3CCR1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccr100
2QEXZ 1YI21 1YJW1 3CC21 3CCJ1 1YJN1 3CCLZ 3CMAZ 1S72Z 2QEX1 3CCVZ 3CD6Z 3CCL1 1VQ51 3CC71 3CMA1 1S721 3CCV1 3CD61 1Q862 1KQSZ 3CPWZ 1QVGY 3CCR1 1K8A2 1QVGZ 1M901 1KD12 1YIJZ 1VQ9Z 3CXCZ 3CCQ1 1Q7Y1 1YIJ1 1VQ91 1VQ4Z 3OW2Y 1VQPZ 1KC81 3CC4Z 1VQ41 1K732 3G4SZ 3CC41 3G4S1 1VQ7Z 3CMEZ 1M1K2 1VQ71 1Q861 1N8R2 3CME1 1K8A1 1Q812 2QA4Z 1W2BY 3I56Z 1VQNZ 3G71Z 1JJ2Y 1YJ9Z 1KD11 2QA41 3I561 3CCSZ 3G711 1JJ2Z 1VQN1 1YJ91 3OW2Z 1Q822 3CCS1 1VQP1 1K9M2 1VQLZ 1NJI2 3CCUZ 1K731 1VQL1 3CC2Z 3CCEZ 1YITZ 2OTLZ 1M1K1 1QVFY 1YHQZ 3CCE1 1YIT1 1N8R1 1VQ5Z 2OTL1 3CC7Z 1VQKZ 1QVFZ 1W2BZ 1YHQ1 1Q811 3G6EZ 1VQOZ 1VQ6Z 1KQSY 1VQK1 2OTJZ 3CPWY 1VQ8Z 3CCRZ 3CCMZ 3G6E1 1VQO1 1VQMZ 1M902 1VQ61 2OTJ1 1VQ81 3I55Z 3CCM1 1VQM1 1Q821 1Q7Y2 3CCQZ 3CXCY 3I551 1K9M1 3CCU1 1YI2Z 1NJI1 1YJWZ 3CCJZ 1YJNZ 1KC82
chains in the Genus database with same CATH superfamily
3H3VJ 1YJW1 3CC21 2JA8I 2QEX1 3S15I 1DL6A 5IT9b 1S721 4MD7A 1I6HI 3CPWZ 3HOXI 5D1OB 1QVGY 2DE6A 1K8A2 4XX2A 1QVGZ 2DE7A 3HOYI 4BBSI 3S1MI 4A3II 4NFRA 2VPXA 4RS4A 2HF1A 1VQ91 5FLXf 3CC4Z 4RV9A 1USPB 1N2FA 1K732 3NH8A 4MD9A 3D2LA 2R6MA 3G4S1 2ZAEB 2GU2A 1VQ71 3BG0B 2P28A 2E2II 1K8A1 2YU9I 1W2BY 2YADA 1P9NA 3VTNA 1Y8CA 1JJ2Y 1YJ9Z 2QA41 3I561 1JJ2Z 2B63I 3OW2Z 3GTMS 4BY1I 1I50I 1VQLZ 2VUGA 3ESWA 1NJI2 1WZNA 1K731 4E2WA 1PFTA 2OZKA 2OOXB 2QKDA 2BJOA 3NDJA 3CCE1 3KIFA 2IZ4A 2OTL1 2IV2X 1Z03A 4RVDA 3FQMA 4E30A 1VQK1 3D6WA 2OTJZ 2JS4A 3G6E1 1VQO1 1VQMZ 1VQ61 3Q87A 3M4OI 3GTOI 3LUSA 1VQ81 3CQZI 2VUMI 4A3LI 2R92I 3QWUA 4QTUA 3CXCY 3I551 3CCU1 1NJI1 3MZKB 3MONA 3TE5B 3CCJZ 1YJNZ 4A3EI 1YI21 4BXXI 1RO2A 1ZB8A 4E2ZA 1ZH1A 2JNYA 3CMAZ 1AA6A 4EWCA 1Z01A 2O4HA 4Y7NI 3CC71 4NBDA 3VMGA 2QREB 1WJ2A 4HGYA 5IT9f 3CCR1 2PK7A 4RVHA 3I4NI 2R7ZI 4NBFA 2RBLA 3CCQ1 4A3BI 4NB9A 2LIYA 2V8IA 2GTHA 1LQLA 2NVXI 3CC41 2R93I 2I3CA 2V3VA 1TWAI 2RHBA 3CMEZ 1RO0A 3BG1B 5D1OA 2QRCB 2NVQI 1L1OC 2AKLA 3NDIA 4DQYB 1S7MA 3S2HI 2V8JA 2E9HA 1VQNZ 3GCFA 2E2JI 4MD8A 2LFUA 2JMOA 2JIRA 2QR1B 1YJ91 2WB1A 1WCMI 1FDOA 1USPA 1X3ZA 3F3PC 1RLYA 