1TWAI

Rna polymerase ii complexed with atp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI02
1L1OC 3GKQA 1WCMI 1TWGI 3HOWI 3S1QI 1TWFI 2JR6A 3S16I 3I4MI 4X6AI 3PO3S 1R9TI 2R93I 4NBEA 1LQLA 3M4OI 5C4JI 2P3YA 3HOVI 2E2II 4NBGA 3LUSA 3S1MI 2R7ZI 4NBFA 3S2HI 3RZDI 4NBCA 4A3GI 1TWHI 2E2JI 2R92I 4A3CI 4A3DI 3CQZI 3U50C 3GTQI 2KPIA 4A93I 1Y1VS 3GTLI 4XX2A 1N2FA 3GTKI 1X3ZA 3FKII 4QTUA 2B63I 2JS4A 1Y1WI 3PO3I 3ESWA 3Q87A 3H0GI 2DE7A 4QTTA 2K5RA 1YUAA 3EERA 1ZB8A 2NVYI 1TFIA 3S1RI 1PFTA 3GTMI 4A3BI 2JA8I 5C44I 1TWCI 3VMHA 5IP7I 4MH4A 2J6AA 3VMGA 1NUIA 3S15I 3VMIA 2RBLA 3HOYI 4A3KI 1ZB9A 4BXXI 1X3WA 1RLYA 1Y1VI 4Y7NI 4A3FI 2NVQI 1DL6A 3GTJI 1I50I 4NBHA 3GTMS 3GTGI 1VLAA 4NB9A 4BY1I 2F4MA 4NBAA 5IP9I 2YU9I 3HOUI 1WW9A 4A3LI 3PO2I 1RO4A 2BJOA 4A3EI 2F4OA 5C4XI 1QYPA 3S14I 4A3II 5CM2M 4BBRI 3RZOI 2VUMI 3D6WA 4A3MI 1I6HI 3I07A 2E2HI 2NVTI 2HF1A 5C3EI 1USPB 2AKLA 4NBBA 3M3YI 3GTPI 2DE6A 4NBDA 3VB9A 3S17I 2JA6I 3S2DI 2PK7A 4BY7I 2JNYA 4A3JI 3I4NI 2DE5A 1USPA 1TWAI 3HOZI 1SFOI 1K83I 3H3VJ 3GTOI 4NOZA 4Y52I 4NB8A 3S1NI 4BBSI 2JA5I 1I3QI 3K7AI 2NVXI 3HOXI 5FLMI 2JA7I 3GCFA 1ML8A
chains in the Genus database with same CATH superfamily
1L1OC 3TDHB 1VQK1 3IR7A 3GKQA 1QVFZ 1TWFI 2JR6A 4MRIA 1VQO1 3S16I 4X6AI 2QA41 1VQMZ 1Q7Y1 1VQ9Z 3F3FC 5C4JI 2E9HA 3I551 3HOVI 4NBGA 3CME1 3CPWZ 3CCQ1 1VQP1 3J80f 3F3PC 2QRDB 1YHQZ 1Y1VS 4E2YA 2VUGA 1RO2A 3IX0A 1Y1WI 3ESWA 1YIT1 2OOXB 2DE7A 2QREB 2OZKA 3D9XA 1Q7Y2 1ZB8A 1YITZ 1TFIA 1PFTA 3CCMZ 3P5JB 4MXUA 1YJW1 4MH4A 2NAPA 2J6AA 3VMGA 1NUIA 3CC2Z 3HOYI 4BXXI 1X3WA 1Y1VI 4Y7NI 1W2BZ 1VQLZ 1K8A2 1DL6A 4S1TA 4HH4A 4NBAA 2RT9A 1VQOZ 3PO2I 1VQ51 2BJOA 2F4OA 5FLXf 4DK1A 3S14I 5CM2M 5IT9f 1VQKZ 3EEDA 2VUMI 2JUBA 3CCEZ 1RQFA 3I07A 2K3RA 1YJN1 3OW2Z 1USPB 5T67A 1KQSZ 4HGZA 3GTPI 1FDOA 2QLVB 2JA6I 2PK7A 4BY7I 1M901 3I4NI 3CCR1 1TWAI 1KD12 1SFOI 4RVFA 5D1OB 3GTOI 1Q812 3CCU1 3K7AI 5FLMI 2JA7I 1QVFY 1KC82 2OTLZ 1YI2Z 3HOWI 4E31A 3PO3S 1R9TI 2P3YA 2E2II 2WAQA 1KRLA 3S1MI 3RZDI 1TWHI 2E2JI 2R92I 3CMAZ 4A3DI 2RIQA 3J80b 3CQZI 3U50C 1RO0A 1N2FA 2M48A 3CCM1 2M6NA 1M1K1 1YJ91 2B63I 2JS4A 1K8A1 3NDJA 3G6EZ 1WJ2A 4E2ZA 1VQ71 4QTTA 1Q862 4E2WA 2AYDA 