 4HGZA 2LIYA 2W04A 3IX0A 2K3RA 1YHQ1 2JA5I 1M1K2 5A2Qf 3CCLZ 1QVFZ 3PO3I 3CCR1 3JAMf 1WCMI 2R7ZI 4A3II 1Q862 3VB9A 1Z02A 3MONA 3CCM1 1N8R1 2V8KA 2F4MA 3CCJ1 3FKII 3CPWZ 1YJ9Z 4NBAA 1VQL1 1NJI2 1RO0A 1X3ZA 4E2WA 4DGLA 4A3DI 3CCEZ 3CXCZ 2J6AA 3OW2Z 1KD11 3HOYI 4AYBA 3CCL1 1TWHI 3S1RI 3EERA 4QTTA 5A2Qb 4HH4A 3CMAZ 5C4XI 2GTHA 3HOVI 1YUAA 1K9M2 1DL6A 3J81f 5FLMI 3HOWI 1YJ91 4NB8A 1JJ2Y 1L1OC 2F4OA 1USPA 1JWHC 2OOYB 1Y1VI 1K83I 4Y52I 3CCE1 2RPRA 1VQPZ 1Q811 1S7MA 1NJI1 2YADA 2PMZA 2R93I 1S72Z 4BY7I 4A3BI 3CMA1 3F3PC 2QLVB 3GTJI 1RLYA 3S16I 2AKLA 2OTJZ 3PO2I 5T64A 3J81b 5T6BA 1VQ4Z 3H0GI 2PM9A 3Q87A 5FLXf 4A3FI 1YUKA 1TWFI 3VMHA 1VQKZ 1VQP1 2RHBA 2QA4Z 2YU9I 3VMGA 4MD7A 3CCVZ 1K8A1 3I4NI 2OTJ1 1KC81 2E2HI 3S17I 1WIIA 2V8JA 1USPB 3NDIA 4E2XA 3D6WA 2JMOA 2V8IA 1VQ41 1WW9A 4CL1A 1YJW1 5FLXb 2QRCB 2HU9A 2RT9A 1VQK1 2RIQA 1VQ7Z 3J7A4 2QA41 3F3FC 3CCV1 1QVGY 3I07A 1NUIA 3VMIA 3CCUZ 5IT9b 4E30A 4RVGA 2WAQA 3CMEZ 5AN9F 3CCQZ 2VUGA 4QTUA 1QYPA 3CC2Z 3CQZI 3RZOI 3ESWA 3IF8A 4BY1I 2R6MA 4MD9A 3S14I 2Q51A 3S2DI 1VQ71 2GTIA 2RBLA 1M902 3D9XA 3CC7Z 3CPWY 4A3GI 1X0TA 3P5JB 4MRIA 5D1PA 1Q7Y1 1W2BY 4TNUA 2E2JI 2KI7B 2QRDB 3CXCY 3I55Z 3OW2Y 3CME1 1Y1WI 3GTQI 3CCQ1 3GTGI 2E2II 3NH4A 2VUMI 4Y7NI 4NBDA 3CC21 1TWAI 1TWGI 2JR6A 5LL6f 4RV9A 1M1K1 3G4SZ 3NDJA 3CC71 2E9HA 1Q861 2NVXI 4NBFA 1RNIA 1YJNZ 1YITZ 3RZDI 1M901 3I551 3GTOI 1I6HI 3CD6Z 2P3YA 4HGYA 1Q822 3HOUI 3GTMS 1JJ2Z 4S1TA 2JNYA 1ZB9A 4RVHA 3G4S1 2NVQI 2B63I 1TWCI 3HOXI 3M3YI 3I56Z 3CCSZ 4DK1A 3VTNA 1K9M1 2KPIA 4MXUA 1YJN1 1YIT1 1SFOI 3MZKB 2DE5A 3CD61 2GU2A 1S721 4A3JI 4BBSI 3NFZA 5IT9f 4NOZA 4NH1C 4A3CI 1KQSY 3KIFA 1P9NA 3M4OI 3I561 1ZB8A 2ZAEB 4RVDA 3CCS1 1VQ9Z 1I50I 3CC4Z 2G2KA 3HOZI 5IP9I 2JA7I 4NFRA 4NBBA 3I4MI 3S1MI 2Q4ZA 4NBEA 1RO4A 1VQ8Z 1K732 1QF8A 2K5RA 3FQMA 3IFUA 4E33A 2BJOA 1X3WA 2QEXZ 2P28A 1N8R2 2WB1A 5IP7I 3KIHA 1YI2Z 4A93I 1RO2A 5C44I 2JS4A 3QWUA 1VQ91 1VQOZ 1QVFY 3S1QI 1VQ5Z 3PO3S 1ZH1A 3NH8A 1VQ6Z 1QVGZ 1KD12 4MH4A 4NBGA 5T67A 1KRLA 3T4NB 2Y0SA 2I3CA 3G6EZ 3GTPI 3BG0B 3CCU1 1NP6A 1RQFA 2QEX1 4A3LI 2O4HA 1YI21 4BBRI 1K731 