1VQP1 1X0TA 3IR7A 3S1NI 3NH5A 4QTTA 3S17I 3FQQA 3U50C 2AYDA 1VQL1 1WW9A 2Q51A 3CC2Z 1I3QI 3J7A4 1RO4A 2VPWA 5LL6f 2PM9A 1YHQZ 5IP9I 3S1QI 1W2BZ 3H0GI 1WIIA 1KQSY 2LEXA 4E2XA 5CM2M 2OTJ1 4E2YA 1RQFA 1QXFA 3JAMb 1VQM1 1X3WA 3TDHB 4NBBA 1Q7Y2 2M48A 4BBRI 2W03A 1R9TI 3CCJ1 1YJN1 3S1RI 3CCLZ 3GTKI 3CCVZ 3CD6Z 1KRLA 5D1PA 1VQ51 3CMA1 1K83I 2WAQA 3S16I 3S2DI 1YUAA 3D9XA 2QLVB 1TFIA 3NFZA 3J81b 1YIJZ 4NH1C 1ML8A 1TWGI 3HKZA 3CXCZ 4RVGA 1Q7Y1 1VQ4Z 2P3YA 1NP6A 3RZDI 1FDIA 3EEDA 2KPIA 4MONA 2M6NA 3GKQA 4Y52I 2KI7B 4TNUA 3EERA 3F3FC 1M1K2 2G2KA 4A3DI 1N8R2 3RZOI 3CME1 4A3CI 4MXUA 1Q812 4E33A 3G71Z 4S1TA 5FLMI 2H85A 2O53A 5C44I 3CCSZ 1VQN1 3KIHA 5C3EI 2EGTA 3PO3S 2RPRA 1YUKA 1K9M2 2F4MA 4A3KI 3CCUZ 2JA7I 4AYBA 4BY7I 4NBCA 4X6AI 4HH4A 3PO2I 4NOZA 1YITZ 2Q4ZA 3T4NB 1M1K1 2Y0SA 2RIQA 1N8R1 3P5JB 3GTPI 3CC7Z 3J80b 1YHQ1 1Q811 1RNIA 3CPWY 2VF1A 4HGZA 4NBGA 3CCRZ 3CCMZ 1M902 4A3MI 3HOWI 4A3JI 2NVTI 5A2Qb 2HU9A 3CCQZ 1K9M1 3I07A 1Q16A 5C4XI 3JAMf 1YJWZ 3VMIA 4NBAA 1KC82 2QRDB 5AN9F 3PO3I 2QEXZ 3VB9A 1S72Z 3VMHA 3CCL1 2PMZA 1Y1VS 4E32A 3CCV1 3GTGI 3CD61 1Q862 2W04A 1KQSZ 5C4JI 4MH4A 2VPZA 5T67A 3K7AI 4NBHA 4NBEA 1M901 3GTJI 1KD12 3I4MI 1VQ9Z 4NB8A 1Z02A 2DE5A 2E7ZA 5FLXb 3J81f 2J6AA 1YIJ1 3HOUI 2NVYI 2RT9A 1ZB9A 4CL1A 2VPYA 3OW2Y 1VQPZ 1KC81 1VQ41 1SIWA 4E31A 2OOYB 2NAPA 3G4SZ 2GTIA 1VQ7Z 2V8KA 5T64A 3FKII 3S14I 5T6BA 3NH4A 4RVFA 1Q861 1VLAA 3IF8A 2JA5I 2IZ3A 2QA4Z 3GTQI 2JIMA 3I56Z 1Y1VI 4A3FI 1QF8A 1KD11 4A3GI 3HOZI 3G711 1Y1WI 3IFUA 4DGLA 3CCS1 1Q822 1TWHI 1SFOI 2F4OA 1TWCI 2JA6I 2JIOA 1JWHC 1QYPA 1NUIA 3CCEZ 2OTLZ 1QVFY 3GTMI 1YIT1 1VQ5Z 2JR6A 3IX0A 1VQKZ 1QVFZ 4MRIA 2JIQA 3G6EZ 1VQOZ 1VQ6Z 2K5RA 3M3YI 2JUBA 3GTLI 3J80f 1VQ8Z 4DK1A 2JIPA 2V45A 3I55Z 3CCM1 3MZLB 1Q821 3HOVI 4A93I 2K3RA 5A2Qf 1YI2Z 5IP7I 1TWFI 2E2HI
chains in the Genus database with same CATH topology