2V8IA 3NH5A 3FQMA 2R6MA 2Q4ZA 2O53A 2NVYI 3IF8A 3S1RI 1Q861 3GTMI 2JA8I 1FDIA 1TWCI 3VMHA 1YUKA 3I561 4RVGA 3VMIA 2VF1A 4A3FI 2GTIA 1NJI2 1VQN1 5T64A 3GTJI 3CC21 2PM9A 1VLAA 3I56Z 2YADA 1Z01A 4BY1I 4MD9A 5IP9I 3CCJZ 1WW9A 4A3LI 4A3EI 4A3II 4BBRI 4A3MI 1I6HI 1SIWA 1YIJ1 3BG1B 5C3EI 1VQ4Z 1QVGZ 3CCRZ 4NBBA 3CD61 3M3YI 2E7ZA 4NBDA 3VB9A 3G711 2H85A 1AA6A 2IV2X 4A3JI 2DE5A 1USPA 3D2LA 3H3VJ 3G4SZ 4DQYB 1WZNA 2I3CA 2IZ3A 3S1NI 1YIJZ 2OOYB 3HOXI 2PMZA 3T4NB 3GCFA 1S7MA 2JIOA 1TWGI 1VQ5Z 1S721 1LQLA 2W03A 3M4OI 2RHBA 2WB1A 2R7ZI 3S2HI 4MD7A 4NBCA 1Q822 3TE5B 4A3CI 1P9NA 1Q16A 3KIHA 3GTQI 2KPIA 3NH8A 5T6BA 3GTLI 4NH1C 4XX2A 1S72Z 2V8KA 2V45A 3CCS1 3PO3I 3Q87A 2EGTA 3H0GI 1KQSY 5IT9b 2JIRA 3CC41 1QF8A 4RV9A 1VQ7Z 3CCUZ 3EERA 4E2XA 4NFRA 3NH4A 1JJ2Z 3JAMf 1VQ61 2V8JA 2VPZA 4A3BI 1YJ9Z 2QEXZ 1KD11 5A2Qb 3CCJ1 3VTNA 4E30A 1Q821 1NJI1 3S15I 2RBLA 2IZ4A 4A3KI 5AN9F 1N8R1 1ZB9A 2QRCB 3CCQZ 3CMEZ 4E33A 1VQPZ 2HU9A 3IFUA 3CCV1 1K9M1 3CCE1 4CL1A 4NB9A 3J81f 5FLXb 4TNUA 1VQ91 2YU9I 1YI21 4MONA 5C4XI 2QKDA 3D6WA 1JJ2Y 1X0TA 1Z03A 1QVGY 3G4S1 2JIQA 2E2HI 2HF1A 2AKLA 3CCL1 4HGYA 1WIIA 2O4HA 3NDIA 3CC71 3G71Z 3S17I 2W04A 3S2DI 1VQ6Z 1VQ41 2JIMA 4NOZA 1M902 1K9M2 4Y52I 4NB8A 1I3QI 2NVXI 3BG0B 1ML8A 3CCSZ 2LFUA 3MZLB 4RS4A 4E32A 1WCMI 3S1QI 3QWUA 3I4MI 1YHQ1 2KI7B 2LIYA 1Q811 2R93I 4NBEA 3HKZA 1VQL1 1Z02A 2JMOA 3LUSA 2GU2A 4A3GI 4NBFA 2V3VA 3CPWY 2VPWA 2ZAEB 4A93I 2QA4Z 2OTJZ 3MZKB 3GTKI 1X3ZA 3FKII 4QTUA 2QEX1 1K732 1ZH1A 3OW2Y 1VQ8Z 2OTL1 2RPRA 2VPYA 5D1OA 1YJNZ 1N8R2 2K5RA 2LEXA 1YUAA 1M1K2 3G6E1 2Q51A 3KIFA 2Y0SA 3CXCZ 5C44I 2OTJ1 5IP7I 3NFZA 4DGLA 1Y8CA 1VQNZ 3CMA1 3CCLZ 1RLYA 1QXFA 1NP6A 2NVQI 5D1PA 3I55Z 1W2BY 2GTHA 1I50I 4NBHA 4RVHA 3GTMS 3GTGI 4RVDA 2F4MA 3HOUI 3J7A4 4MD8A 1RO4A 3FQQA 1K731 1QYPA 2P28A 3RZOI 5LL6f 3CCVZ 1RNIA 1JWHC 3J81b 2NVTI 1VQ81 3MONA 2DE6A 4AYBA 2VPXA 3CC7Z 1YJWZ 2JIPA 2JNYA 2G2KA 3CD6Z 2QR1B 3HOZI 5A2Qf 1KC81 1K83I 3CXCY 4BBSI 2JA5I 4EWCA 3CC4Z 3JAMb 1VQM1
chains in the Genus database with same CATH topology
