3CCR1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccr100
1N8R2 1YJ91 1VQO1 1YIT1 2OTLZ 3CCLZ 1M901 3CD6Z 1K732 3CCR1 1Q861 1N8R1 1VQPZ 3CC4Z 2QEX1 1VQOZ 1YITZ 1K731 3CMA1 1KQSZ 3CCE1 3CCRZ 3CCV1 1QVGZ 2QEXZ 1VQM1 3CMAZ 1JJ2Z 3CCVZ 1VQ41 1VQK1 1VQ71 3CXCZ 2OTJ1 3CCQ1 1K8A2 1VQ4Z 1VQ7Z 1VQKZ 3G6E1 1YI21 1NJI2 2OTJZ 3CCQZ 1W2BZ 1VQ91 3OW2Z 1NJI1 1JJ2Y 1YHQ1 3G6EZ 1YI2Z 1M1K2 1VQL1 1K9M2 3CCJ1 1VQ9Z 1YHQZ 1S721 1K9M1 3CCM1 1VQLZ 1QVFZ 3G711 1KD12 3CCJZ 3CPWZ 1VQ81 3CC71 3CCS1 1S72Z 1KD11 2QA41 3CCMZ 3G4S1 1VQN1 3G71Z 1VQ8Z 3CC7Z 1KQSY 3CME1 3CCSZ 1QVGY 1YJN1 2QA4Z 1K8A1 3G4SZ 1VQNZ 1Q7Y2 1Q812 3CMEZ 1YJNZ 1Q7Y1 1Q811 3CPWY 3I55Z 3CXCY 1KC82 1M1K1 1VQ5Z 1KC81 3CC21 1M902 1YIJ1 1W2BY 3OW2Y 1YJW1 3CC2Z 3I561 3CCU1 1Q822 1YJ9Z 1YIJZ 1YJWZ 1VQ61 3I551 1Q821 3I56Z 3CCUZ 1QVFY 1VQ51 3CCEZ 1VQ6Z 1VQMZ 2OTL1 3CCL1 3CD61 1VQP1 3CC41 1Q862
chains in the Genus database with same CATH superfamily
1YIT1 2OTLZ 3CCLZ 1M901 1WCMI 1N8R1 3CC4Z 2V8JA 1RNIA 1KQSZ 3CCE1 2KI7B 5D1OB 3CCV1 2Y0SA 2RHBA 3JAMb 2WAQA 4NB8A 1JJ2Z 2LIYA 1NP6A 1VQK1 4X6AI 2JA6I 2R6MA 1SIWA 2P3YA 2JUBA 2AKLA 1WZNA 1YI21 2VPXA 1NJI2 3CCQZ 3GTJI 3GTQI 4A3MI 1Y1VI 4A3KI 2DE6A 3QWUA 2V45A 1X3WA 3VB9A 2V8KA 1WIIA 3CPWZ 1VQ81 3S15I 2JMOA 1ZH1A 3VMHA 4RVFA 3GTOI 5D1PA 1KQSY 3CCSZ 4XX2A 1K8A1 4RVDA 4A3EI 3FQMA 1I6HI 3ESWA 3FKII 1ZB9A 2QLVB 3S2DI 3IF8A 2F4OA 1VQ5Z 3JAMf 3CC21 2NAPA 1L1OC 3Q87A 3S16I 4TNUA 2PK7A 4HGYA 4E2WA 3S1RI 3I561 3CCU1 5C3EI 1YIJZ 5T64A 3VMIA 4E31A 2EGTA 2OZKA 5T67A 4AYBA 3CCEZ 1ZB8A 4E32A 2GTHA 3MONA 4MH4A 3CD61 2E9HA 3KIHA 3J80b 1NUIA 4QTUA 4BBRI 3T4NB 1K732 2BJOA 2B63I 3S1NI 2QEX1 5D1OA 2PMZA 1VQOZ 3NDJA 3CCRZ 5FLXb 3LUSA 3TE5B 5T6BA 3CMAZ 4Y7NI 1Z03A 3I4MI 1QXFA 1P9NA 4RVHA 2K5RA 3GTPI 1VQ4Z 1VQ7Z 1RO2A 3U50C 2OTJZ 2M6NA 2NVXI 3HOZI 3BG1B 3S2HI 4NBAA 1VQ91 1NJI1 1Y8CA 1YHQ1 3G6EZ 4DQYB 3NH5A 2W03A 1M1K2 4CL1A 1Z02A 1Y1WI 2QRDB 4MONA 5CM2M 2OOXB 3HOWI 4HH4A 3CCM1 1VQLZ 1QYPA 1QVFZ 3G711 2DE5A 3CCJZ 2QR1B 1KRLA 1RO4A 1S72Z 3MZLB 2QA41 2AYDA 1RLYA 3I07A 3CC7Z 4NH1C 3J81f 1YJN1 3G4SZ 1VQNZ 3GCFA 1Q7Y2 2JR6A 3HKZA 