3H3VJ 1YJW1 3CC21 2JA8I 2QEX1 3S15I 1DL6A 5IT9b 1S721 4MD7A 1I6HI 3CPWZ 3HOXI 5D1OB 1QVGY 2DE6A 1K8A2 4XX2A 1QVGZ 2DE7A 3HOYI 4BBSI 3S1MI 4A3II 4NFRA 4RS4A 2HF1A 1VQ91 5FLXf 3CC4Z 4RV9A 1USPB 1N2FA 1K732 3NH8A 4MD9A 2R6MA 3G4S1 2ZAEB 2GU2A 1VQ71 3BG0B 2P28A 2E2II 1K8A1 2YU9I 1W2BY 2YADA 1P9NA 3VTNA 1JJ2Y 1YJ9Z 2QA41 3I561 1JJ2Z 2B63I 3OW2Z 3GTMS 4BY1I 1I50I 1VQLZ 2VUGA 3ESWA 1NJI2 1K731 4E2WA 1PFTA 2OZKA 2OOXB 2QKDA 2BJOA 3NDJA 3CCE1 3KIFA 2IZ4A 2OTL1 1Z03A 4RVDA 3FQMA 4E30A 1VQK1 3D6WA 2OTJZ 2JS4A 3G6E1 1VQO1 1VQMZ 1VQ61 3Q87A 3M4OI 3GTOI 3LUSA 1VQ81 3CQZI 2VUMI 4A3LI 2R92I 3QWUA 4QTUA 3CXCY 3I551 3CCU1 1NJI1 3MZKB 3MONA 3TE5B 3CCJZ 1YJNZ 4A3EI 1YI21 4BXXI 1RO2A 1ZB8A 4E2ZA 1ZH1A 2JNYA 3CMAZ 4EWCA 1Z01A 2O4HA 4Y7NI 3CC71 4NBDA 3VMGA 2QREB 5IT9f 4HGYA 3CCR1 2PK7A 4RVHA 3I4NI 2R7ZI 4NBFA 2RBLA 3CCQ1 4A3BI 4NB9A 2LIYA 2V8IA 2GTHA 1LQLA 2NVXI 3CC41 2R93I 2I3CA 1TWAI 2RHBA 3CMEZ 1RO0A 3BG1B 5D1OA 2QRCB 2NVQI 1L1OC 2AKLA 3NDIA 4DQYB 1S7MA 3S2HI 2V8JA 2E9HA 1VQNZ 3GCFA 2E2JI 4MD8A 2LFUA 2JMOA 2QR1B 1YJ91 2WB1A 1WCMI 1USPA 1X3ZA 3F3PC 1RLYA 1VQP1 1X0TA 3S1NI 3NH5A 4QTTA 3S17I 3FQQA 3U50C 1VQL1 1WW9A 2Q51A 3CC2Z 1I3QI 3J7A4 1RO4A 5LL6f 2PM9A 1YHQZ 5IP9I 3S1QI 1W2BZ 3H0GI 1WIIA 1KQSY 4E2XA 5CM2M 2OTJ1 4E2YA 1RQFA 3JAMb 1VQM1 1X3WA 3TDHB 4NBBA 1Q7Y2 2M48A 4BBRI 2W03A 1R9TI 3CCJ1 1YJN1 3S1RI 3CCLZ 3GTKI 3CCVZ 3CD6Z 1KRLA 5D1PA 1VQ51 3CMA1 1K83I 2WAQA 3S16I 3S2DI 1YUAA 3D9XA 2QLVB 1TFIA 3NFZA 3J81b 1YIJZ 4NH1C 1ML8A 1TWGI 3HKZA 3CXCZ 4RVGA 1Q7Y1 1VQ4Z 2P3YA 1NP6A 3RZDI 3EEDA 2KPIA 4MONA 2M6NA 3GKQA 4Y52I 2KI7B 4TNUA 3EERA 3F3FC 1M1K2 2G2KA 4A3DI 1N8R2 3RZOI 3CME1 4A3CI 4MXUA 1Q812 4E33A 3G71Z 4S1TA 5FLMI 2H85A 2O53A 5C44I 3CCSZ 1VQN1 3KIHA 5C3EI 2EGTA 3PO3S 2RPRA 1YUKA 1K9M2 2F4MA 4A3KI 3CCUZ 2JA7I 4AYBA 4BY7I 4NBCA 4X6AI 4HH4A 3PO2I 4NOZA 1YITZ 2Q4ZA 3T4NB 1M1K1 2Y0SA 2RIQA 1N8R1 3P5JB 3GTPI 3CC7Z 3J80b 1YHQ1 1Q811 1RNIA 3CPWY 2VF1A 4HGZA 4NBGA 3CCRZ 3CCMZ 1M902 4A3MI 3HOWI 4A3JI 2NVTI 5A2Qb 2HU9A 3CCQZ 1K9M1 3I07A 5C4XI 3JAMf 1YJWZ 3VMIA 4NBAA 1KC82 2QRDB 5AN9F 3PO3I 2QEXZ 3VB9A 1S72Z 3VMHA 3CCL1 2PMZA 1Y1VS 4E32A 3CCV1 3GTGI 3CD61 1Q862 2W04A 1KQSZ 5C4JI 4MH4A 5T67A 3K7AI 4NBHA 4NBEA 1M901 3GTJI 1KD12 3I4MI 1VQ9Z 4NB8A 1Z02A 2DE5A 5FLXb 3J81f 2J6AA 1YIJ1 3HOUI 2NVYI 2RT9A 1ZB9A 4CL1A 3OW2Y 1VQPZ 1KC81 1VQ41 4E31A 2OOYB 