1L1OC 3TDHB 1VQK1 3GKQA 1QVFZ 1TWFI 2JR6A 4MRIA 1VQO1 3S16I 4X6AI 2QA41 1VQMZ 1Q7Y1 1VQ9Z 3F3FC 5C4JI 2E9HA 3I551 3HOVI 4NBGA 3CME1 3CPWZ 3CCQ1 1VQP1 3J80f 3F3PC 2QRDB 1YHQZ 1Y1VS 4E2YA 2VUGA 1RO2A 3IX0A 1Y1WI 3ESWA 1YIT1 2OOXB 2DE7A 2QREB 2OZKA 3D9XA 1Q7Y2 1ZB8A 1YITZ 1TFIA 1PFTA 3CCMZ 3P5JB 4MXUA 1YJW1 4MH4A 2J6AA 3VMGA 1NUIA 3CC2Z 3HOYI 4BXXI 1X3WA 1Y1VI 4Y7NI 1W2BZ 1VQLZ 1K8A2 1DL6A 4S1TA 4HH4A 4NBAA 2RT9A 1VQOZ 3PO2I 1VQ51 2BJOA 2F4OA 5FLXf 4DK1A 3S14I 5CM2M 5IT9f 1VQKZ 3EEDA 2VUMI 2JUBA 3CCEZ 1RQFA 3I07A 2K3RA 1YJN1 3OW2Z 1USPB 5T67A 1KQSZ 4HGZA 3GTPI 2QLVB 2JA6I 2PK7A 4BY7I 1M901 3I4NI 3CCR1 1TWAI 1KD12 1SFOI 4RVFA 5D1OB 3GTOI 1Q812 3CCU1 3K7AI 5FLMI 2JA7I 1QVFY 1KC82 2OTLZ 1YI2Z 3HOWI 4E31A 3PO3S 1R9TI 2P3YA 2E2II 2WAQA 1KRLA 3S1MI 3RZDI 1TWHI 2E2JI 2R92I 3CMAZ 4A3DI 2RIQA 3J80b 3CQZI 3U50C 1RO0A 1N2FA 2M48A 3CCM1 2M6NA 1M1K1 1YJ91 2B63I 2JS4A 1K8A1 3NDJA 3G6EZ 4E2ZA 1VQ71 4QTTA 1Q862 2V8IA 4E2WA 3NH5A 3FQMA 2R6MA 2Q4ZA 2O53A 2NVYI 3IF8A 3S1RI 1Q861 3GTMI 2JA8I 1TWCI 3VMHA 1YUKA 3I561 4RVGA 3VMIA 2VF1A 4A3FI 2GTIA 1NJI2 1VQN1 5T64A 3GTJI 3CC21 2PM9A 1VLAA 3I56Z 2YADA 1Z01A 4BY1I 4MD9A 5IP9I 3CCJZ 1WW9A 4A3LI 4A3EI 4A3II 4BBRI 4A3MI 1I6HI 1YIJ1 3BG1B 5C3EI 1VQ4Z 1QVGZ 3CCRZ 4NBBA 3CD61 3M3YI 4NBDA 3VB9A 3G711 2H85A 4A3JI 2DE5A 1USPA 3H3VJ 3G4SZ 4DQYB 2I3CA 2IZ3A 3S1NI 1YIJZ 2OOYB 3HOXI 2PMZA 3T4NB 3GCFA 1S7MA 1TWGI 1VQ5Z 1S721 1LQLA 2W03A 3M4OI 2RHBA 2WB1A 2R7ZI 3S2HI 4MD7A 4NBCA 1Q822 3TE5B 4A3CI 1P9NA 3KIHA 3GTQI 2KPIA 3NH8A 5T6BA 3GTLI 4NH1C 4XX2A 1S72Z 2V8KA 3CCS1 3PO3I 3Q87A 2EGTA 3H0GI 1KQSY 5IT9b 3CC41 1QF8A 4RV9A 1VQ7Z 3CCUZ 3EERA 4E2XA 4NFRA 3NH4A 1JJ2Z 3JAMf 1VQ61 2V8JA 4A3BI 1YJ9Z 2QEXZ 1KD11 5A2Qb 3CCJ1 3VTNA 4E30A 1Q821 1NJI1 3S15I 2RBLA 2IZ4A 4A3KI 5AN9F 1N8R1 1ZB9A 2QRCB 3CCQZ 3CMEZ 4E33A 1VQPZ 2HU9A 3IFUA 3CCV1 1K9M1 3CCE1 4CL1A 4NB9A 3J81f 5FLXb 4TNUA 1VQ91 2YU9I 1YI21 4MONA 5C4XI 2QKDA 3D6WA 1JJ2Y 1X0TA 1Z03A 1QVGY 3G4S1 2E2HI 2HF1A 2AKLA 3CCL1 4HGYA 1WIIA 2O4HA 3NDIA 3CC71 3G71Z 3S17I 2W04A 3S2DI 1VQ6Z 1VQ41 4NOZA 1M902 1K9M2 4Y52I 4NB8A 1I3QI 2NVXI 3BG0B 1ML8A 3CCSZ 2LFUA 3MZLB 4RS4A 4E32A 1WCMI 3S1QI 3QWUA 3I4MI 1YHQ1 2KI7B 2LIYA 1Q811 2R93I 4NBEA 3HKZA 1VQL1 1Z02A 2JMOA 3LUSA 2GU2A 4A3GI 4NBFA 3CPWY 2ZAEB 4A93I 2QA4Z 2OTJZ 3MZKB 3GTKI 1X3ZA 3FKII 4QTUA 2QEX1 1K732 1ZH1A 3OW2Y 1VQ8Z 2OTL1 2RPRA 5D1OA 1YJNZ 1N8R2 2K5RA 1YUAA 1M1K2 3G6E1 2Q51A 3KIFA 2Y0SA 3CXCZ 5C44I 2OTJ1 5IP7I 3NFZA 4DGLA 1VQNZ 3CMA1 3CCLZ 1RLYA 1NP6A 2NVQI 5D1PA 3I55Z 1W2BY 2GTHA 1I50I 4NBHA 4RVHA 3GTMS 3GTGI 4RVDA 2F4MA 3HOUI 3J7A4 4MD8A 1RO4A 3FQQA 1K731 1QYPA 2P28A 3RZOI 5LL6f 3CCVZ 1JWHC 1RNIA 3J81b 2NVTI 1VQ81 3MONA 2DE6A 4AYBA 3CC7Z 1YJWZ 2JNYA 2G2KA 3CD6Z 2QR1B 3HOZI 5A2Qf 1KC81 1K83I 3CXCY 4BBSI 2JA5I 4EWCA 3CC4Z 3JAMb 1VQM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  3GKQ A;  1WCM I;  1TWG I;  3HOW I;  3S1Q I;  1TWF I;  2JR6 A;  3S16 I;  3I4M I;  4X6A I;  3PO3 S;  1R9T I;  2R93 I;  4NBE A;  1LQL A;  3M4O I;  5C4J I;  2P3Y A;  3HOV I;  2E2I I;  4NBG A;  3LUS A;  3S1M I;  2R7Z I;  4NBF A;  3S2H I;  3RZD I;  4NBC A;  4A3G I;  1TWH I;  2E2J I;  2R92 I;  4A3C I;  4A3D I;  3CQZ I;  3U50 C;  3GTQ I;  2KPI A;  4A93 I;  1Y1V S;  3GTL I;  4XX2 A;  1N2F A;  3GTK I;  1X3Z A;  3FKI I;  4QTU A;  2B63 I;  2JS4 A;  1Y1W I;  3PO3 I;  3ESW A;  3Q87 A;  3H0G I;  2DE7 A;  4QTT A;  2K5R A;  1YUA A;  3EER A;  1ZB8 A;  2NVY I;  1TFI A;  3S1R I;  1PFT A;  3GTM I;  4A3B I;  2JA8 I;  5C44 I;  1TWC I;  3VMH A;  5IP7 I;  4MH4 A;  2J6A A;  3VMG A;  1NUI A;  3S15 I;  3VMI A;  2RBL A;  3HOY I;  4A3K I;  1ZB9 A;  4BXX I;  1X3W A;  1RLY A;  1Y1V I;  4Y7N I;  4A3F I;  2NVQ I;  1DL6 A;  3GTJ I;  1I50 I;  4NBH A;  3GTM S;  3GTG I;  1VLA A;  4NB9 A;  4BY1 I;  2F4M A;  4NBA A;  5IP9 I;  2YU9 I;  3HOU I;  1WW9 A;  4A3L I;  3PO2 I;  1RO4 A;  2BJO A;  4A3E I;  2F4O A;  5C4X I;  1QYP A;  3S14 I;  4A3I I;  5CM2 M;  4BBR I;  3RZO I;  2VUM I;  3D6W A;  4A3M I;  1I6H I;  3I07 A;  2E2H I;  2NVT I;  2HF1 A;  5C3E I;  1USP B;  2AKL A;  4NBB A;  3M3Y I;  3GTP I;  2DE6 A;  4NBD A;  3VB9 A;  3S17 I;  2JA6 I;  3S2D I;  2PK7 A;  4BY7 I;  2JNY A;  4A3J I;  3I4N I;  2DE5 A;  1USP A;  1TWA I;  3HOZ I;  1SFO I;  1K83 I;  3H3V J;  3GTO I;  4NOZ A;  4Y52 I;  4NB8 A;  3S1N I;  4BBS I;  2JA5 I;  1I3Q I;  3K7A I;  2NVX I;  3HOX I;  5FLM I;  2JA7 I;  3GCF A;  1ML8 A; 
#chains in the Genus database with same CATH topology