2NVTI 3CMEZ 1K83I 1TWAI 5C4JI 3NH4A 3H3VJ 1I3QI 2RPRA 1KC82 4NB9A 5FLXf 1M902 4E33A 3GKQA 5IT9b 3PO3S 3EERA 3M4OI 4A3II 4BXXI 4NBEA 3GTGI 1YJWZ 2JA8I 1TWHI 2LFUA 4Y52I 3M3YI 1DL6A 5A2Qb 2LEXA 1QVFY 4E30A 3NFZA 2RIQA 1VQ6Z 2JIPA 2GU2A 3RZOI 2OTL1 1PFTA 3HOYI 4NBCA 1Z01A 3CCL1 1TWGI 2NVYI 3CC41 1Q862 1YJ91 2JIOA 2OOYB 2J6AA 1VQPZ 2ZAEB 2JA7I 1YITZ 1K731 4QTTA 2DE7A 2VF1A 2VPWA 4RVGA 2Q51A 1VQM1 2KPIA 4MD9A 1WJ2A 2JA5I 1I50I 1TFIA 3CCVZ 4NBHA 3CXCZ 3CCQ1 3J7A4 1K8A2 1VQKZ 1ML8A 4MD7A 1W2BZ 2JIRA 3OW2Z 1YI2Z 2QRCB 1K9M2 4BBSI 2IZ4A 3S1QI 4DGLA 3EEDA 2WB1A 3S14I 2O4HA 1KD12 4NFRA 2VPYA 2R92I 1Q16A 4NOZA 3CCS1 3VTNA 2RT9A 3P5JB 2HU9A 1VQ8Z 1YUKA 2VPZA 2IV2X 3H0GI 2E2HI 3KIFA 2QKDA 1RO0A 1Q812 4NBGA 4S1TA 1Q7Y1 3CXCY 3S17I 4A3JI 1R9TI 5C44I 1KC81 3VMGA 5AN9F 2GTIA 1YIJ1 4A3BI 1W2BY 3OW2Y 2V3VA 5LL6f 3CC2Z 1S7MA 2YADA 3HOXI 1Q822 4A3FI 1YJ9Z 3D9XA 3J80f 3I551 3NDIA 4BY1I 3I56Z 3CCUZ 3IFUA 2R7ZI 4A3LI 1VLAA 1USPA 1FDOA 1VQMZ 3GTKI 5FLMI 2O53A 3I4NI 4BY7I 3TDHB 1N8R2 4NBDA 1VQO1 3F3PC 3CD6Z 4MXUA 3S1MI 4A3DI 3CCR1 1Q861 4E2YA 3HOVI 2Q4ZA 3CMA1 3F3FC 2E2JI 2JNYA 2M48A 1QVGZ 3PO2I 2E7ZA 2QEXZ 3NH8A 2JS4A 2RBLA 3GTLI 4E2ZA 2W04A 3BG0B 1VQ41 1VQ71 1AA6A 4RV9A 2OTJ1 1USPB 2H85A 3G6E1 1SFOI 2V8IA 5IP9I 1LQLA 2F4MA 1JJ2Y 2JIQA 3IX0A 3IR7A 1X0TA 1VQL1 2R93I 1FDIA 3CCJ1 3FQQA 3D6WA 4EWCA 1VQ9Z 1YHQZ 2P28A 4DK1A 1S721 1K9M1 1JWHC 3PO3I 4RS4A 1QF8A 3CC71 2QREB 5C4XI 1KD11 3CCMZ 4NBFA 3G4S1 1VQN1 3G71Z 2IZ3A 3GTMS 3CME1 2G2KA 3RZDI 1QVGY 2K3RA 2QA4Z 1X3ZA 4NBBA 4A3CI 5IT9f 2VUGA 1YJNZ 4HGZA 1Q811 3CPWY 1YUAA 4MD8A 3I55Z 1TWFI 1M1K1 4E2XA 4A3GI 1RQFA 3J81b 5A2Qf 2YU9I 2VUMI 2PM9A 1YJW1 2HF1A 5IP7I 3D2LA 3CQZI 2JIMA 1VQ61 1Q821 2NVQI 4A93I 1VQ51 4MRIA 1N2FA 1Y1VS 2I3CA 3GTMI 3MZKB 1WW9A 1TWCI 3K7AI 3HOUI 1VQP1 2E2II
chains in the Genus database with same CATH topology