3G4SZ 2GTIA 1VQ7Z 2V8KA 5T64A 3FKII 3S14I 5T6BA 3NH4A 4RVFA 1Q861 1VLAA 3IF8A 2JA5I 2IZ3A 2QA4Z 3GTQI 3I56Z 1Y1VI 4A3FI 1QF8A 1KD11 4A3GI 3HOZI 3G711 1Y1WI 3IFUA 4DGLA 3CCS1 1Q822 1TWHI 1SFOI 2F4OA 1TWCI 2JA6I 1JWHC 1QYPA 1NUIA 3CCEZ 2OTLZ 1QVFY 3GTMI 1YIT1 1VQ5Z 2JR6A 3IX0A 1VQKZ 1QVFZ 4MRIA 3G6EZ 1VQOZ 1VQ6Z 2K5RA 3M3YI 2JUBA 3GTLI 3J80f 1VQ8Z 4DK1A 3I55Z 3CCM1 3MZLB 1Q821 3HOVI 4A93I 2K3RA 5A2Qf 1YI2Z 5IP7I 1TWFI 2E2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  1YI2 1;  1YJW 1;  3CC2 1;  3CCJ 1;  1YJN 1;  3CCL Z;  3CMA Z;  1S72 Z;  2QEX 1;  3CCV Z;  3CD6 Z;  3CCL 1;  1VQ5 1;  3CC7 1;  3CMA 1;  1S72 1;  3CCV 1;  3CD6 1;  1Q86 2;  1KQS Z;  3CPW Z;  1QVG Y;  3CCR 1;  1K8A 2;  1QVG Z;  1M90 1;  1KD1 2;  1YIJ Z;  1VQ9 Z;  3CXC Z;  3CCQ 1;  1Q7Y 1;  1YIJ 1;  1VQ9 1;  1VQ4 Z;  3OW2 Y;  1VQP Z;  1KC8 1;  3CC4 Z;  1VQ4 1;  1K73 2;  3G4S Z;  3CC4 1;  3G4S 1;  1VQ7 Z;  3CME Z;  1M1K 2;  1VQ7 1;  1Q86 1;  1N8R 2;  3CME 1;  1K8A 1;  1Q81 2;  2QA4 Z;  1W2B Y;  3I56 Z;  1VQN Z;  3G71 Z;  1JJ2 Y;  1YJ9 Z;  1KD1 1;  2QA4 1;  3I56 1;  3CCS Z;  3G71 1;  1JJ2 Z;  1VQN 1;  1YJ9 1;  3OW2 Z;  1Q82 2;  3CCS 1;  1VQP 1;  1K9M 2;  1VQL Z;  1NJI 2;  3CCU Z;  1K73 1;  1VQL 1;  3CC2 Z;  3CCE Z;  1YIT Z;  2OTL Z;  1M1K 1;  1QVF Y;  1YHQ Z;  3CCE 1;  1YIT 1;  1N8R 1;  1VQ5 Z;  2OTL 1;  3CC7 Z;  1VQK Z;  1QVF Z;  1W2B Z;  1YHQ 1;  1Q81 1;  3G6E Z;  1VQO Z;  1VQ6 Z;  1KQS Y;  1VQK 1;  2OTJ Z;  3CPW Y;  1VQ8 Z;  3CCR Z;  3CCM Z;  3G6E 1;  1VQO 1;  1VQM Z;  1M90 2;  1VQ6 1;  2OTJ 1;  1VQ8 1;  3I55 Z;  3CCM 1;  1VQM 1;  1Q82 1;  1Q7Y 2;  3CCQ Z;  3CXC Y;  3I55 1;  1K9M 1;  3CCU 1;  1YI2 Z;  1NJI 1;  1YJW Z;  3CCJ Z;  1YJN Z;  1KC8 2; 
#chains in the Genus database with same CATH topology
 3H3V J;  1YJW 1;  3CC2 1;  2JA8 I;  2QEX 1;  3S15 I;  1DL6 A;  5IT9 b;  1S72 1;  4MD7 A;  1I6H I;  3CPW Z;  3HOX I;  5D1O B;  1QVG Y;  2DE6 A;  1K8A 2;  4XX2 A;  1QVG Z;  2DE7 A;  3HOY I;  4BBS I;  3S1M I;  4A3I I;  4NFR A;  2VPX A;  4RS4 A;  2HF1 A;  1VQ9 1;  5FLX f;  3CC4 Z;  4RV9 A;  1USP B;  1N2F A;  1K73 2;  3NH8 