3CCR1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccr100
1VQ61 3CMAZ 3CCEZ 1N8R1 1Q861 3CD6Z 1VQ7Z 1M1K1 3I55Z 2OTJZ 1Q821 3G6E1 3CME1 1VQ8Z 1VQM1 1KD12 3G4SZ 2QEXZ 3CXCZ 3CCM1 1VQN1 1Q811 3CCLZ 1VQ4Z 1K8A1 1VQ91 1YIJZ 1W2BY 1VQ51 1K732 1YHQZ 3G71Z 3CCQZ 1KC82 3CCVZ 1VQKZ 3CCJ1 1VQO1 1QVGY 3I56Z 1YJ91 1QVFZ 1S72Z 1VQL1 3CCSZ 3CC2Z 1NJI2 2QA4Z 3CCE1 3CMA1 3CC7Z 2OTLZ 1YJN1 1M902 3CD61 1VQ71 1QVFY 1W2BZ 1Q7Y2 1K9M2 3CPWY 1VQP1 2QEX1 1QVGZ 3CCU1 3G6EZ 1YJWZ 3CC4Z 1YI21 1N8R2 1Q862 1M1K2 3CCL1 1VQ41 1YIJ1 1Q822 1KQSZ 1VQ9Z 3CCRZ 3CPWZ 1KD11 3G711 3CCQ1 1VQ5Z 3CCV1 1VQK1 1Q812 1YITZ 1S721 3I551 1KQSY 2OTJ1 1VQ6Z 3CCJZ 1VQOZ 1K9M1 3CCS1 1VQ81 3CC21 3G4S1 3CC71 2OTL1 3CMEZ 1VQMZ 3OW2Y 1K731 1JJ2Z 1YJNZ 3CCMZ 1KC81 1VQNZ 1YJW1 3CC41 1VQPZ 1JJ2Y 3CCUZ 1NJI1 1YHQ1 1YI2Z 1M901 3I561 3OW2Z 1Q7Y1 1K8A2 3CCR1 1YJ9Z 3CXCY 2QA41 1VQLZ 1YIT1
chains in the Genus database with same CATH superfamily
3J7A4 3S14I 3VTNA 3J80f 2JA6I 4NB9A 3JAMf 2QEXZ 2AKLA 2EGTA 1NP6A 4BY1I 4Y52I 1WIIA 1ZH1A 3CCLZ 1VQ91 2E7ZA 3HOUI 2E2HI 1W2BY 3PO3I 2V8KA 5C44I 1P9NA 1TWFI 1YHQZ 3S1NI 4TNUA 4A3FI 1VQO1 5IT9b 4E2ZA 1QXFA 1USPA 3HOXI 5FLXf 3CC2Z 3VMHA 4NH1C 2G2KA 2OTLZ 4E2YA 4MH4A 3TE5B 4E2WA 2VUMI 1QVGZ 3D2LA 1YJWZ 2RBLA 4NBCA 1YI21 4E2XA 1DL6A 2JMOA 2JIRA 1RQFA 1YIJ1 3J81b 3PO2I 3GTMS 4NFRA 3I4NI 2QRDB 2I3CA 4NBBA 4DGLA 3M4OI 3K7AI 1KD11 4A3DI 3D6WA 4MD7A 1KQSY 1VQ6Z 3HOZI 3CCJZ 1ZB9A 3CCS1 4MD9A 3HOYI 1YUKA 4HGZA 2PMZA 1VQMZ 3OW2Y 2E2JI 2IV2X 3S1QI 1RNIA 1KC81 3S17I 2OZKA 2VPXA 2GTHA 3CC41 1ZB8A 1VQPZ 1JJ2Y 2V8JA 3CCUZ 1Y1VI 3F3PC 1M901 1L1OC 4X6AI 5D1OA 4E32A 3CMAZ 3EEDA 4E33A 1M1K1 3I55Z 2OTJZ 4XX2A 5A2Qf 1X3ZA 3CME1 4E31A 1KD12 3G4SZ 1Q16A 3CXCZ 4NBAA 2AYDA 1WCMI 2NAPA 1I6HI 3IR7A 1VQN1 1S7MA 1X3WA 1VQ4Z 3GTGI 1Z03A 1I3QI 3S16I 1LQLA 2VPWA 2QKDA 3CCQZ 1KC82 3I56Z 1RO0A 1ML8A 3P5JB 2IZ4A 3FQMA 2HU9A 2VPYA 2QA4Z 4BXXI 1YJN1 1M902 2KI7B 1RO2A 3F3FC 4MRIA 3CPWY 3KIHA 2QEX1 2M6NA 2JS4A 4NBFA 1K83I 4CL1A 1Y1WI 3CCL1 1M1K2 4RVHA 2P3YA 2JIQA 1KQSZ 4A93I 5T64A 1VQ9Z 4BBRI 2DE6A 3MZKB 3BG1B 1YUAA 1YITZ 2W03A 2O53A 3HOWI 