1YIT1 2OTLZ 3CCLZ 1M901 1WCMI 1N8R1 3CC4Z 2V8JA 1RNIA 1KQSZ 3CCE1 2KI7B 5D1OB 3CCV1 2Y0SA 2RHBA 3JAMb 2WAQA 4NB8A 1JJ2Z 2LIYA 1NP6A 1VQK1 4X6AI 2JA6I 2R6MA 2P3YA 2JUBA 2AKLA 1YI21 1NJI2 3CCQZ 3GTJI 3GTQI 4A3MI 1Y1VI 4A3KI 2DE6A 3QWUA 1X3WA 3VB9A 2V8KA 1WIIA 3CPWZ 1VQ81 3S15I 2JMOA 1ZH1A 3VMHA 4RVFA 3GTOI 5D1PA 1KQSY 3CCSZ 4XX2A 1K8A1 4RVDA 4A3EI 3FQMA 1I6HI 3ESWA 3FKII 1ZB9A 2QLVB 3S2DI 3IF8A 2F4OA 1VQ5Z 3JAMf 3CC21 1L1OC 3Q87A 3S16I 4TNUA 2PK7A 4HGYA 4E2WA 3S1RI 3I561 3CCU1 5C3EI 1YIJZ 5T64A 3VMIA 4E31A 2EGTA 2OZKA 5T67A 4AYBA 3CCEZ 1ZB8A 4E32A 2GTHA 3MONA 4MH4A 3CD61 2E9HA 3KIHA 3J80b 1NUIA 4QTUA 4BBRI 3T4NB 1K732 2BJOA 2B63I 3S1NI 2QEX1 5D1OA 2PMZA 1VQOZ 3NDJA 3CCRZ 5FLXb 3LUSA 3TE5B 5T6BA 3CMAZ 4Y7NI 1Z03A 3I4MI 1P9NA 4RVHA 2K5RA 3GTPI 1VQ4Z 1VQ7Z 1RO2A 3U50C 2OTJZ 2M6NA 2NVXI 3HOZI 3BG1B 3S2HI 4NBAA 1VQ91 1NJI1 1YHQ1 3G6EZ 4DQYB 3NH5A 2W03A 1M1K2 4CL1A 1Z02A 1Y1WI 2QRDB 4MONA 5CM2M 2OOXB 3HOWI 4HH4A 3CCM1 1VQLZ 1QYPA 1QVFZ 3G711 2DE5A 3CCJZ 2QR1B 1KRLA 1RO4A 1S72Z 3MZLB 2QA41 1RLYA 3I07A 3CC7Z 4NH1C 3J81f 1YJN1 3G4SZ 1VQNZ 3GCFA 1Q7Y2 2JR6A 3HKZA 2NVTI 3CMEZ 1K83I 1TWAI 5C4JI 3NH4A 3H3VJ 1I3QI 2RPRA 1KC82 4NB9A 5FLXf 1M902 4E33A 3GKQA 5IT9b 3PO3S 3EERA 3M4OI 4A3II 4BXXI 4NBEA 3GTGI 1YJWZ 2JA8I 1TWHI 2LFUA 4Y52I 3M3YI 1DL6A 5A2Qb 1QVFY 4E30A 3NFZA 2RIQA 1VQ6Z 2GU2A 3RZOI 2OTL1 1PFTA 3HOYI 4NBCA 1Z01A 3CCL1 1TWGI 2NVYI 3CC41 1Q862 1YJ91 2OOYB 2J6AA 1VQPZ 2ZAEB 2JA7I 1YITZ 1K731 4QTTA 2DE7A 2VF1A 4RVGA 2Q51A 1VQM1 2KPIA 4MD9A 2JA5I 1I50I 1TFIA 3CCVZ 4NBHA 3CXCZ 3CCQ1 3J7A4 1K8A2 1VQKZ 1ML8A 4MD7A 1W2BZ 3OW2Z 1YI2Z 2QRCB 1K9M2 4BBSI 2IZ4A 3S1QI 4DGLA 3EEDA 2WB1A 3S14I 2O4HA 1KD12 4NFRA 2R92I 4NOZA 3CCS1 3VTNA 2RT9A 3P5JB 2HU9A 1VQ8Z 1YUKA 3H0GI 2E2HI 3KIFA 2QKDA 1RO0A 1Q812 4NBGA 4S1TA 1Q7Y1 3CXCY 3S17I 4A3JI 1R9TI 5C44I 1KC81 3VMGA 5AN9F 2GTIA 1YIJ1 4A3BI 1W2BY 3OW2Y 5LL6f 3CC2Z 1S7MA 2YADA 3HOXI 1Q822 4A3FI 1YJ9Z 3D9XA 3J80f 3I551 3NDIA 4BY1I 3I56Z 3CCUZ 3IFUA 2R7ZI 4A3LI 1VLAA 1USPA 1VQMZ 3GTKI 5FLMI 2O53A 3I4NI 4BY7I 3TDHB 1N8R2 4NBDA 1VQO1 3F3PC 3CD6Z 4MXUA 3S1MI 4A3DI 3CCR1 1Q861 4E2YA 3HOVI 2Q4ZA 3CMA1 3F3FC 2E2JI 2JNYA 2M48A 1QVGZ 3PO2I 2QEXZ 3NH8A 2JS4A 2RBLA 3GTLI 4E2ZA 2W04A 3BG0B 1VQ41 1VQ71 4RV9A 2OTJ1 1USPB 2H85A 3G6E1 1SFOI 2V8IA 5IP9I 1LQLA 2F4MA 1JJ2Y 3IX0A 1X0TA 1VQL1 2R93I 3CCJ1 3FQQA 3D6WA 