A;  4MD9 A;  3D2L A;  2R6M A;  3G4S 1;  2ZAE B;  2GU2 A;  1VQ7 1;  3BG0 B;  2P28 A;  2E2I I;  1K8A 1;  2YU9 I;  1W2B Y;  2YAD A;  1P9N A;  3VTN A;  1Y8C A;  1JJ2 Y;  1YJ9 Z;  2QA4 1;  3I56 1;  1JJ2 Z;  2B63 I;  3OW2 Z;  3GTM S;  4BY1 I;  1I50 I;  1VQL Z;  2VUG A;  3ESW A;  1NJI 2;  1WZN A;  1K73 1;  4E2W A;  1PFT A;  2OZK A;  2OOX B;  2QKD A;  2BJO A;  3NDJ A;  3CCE 1;  3KIF A;  2IZ4 A;  2OTL 1;  2IV2 X;  1Z03 A;  4RVD A;  3FQM A;  4E30 A;  1VQK 1;  3D6W A;  2OTJ Z;  2JS4 A;  3G6E 1;  1VQO 1;  1VQM Z;  1VQ6 1;  3Q87 A;  3M4O I;  3GTO I;  3LUS A;  1VQ8 1;  3CQZ I;  2VUM I;  4A3L I;  2R92 I;  3QWU A;  4QTU A;  3CXC Y;  3I55 1;  3CCU 1;  1NJI 1;  3MZK B;  3MON A;  3TE5 B;  3CCJ Z;  1YJN Z;  4A3E I;  1YI2 1;  4BXX I;  1RO2 A;  1ZB8 A;  4E2Z A;  1ZH1 A;  2JNY A;  3CMA Z;  1AA6 A;  4EWC A;  1Z01 A;  2O4H A;  4Y7N I;  3CC7 1;  4NBD A;  3VMG A;  2QRE B;  1WJ2 A;  4HGY A;  5IT9 f;  3CCR 1;  2PK7 A;  4RVH A;  3I4N I;  2R7Z I;  4NBF A;  2RBL A;  3CCQ 1;  4A3B I;  4NB9 A;  2LIY A;  2V8I A;  2GTH A;  1LQL A;  2NVX I;  3CC4 1;  2R93 I;  2I3C A;  2V3V A;  1TWA I;  2RHB A;  3CME Z;  1RO0 A;  3BG1 B;  5D1O A;  2QRC B;  2NVQ I;  1L1O C;  2AKL A;  3NDI A;  4DQY B;  1S7M A;  3S2H I;  2V8J A;  2E9H A;  1VQN Z;  3GCF A;  2E2J I;  4MD8 A;  2LFU A;  2JMO A;  2JIR A;  2QR1 B;  1YJ9 1;  2WB1 A;  1WCM I;  1FDO A;  1USP A;  1X3Z A;  3F3P C;  1RLY A;  1VQP 1;  1X0T A;  3IR7 A;  3S1N I;  3NH5 A;  4QTT A;  3S17 I;  3FQQ A;  3U50 C;  2AYD A;  1VQL 1;  1WW9 A;  2Q51 A;  3CC2 Z;  1I3Q I;  3J7A 4;  1RO4 A;  2VPW A;  5LL6 f;  2PM9 A;  1YHQ Z;  5IP9 I;  3S1Q I;  1W2B Z;  3H0G I;  1WII A;  1KQS Y;  2LEX A;  4E2X A;  5CM2 M;  2OTJ 1;  4E2Y A;  1RQF A;  1QXF A;  3JAM b;  1VQM 1;  1X3W A;  3TDH B;  4NBB A;  1Q7Y 2;  2M48 A;  4BBR I;  2W03 A;  1R9T I;  3CCJ 1;  1YJN 1;  3S1R I;  3CCL Z;  3GTK I;  3CCV Z;  3CD6 Z;  1KRL A;  5D1P A;  1VQ5 1;  3CMA 1;  1K83 I;  2WAQ A;  3S16 I;  3S2D I;  1YUA A;  3D9X A;  2QLV B;  1TFI A;  3NFZ A;  3J81 b;  1YIJ Z;  4NH1 C;  1ML8 A;  1TWG I;  3HKZ A;  3CXC Z;  4RVG A;  1Q7Y 1;  1VQ4 Z;  2P3Y