1K9M1 1VQOZ 3GTQI 2R7ZI 1VQ81 1N2FA 3CC21 2OOYB 3VMGA 1SFOI 2OTL1 3TDHB 2V3VA 2VPZA 1K731 2V45A 1JJ2Z 3I4MI 2LFUA 1USPB 3CCMZ 4A3II 4A3CI 2QLVB 1JWHC 3GTPI 1YJW1 4A3BI 1SIWA 3T4NB 4E30A 5IT9f 3GTOI 2LIYA 1YI2Z 1WW9A 3HKZA 1Q7Y1 4NBDA 2JA7I 1FDIA 1YJ9Z 4S1TA 2JUBA 1VQLZ 2F4OA 1TWHI 2W04A 5C4JI 1WZNA 2JA5I 1VQ61 3CCEZ 1N8R1 1Q861 3CD6Z 1VQ7Z 3S2DI 3FQQA 3IF8A 1Z01A 1Q821 3EERA 3G6E1 3J81f 3GTMI 2V8IA 1VQM1 2YU9I 3D9XA 1Q811 1K8A1 3QWUA 1VQ51 3Q87A 1K732 2NVTI 3G71Z 3CCVZ 1VQKZ 1QVGY 1S72Z 5IP9I 3GTJI 1VLAA 4A3GI 1TWCI 3VMIA 3CMA1 3CC7Z 1QVFY 1W2BZ 1Q7Y2 2JIMA 3NDJA 1QF8A 5LL6f 3U50C 3GKQA 3S15I 3IFUA 4MONA 4A3EI 1QYPA 3J80b 1N8R2 1Q862 3H0GI 1VQ41 3JAMb 2O4HA 1Q822 3NH5A 3CCRZ 3HOVI 2BJOA 3LUSA 4QTTA 3CCQ1 3NH8A 3S1RI 1Q812 3H3VJ 2QR1B 2HF1A 2GTIA 3PO3S 2NVXI 1R9TI 3MONA 2Q4ZA 1RLYA 4EWCA 1WJ2A 4A3LI 3I07A 2K5RA 1YJNZ 5AN9F 5FLXb 4A3JI 3GTKI 1KRLA 1PFTA 4HH4A 3FKII 1FDOA 2Y0SA 4AYBA 1NJI1 1YHQ1 2M48A 1Z02A 2RIQA 4NOZA 2F4MA 3RZOI 2YADA 3OW2Z 4NBHA 4MD8A 3CXCY 2WB1A 3GTLI 1YIT1 4Y7NI 1RO4A 2ZAEB 4NB8A 3NH4A 2J6AA 2DE5A 1VQ8Z 2E2II 5C3EI 3CCM1 2E9HA 2LEXA 2NVYI 2R93I 2JIPA 5D1PA 2B63I 1YIJZ 3GCFA 3NDIA 2QREB 4BY7I 4A3MI 2R92I 2JNYA 5IP7I 2DE7A 3CCJ1 2Q51A 1YJ91 1QVFZ 4RVFA 1Y1VS 1VQL1 4NBEA 2JIOA 3BG0B 3CCSZ 2VUGA 5CM2M 3S1MI 5T67A 1NJI2 3ESWA 3CCE1 3CD61 1VQ71 2H85A 2RHBA 1K9M2 1VQP1 1I50I 3CCU1 2PM9A 3G6EZ 3IX0A 2JR6A 3CC4Z 2GU2A 2RT9A 4RVDA 2IZ3A 5A2Qb 1NUIA 4DK1A 1X0TA 2P28A 3CPWZ 3G711 2JA8I 1VQ5Z 5D1OB 3CCV1 1VQK1 3M3YI 1S721 3I551 2OTJ1 3CQZI 5FLMI 2NVQI 3NFZA 4MXUA 5T6BA 4HGYA 3G4S1 1TFIA 3CC71 3VB9A 3CMEZ 3MZLB 2KPIA 2QRCB 3S2HI 1TWAI 2R6MA 4RS4A 2OOXB 1Y8CA 1VQNZ 2RPRA 4NBGA 2K3RA 4A3KI 5C4XI 2WAQA 4QTUA 3KIFA 3I561 4BBSI 2PK7A 1AA6A 1K8A2 3CCR1 3RZDI 2QA41 2VF1A 4DQYB 1TWGI 4RV9A 4RVGA
chains in the Genus database with same CATH topology