3S2HI 2OZKA 2DE7A 3BG1B 2OTLZ 4X6AI 1VQO1 1VQ51 2DE6A 2O53A 1Q812 1VQ61 2VF1A 3TDHB 1W2BZ 1VQMZ 3GKQA 3J80b 2JA8I 2NVYI 2QR1B 2H85A 2R92I 4E2YA 3G6E1 3LUSA 4RVFA 3H3VJ 3GTLI 1Y1VS 4A3EI 1LQLA 3JAMb 2OTL1 1YIJZ 2HF1A 4NBHA 2NVTI 2QKDA 1VQM1 4A3MI 3G71Z 2M6NA 4E2ZA 1K8A2 1Z03A 5C3EI 1KC82 5C4JI 1ML8A 2M48A 5D1OA 2JUBA 1R9TI 3GTMI 4A3KI 1VLAA 3GCFA 1YIJ1 1VQNZ 3HKZA 2W03A 3GTKI 4BXXI 2EGTA 4E32A 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  3G71 1;  1YI2 Z;  1YJW Z;  3CCE 1;  1Q82 1;  3CXC Y;  1VQP Z;  1Q81 1;  3I55 Z;  3OW2 Y;  3CME 1;  1VQ9 1;  1VQO Z;  1NJI 1;  1QVF Y;  3CCQ 1;  1VQ5 Z;  1S72 Z;  3CMA 1;  3CC2 1;  1VQ6 Z;  1QVG Z;  1KD1 2;  2OTJ Z;  1M1K 1;  1KQS Z;  3G4S Z;  1VQN 1;  3CC7 1;  3G6E Z;  1Q86 1;  1YHQ Z;  3CCU 1;  1VQ4 Z;  2QEX 1;  3CCR Z;  1YJN Z;  1YIT Z;  1YI2 1;  1K73 1;  1M90 1;  1VQK Z;  1VQP 1;  3I55 1;  2OTL Z;  3CC4 1;  1VQO 1;  1Q7Y 2;  3CD6 Z;  1VQ5 1;  3CCM Z;  2QA4 Z;  3CCJ Z;  1Q82 2;  3CCV Z;  1VQL Z;  1JJ2 Z;  1Q81 2;  1VQ6 1;  1K8A 1;  2OTJ 1;  1W2B Z;  1KC8 1;  1VQM Z;  3G4S 1;  1VQ8 1;  3I56 Z;  3G6E 1;  3CCS Z;  1YHQ 1;  1K9M 1;  1M1K 2;  3CCL Z;  1QVF Z;  1VQ4 1;  1YJW 1;  3CCR 1;  1YJN 1;  1YIT 1;  1Q86 2;  1VQK 1;  2OTL 1;  1VQ7 Z;  3CD6 1;  1S72 1;  3CCM 1;  2QA4 1;  1N8R 1;  3CCJ 1;  1YIJ Z;  3CPW Z;  1YJ9 Z;  3CCV 1;  1VQL 1;  1QVG Y;  1NJI 2;  3CCU Z;  1KQS Y;  1VQM 1;  3G71 Z;  3CCE Z;  3CXC Z;  3I56 1;  3OW2 Z;  1K8A 2;  1KD1 1;  3CME Z;  3CCS 1;  1VQ9 Z;  3CC4 Z;  3CCQ Z;  1KC8 2;  3CCL 1;  3CMA Z;  3CC2 Z;  1K9M 2;  1VQ7 1;  1VQ8 Z;  1K73 2;  1M90 2;  1YIJ 1;  1VQN Z;  3CC7 Z;  1YJ9 1;  3CPW Y;  1JJ2 Y;  1Q7Y 1;  1W2B Y;  2QEX Z; 
#chains in the Genus database with same CATH topology
 3G71 1;  1YJW Z;  1Q82 1;  3S1N I;  3S15 I;  2LFU A;  5CM2 M;  3EED A;  2PK7 A;  1WJ2 A;  1KQS Z;  3K7A I;  4XX2 A;  4EWC A;  1VQN 1;  1N2F A;  3NH5 A;  1YHQ Z;  2JA6 I;  1I3Q I;  4NB9 A;  1FDO A;  4NBC A;  3TE5 B;  1PFT A;  3CCR Z;  3FQQ A;  4RS4 A;  3U50 C;  3CC4 1;  5D1O B;  1Q7Y 2;  2OOX B;  3CCM Z;  4MON A;  1TFI A;  2JIO A;  3CCJ Z;  