A;  1NP6 A;  3RZD I;  1FDI A;  3EED A;  2KPI A;  4MON A;  2M6N A;  3GKQ A;  4Y52 I;  2KI7 B;  4TNU A;  3EER A;  3F3F C;  1M1K 2;  2G2K A;  4A3D I;  1N8R 2;  3RZO I;  3CME 1;  4A3C I;  4MXU A;  1Q81 2;  4E33 A;  3G71 Z;  4S1T A;  5FLM I;  2H85 A;  2O53 A;  5C44 I;  3CCS Z;  1VQN 1;  3KIH A;  5C3E I;  2EGT A;  3PO3 S;  2RPR A;  1YUK A;  1K9M 2;  2F4M A;  4A3K I;  3CCU Z;  2JA7 I;  4AYB A;  4BY7 I;  4NBC A;  4X6A I;  4HH4 A;  3PO2 I;  4NOZ A;  1YIT Z;  2Q4Z A;  3T4N B;  1M1K 1;  2Y0S A;  2RIQ A;  1N8R 1;  3P5J B;  3GTP I;  3CC7 Z;  3J80 b;  1YHQ 1;  1Q81 1;  1RNI A;  3CPW Y;  2VF1 A;  4HGZ A;  4NBG A;  3CCR Z;  3CCM Z;  1M90 2;  4A3M I;  3HOW I;  4A3J I;  2NVT I;  5A2Q b;  2HU9 A;  3CCQ Z;  1K9M 1;  3I07 A;  1Q16 A;  5C4X I;  3JAM f;  1YJW Z;  3VMI A;  4NBA A;  1KC8 2;  2QRD B;  5AN9 F;  3PO3 I;  2QEX Z;  3VB9 A;  1S72 Z;  3VMH A;  3CCL 1;  2PMZ A;  1Y1V S;  4E32 A;  3CCV 1;  3GTG I;  3CD6 1;  1Q86 2;  2W04 A;  1KQS Z;  5C4J I;  4MH4 A;  2VPZ A;  5T67 A;  3K7A I;  4NBH A;  4NBE A;  1M90 1;  3GTJ I;  1KD1 2;  3I4M I;  1VQ9 Z;  4NB8 A;  1Z02 A;  2DE5 A;  2E7Z A;  5FLX b;  3J81 f;  2J6A A;  1YIJ 1;  3HOU I;  2NVY I;  2RT9 A;  1ZB9 A;  4CL1 A;  2VPY A;  3OW2 Y;  1VQP Z;  1KC8 1;  1VQ4 1;  1SIW A;  4E31 A;  2OOY B;  2NAP A;  3G4S Z;  2GTI A;  1VQ7 Z;  2V8K A;  5T64 A;  3FKI I;  3S14 I;  5T6B A;  3NH4 A;  4RVF A;  1Q86 1;  1VLA A;  3IF8 A;  2JA5 I;  2IZ3 A;  2QA4 Z;  3GTQ I;  2JIM A;  3I56 Z;  1Y1V I;  4A3F I;  1QF8 A;  1KD1 1;  4A3G I;  3HOZ I;  3G71 1;  1Y1W I;  3IFU A;  4DGL A;  3CCS 1;  1Q82 2;  1TWH I;  1SFO I;  2F4O A;  1TWC I;  2JA6 I;  2JIO A;  1JWH C;  1QYP A;  1NUI A;  3CCE Z;  2OTL Z;  1QVF Y;  3GTM I;  1YIT 1;  1VQ5 Z;  2JR6 A;  3IX0 A;  1VQK Z;  1QVF Z;  4MRI A;  2JIQ A;  3G6E Z;  1VQO Z;  1VQ6 Z;  2K5R A;  3M3Y I;  2JUB A;  3GTL I;  3J80 f;  1VQ8 Z;  4DK1 A;  2JIP A;  2V45 A;  3I55 Z;  3CCM 1;  3MZL B;  1Q82 1;  3HOV I;  4A93 I;  2K3R A;  5A2Q f;  1YI2 Z;  5IP7 I;  1TWF I;  2E2H I; 
#chains in the Genus database with same CATH homology