3J7A4 3S14I 3VTNA 3J80f 2JA6I 4NB9A 3JAMf 2QEXZ 2AKLA 2EGTA 1NP6A 4BY1I 4Y52I 1WIIA 1ZH1A 3CCLZ 1VQ91 3HOUI 2E2HI 1W2BY 3PO3I 2V8KA 5C44I 1P9NA 1TWFI 1YHQZ 3S1NI 4TNUA 4A3FI 1VQO1 5IT9b 4E2ZA 1USPA 3HOXI 5FLXf 3CC2Z 3VMHA 4NH1C 2G2KA 2OTLZ 4E2YA 4MH4A 3TE5B 4E2WA 2VUMI 1QVGZ 1YJWZ 2RBLA 4NBCA 1YI21 4E2XA 1DL6A 2JMOA 1RQFA 1YIJ1 3J81b 3PO2I 3GTMS 4NFRA 3I4NI 2QRDB 2I3CA 4NBBA 4DGLA 3M4OI 3K7AI 1KD11 4A3DI 3D6WA 4MD7A 1KQSY 1VQ6Z 3HOZI 3CCJZ 1ZB9A 3CCS1 4MD9A 3HOYI 1YUKA 4HGZA 2PMZA 1VQMZ 3OW2Y 2E2JI 3S1QI 1RNIA 1KC81 3S17I 2OZKA 2GTHA 3CC41 1ZB8A 1VQPZ 1JJ2Y 2V8JA 3CCUZ 1Y1VI 3F3PC 1M901 1L1OC 4X6AI 5D1OA 4E32A 3CMAZ 3EEDA 4E33A 1M1K1 3I55Z 2OTJZ 4XX2A 5A2Qf 1X3ZA 3CME1 4E31A 1KD12 3G4SZ 3CXCZ 4NBAA 1WCMI 1I6HI 1VQN1 1S7MA 1X3WA 1VQ4Z 3GTGI 1Z03A 1I3QI 3S16I 1LQLA 2QKDA 3CCQZ 1KC82 3I56Z 1RO0A 1ML8A 3P5JB 2IZ4A 3FQMA 2HU9A 2QA4Z 4BXXI 1YJN1 1M902 2KI7B 1RO2A 3F3FC 4MRIA 3CPWY 3KIHA 2QEX1 2M6NA 2JS4A 4NBFA 1K83I 4CL1A 1Y1WI 3CCL1 1M1K2 4RVHA 2P3YA 1KQSZ 4A93I 5T64A 1VQ9Z 4BBRI 2DE6A 3MZKB 3BG1B 1YUAA 1YITZ 2W03A 2O53A 3HOWI 1K9M1 1VQOZ 3GTQI 2R7ZI 1VQ81 1N2FA 3CC21 2OOYB 3VMGA 1SFOI 2OTL1 3TDHB 1K731 1JJ2Z 3I4MI 2LFUA 1USPB 3CCMZ 4A3II 4A3CI 2QLVB 1JWHC 3GTPI 1YJW1 4A3BI 3T4NB 4E30A 5IT9f 3GTOI 2LIYA 1YI2Z 1WW9A 3HKZA 1Q7Y1 4NBDA 2JA7I 1YJ9Z 4S1TA 2JUBA 1VQLZ 2F4OA 1TWHI 2W04A 5C4JI 2JA5I 1VQ61 3CCEZ 1N8R1 1Q861 3CD6Z 1VQ7Z 3S2DI 3FQQA 3IF8A 1Z01A 1Q821 3EERA 3G6E1 3J81f 3GTMI 2V8IA 1VQM1 2YU9I 3D9XA 1Q811 1K8A1 3QWUA 1VQ51 3Q87A 1K732 2NVTI 3G71Z 3CCVZ 1VQKZ 1QVGY 1S72Z 5IP9I 3GTJI 1VLAA 4A3GI 1TWCI 3VMIA 3CMA1 3CC7Z 1QVFY 1W2BZ 1Q7Y2 3NDJA 1QF8A 5LL6f 3U50C 3GKQA 3S15I 3IFUA 4MONA 4A3EI 1QYPA 3J80b 1N8R2 1Q862 3H0GI 1VQ41 3JAMb 2O4HA 1Q822 3NH5A 3CCRZ 3HOVI 2BJOA 3LUSA 4QTTA 3CCQ1 3NH8A 3S1RI 1Q812 3H3VJ 2QR1B 2HF1A 2GTIA 3PO3S 2NVXI 1R9TI 3MONA 2Q4ZA 1RLYA 4EWCA 4A3LI 3I07A 2K5RA 1YJNZ 5AN9F 5FLXb 4A3JI 3GTKI 1KRLA 1PFTA 4HH4A 3FKII 2Y0SA 4AYBA 1NJI1 1YHQ1 2M48A 1Z02A 2RIQA 4NOZA 2F4MA 3RZOI 2YADA 3OW2Z 4NBHA 4MD8A 3CXCY 2WB1A 3GTLI 1YIT1 4Y7NI 1RO4A 2ZAEB 4NB8A 3NH4A 2J6AA 2DE5A 1VQ8Z 2E2II 5C3EI 3CCM1 2E9HA 2NVYI 2R93I 5D1PA 2B63I 1YIJZ 3GCFA 3NDIA 2QREB 4BY7I 4A3MI 2R92I 2JNYA 5IP7I 2DE7A 3CCJ1 2Q51A 1YJ91 1QVFZ 4RVFA 1Y1VS 1VQL1 4NBEA 3BG0B 3CCSZ 2VUGA 5CM2M 3S1MI 5T67A 1NJI2 3ESWA 3CCE1 3CD61 1VQ71 2H85A 