4EWCA 1VQ9Z 1YHQZ 2P28A 4DK1A 1S721 1K9M1 1JWHC 3PO3I 4RS4A 1QF8A 3CC71 2QREB 5C4XI 1KD11 3CCMZ 4NBFA 3G4S1 1VQN1 3G71Z 2IZ3A 3GTMS 3CME1 3RZDI 2G2KA 1QVGY 2K3RA 2QA4Z 1X3ZA 4NBBA 4A3CI 5IT9f 2VUGA 1YJNZ 4HGZA 1Q811 3CPWY 1YUAA 4MD8A 3I55Z 1TWFI 1M1K1 4E2XA 4A3GI 1RQFA 3J81b 5A2Qf 2YU9I 2VUMI 2PM9A 1YJW1 2HF1A 5IP7I 3CQZI 1VQ61 1Q821 2NVQI 4A93I 1VQ51 4MRIA 1N2FA 1Y1VS 2I3CA 3GTMI 3MZKB 1WW9A 1TWCI 3K7AI 3HOUI 1VQP1 2E2II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  1YJ9 1;  1VQO 1;  1YIT 1;  2OTL Z;  3CCL Z;  1M90 1;  3CD6 Z;  1K73 2;  3CCR 1;  1Q86 1;  1N8R 1;  1VQP Z;  3CC4 Z;  2QEX 1;  1VQO Z;  1YIT Z;  1K73 1;  3CMA 1;  1KQS Z;  3CCE 1;  3CCR Z;  3CCV 1;  1QVG Z;  2QEX Z;  1VQM 1;  3CMA Z;  1JJ2 Z;  3CCV Z;  1VQ4 1;  1VQK 1;  1VQ7 1;  3CXC Z;  2OTJ 1;  3CCQ 1;  1K8A 2;  1VQ4 Z;  1VQ7 Z;  1VQK Z;  3G6E 1;  1YI2 1;  1NJI 2;  2OTJ Z;  3CCQ Z;  1W2B Z;  1VQ9 1;  3OW2 Z;  1NJI 1;  1JJ2 Y;  1YHQ 1;  3G6E Z;  1YI2 Z;  1M1K 2;  1VQL 1;  1K9M 2;  3CCJ 1;  1VQ9 Z;  1YHQ Z;  1S72 1;  1K9M 1;  3CCM 1;  1VQL Z;  1QVF Z;  3G71 1;  1KD1 2;  3CCJ Z;  3CPW Z;  1VQ8 1;  3CC7 1;  3CCS 1;  1S72 Z;  1KD1 1;  2QA4 1;  3CCM Z;  3G4S 1;  1VQN 1;  3G71 Z;  1VQ8 Z;  3CC7 Z;  1KQS Y;  3CME 1;  3CCS Z;  1QVG Y;  1YJN 1;  2QA4 Z;  1K8A 1;  3G4S Z;  1VQN Z;  1Q7Y 2;  1Q81 2;  3CME Z;  1YJN Z;  1Q7Y 1;  1Q81 1;  3CPW Y;  3I55 Z;  3CXC Y;  1KC8 2;  1M1K 1;  1VQ5 Z;  1KC8 1;  3CC2 1;  1M90 2;  1YIJ 1;  1W2B Y;  3OW2 Y;  1YJW 1;  3CC2 Z;  3I56 1;  3CCU 1;  1Q82 2;  1YJ9 Z;  1YIJ Z;  1YJW Z;  1VQ6 1;  3I55 1;  1Q82 1;  3I56 Z;  3CCU Z;  1QVF Y;  1VQ5 1;  3CCE Z;  1VQ6 Z;  1VQM Z;  2OTL 1;  3CCL 1;  3CD6 1;  1VQP 1;  3CC4 1;  1Q86 2; 
#chains in the Genus database with same CATH topology
 1YIT 1;  2OTL Z;  3CCL Z;  1M90 1;  1WCM I;  1N8R 1;  3CC4 Z;  2V8J A;  1RNI A;  1KQS Z;  3CCE 1;  2KI7 B;  5D1O B;  3CCV 1;  2Y0S A;  2RHB A;  3JAM b;  2WAQ A;  4NB8 A;  1JJ2 Z;  2LIY A;  1NP6 A;  1VQK 1;  4X6A I;  2JA6 I;  2R6M A;  1SIW A;  2P3Y A;  2JUB A;  2AKL A;  1WZN A;  1YI2 1;  2VPX A;  1NJI 2;  3CCQ Z;  3GTJ I;  3GTQ I;  4A3M I;  1Y1V I;  4A3K I;  2DE6 A;  3QWU A;  2V45 A;  1X3W A;  3VB9 A;  2V8K A;  1WII A;  3CPW Z;  1VQ8 1;  3S15 I;  2JMO A;  1ZH1 A;  3VMH A;  4RVF A;  3GTO I;  5D1P A;  1KQS Y;  3CCS Z;  4XX2 A;  1K8A 1;  4RVD A;  4A3E I;  3FQM A;  1I6H I;  3ESW A;  3FKI I;  1ZB9 A;  2QLV B;  3S2D I;  3IF8 A;  2F4O A;  1VQ5 Z;  3JAM f;  3CC2 1;  2NAP A;  1L1O C;  3Q87 A;  3S16 I;  4TNU A;  2PK7 A;  4HGY A;  4E2W A;  3S1R I;  3I56 1;  3CCU 1;  5C3E I;  1YIJ Z;  5T64 A;  3VMI A;  4E31 A;  2EGT A;  2OZK A;  5T67 A;  4AYB A;  3CCE Z;  1ZB8 A;  4E32 A;  2GTH A;  3MON A;  4MH4 A;  3CD6 1;  2E9H A;  3KIH A;  3J80 b;  1NUI A;  4QTU A;  4BBR I;  3T4N B;  1K73 2;  2BJO A;  2B63 I;  3S1N I;  2QEX 1;  5D1O A;  2PMZ A;  1VQO Z;  3NDJ A;  3CCR Z;  5FLX b;  3LUS A;  3TE5 B;  5T6B A;  3CMA Z;  4Y7N I;  1Z03 A;  3I4M I;  1QXF A;  1P9N A;  4RVH A;  2K5R A;  3GTP I;  1VQ4 Z;  1VQ7 Z;  1RO2 A;  3U50 C;  2OTJ Z;  2M6N A;  2NVX I;  3HOZ I;  3BG1 B;  3S2H I;  4NBA A;  1VQ9 1;  1NJI 1;  1Y8C A;  1YHQ 1;  3G6E Z;  4DQY B;  3NH5 A;  2W03 A;  1M1K 2;  4CL1 A;  1Z02 A;  1Y1W I;  2QRD B;  4MON A;  5CM2 M;  2OOX B;  3HOW I;  4HH4 A;  3CCM 1;  1VQL Z;  1QYP A;  1QVF Z;  3G71 1;  2DE5 A;  3CCJ Z;  2QR1 B;  1KRL A;  1RO4 A;  1S72 Z;  3MZL B;  2QA4 1;  2AYD A;  1RLY A;  3I07 A;  3CC7 Z;  4NH1 C;  3J81 f;  1YJN 1;  3G4S Z;  1VQN Z;  3GCF A;  1Q7Y 2;  2JR6 A;  3HKZ A;  2NVT I;  3CME Z;  1K83 I;  1TWA I;  5C4J I;  3NH4 A;  3H3V J;  1I3Q I;  2RPR A;  1KC8 2;  4NB9 A;  5FLX f;  1M90 2;  4E33 A;  3GKQ A;  5IT9 b;  3PO3 S;  3EER A;  3M4O I;  4A3I I;  4BXX I;  4NBE A;  3GTG I;  1YJW Z;  2JA8 I;  1TWH I;  2LFU A;  4Y52 I;  3M3Y I;  1DL6 A;  5A2Q b;  2LEX A;  1QVF Y;  4E30 A;  3NFZ A;  2RIQ A;  1VQ6 Z;  2JIP A;  2GU2 A;  3RZO I;  2OTL 1;  1PFT A;  3HOY I;  4NBC A;  1Z01 A;  3CCL 1;  1TWG I;  2NVY I;  3CC4 1;  1Q86 2;  1YJ9 1;  2JIO A;  2OOY B;  2J6A A;  1VQP Z;  2ZAE B;  2JA7 I;  1YIT Z;  1K73 1;  4QTT A;  2DE7 A;  2VF1 A;  2VPW A;  4RVG A;  2Q51 A;  1VQM 1;  2KPI A;  4MD9 A;  1WJ2 A;  2JA5 I;  1I50 I;  1TFI A;  3CCV Z;  4NBH