2VPX A;  3MZL B;  2IZ4 A;  1VQL Z;  2IZ3 A;  1Z01 A;  3J80 f;  4MD8 A;  4E31 A;  1VQ8 1;  2QRE B;  4HGZ A;  2LIY A;  2W04 A;  3IX0 A;  2K3R A;  1YHQ 1;  2JA5 I;  1M1K 2;  5A2Q f;  3CCL Z;  1QVF Z;  3PO3 I;  3CCR 1;  3JAM f;  1WCM I;  2R7Z I;  4A3I I;  1Q86 2;  3VB9 A;  1Z02 A;  3MON A;  2VPY A;  3CCM 1;  1N8R 1;  2V8K A;  2F4M A;  3CCJ 1;  3FKI I;  3CPW Z;  2E7Z A;  1YJ9 Z;  4NBA A;  1VQL 1;  1NJI 2;  2JIQ A;  1RO0 A;  1X3Z A;  4E2W A;  4DGL A;  4A3D I;  3CCE Z;  3CXC Z;  2J6A A;  2V3V A;  3OW2 Z;  1KD1 1;  3HOY I;  4AYB A;  3CCL 1;  1TWH I;  3S1R I;  3EER A;  4QTT A;  5A2Q b;  4HH4 A;  3CMA Z;  5C4X I;  2GTH A;  3HOV I;  1YUA A;  1K9M 2;  1DL6 A;  3J81 f;  5FLM I;  3HOW I;  1YJ9 1;  4NB8 A;  1JJ2 Y;  1L1O C;  2F4O A;  1USP A;  1JWH C;  2OOY B;  1Y1V I;  1K83 I;  4Y52 I;  3CCE 1;  2RPR A;  1VQP Z;  1Q81 1;  1S7M A;  1NJI 1;  2YAD A;  2PMZ A;  2R93 I;  1S72 Z;  4BY7 I;  4A3B I;  3CMA 1;  3F3P C;  2QLV B;  3GTJ I;  1RLY A;  3S16 I;  2AKL A;  2OTJ Z;  3PO2 I;  5T64 A;  3J81 b;  5T6B A;  1VQ4 Z;  3H0G I;  2PM9 A;  3Q87 A;  5FLX f;  4A3F I;  1YUK A;  1TWF I;  3VMH A;  1VQK Z;  1VQP 1;  2RHB A;  2QA4 Z;  2YU9 I;  3VMG A;  4MD7 A;  3CCV Z;  1K8A 1;  3I4N I;  2OTJ 1;  1KC8 1;  2E2H I;  3S17 I;  3IR7 A;  1WII A;  1WZN A;  1USP B;  2V8J A;  3NDI A;  4E2X A;  3D6W A;  2JMO A;  2V8I A;  1VQ4 1;  1WW9 A;  4CL1 A;  1YJW 1;  5FLX b;  2QRC B;  2HU9 A;  2RT9 A;  1VQK 1;  2RIQ A;  1VQ7 Z;  3J7A 4;  2QA4 1;  3F3F C;  3CCV 1;  1QVG Y;  3I07 A;  2LEX A;  1NUI A;  3VMI A;  3CCU Z;  5IT9 b;  4E30 A;  4RVG A;  2WAQ A;  3CME Z;  5AN9 F;  3CCQ Z;  2VUG A;  2AYD A;  4QTU A;  1QYP A;  3CC2 Z;  3CQZ I;  3RZO I;  3ESW A;  3IF8 A;  4BY1 I;  2R6M A;  4MD9 A;  3S14 I;  2Q51 A;  3S2D I;  1VQ7 1;  2GTI A;  2RBL A;  1M90 2;  3D9X A;  3CC7 Z;  3CPW Y;  4A3G I;  1X0T A;  3P5J B;  4MRI A;  5D1P A;  1Q7Y 1;  1W2B Y;  4TNU A;  2E2J I;  2KI7 B;  2V45 A;  2QRD B;  3CXC Y;  3I55 Z;  3OW2 Y;  3CME 1;  1Y1W I;  3GTQ I;  3CCQ 1;  3GTG I;  2E2I I;  3NH4 A;  2VUM I;  4Y7N I;  4NBD A;  3CC2 1;  1TWA I;  1TWG I;  2JR6 A;  