2RHBA 1K9M2 1VQP1 1I50I 3CCU1 2PM9A 3G6EZ 3IX0A 2JR6A 3CC4Z 2GU2A 2RT9A 4RVDA 2IZ3A 5A2Qb 1NUIA 4DK1A 1X0TA 2P28A 3CPWZ 3G711 2JA8I 1VQ5Z 5D1OB 3CCV1 1VQK1 3M3YI 1S721 3I551 2OTJ1 3CQZI 5FLMI 2NVQI 3NFZA 4MXUA 5T6BA 4HGYA 3G4S1 1TFIA 3CC71 3VB9A 3CMEZ 3MZLB 2KPIA 2QRCB 3S2HI 1TWAI 2R6MA 4RS4A 2OOXB 1VQNZ 2RPRA 4NBGA 2K3RA 4A3KI 5C4XI 2WAQA 4QTUA 3KIFA 3I561 4BBSI 2PK7A 1K8A2 3CCR1 3RZDI 2QA41 2VF1A 4DQYB 1TWGI 4RV9A 4RVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 1;  3CMA Z;  3CCE Z;  1N8R 1;  1Q86 1;  3CD6 Z;  1VQ7 Z;  1M1K 1;  3I55 Z;  2OTJ Z;  1Q82 1;  3G6E 1;  3CME 1;  1VQ8 Z;  1VQM 1;  1KD1 2;  3G4S Z;  2QEX Z;  3CXC Z;  3CCM 1;  1VQN 1;  1Q81 1;  3CCL Z;  1VQ4 Z;  1K8A 1;  1VQ9 1;  1YIJ Z;  1W2B Y;  1VQ5 1;  1K73 2;  1YHQ Z;  3G71 Z;  3CCQ Z;  1KC8 2;  3CCV Z;  1VQK Z;  3CCJ 1;  1VQO 1;  1QVG Y;  3I56 Z;  1YJ9 1;  1QVF Z;  1S72 Z;  1VQL 1;  3CCS Z;  3CC2 Z;  1NJI 2;  2QA4 Z;  3CCE 1;  3CMA 1;  3CC7 Z;  2OTL Z;  1YJN 1;  1M90 2;  3CD6 1;  1VQ7 1;  1QVF Y;  1W2B Z;  1Q7Y 2;  1K9M 2;  3CPW Y;  1VQP 1;  2QEX 1;  1QVG Z;  3CCU 1;  3G6E Z;  1YJW Z;  3CC4 Z;  1YI2 1;  1N8R 2;  1Q86 2;  1M1K 2;  3CCL 1;  1VQ4 1;  1YIJ 1;  1Q82 2;  1KQS Z;  1VQ9 Z;  3CCR Z;  3CPW Z;  1KD1 1;  3G71 1;  3CCQ 1;  1VQ5 Z;  3CCV 1;  1VQK 1;  1Q81 2;  1YIT Z;  1S72 1;  3I55 1;  1KQS Y;  2OTJ 1;  1VQ6 Z;  3CCJ Z;  1VQO Z;  1K9M 1;  3CCS 1;  1VQ8 1;  3CC2 1;  3G4S 1;  3CC7 1;  2OTL 1;  3CME Z;  1VQM Z;  3OW2 Y;  1K73 1;  1JJ2 Z;  1YJN Z;  3CCM Z;  1KC8 1;  1VQN Z;  1YJW 1;  3CC4 1;  1VQP Z;  1JJ2 Y;  3CCU Z;  1NJI 1;  1YHQ 1;  1YI2 Z;  1M90 1;  3I56 1;  3OW2 Z;  1Q7Y 1;  1K8A 2;  3CCR 1;  1YJ9 Z;  3CXC Y;  2QA4 1;  1VQL Z;  1YIT 1; 
#chains in the Genus database with same CATH topology
 3J7A 4;  3S14 I;  3VTN A;  3J80 f;  2JA6 I;  4NB9 A;  3JAM f;  2QEX Z;  2AKL A;  2EGT A;  1NP6 A;  4BY1 I;  4Y52 I;  1WII A;  1ZH1 A;  3CCL Z;  1VQ9 1;  2E7Z A;  3HOU I;  2E2H I;  1W2B Y;  3PO3 I;  2V8K A;  5C44 I;  1P9N A;  1TWF I;  1YHQ Z;  3S1N I;  4TNU A;  4A3F I;  1VQO 1;  5IT9 b;  4E2Z A;  1QXF A;  1USP A;  3HOX