 1L1O C;  3TDH B;  1VQK 1;  3IR7 A;  3GKQ A;  1QVF Z;  1TWF I;  2JR6 A;  4MRI A;  1VQO 1;  3S16 I;  4X6A I;  2QA4 1;  1VQM Z;  1Q7Y 1;  1VQ9 Z;  3F3F C;  5C4J I;  2E9H A;  3I55 1;  3HOV I;  4NBG A;  3CME 1;  3CPW Z;  3CCQ 1;  1VQP 1;  3J80 f;  3F3P C;  2QRD B;  1YHQ Z;  1Y1V S;  4E2Y A;  2VUG A;  1RO2 A;  3IX0 A;  1Y1W I;  3ESW A;  1YIT 1;  2OOX B;  2DE7 A;  2QRE B;  2OZK A;  3D9X A;  1Q7Y 2;  1ZB8 A;  1YIT Z;  1TFI A;  1PFT A;  3CCM Z;  3P5J B;  4MXU A;  1YJW 1;  4MH4 A;  2NAP A;  2J6A A;  3VMG A;  1NUI A;  3CC2 Z;  3HOY I;  4BXX I;  1X3W A;  1Y1V I;  4Y7N I;  1W2B Z;  1VQL Z;  1K8A 2;  1DL6 A;  4S1T A;  4HH4 A;  4NBA A;  2RT9 A;  1VQO Z;  3PO2 I;  1VQ5 1;  2BJO A;  2F4O A;  5FLX f;  4DK1 A;  3S14 I;  5CM2 M;  5IT9 f;  1VQK Z;  3EED A;  2VUM I;  2JUB A;  3CCE Z;  1RQF A;  3I07 A;  2K3R A;  1YJN 1;  3OW2 Z;  1USP B;  5T67 A;  1KQS Z;  4HGZ A;  3GTP I;  1FDO A;  2QLV B;  2JA6 I;  2PK7 A;  4BY7 I;  1M90 1;  3I4N I;  3CCR 1;  1TWA I;  1KD1 2;  1SFO I;  4RVF A;  5D1O B;  3GTO I;  1Q81 2;  3CCU 1;  3K7A I;  5FLM I;  2JA7 I;  1QVF Y;  1KC8 2;  2OTL Z;  1YI2 Z;  3HOW I;  4E31 A;  3PO3 S;  1R9T I;  2P3Y A;  2E2I I;  2WAQ A;  1KRL A;  3S1M I;  3RZD I;  1TWH I;  2E2J I;  2R92 I;  3CMA Z;  4A3D I;  2RIQ A;  3J80 b;  3CQZ I;  3U50 C;  1RO0 A;  1N2F A;  2M48 A;  3CCM 1;  2M6N A;  1M1K 1;  1YJ9 1;  2B63 I;  2JS4 A;  1K8A 1;  3NDJ A;  3G6E Z;  1WJ2 A;  4E2Z A;  1VQ7 1;  4QTT A;  1Q86 2;  4E2W A;  2AYD A;  2V8I A;  3NH5 A;  3FQM A;  2R6M A;  2Q4Z A;  2O53 A;  2NVY I;  3IF8 A;  3S1R I;  1Q86 1;  3GTM I;  2JA8 I;  1FDI A;  1TWC I;  3VMH A;  1YUK A;  3I56 1;  4RVG A;  3VMI A;  2VF1 A;  4A3F I;  2GTI A;  1NJI 2;  1VQN 1;  5T64 A;  3GTJ I;  3CC2 1;  2PM9 A;  1VLA A;  3I56 Z;  2YAD A;  1Z01 A;  4BY1 I;  4MD9 A;  5IP9 I;  3CCJ Z;  1WW9 A;  4A3L I;  4A3E I;  4A3I I;  4BBR I;  4A3M I;  1I6H I;  1SIW A;  1YIJ 1;  3BG1 B;  5C3E I;  1VQ4 Z;  1QVG Z;  3CCR Z;  4NBB A;  3CD6 1;  3M3Y I;  2E7Z A;  4NBD A;  3VB9 A;  3G71 1;  2H85 A;  1AA6 A;  2IV2 X;  4A3J I;  2DE5 A;  1USP A;  3D2L A;  3H3V J;  3G4S Z;  4DQY B;  1WZN A;  2I3C A;  2IZ3 A;  3S1N I;  1YIJ Z;  2OOY B;  3HOX I;  2PMZ A;  3T4N B;  3GCF A;  1S7M A;  2JIO A;  1TWG