5LL6 f;  4RV9 A;  2JIR A;  1M1K 1;  3G4S Z;  3D2L A;  1AA6 A;  3NDJ A;  3CC7 1;  2E9H A;  1Q86 1;  2NVX I;  4NBF A;  1RNI A;  1YJN Z;  2JIP A;  1YIT Z;  3RZD I;  1M90 1;  3I55 1;  3GTO I;  1I6H I;  3CD6 Z;  2P3Y A;  4HGY A;  2NAP A;  1Q82 2;  3HOU I;  3GTM S;  1JJ2 Z;  4S1T A;  2JNY A;  1ZB9 A;  4RVH A;  3G4S 1;  2NVQ I;  2B63 I;  1TWC I;  3HOX I;  3M3Y I;  3I56 Z;  3CCS Z;  4DK1 A;  3VTN A;  1K9M 1;  2KPI A;  4MXU A;  1YJN 1;  1YIT 1;  1SFO I;  3MZK B;  2DE5 A;  2VPW A;  3CD6 1;  2GU2 A;  1S72 1;  1FDI A;  4A3J I;  4BBS I;  3NFZ A;  5IT9 f;  4NOZ A;  4NH1 C;  4A3C I;  1KQS Y;  3KIF A;  1P9N A;  3M4O I;  2IV2 X;  3I56 1;  1ZB8 A;  2ZAE B;  4RVD A;  3CCS 1;  1VQ9 Z;  1I50 I;  3CC4 Z;  2G2K A;  3HOZ I;  5IP9 I;  2JA7 I;  4NFR A;  4NBB A;  3I4M I;  3S1M I;  2Q4Z A;  4NBE A;  1RO4 A;  1VQ8 Z;  1K73 2;  1QF8 A;  2K5R A;  3FQM A;  3IFU A;  4E33 A;  2BJO A;  2JIM A;  1X3W A;  2QEX Z;  2P28 A;  1N8R 2;  1Y8C A;  2WB1 A;  3KIH A;  5IP7 I;  1YI2 Z;  1QXF A;  4A93 I;  1RO2 A;  5C44 I;  2JS4 A;  3QWU A;  1VQ9 1;  1VQO Z;  1QVF Y;  3S1Q I;  1VQ5 Z;  3PO3 S;  1ZH1 A;  3NH8 A;  1VQ6 Z;  1QVG Z;  1KD1 2;  4MH4 A;  2VPZ A;  4NBG A;  5T67 A;  1Q16 A;  1KRL A;  3T4N B;  2Y0S A;  2I3C A;  3G6E Z;  3GTP I;  3BG0 B;  3CCU 1;  1NP6 A;  1RQF A;  2QEX 1;  4A3L I;  2O4H A;  1YI2 1;  4BBR I;  1K73 1;  3S2H I;  2OZK A;  2DE7 A;  3BG1 B;  2OTL Z;  4X6A I;  1VQO 1;  1VQ5 1;  2DE6 A;  2O53 A;  1Q81 2;  1VQ6 1;  2VF1 A;  3TDH B;  1W2B Z;  1VQM Z;  3GKQ A;  3J80 b;  2JA8 I;  2NVY I;  2QR1 B;  2H85 A;  2R92 I;  4E2Y A;  3G6E 1;  3LUS A;  4RVF A;  3H3V J;  3GTL I;  1Y1V S;  4A3E I;  1LQL A;  3JAM b;  2OTL 1;  1YIJ Z;  2HF1 A;  4NBH A;  2NVT I;  2QKD A;  1VQM 1;  4A3M I;  3G71 Z;  2M6N A;  4E2Z A;  1K8A 2;  1Z03 A;  5C3E I;  1KC8 2;  5C4J I;  1ML8 A;  2M48 A;  5D1O A;  2JUB A;  1R9T I;  3GTM I;  4A3K I;  1VLA A;  3GCF A;  1YIJ 1;  1VQN Z;  3HKZ A;  2W03 A;  1SIW A;  3GTK I;  4BXX I;  2EGT A;  4E32 A;  4DQY B; 
#chains in the Genus database with same CATH homology