A;  3CXC Z;  3CCQ 1;  3J7A 4;  1K8A 2;  1VQK Z;  1ML8 A;  4MD7 A;  1W2B Z;  2JIR A;  3OW2 Z;  1YI2 Z;  2QRC B;  1K9M 2;  4BBS I;  2IZ4 A;  3S1Q I;  4DGL A;  3EED A;  2WB1 A;  3S14 I;  2O4H A;  1KD1 2;  4NFR A;  2VPY A;  2R92 I;  1Q16 A;  4NOZ A;  3CCS 1;  3VTN A;  2RT9 A;  3P5J B;  2HU9 A;  1VQ8 Z;  1YUK A;  2VPZ A;  2IV2 X;  3H0G I;  2E2H I;  3KIF A;  2QKD A;  1RO0 A;  1Q81 2;  4NBG A;  4S1T A;  1Q7Y 1;  3CXC Y;  3S17 I;  4A3J I;  1R9T I;  5C44 I;  1KC8 1;  3VMG A;  5AN9 F;  2GTI A;  1YIJ 1;  4A3B I;  1W2B Y;  3OW2 Y;  2V3V A;  5LL6 f;  3CC2 Z;  1S7M A;  2YAD A;  3HOX I;  1Q82 2;  4A3F I;  1YJ9 Z;  3D9X A;  3J80 f;  3I55 1;  3NDI A;  4BY1 I;  3I56 Z;  3CCU Z;  3IFU A;  2R7Z I;  4A3L I;  1VLA A;  1USP A;  1FDO A;  1VQM Z;  3GTK I;  5FLM I;  2O53 A;  3I4N I;  4BY7 I;  3TDH B;  1N8R 2;  4NBD A;  1VQO 1;  3F3P C;  3CD6 Z;  4MXU A;  3S1M I;  4A3D I;  3CCR 1;  1Q86 1;  4E2Y A;  3HOV I;  2Q4Z A;  3CMA 1;  3F3F C;  2E2J I;  2JNY A;  2M48 A;  1QVG Z;  3PO2 I;  2E7Z A;  2QEX Z;  3NH8 A;  2JS4 A;  2RBL A;  3GTL I;  4E2Z A;  2W04 A;  3BG0 B;  1VQ4 1;  1VQ7 1;  1AA6 A;  4RV9 A;  2OTJ 1;  1USP B;  2H85 A;  3G6E 1;  1SFO I;  2V8I A;  5IP9 I;  1LQL A;  2F4M A;  1JJ2 Y;  2JIQ A;  3IX0 A;  3IR7 A;  1X0T A;  1VQL 1;  2R93 I;  1FDI A;  3CCJ 1;  3FQQ A;  3D6W A;  4EWC A;  1VQ9 Z;  1YHQ Z;  2P28 A;  4DK1 A;  1S72 1;  1K9M 1;  1JWH C;  3PO3 I;  4RS4 A;  1QF8 A;  3CC7 1;  2QRE B;  5C4X I;  1KD1 1;  3CCM Z;  4NBF A;  3G4S 1;  1VQN 1;  3G71 Z;  2IZ3 A;  3GTM S;  3CME 1;  2G2K A;  3RZD I;  1QVG Y;  2K3R A;  2QA4 Z;  1X3Z A;  4NBB A;  4A3C I;  5IT9 f;  2VUG A;  1YJN Z;  4HGZ A;  1Q81 1;  3CPW Y;  1YUA A;  4MD8 A;  3I55 Z;  1TWF I;  1M1K 1;  4E2X A;  4A3G I;  1RQF A;  3J81 b;  5A2Q f;  2YU9 I;  2VUM I;  2PM9 A;  1YJW 1;  2HF1 A;  5IP7 I;  3D2L A;  3CQZ I;  2JIM A;  1VQ6 1;  1Q82 1;  2NVQ I;  4A93 I;  1VQ5 1;  4MRI A;  1N2F A;  1Y1V S;  2I3C A;  3GTM I;  3MZK B;  1WW9 A;  1TWC I;  3K7A I;  3HOU I;  1VQP 1;  2E2I I; 
#chains in the Genus database with same CATH homology