I;  1VQ5 Z;  1S72 1;  1LQL A;  2W03 A;  3M4O I;  2RHB A;  2WB1 A;  2R7Z I;  3S2H I;  4MD7 A;  4NBC A;  1Q82 2;  3TE5 B;  4A3C I;  1P9N A;  1Q16 A;  3KIH A;  3GTQ I;  2KPI A;  3NH8 A;  5T6B A;  3GTL I;  4NH1 C;  4XX2 A;  1S72 Z;  2V8K A;  2V45 A;  3CCS 1;  3PO3 I;  3Q87 A;  2EGT A;  3H0G I;  1KQS Y;  5IT9 b;  2JIR A;  3CC4 1;  1QF8 A;  4RV9 A;  1VQ7 Z;  3CCU Z;  3EER A;  4E2X A;  4NFR A;  3NH4 A;  1JJ2 Z;  3JAM f;  1VQ6 1;  2V8J A;  2VPZ A;  4A3B I;  1YJ9 Z;  2QEX Z;  1KD1 1;  5A2Q b;  3CCJ 1;  3VTN A;  4E30 A;  1Q82 1;  1NJI 1;  3S15 I;  2RBL A;  2IZ4 A;  4A3K I;  5AN9 F;  1N8R 1;  1ZB9 A;  2QRC B;  3CCQ Z;  3CME Z;  4E33 A;  1VQP Z;  2HU9 A;  3IFU A;  3CCV 1;  1K9M 1;  3CCE 1;  4CL1 A;  4NB9 A;  3J81 f;  5FLX b;  4TNU A;  1VQ9 1;  2YU9 I;  1YI2 1;  4MON A;  5C4X I;  2QKD A;  3D6W A;  1JJ2 Y;  1X0T A;  1Z03 A;  1QVG Y;  3G4S 1;  2JIQ A;  2E2H I;  2HF1 A;  2AKL A;  3CCL 1;  4HGY A;  1WII A;  2O4H A;  3NDI A;  3CC7 1;  3G71 Z;  3S17 I;  2W04 A;  3S2D I;  1VQ6 Z;  1VQ4 1;  2JIM A;  4NOZ A;  1M90 2;  1K9M 2;  4Y52 I;  4NB8 A;  1I3Q I;  2NVX I;  3BG0 B;  1ML8 A;  3CCS Z;  2LFU A;  3MZL B;  4RS4 A;  4E32 A;  1WCM I;  3S1Q I;  3QWU A;  3I4M I;  1YHQ 1;  2KI7 B;  2LIY A;  1Q81 1;  2R93 I;  4NBE A;  3HKZ A;  1VQL 1;  1Z02 A;  2JMO A;  3LUS A;  2GU2 A;  4A3G I;  4NBF A;  2V3V A;  3CPW Y;  2VPW A;  2ZAE B;  4A93 I;  2QA4 Z;  2OTJ Z;  3MZK B;  3GTK I;  1X3Z A;  3FKI I;  4QTU A;  2QEX 1;  1K73 2;  1ZH1 A;  3OW2 Y;  1VQ8 Z;  2OTL 1;  2RPR A;  2VPY A;  5D1O A;  1YJN Z;  1N8R 2;  2K5R A;  2LEX A;  1YUA A;  1M1K 2;  3G6E 1;  2Q51 A;  3KIF A;  2Y0S A;  3CXC Z;  5C44 I;  2OTJ 1;  5IP7 I;  3NFZ A;  4DGL A;  1Y8C A;  1VQN Z;  3CMA 1;  3CCL Z;  1RLY A;  1QXF A;  1NP6 A;  2NVQ I;  5D1P A;  3I55 Z;  1W2B Y;  2GTH A;  1I50 I;  4NBH A;  4RVH A;  3GTM S;  3GTG I;  4RVD A;  2F4M A;  3HOU I;  3J7A 4;  4MD8 A;  1RO4 A;  3FQQ A;  1K73 1;  1QYP A;  2P28 A;  3RZO I;  5LL6 f;  3CCV Z;  1RNI A;  1JWH C;  3J81 b;  2NVT I;  1VQ8 1;  3MON A;  2DE6 A;  4AYB A;  2VPX A;  3CC7 Z;  1YJW Z;  2JIP A;  2JNY A;  2G2K A;  3CD6 Z;  2QR1 B;  3HOZ I;  5A2Q f;  1KC8 1;  1K83 I;  3CXC Y;  4BBS I;  2JA5 I;  4EWC A;  3CC4 Z;  3JAM b;  1VQM 1; 
