1TWAI

Rna polymerase ii complexed with atp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI02
5IP9I 1K83I 2JA6I 3FKII 4A3GI 3S1RI 2KPIA 1PFTA 2PK7A 4A3MI 2DE6A 4Y52I 3D6WA 3GTGI 3GTQI 2NVQI 1N2FA 1L1OC 4A3LI 1X3ZA 3I07A 4A93I 3S1MI 1WCMI 3HOVI 2YU9I 3S17I 5C44I 2J6AA 4BBRI 4QTUA 2JA8I 2F4OA 5C3EI 4NBFA 3K7AI 2DE7A 3GKQA 4BXXI 3HOYI 3CQZI 2B63I 4A3FI 1ML8A 3GTKI 1TWAI 2R93I 3PO3S 3S15I 3S14I 5C4XI 3Q87A 1ZB8A 4NOZA 5FLMI 2R7ZI 4BBSI 2E2II 1QYPA 4A3DI 1TFIA 4Y7NI 3S1QI 1SFOI 2HF1A 1TWCI 4NB9A 2DE5A 4NB8A 3LUSA 3GTMI 4A3JI 2JA5I 1TWGI 3U50C 3S2DI 3HOZI 3GTMS 3HOWI 3S1NI 2BJOA 1VLAA 3I4MI 5C4JI 1LQLA 3PO3I 1RO4A 3GTPI 4A3EI 5IP7I 3VMGA 1RLYA 3H0GI 2K5RA 2JS4A 3M3YI 4MH4A 2F4MA 2NVXI 2JR6A 4X6AI 3RZOI 4NBGA 4XX2A 3GTOI 3S2HI 2AKLA 2NVYI 4NBEA 2JA7I 1X3WA 4A3CI 2E2HI 1I3QI 3M4OI 3EERA 4QTTA 4NBBA 2R92I 1Y1WI 3S16I 1USPB 4NBHA 1NUIA 3VMIA 4A3BI 4BY1I 3VMHA 1I6HI 2VUMI 1TWHI 1WW9A 3HOXI 3GCFA 3ESWA 3HOUI 3GTLI 2RBLA 2E2JI 2P3YA 3I4NI 2JNYA 1I50I 1R9TI 5CM2M 3VB9A 3PO2I 4BY7I 1Y1VI 1TWFI 1ZB9A 3GTJI 2NVTI 4NBAA 1USPA 4A3II 1Y1VS 4NBDA 4A3KI 3RZDI 3H3VJ 1DL6A 4NBCA 1YUAA
chains in the Genus database with same CATH superfamily
5IP9I 1M902 1K83I 2QRCB 1YITZ 2V8KA 1RO2A 1VQO1 2JIQA 3JAMb 1X3ZA 5D1OB 2W04A 4MRIA 1WCMI 1Q16A 1W2BZ 5AN9F 4MD9A 2J6AA 1VQ51 3MONA 2F4OA 5IT9f 2KI7B 2OOYB 1VQ5Z 3HOYI 1VQ61 2R93I 2VPYA 3J7A4 3PO3S 3I551 3S14I 1ZB8A 4A3DI 3I55Z 3CME1 1SIWA 3MZLB 3CMEZ 3S1NI 1KC81 1VLAA 2IZ3A 3PO3I 3MZKB 3GTPI 4A3EI 3VMGA 2K5RA 4EWCA 2JS4A 1Z02A 4MH4A 3CD61 3CC41 3G4S1 4NBGA 3GTOI 1VQ81 3CD6Z 3CCV1 3CC4Z 3G4SZ 3CPWY 3TDHB 2QLVB 1YI21 3OW2Y 2R6MA 3NH5A 1YI2Z 1USPB 3VMIA 4BY1I 3VMHA 2G2KA 5T6BA 3HOXI 3CC2Z 1K732 3GCFA 3ESWA 2P28A 1S721 2OZKA 4RVHA 2RIQA 5A2Qb 3CCU1 5CM2M 1S72Z 1K9M1 1WJ2A 4BY7I 5T67A 1ZB9A 1QVGY 3CCUZ 4DQYB 4RS4A 2LEXA 1Y1VS 3F3FC 2E9HA 1Z01A 4RVGA 2RPRA 4A3GI 1W2BY 4A3MI 2DE6A 3D6WA 1AA6A 3GTQI 3G6E1 1Y8CA 1WZNA 4A93I 3S1MI 4AYBA 2VF1A 3G6EZ 1VQ41 4QTUA 3J80b 4NBFA 3K7AI 2DE7A 2OTL1 5T64A 3GKQA 1KQSY 4RVDA 2RT9A 4A3FI 1QVGZ 3IF8A 2O53A 3CCJZ 5C4XI 4NOZA 1RNIA 5FLMI 1K8A2 3S1QI 2E7ZA 1P9NA 3CCL1 1NJI2 1VQOZ 2DE5A 3LUSA 1N8R2 2JA5I 1TWGI 3FQQA 2VUGA 3U50C 3J81b 4E2XA 3NDIA 1KD11 3HOWI 3BG1B 2V8JA 2K3RA 2Y0SA 1Q7Y1 3NH4A 2JIMA 5IP7I 1Z03A 4E2WA 1VQ6Z 2QREB 3P5JB 3CXCY 3F3PC 1YJW1 2JR6A 3RZOI 2LIYA 1KQSZ 3S2HI 1YJWZ 2AKLA 2NVYI 2JA7I 1Q862 4A3CI 1Q821 2E2HI 1VQK1 2O4HA 2V45A 4NBBA 3TE5B 1Y1WI 