I;  5FLX f;  3CC2 Z;  3VMH A;  4NH1 C;  2G2K A;  2OTL Z;  4E2Y A;  4MH4 A;  3TE5 B;  4E2W A;  2VUM I;  1QVG Z;  3D2L A;  1YJW Z;  2RBL A;  4NBC A;  1YI2 1;  4E2X A;  1DL6 A;  2JMO A;  2JIR A;  1RQF A;  1YIJ 1;  3J81 b;  3PO2 I;  3GTM S;  4NFR A;  3I4N I;  2QRD B;  2I3C A;  4NBB A;  4DGL A;  3M4O I;  3K7A I;  1KD1 1;  4A3D I;  3D6W A;  4MD7 A;  1KQS Y;  1VQ6 Z;  3HOZ I;  3CCJ Z;  1ZB9 A;  3CCS 1;  4MD9 A;  3HOY I;  1YUK A;  4HGZ A;  2PMZ A;  1VQM Z;  3OW2 Y;  2E2J I;  2IV2 X;  3S1Q I;  1RNI A;  1KC8 1;  3S17 I;  2OZK A;  2VPX A;  2GTH A;  3CC4 1;  1ZB8 A;  1VQP Z;  1JJ2 Y;  2V8J A;  3CCU Z;  1Y1V I;  3F3P C;  1M90 1;  1L1O C;  4X6A I;  5D1O A;  4E32 A;  3CMA Z;  3EED A;  4E33 A;  1M1K 1;  3I55 Z;  2OTJ Z;  4XX2 A;  5A2Q f;  1X3Z A;  3CME 1;  4E31 A;  1KD1 2;  3G4S Z;  1Q16 A;  3CXC Z;  4NBA A;  2AYD A;  1WCM I;  2NAP A;  1I6H I;  3IR7 A;  1VQN 1;  1S7M A;  1X3W A;  1VQ4 Z;  3GTG I;  1Z03 A;  1I3Q I;  3S16 I;  1LQL A;  2VPW A;  2QKD A;  3CCQ Z;  1KC8 2;  3I56 Z;  1RO0 A;  1ML8 A;  3P5J B;  2IZ4 A;  3FQM A;  2HU9 A;  2VPY A;  2QA4 Z;  4BXX I;  1YJN 1;  1M90 2;  2KI7 B;  1RO2 A;  3F3F C;  4MRI A;  3CPW Y;  3KIH A;  2QEX 1;  2M6N A;  2JS4 A;  4NBF A;  1K83 I;  4CL1 A;  1Y1W I;  3CCL 1;  1M1K 2;  4RVH A;  2P3Y A;  2JIQ A;  1KQS Z;  4A93 I;  5T64 A;  1VQ9 Z;  4BBR I;  2DE6 A;  3MZK B;  3BG1 B;  1YUA A;  1YIT Z;  2W03 A;  2O53 A;  3HOW I;  1K9M 1;  1VQO Z;  3GTQ I;  2R7Z I;  1VQ8 1;  1N2F A;  3CC2 1;  2OOY B;  3VMG A;  1SFO I;  2OTL 1;  3TDH B;  2V3V A;  2VPZ A;  1K73 1;  2V45 A;  1JJ2 Z;  3I4M I;  2LFU A;  1USP B;  3CCM Z;  4A3I I;  4A3C I;  2QLV B;  1JWH C;  3GTP I;  1YJW 1;  4A3B I;  1SIW A;  3T4N B;  4E30 A;  5IT9 f;  3GTO I;  2LIY A;  1YI2 Z;  1WW9 A;  3HKZ A;  1Q7Y 1;  4NBD A;  2JA7 I;  1FDI A;  1YJ9 Z;  4S1T A;  2JUB A;  1VQL Z;  2F4O A;  1TWH I;  2W04 A;  5C4J I;  1WZN A;  2JA5 I;  1VQ6 1;  3CCE Z;  1N8R 1;  1Q86 1;  3CD6 Z;  1VQ7 Z;  3S2D I;  3FQQ A;  3IF8 A;  1Z01 A;  1Q82 1;  3EER A;  3G6E 1;  3J81 f;  3GTM I;  2V8I A;  1VQM 1;  2YU9 I;  3D9X A;  1Q81 1;  1K8A 1;  3QWU A;  