#chains in the Genus database with same CATH homology
 1L1O C;  3TDH B;  1VQK 1;  3GKQ A;  1QVF Z;  1TWF I;  2JR6 A;  4MRI A;  1VQO 1;  3S16 I;  4X6A I;  2QA4 1;  1VQM Z;  1Q7Y 1;  1VQ9 Z;  3F3F C;  5C4J I;  2E9H A;  3I55 1;  3HOV I;  4NBG A;  3CME 1;  3CPW Z;  3CCQ 1;  1VQP 1;  3J80 f;  3F3P C;  2QRD B;  1YHQ Z;  1Y1V S;  4E2Y A;  2VUG A;  1RO2 A;  3IX0 A;  1Y1W I;  3ESW A;  1YIT 1;  2OOX B;  2DE7 A;  2QRE B;  2OZK A;  3D9X A;  1Q7Y 2;  1ZB8 A;  1YIT Z;  1TFI A;  1PFT A;  3CCM Z;  3P5J B;  4MXU A;  1YJW 1;  4MH4 A;  2J6A A;  3VMG A;  1NUI A;  3CC2 Z;  3HOY I;  4BXX I;  1X3W A;  1Y1V I;  4Y7N I;  1W2B Z;  1VQL Z;  1K8A 2;  1DL6 A;  4S1T A;  4HH4 A;  4NBA A;  2RT9 A;  1VQO Z;  3PO2 I;  1VQ5 1;  2BJO A;  2F4O A;  5FLX f;  4DK1 A;  3S14 I;  5CM2 M;  5IT9 f;  1VQK Z;  3EED A;  2VUM I;  2JUB A;  3CCE Z;  1RQF A;  3I07 A;  2K3R A;  1YJN 1;  3OW2 Z;  1USP B;  5T67 A;  1KQS Z;  4HGZ A;  3GTP I;  2QLV B;  2JA6 I;  2PK7 A;  4BY7 I;  1M90 1;  3I4N I;  3CCR 1;  1TWA I;  1KD1 2;  1SFO I;  4RVF A;  5D1O B;  3GTO I;  1Q81 2;  3CCU 1;  3K7A I;  5FLM I;  2JA7 I;  1QVF Y;  1KC8 2;  2OTL Z;  1YI2 Z;  3HOW I;  4E31 A;  3PO3 S;  1R9T I;  2P3Y A;  2E2I I;  2WAQ A;  1KRL A;  3S1M I;  3RZD I;  1TWH I;  2E2J I;  2R92 I;  3CMA Z;  4A3D I;  2RIQ A;  3J80 b;  3CQZ I;  3U50 C;  1RO0 A;  1N2F A;  2M48 A;  3CCM 1;  2M6N A;  1M1K 1;  1YJ9 1;  2B63 I;  2JS4 A;  1K8A 1;  3NDJ A;  3G6E Z;  4E2Z A;  1VQ7 1;  4QTT A;  1Q86 2;  2V8I A;  4E2W A;  3NH5 A;  3FQM A;  2R6M A;  2Q4Z A;  2O53 A;  2NVY I;  3IF8 A;  3S1R I;  1Q86 1;  3GTM I;  2JA8 I;  1TWC I;  3VMH A;  1YUK A;  3I56 1;  4RVG A;  3VMI A;  2VF1 A;  4A3F I;  2GTI A;  1NJI 2;  1VQN 1;  5T64 A;  3GTJ I;  3CC2 1;  2PM9 A;  1VLA A;  3I56 Z;  2YAD A;  1Z01 A;  4BY1 I;  4MD9 A;  5IP9 I;  3CCJ Z;  1WW9 A;  4A3L I;  4A3E I;  4A3I I;  4BBR I;  4A3M I;  1I6H I;  1YIJ 1;  3BG1 B;  5C3E I;  1VQ4 Z;  1QVG Z;  3CCR Z;  4NBB A;  3CD6 1;  3M3Y I;  4NBD A;  3VB9 A;  3G71 1;  2H85 A;  4A3J I;  2DE5 A;  1USP A;  3H3V J;  3G4S Z;  4DQY B;  2I3C A;  2IZ3 A;  3S1N I;  1YIJ Z;  2OOY B;  3HOX I;  2PMZ A;  3T4N