 1YIT 1;  2OTL Z;  3CCL Z;  1M90 1;  1WCM I;  1N8R 1;  3CC4 Z;  2V8J A;  1RNI A;  1KQS Z;  3CCE 1;  2KI7 B;  5D1O B;  3CCV 1;  2Y0S A;  2RHB A;  3JAM b;  2WAQ A;  4NB8 A;  1JJ2 Z;  2LIY A;  1NP6 A;  1VQK 1;  4X6A I;  2JA6 I;  2R6M A;  2P3Y A;  2JUB A;  2AKL A;  1YI2 1;  1NJI 2;  3CCQ Z;  3GTJ I;  3GTQ I;  4A3M I;  1Y1V I;  4A3K I;  2DE6 A;  3QWU A;  1X3W A;  3VB9 A;  2V8K A;  1WII A;  3CPW Z;  1VQ8 1;  3S15 I;  2JMO A;  1ZH1 A;  3VMH A;  4RVF A;  3GTO I;  5D1P A;  1KQS Y;  3CCS Z;  4XX2 A;  1K8A 1;  4RVD A;  4A3E I;  3FQM A;  1I6H I;  3ESW A;  3FKI I;  1ZB9 A;  2QLV B;  3S2D I;  3IF8 A;  2F4O A;  1VQ5 Z;  3JAM f;  3CC2 1;  1L1O C;  3Q87 A;  3S16 I;  4TNU A;  2PK7 A;  4HGY A;  4E2W A;  3S1R I;  3I56 1;  3CCU 1;  5C3E I;  1YIJ Z;  5T64 A;  3VMI A;  4E31 A;  2EGT A;  2OZK A;  5T67 A;  4AYB A;  3CCE Z;  1ZB8 A;  4E32 A;  2GTH A;  3MON A;  4MH4 A;  3CD6 1;  2E9H A;  3KIH A;  3J80 b;  1NUI A;  4QTU A;  4BBR I;  3T4N B;  1K73 2;  2BJO A;  2B63 I;  3S1N I;  2QEX 1;  5D1O A;  2PMZ A;  1VQO Z;  3NDJ A;  3CCR Z;  5FLX b;  3LUS A;  3TE5 B;  5T6B A;  3CMA Z;  4Y7N I;  1Z03 A;  3I4M I;  1P9N A;  4RVH A;  2K5R A;  3GTP I;  1VQ4 Z;  1VQ7 Z;  1RO2 A;  3U50 C;  2OTJ Z;  2M6N A;  2NVX I;  3HOZ I;  3BG1 B;  3S2H I;  4NBA A;  1VQ9 1;  1NJI 1;  1YHQ 1;  3G6E Z;  4DQY B;  3NH5 A;  2W03 A;  1M1K 2;  4CL1 A;  1Z02 A;  1Y1W I;  2QRD B;  4MON A;  5CM2 M;  2OOX B;  3HOW I;  4HH4 A;  3CCM 1;  1VQL Z;  1QYP A;  1QVF Z;  3G71 1;  2DE5 A;  3CCJ Z;  2QR1 B;  1KRL A;  1RO4 A;  1S72 Z;  3MZL B;  2QA4 1;  1RLY A;  3I07 A;  3CC7 Z;  4NH1 C;  3J81 f;  1YJN 1;  3G4S Z;  1VQN Z;  3GCF A;  1Q7Y 2;  2JR6 A;  3HKZ A;  2NVT I;  3CME Z;  1K83 I;  1TWA I;  5C4J I;  3NH4 A;  3H3V J;  1I3Q I;  2RPR A;  1KC8 2;  4NB9 A;  5FLX f;  1M90 2;  4E33 A;  3GKQ A;  5IT9 b;  3PO3 S;  3EER A;  3M4O I;  4A3I I;  4BXX I;  4NBE A;  3GTG I;  1YJW Z;  2JA8 I;  1TWH I;  2LFU A;  4Y52 I;  3M3Y I;  1DL6 A;  5A2Q b;  1QVF Y;  4E30 A;  3NFZ A;  2RIQ A;  1VQ6 Z;  2GU2 A;  3RZO I;  2OTL 1;  1PFT A;  3HOY I;  4NBC A;  1Z01 A;  3CCL 1;  1TWG I;  2NVY I;  3CC4 1;  1Q86 2;  1YJ9 1;  2OOY B;  