1VQ5 1;  3Q87 A;  1K73 2;  2NVT I;  3G71 Z;  3CCV Z;  1VQK Z;  1QVG Y;  1S72 Z;  5IP9 I;  3GTJ I;  1VLA A;  4A3G I;  1TWC I;  3VMI A;  3CMA 1;  3CC7 Z;  1QVF Y;  1W2B Z;  1Q7Y 2;  2JIM A;  3NDJ A;  1QF8 A;  5LL6 f;  3U50 C;  3GKQ A;  3S15 I;  3IFU A;  4MON A;  4A3E I;  1QYP A;  3J80 b;  1N8R 2;  1Q86 2;  3H0G I;  1VQ4 1;  3JAM b;  2O4H A;  1Q82 2;  3NH5 A;  3CCR Z;  3HOV I;  2BJO A;  3LUS A;  4QTT A;  3CCQ 1;  3NH8 A;  3S1R I;  1Q81 2;  3H3V J;  2QR1 B;  2HF1 A;  2GTI A;  3PO3 S;  2NVX I;  1R9T I;  3MON A;  2Q4Z A;  1RLY A;  4EWC A;  1WJ2 A;  4A3L I;  3I07 A;  2K5R A;  1YJN Z;  5AN9 F;  5FLX b;  4A3J I;  3GTK I;  1KRL A;  1PFT A;  4HH4 A;  3FKI I;  1FDO A;  2Y0S A;  4AYB A;  1NJI 1;  1YHQ 1;  2M48 A;  1Z02 A;  2RIQ A;  4NOZ A;  2F4M A;  3RZO I;  2YAD A;  3OW2 Z;  4NBH A;  4MD8 A;  3CXC Y;  2WB1 A;  3GTL I;  1YIT 1;  4Y7N I;  1RO4 A;  2ZAE B;  4NB8 A;  3NH4 A;  2J6A A;  2DE5 A;  1VQ8 Z;  2E2I I;  5C3E I;  3CCM 1;  2E9H A;  2LEX A;  2NVY I;  2R93 I;  2JIP A;  5D1P A;  2B63 I;  1YIJ Z;  3GCF A;  3NDI A;  2QRE B;  4BY7 I;  4A3M I;  2R92 I;  2JNY A;  5IP7 I;  2DE7 A;  3CCJ 1;  2Q51 A;  1YJ9 1;  1QVF Z;  4RVF A;  1Y1V S;  1VQL 1;  4NBE A;  2JIO A;  3BG0 B;  3CCS Z;  2VUG A;  5CM2 M;  3S1M I;  5T67 A;  1NJI 2;  3ESW A;  3CCE 1;  3CD6 1;  1VQ7 1;  2H85 A;  2RHB A;  1K9M 2;  1VQP 1;  1I50 I;  3CCU 1;  2PM9 A;  3G6E Z;  3IX0 A;  2JR6 A;  3CC4 Z;  2GU2 A;  2RT9 A;  4RVD A;  2IZ3 A;  5A2Q b;  1NUI A;  4DK1 A;  1X0T A;  2P28 A;  3CPW Z;  3G71 1;  2JA8 I;  1VQ5 Z;  5D1O B;  3CCV 1;  1VQK 1;  3M3Y I;  1S72 1;  3I55 1;  2OTJ 1;  3CQZ I;  5FLM I;  2NVQ I;  3NFZ A;  4MXU A;  5T6B A;  4HGY A;  3G4S 1;  1TFI A;  3CC7 1;  3VB9 A;  3CME Z;  3MZL B;  2KPI A;  2QRC B;  3S2H I;  1TWA I;  2R6M A;  4RS4 A;  2OOX B;  1Y8C A;  1VQN Z;  2RPR A;  4NBG A;  2K3R A;  4A3K I;  5C4X I;  2WAQ A;  4QTU A;  3KIF A;  3I56 1;  4BBS I;  2PK7 A;  1AA6 A;  1K8A 2;  3CCR 1;  3RZD I;  2QA4 1;  2VF1 A;  4DQY B;  1TWG I;  4RV9 A;  4RVG A; 
#chains in the Genus database with same CATH homology