B;  3GCF A;  1S7M A;  1TWG I;  1VQ5 Z;  1S72 1;  1LQL A;  2W03 A;  3M4O I;  2RHB A;  2WB1 A;  2R7Z I;  3S2H I;  4MD7 A;  4NBC A;  1Q82 2;  3TE5 B;  4A3C I;  1P9N A;  3KIH A;  3GTQ I;  2KPI A;  3NH8 A;  5T6B A;  3GTL I;  4NH1 C;  4XX2 A;  1S72 Z;  2V8K A;  3CCS 1;  3PO3 I;  3Q87 A;  2EGT A;  3H0G I;  1KQS Y;  5IT9 b;  3CC4 1;  1QF8 A;  4RV9 A;  1VQ7 Z;  3CCU Z;  3EER A;  4E2X A;  4NFR A;  3NH4 A;  1JJ2 Z;  3JAM f;  1VQ6 1;  2V8J A;  4A3B I;  1YJ9 Z;  2QEX Z;  1KD1 1;  5A2Q b;  3CCJ 1;  3VTN A;  4E30 A;  1Q82 1;  1NJI 1;  3S15 I;  2RBL A;  2IZ4 A;  4A3K I;  5AN9 F;  1N8R 1;  1ZB9 A;  2QRC B;  3CCQ Z;  3CME Z;  4E33 A;  1VQP Z;  2HU9 A;  3IFU A;  3CCV 1;  1K9M 1;  3CCE 1;  4CL1 A;  4NB9 A;  3J81 f;  5FLX b;  4TNU A;  1VQ9 1;  2YU9 I;  1YI2 1;  4MON A;  5C4X I;  2QKD A;  3D6W A;  1JJ2 Y;  1X0T A;  1Z03 A;  1QVG Y;  3G4S 1;  2E2H I;  2HF1 A;  2AKL A;  3CCL 1;  4HGY A;  1WII A;  2O4H A;  3NDI A;  3CC7 1;  3G71 Z;  3S17 I;  2W04 A;  3S2D I;  1VQ6 Z;  1VQ4 1;  4NOZ A;  1M90 2;  1K9M 2;  4Y52 I;  4NB8 A;  1I3Q I;  2NVX I;  3BG0 B;  1ML8 A;  3CCS Z;  2LFU A;  3MZL B;  4RS4 A;  4E32 A;  1WCM I;  3S1Q I;  3QWU A;  3I4M I;  1YHQ 1;  2KI7 B;  2LIY A;  1Q81 1;  2R93 I;  4NBE A;  3HKZ A;  1VQL 1;  1Z02 A;  2JMO A;  3LUS A;  2GU2 A;  4A3G I;  4NBF A;  3CPW Y;  2ZAE B;  4A93 I;  2QA4 Z;  2OTJ Z;  3MZK B;  3GTK I;  1X3Z A;  3FKI I;  4QTU A;  2QEX 1;  1K73 2;  1ZH1 A;  3OW2 Y;  1VQ8 Z;  2OTL 1;  2RPR A;  5D1O A;  1YJN Z;  1N8R 2;  2K5R A;  1YUA A;  1M1K 2;  3G6E 1;  2Q51 A;  3KIF A;  2Y0S A;  3CXC Z;  5C44 I;  2OTJ 1;  5IP7 I;  3NFZ A;  4DGL A;  1VQN Z;  3CMA 1;  3CCL Z;  1RLY A;  1NP6 A;  2NVQ I;  5D1P A;  3I55 Z;  1W2B Y;  2GTH A;  1I50 I;  4NBH A;  4RVH A;  3GTM S;  3GTG I;  4RVD A;  2F4M A;  3HOU I;  3J7A 4;  4MD8 A;  1RO4 A;  3FQQ A;  1K73 1;  1QYP A;  2P28 A;  3RZO I;  5LL6 f;  3CCV Z;  1JWH C;  1RNI A;  3J81 b;  2NVT I;  1VQ8 1;  3MON A;  2DE6 A;  4AYB A;  3CC7 Z;  1YJW Z;  2JNY A;  2G2K A;  3CD6 Z;  2QR1 B;  3HOZ I;  5A2Q f;  1KC8 1;  1K83 I;  3CXC Y;  4BBS I;  2JA5 I;  4EWC A;  3CC4 Z;  3JAM b;  1VQM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...