2J6A A;  1VQP Z;  2ZAE B;  2JA7 I;  1YIT Z;  1K73 1;  4QTT A;  2DE7 A;  2VF1 A;  4RVG A;  2Q51 A;  1VQM 1;  2KPI A;  4MD9 A;  2JA5 I;  1I50 I;  1TFI A;  3CCV Z;  4NBH A;  3CXC Z;  3CCQ 1;  3J7A 4;  1K8A 2;  1VQK Z;  1ML8 A;  4MD7 A;  1W2B Z;  3OW2 Z;  1YI2 Z;  2QRC B;  1K9M 2;  4BBS I;  2IZ4 A;  3S1Q I;  4DGL A;  3EED A;  2WB1 A;  3S14 I;  2O4H A;  1KD1 2;  4NFR A;  2R92 I;  4NOZ A;  3CCS 1;  3VTN A;  2RT9 A;  3P5J B;  2HU9 A;  1VQ8 Z;  1YUK A;  3H0G I;  2E2H I;  3KIF A;  2QKD A;  1RO0 A;  1Q81 2;  4NBG A;  4S1T A;  1Q7Y 1;  3CXC Y;  3S17 I;  4A3J I;  1R9T I;  5C44 I;  1KC8 1;  3VMG A;  5AN9 F;  2GTI A;  1YIJ 1;  4A3B I;  1W2B Y;  3OW2 Y;  5LL6 f;  3CC2 Z;  1S7M A;  2YAD A;  3HOX I;  1Q82 2;  4A3F I;  1YJ9 Z;  3D9X A;  3J80 f;  3I55 1;  3NDI A;  4BY1 I;  3I56 Z;  3CCU Z;  3IFU A;  2R7Z I;  4A3L I;  1VLA A;  1USP A;  1VQM Z;  3GTK I;  5FLM I;  2O53 A;  3I4N I;  4BY7 I;  3TDH B;  1N8R 2;  4NBD A;  1VQO 1;  3F3P C;  3CD6 Z;  4MXU A;  3S1M I;  4A3D I;  3CCR 1;  1Q86 1;  4E2Y A;  3HOV I;  2Q4Z A;  3CMA 1;  3F3F C;  2E2J I;  2JNY A;  2M48 A;  1QVG Z;  3PO2 I;  2QEX Z;  3NH8 A;  2JS4 A;  2RBL A;  3GTL I;  4E2Z A;  2W04 A;  3BG0 B;  1VQ4 1;  1VQ7 1;  4RV9 A;  2OTJ 1;  1USP B;  2H85 A;  3G6E 1;  1SFO I;  2V8I A;  5IP9 I;  1LQL A;  2F4M A;  1JJ2 Y;  3IX0 A;  1X0T A;  1VQL 1;  2R93 I;  3CCJ 1;  3FQQ A;  3D6W A;  4EWC A;  1VQ9 Z;  1YHQ Z;  2P28 A;  4DK1 A;  1S72 1;  1K9M 1;  1JWH C;  3PO3 I;  4RS4 A;  1QF8 A;  3CC7 1;  2QRE B;  5C4X I;  1KD1 1;  3CCM Z;  4NBF A;  3G4S 1;  1VQN 1;  3G71 Z;  2IZ3 A;  3GTM S;  3CME 1;  3RZD I;  2G2K A;  1QVG Y;  2K3R A;  2QA4 Z;  1X3Z A;  4NBB A;  4A3C I;  5IT9 f;  2VUG A;  1YJN Z;  4HGZ A;  1Q81 1;  3CPW Y;  1YUA A;  4MD8 A;  3I55 Z;  1TWF I;  1M1K 1;  4E2X A;  4A3G I;  1RQF A;  3J81 b;  5A2Q f;  2YU9 I;  2VUM I;  2PM9 A;  1YJW 1;  2HF1 A;  5IP7 I;  3CQZ I;  1VQ6 1;  1Q82 1;  2NVQ I;  4A93 I;  1VQ5 1;  4MRI A;  1N2F A;  1Y1V S;  2I3C A;  3GTM I;  3MZK B;  1WW9 A;  1TWC I;  3K7A I;  3HOU I;  1VQP 1;  2E2I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...