 3J7A 4;  3S14 I;  3VTN A;  3J80 f;  2JA6 I;  4NB9 A;  3JAM f;  2QEX Z;  2AKL A;  2EGT A;  1NP6 A;  4BY1 I;  4Y52 I;  1WII A;  1ZH1 A;  3CCL Z;  1VQ9 1;  3HOU I;  2E2H I;  1W2B Y;  3PO3 I;  2V8K A;  5C44 I;  1P9N A;  1TWF I;  1YHQ Z;  3S1N I;  4TNU A;  4A3F I;  1VQO 1;  5IT9 b;  4E2Z A;  1USP A;  3HOX I;  5FLX f;  3CC2 Z;  3VMH A;  4NH1 C;  2G2K A;  2OTL Z;  4E2Y A;  4MH4 A;  3TE5 B;  4E2W A;  2VUM I;  1QVG Z;  1YJW Z;  2RBL A;  4NBC A;  1YI2 1;  4E2X A;  1DL6 A;  2JMO A;  1RQF A;  1YIJ 1;  3J81 b;  3PO2 I;  3GTM S;  4NFR A;  3I4N I;  2QRD B;  2I3C A;  4NBB A;  4DGL A;  3M4O I;  3K7A I;  1KD1 1;  4A3D I;  3D6W A;  4MD7 A;  1KQS Y;  1VQ6 Z;  3HOZ I;  3CCJ Z;  1ZB9 A;  3CCS 1;  4MD9 A;  3HOY I;  1YUK A;  4HGZ A;  2PMZ A;  1VQM Z;  3OW2 Y;  2E2J I;  3S1Q I;  1RNI A;  1KC8 1;  3S17 I;  2OZK A;  2GTH A;  3CC4 1;  1ZB8 A;  1VQP Z;  1JJ2 Y;  2V8J A;  3CCU Z;  1Y1V I;  3F3P C;  1M90 1;  1L1O C;  4X6A I;  5D1O A;  4E32 A;  3CMA Z;  3EED A;  4E33 A;  1M1K 1;  3I55 Z;  2OTJ Z;  4XX2 A;  5A2Q f;  1X3Z A;  3CME 1;  4E31 A;  1KD1 2;  3G4S Z;  3CXC Z;  4NBA A;  1WCM I;  1I6H I;  1VQN 1;  1S7M A;  1X3W A;  1VQ4 Z;  3GTG I;  1Z03 A;  1I3Q I;  3S16 I;  1LQL A;  2QKD A;  3CCQ Z;  1KC8 2;  3I56 Z;  1RO0 A;  1ML8 A;  3P5J B;  2IZ4 A;  3FQM A;  2HU9 A;  2QA4 Z;  4BXX I;  1YJN 1;  1M90 2;  2KI7 B;  1RO2 A;  3F3F C;  4MRI A;  3CPW Y;  3KIH A;  2QEX 1;  2M6N A;  2JS4 A;  4NBF A;  1K83 I;  4CL1 A;  1Y1W I;  3CCL 1;  1M1K 2;  4RVH A;  2P3Y A;  1KQS Z;  4A93 I;  5T64 A;  1VQ9 Z;  4BBR I;  2DE6 A;  3MZK B;  3BG1 B;  1YUA A;  1YIT Z;  2W03 A;  2O53 A;  3HOW I;  1K9M 1;  1VQO Z;  3GTQ I;  2R7Z I;  1VQ8 1;  1N2F A;  3CC2 1;  2OOY B;  3VMG A;  1SFO I;  2OTL 1;  3TDH B;  1K73 1;  1JJ2 Z;  3I4M I;  2LFU A;  1USP B;  3CCM Z;  4A3I I;  4A3C I;  2QLV B;  1JWH C;  3GTP I;  1YJW 1;  4A3B I;  3T4N B;  4E30 A;  5IT9 f;  3GTO I;  2LIY A;  1YI2 Z;  1WW9 A;  3HKZ A;  1Q7Y 1;  4NBD A;  2JA7 I;  1YJ9 Z;  4S1T A;  2JUB A;  1VQL Z;  2F4O A;  1TWH I;  2W04 A;  5C4J I;  2JA5 I;  1VQ6 1;  3CCE Z;  1N8R 1;  1Q86 1;  3CD6 Z;  1VQ7 Z;  3S2D I;  3FQQ A;  3IF8 A;  1Z01 