 3H3V J;  1YJW 1;  3CC2 1;  2JA8 I;  2QEX 1;  3S15 I;  1DL6 A;  5IT9 b;  1S72 1;  4MD7 A;  1I6H I;  3CPW Z;  3HOX I;  5D1O B;  1QVG Y;  2DE6 A;  1K8A 2;  4XX2 A;  1QVG Z;  2DE7 A;  3HOY I;  4BBS I;  3S1M I;  4A3I I;  4NFR A;  4RS4 A;  2HF1 A;  1VQ9 1;  5FLX f;  3CC4 Z;  4RV9 A;  1USP B;  1N2F A;  1K73 2;  3NH8 A;  4MD9 A;  2R6M A;  3G4S 1;  2ZAE B;  2GU2 A;  1VQ7 1;  3BG0 B;  2P28 A;  2E2I I;  1K8A 1;  2YU9 I;  1W2B Y;  2YAD A;  1P9N A;  3VTN A;  1JJ2 Y;  1YJ9 Z;  2QA4 1;  3I56 1;  1JJ2 Z;  2B63 I;  3OW2 Z;  3GTM S;  4BY1 I;  1I50 I;  1VQL Z;  2VUG A;  3ESW A;  1NJI 2;  1K73 1;  4E2W A;  1PFT A;  2OZK A;  2OOX B;  2QKD A;  2BJO A;  3NDJ A;  3CCE 1;  3KIF A;  2IZ4 A;  2OTL 1;  1Z03 A;  4RVD A;  3FQM A;  4E30 A;  1VQK 1;  3D6W A;  2OTJ Z;  2JS4 A;  3G6E 1;  1VQO 1;  1VQM Z;  1VQ6 1;  3Q87 A;  3M4O I;  3GTO I;  3LUS A;  1VQ8 1;  3CQZ I;  2VUM I;  4A3L I;  2R92 I;  3QWU A;  4QTU A;  3CXC Y;  3I55 1;  3CCU 1;  1NJI 1;  3MZK B;  3MON A;  3TE5 B;  3CCJ Z;  1YJN Z;  4A3E I;  1YI2 1;  4BXX I;  1RO2 A;  1ZB8 A;  4E2Z A;  1ZH1 A;  2JNY A;  3CMA Z;  4EWC A;  1Z01 A;  2O4H A;  4Y7N I;  3CC7 1;  4NBD A;  3VMG A;  2QRE B;  5IT9 f;  4HGY A;  3CCR 1;  2PK7 A;  4RVH A;  3I4N I;  2R7Z I;  4NBF A;  2RBL A;  3CCQ 1;  4A3B I;  4NB9 A;  2LIY A;  2V8I A;  2GTH A;  1LQL A;  2NVX I;  3CC4 1;  2R93 I;  2I3C A;  1TWA I;  2RHB A;  3CME Z;  1RO0 A;  3BG1 B;  5D1O A;  2QRC B;  2NVQ I;  1L1O C;  2AKL A;  3NDI A;  4DQY B;  1S7M A;  3S2H I;  2V8J A;  2E9H A;  1VQN Z;  3GCF A;  2E2J I;  4MD8 A;  2LFU A;  2JMO A;  2QR1 B;  1YJ9 1;  2WB1 A;  1WCM I;  1USP A;  1X3Z A;  3F3P C;  1RLY A;  1VQP 1;  1X0T A;  3S1N I;  3NH5 A;  4QTT A;  3S17 I;  3FQQ A;  3U50 C;  1VQL 1;  1WW9 A;  2Q51 A;  3CC2 Z;  1I3Q I;  3J7A 4;  1RO4 A;  5LL6 f;  2PM9 A;  1YHQ Z;  5IP9 I;  3S1Q I;  1W2B Z;  3H0G I;  1WII A;  1KQS Y;  4E2X A;  5CM2 M;  2OTJ 1;  4E2Y A;  1RQF A;  3JAM b;  1VQM 1;  1X3W A;  3TDH B;  4NBB A;  1Q7Y 2;  2M48 A;  4BBR I;  2W03 A;  1R9T I;  3CCJ 1;  1YJN 1;  3S1R I;  3CCL Z;  3GTK I;  3CCV Z;  3CD6 Z;  1KRL A;  5D1P A;  1VQ5 1;  3CMA 1;  1K83 I;  2WAQ A;  3S16 