 3G71 1;  1YJW Z;  1Q82 1;  3S1N I;  3S15 I;  2LFU A;  5CM2 M;  3EED A;  2PK7 A;  1KQS Z;  3K7A I;  4XX2 A;  4EWC A;  1VQN 1;  1N2F A;  3NH5 A;  1YHQ Z;  2JA6 I;  1I3Q I;  4NB9 A;  4NBC A;  3TE5 B;  1PFT A;  3CCR Z;  3FQQ A;  4RS4 A;  3U50 C;  3CC4 1;  5D1O B;  1Q7Y 2;  2OOX B;  3CCM Z;  4MON A;  1TFI A;  3CCJ Z;  3MZL B;  2IZ4 A;  1VQL Z;  2IZ3 A;  1Z01 A;  3J80 f;  4MD8 A;  4E31 A;  1VQ8 1;  2QRE B;  4HGZ A;  2LIY A;  2W04 A;  3IX0 A;  2K3R A;  1YHQ 1;  2JA5 I;  1M1K 2;  5A2Q f;  3CCL Z;  1QVF Z;  3PO3 I;  3CCR 1;  3JAM f;  1WCM I;  2R7Z I;  4A3I I;  1Q86 2;  3VB9 A;  1Z02 A;  3MON A;  3CCM 1;  1N8R 1;  2V8K A;  2F4M A;  3CCJ 1;  3FKI I;  3CPW Z;  1YJ9 Z;  4NBA A;  1VQL 1;  1NJI 2;  1RO0 A;  1X3Z A;  4E2W A;  4DGL A;  4A3D I;  3CCE Z;  3CXC Z;  2J6A A;  3OW2 Z;  1KD1 1;  3HOY I;  4AYB A;  3CCL 1;  1TWH I;  3S1R I;  3EER A;  4QTT A;  5A2Q b;  4HH4 A;  3CMA Z;  5C4X I;  2GTH A;  3HOV I;  1YUA A;  1K9M 2;  1DL6 A;  3J81 f;  5FLM I;  3HOW I;  1YJ9 1;  4NB8 A;  1JJ2 Y;  1L1O C;  2F4O A;  1USP A;  1JWH C;  2OOY B;  1Y1V I;  1K83 I;  4Y52 I;  3CCE 1;  2RPR A;  1VQP Z;  1Q81 1;  1S7M A;  1NJI 1;  2YAD A;  2PMZ A;  2R93 I;  1S72 Z;  4BY7 I;  4A3B I;  3CMA 1;  3F3P C;  2QLV B;  3GTJ I;  1RLY A;  3S16 I;  2AKL A;  2OTJ Z;  3PO2 I;  5T64 A;  3J81 b;  5T6B A;  1VQ4 Z;  3H0G I;  2PM9 A;  3Q87 A;  5FLX f;  4A3F I;  1YUK A;  1TWF I;  3VMH A;  1VQK Z;  1VQP 1;  2RHB A;  2QA4 Z;  2YU9 I;  3VMG A;  4MD7 A;  3CCV Z;  1K8A 1;  3I4N I;  2OTJ 1;  1KC8 1;  2E2H I;  3S17 I;  1WII A;  2V8J A;  1USP B;  3NDI A;  4E2X A;  3D6W A;  2JMO A;  2V8I A;  1VQ4 1;  1WW9 A;  4CL1 A;  1YJW 1;  5FLX b;  2QRC B;  2HU9 A;  2RT9 A;  1VQK 1;  2RIQ A;  1VQ7 Z;  3J7A 4;  2QA4 1;  3F3F C;  3CCV 1;  1QVG Y;  3I07 A;  1NUI A;  3VMI A;  3CCU Z;  5IT9 b;  4E30 A;  4RVG A;  2WAQ A;  3CME Z;  5AN9 F;  3CCQ Z;  2VUG A;  4QTU A;  1QYP A;  3CC2 Z;  3CQZ I;  3RZO I;  3ESW A;  3IF8 A;  4BY1 I;  2R6M A;  4MD9 A;  3S14 I;  2Q51 A;  3S2D I;  1VQ7 1;  2GTI A;  2RBL A;  1M90 2;  3D9X A;  3CC7 Z;  3CPW Y;  4A3G I;  1X0T A;  3P5J B;  4MRI A;  5D1P A;  1Q7Y 1;  1W2B Y;  4TNU A;  