A;  1Q82 1;  3EER A;  3G6E 1;  3J81 f;  3GTM I;  2V8I A;  1VQM 1;  2YU9 I;  3D9X A;  1Q81 1;  1K8A 1;  3QWU A;  1VQ5 1;  3Q87 A;  1K73 2;  2NVT I;  3G71 Z;  3CCV Z;  1VQK Z;  1QVG Y;  1S72 Z;  5IP9 I;  3GTJ I;  1VLA A;  4A3G I;  1TWC I;  3VMI A;  3CMA 1;  3CC7 Z;  1QVF Y;  1W2B Z;  1Q7Y 2;  3NDJ A;  1QF8 A;  5LL6 f;  3U50 C;  3GKQ A;  3S15 I;  3IFU A;  4MON A;  4A3E I;  1QYP A;  3J80 b;  1N8R 2;  1Q86 2;  3H0G I;  1VQ4 1;  3JAM b;  2O4H A;  1Q82 2;  3NH5 A;  3CCR Z;  3HOV I;  2BJO A;  3LUS A;  4QTT A;  3CCQ 1;  3NH8 A;  3S1R I;  1Q81 2;  3H3V J;  2QR1 B;  2HF1 A;  2GTI A;  3PO3 S;  2NVX I;  1R9T I;  3MON A;  2Q4Z A;  1RLY A;  4EWC A;  4A3L I;  3I07 A;  2K5R A;  1YJN Z;  5AN9 F;  5FLX b;  4A3J I;  3GTK I;  1KRL A;  1PFT A;  4HH4 A;  3FKI I;  2Y0S A;  4AYB A;  1NJI 1;  1YHQ 1;  2M48 A;  1Z02 A;  2RIQ A;  4NOZ A;  2F4M A;  3RZO I;  2YAD A;  3OW2 Z;  4NBH A;  4MD8 A;  3CXC Y;  2WB1 A;  3GTL I;  1YIT 1;  4Y7N I;  1RO4 A;  2ZAE B;  4NB8 A;  3NH4 A;  2J6A A;  2DE5 A;  1VQ8 Z;  2E2I I;  5C3E I;  3CCM 1;  2E9H A;  2NVY I;  2R93 I;  5D1P A;  2B63 I;  1YIJ Z;  3GCF A;  3NDI A;  2QRE B;  4BY7 I;  4A3M I;  2R92 I;  2JNY A;  5IP7 I;  2DE7 A;  3CCJ 1;  2Q51 A;  1YJ9 1;  1QVF Z;  4RVF A;  1Y1V S;  1VQL 1;  4NBE A;  3BG0 B;  3CCS Z;  2VUG A;  5CM2 M;  3S1M I;  5T67 A;  1NJI 2;  3ESW A;  3CCE 1;  3CD6 1;  1VQ7 1;  2H85 A;  2RHB A;  1K9M 2;  1VQP 1;  1I50 I;  3CCU 1;  2PM9 A;  3G6E Z;  3IX0 A;  2JR6 A;  3CC4 Z;  2GU2 A;  2RT9 A;  4RVD A;  2IZ3 A;  5A2Q b;  1NUI A;  4DK1 A;  1X0T A;  2P28 A;  3CPW Z;  3G71 1;  2JA8 I;  1VQ5 Z;  5D1O B;  3CCV 1;  1VQK 1;  3M3Y I;  1S72 1;  3I55 1;  2OTJ 1;  3CQZ I;  5FLM I;  2NVQ I;  3NFZ A;  4MXU A;  5T6B A;  4HGY A;  3G4S 1;  1TFI A;  3CC7 1;  3VB9 A;  3CME Z;  3MZL B;  2KPI A;  2QRC B;  3S2H I;  1TWA I;  2R6M A;  4RS4 A;  2OOX B;  1VQN Z;  2RPR A;  4NBG A;  2K3R A;  4A3K I;  5C4X I;  2WAQ A;  4QTU A;  3KIF A;  3I56 1;  4BBS I;  2PK7 A;  1K8A 2;  3CCR 1;  3RZD I;  2QA4 1;  2VF1 A;  4DQY B;  1TWG I;  4RV9 A;  4RVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...