I;  3S2D I;  1YUA A;  3D9X A;  2QLV B;  1TFI A;  3NFZ A;  3J81 b;  1YIJ Z;  4NH1 C;  1ML8 A;  1TWG I;  3HKZ A;  3CXC Z;  4RVG A;  1Q7Y 1;  1VQ4 Z;  2P3Y A;  1NP6 A;  3RZD I;  3EED A;  2KPI A;  4MON A;  2M6N A;  3GKQ A;  4Y52 I;  2KI7 B;  4TNU A;  3EER A;  3F3F C;  1M1K 2;  2G2K A;  4A3D I;  1N8R 2;  3RZO I;  3CME 1;  4A3C I;  4MXU A;  1Q81 2;  4E33 A;  3G71 Z;  4S1T A;  5FLM I;  2H85 A;  2O53 A;  5C44 I;  3CCS Z;  1VQN 1;  3KIH A;  5C3E I;  2EGT A;  3PO3 S;  2RPR A;  1YUK A;  1K9M 2;  2F4M A;  4A3K I;  3CCU Z;  2JA7 I;  4AYB A;  4BY7 I;  4NBC A;  4X6A I;  4HH4 A;  3PO2 I;  4NOZ A;  1YIT Z;  2Q4Z A;  3T4N B;  1M1K 1;  2Y0S A;  2RIQ A;  1N8R 1;  3P5J B;  3GTP I;  3CC7 Z;  3J80 b;  1YHQ 1;  1Q81 1;  1RNI A;  3CPW Y;  2VF1 A;  4HGZ A;  4NBG A;  3CCR Z;  3CCM Z;  1M90 2;  4A3M I;  3HOW I;  4A3J I;  2NVT I;  5A2Q b;  2HU9 A;  3CCQ Z;  1K9M 1;  3I07 A;  5C4X I;  3JAM f;  1YJW Z;  3VMI A;  4NBA A;  1KC8 2;  2QRD B;  5AN9 F;  3PO3 I;  2QEX Z;  3VB9 A;  1S72 Z;  3VMH A;  3CCL 1;  2PMZ A;  1Y1V S;  4E32 A;  3CCV 1;  3GTG I;  3CD6 1;  1Q86 2;  2W04 A;  1KQS Z;  5C4J I;  4MH4 A;  5T67 A;  3K7A I;  4NBH A;  4NBE A;  1M90 1;  3GTJ I;  1KD1 2;  3I4M I;  1VQ9 Z;  4NB8 A;  1Z02 A;  2DE5 A;  5FLX b;  3J81 f;  2J6A A;  1YIJ 1;  3HOU I;  2NVY I;  2RT9 A;  1ZB9 A;  4CL1 A;  3OW2 Y;  1VQP Z;  1KC8 1;  1VQ4 1;  4E31 A;  2OOY B;  3G4S Z;  2GTI A;  1VQ7 Z;  2V8K A;  5T64 A;  3FKI I;  3S14 I;  5T6B A;  3NH4 A;  4RVF A;  1Q86 1;  1VLA A;  3IF8 A;  2JA5 I;  2IZ3 A;  2QA4 Z;  3GTQ I;  3I56 Z;  1Y1V I;  4A3F I;  1QF8 A;  1KD1 1;  4A3G I;  3HOZ I;  3G71 1;  1Y1W I;  3IFU A;  4DGL A;  3CCS 1;  1Q82 2;  1TWH I;  1SFO I;  2F4O A;  1TWC I;  2JA6 I;  1JWH C;  1QYP A;  1NUI A;  3CCE Z;  2OTL Z;  1QVF Y;  3GTM I;  1YIT 1;  1VQ5 Z;  2JR6 A;  3IX0 A;  1VQK Z;  1QVF Z;  4MRI A;  3G6E Z;  1VQO Z;  1VQ6 Z;  2K5R A;  3M3Y I;  2JUB A;  3GTL I;  3J80 f;  1VQ8 Z;  4DK1 A;  3I55 Z;  3CCM 1;  3MZL B;  1Q82 1;  3HOV I;  4A93 I;  2K3R A;  5A2Q f;  1YI2 Z;  5IP7 I;  1TWF I;  2E2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...