2E2J I;  2KI7 B;  2QRD B;  3CXC Y;  3I55 Z;  3OW2 Y;  3CME 1;  1Y1W I;  3GTQ I;  3CCQ 1;  3GTG I;  2E2I I;  3NH4 A;  2VUM I;  4Y7N I;  4NBD A;  3CC2 1;  1TWA I;  1TWG I;  2JR6 A;  5LL6 f;  4RV9 A;  1M1K 1;  3G4S Z;  3NDJ A;  3CC7 1;  2E9H A;  1Q86 1;  2NVX I;  4NBF A;  1RNI A;  1YJN Z;  1YIT Z;  3RZD I;  1M90 1;  3I55 1;  3GTO I;  1I6H I;  3CD6 Z;  2P3Y A;  4HGY A;  1Q82 2;  3HOU I;  3GTM S;  1JJ2 Z;  4S1T A;  2JNY A;  1ZB9 A;  4RVH A;  3G4S 1;  2NVQ I;  2B63 I;  1TWC I;  3HOX I;  3M3Y I;  3I56 Z;  3CCS Z;  4DK1 A;  3VTN A;  1K9M 1;  2KPI A;  4MXU A;  1YJN 1;  1YIT 1;  1SFO I;  3MZK B;  2DE5 A;  3CD6 1;  2GU2 A;  1S72 1;  4A3J I;  4BBS I;  3NFZ A;  5IT9 f;  4NOZ A;  4NH1 C;  4A3C I;  1KQS Y;  3KIF A;  1P9N A;  3M4O I;  3I56 1;  1ZB8 A;  2ZAE B;  4RVD A;  3CCS 1;  1VQ9 Z;  1I50 I;  3CC4 Z;  2G2K A;  3HOZ I;  5IP9 I;  2JA7 I;  4NFR A;  4NBB A;  3I4M I;  3S1M I;  2Q4Z A;  4NBE A;  1RO4 A;  1VQ8 Z;  1K73 2;  1QF8 A;  2K5R A;  3FQM A;  3IFU A;  4E33 A;  2BJO A;  1X3W A;  2QEX Z;  2P28 A;  1N8R 2;  2WB1 A;  5IP7 I;  3KIH A;  1YI2 Z;  4A93 I;  1RO2 A;  5C44 I;  2JS4 A;  3QWU A;  1VQ9 1;  1VQO Z;  1QVF Y;  3S1Q I;  1VQ5 Z;  3PO3 S;  1ZH1 A;  3NH8 A;  1VQ6 Z;  1QVG Z;  1KD1 2;  4MH4 A;  4NBG A;  5T67 A;  1KRL A;  3T4N B;  2Y0S A;  2I3C A;  3G6E Z;  3GTP I;  3BG0 B;  3CCU 1;  1NP6 A;  1RQF A;  2QEX 1;  4A3L I;  2O4H A;  1YI2 1;  4BBR I;  1K73 1;  3S2H I;  2OZK A;  2DE7 A;  3BG1 B;  2OTL Z;  4X6A I;  1VQO 1;  1VQ5 1;  2DE6 A;  2O53 A;  1Q81 2;  1VQ6 1;  2VF1 A;  3TDH B;  1W2B Z;  1VQM Z;  3GKQ A;  3J80 b;  2JA8 I;  2NVY I;  2QR1 B;  2H85 A;  2R92 I;  4E2Y A;  3G6E 1;  3LUS A;  4RVF A;  3H3V J;  3GTL I;  1Y1V S;  4A3E I;  1LQL A;  3JAM b;  2OTL 1;  1YIJ Z;  2HF1 A;  4NBH A;  2NVT I;  2QKD A;  1VQM 1;  4A3M I;  3G71 Z;  2M6N A;  4E2Z A;  1K8A 2;  1Z03 A;  5C3E I;  1KC8 2;  5C4J I;  1ML8 A;  2M48 A;  5D1O A;  2JUB A;  1R9T I;  3GTM I;  4A3K I;  1VLA A;  3GCF A;  1YIJ 1;  1VQN Z;  3HKZ A;  2W03 A;  3GTK I;  4BXX I;  2EGT A;  4E32 A;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...