1VQKZ 4A3BI 4E2YA 4CL1A 1JWHC 2M48A 3T4NB 3GTLI 1QVFZ 4HGYA 2P3YA 3KIHA 1VQP1 4E2ZA 2HU9A 2VPZA 1M901 3VB9A 2NAPA 1TWFI 1VQ91 3GTJI 1VQ8Z 1VQPZ 1RQFA 3CXCZ 3CCVZ 5IT9b 3CMA1 1VQ9Z 4NBDA 4A3KI 1K8A1 4NBCA 1YUKA 3CMAZ 4DK1A 2JA6I 2M6NA 3FKII 3S1RI 2KPIA 1PFTA 2PK7A 4MD8A 4Y52I 3IR7A 1Q812 1N2FA 2QA41 1L1OC 3FQMA 2W03A 3S17I 4TNUA 5C44I 2QA4Z 2QRDB 1X0TA 4HGZA 4DGLA 2JA8I 5C3EI 2IZ4A 2QR1B 2GTHA 3CQZI 2I3CA 3CCE1 1ML8A 3CCS1 1WIIA 2AYDA 3Q87A 3CCEZ 3CCSZ 2OTJ1 3I561 4BBSI 2E2II 5D1OA 1QYPA 3NFZA 1M1K2 2JIPA 4Y7NI 3JAMf 2OTJZ 3IX0A 2HF1A 1TWCI 1VQL1 1RO0A 3G711 3GTMI 4A3JI 2WB1A 2V3VA 2VPWA 1VQLZ 3G71Z 1VQ4Z 3HOZI 1VQN1 3I4MI 1LQLA 4E30A 1QXFA 2PMZA 2OTLZ 2RHBA 1VQNZ 2GU2A 2JMOA 3CCR1 2F4MA 4X6AI 4XX2A 1KC82 3CCRZ 2ZAEB 1NP6A 4NBEA 1S7MA 1X3WA 1K731 1I3QI 3CCLZ 3EERA 1Q811 4QTTA 2R92I 1QVFY 1NUIA 5FLXb 4HH4A 2VUMI 1TWHI 1WW9A 3NDJA 2WAQA 3CCQ1 4MONA 2E2JI 4MXUA 3CCQZ 2JNYA 1I50I 3PO2I 4NBAA 1USPA 3RZDI 3H3VJ 1M1K1 1VQ71 3HKZA 3NH8A 1K9M2 1VQ7Z 3CC71 4E31A 1KRLA 3CC7Z 3GTGI 2NVQI 4A3LI 3I07A 5A2Qf 3HOVI 2YU9I 5LL6f 4BBRI 2JUBA 1QF8A 4BXXI 1YIJ1 1NJI1 2B63I 1VQM1 3GTKI 1TWAI 1N8R1 1ZH1A 2JIRA 3QWUA 1YIJZ 3S15I 1YHQ1 1VQMZ 5D1PA 2R7ZI 1YJN1 1TFIA 4E32A 1JJ2Y 1YHQZ 1SFOI 1FDIA 1YJNZ 4NH1C 4NB9A 3VTNA 4NB8A 3D9XA 2PM9A 3J80f 3S2DI 1YJ91 3CC21 3GTMS 2BJOA 2QEX1 3D2LA 5C4JI 1RO4A 2V8IA 1YJ9Z 1Q861 4MD7A 1RLYA 3H0GI 2QEXZ 3M3YI 4RVFA 2NVXI 1KD12 2YADA 1Q7Y2 4NFRA 2QKDA 3KIFA 3I56Z 2LFUA 4S1TA 2H85A 2IV2X 3M4OI 4RV9A 3J81f 3S16I 4NBHA 5FLXf 3CPWZ 1JJ2Z 2EGTA 1I6HI 2OOXB 1FDOA 2GTIA 3CCM1 3OW2Z 3BG0B 1Q822 3HOUI 3CCMZ 4E33A 2RBLA 3I4NI 3IFUA 3EEDA 1R9TI 2JIOA 1Y1VI 2NVTI 2Q51A 2Q4ZA 4A3II 1DL6A 2VPXA 3CCJ1 1YUAA 1YIT1
chains in the Genus database with same CATH topology
5IP9I 1M902 1K83I 2QRCB 1YITZ 2V8KA 1RO2A 1VQO1 3JAMb 1X3ZA 5D1OB 2W04A 4MRIA 1WCMI 1W2BZ 5AN9F 4MD9A 2J6AA 1VQ51 3MONA 2F4OA 5IT9f 2KI7B 2OOYB 1VQ5Z 3HOYI 1VQ61 2R93I 3J7A4 3PO3S 3I551 3S14I 1ZB8A 4A3DI 3I55Z 3CME1 3MZLB 3CMEZ 3S1NI 1KC81 1VLAA 2IZ3A 3PO3I 3MZKB 3GTPI 4A3EI 3VMGA 2K5RA 4EWCA 2JS4A 1Z02A 4MH4A 3CD61 3CC41 3G4S1 4NBGA 3GTOI 1VQ81 3CD6Z 3CCV1 3CC4Z 3G4SZ 3CPWY 3TDHB 2QLVB 1YI21 3OW2Y 2R6MA 3NH5A 1YI2Z 1USPB 3VMIA 4BY1I 3VMHA 2G2KA 5T6BA 3HOXI 3CC2Z 1K732 3GCFA 3ESWA 2P28A 1S721 2OZKA 4RVHA 2RIQA 5A2Qb 3CCU1 5CM2M 1S72Z 1K9M1 4BY7I 5T67A 1ZB9A 1QVGY 3CCUZ 4DQYB 4RS4A 1Y1VS 3F3FC 2E9HA 1Z01A 4RVGA 2RPRA 4A3GI 1W2BY 4A3MI 2DE6A 3D6WA 3GTQI 3G6E1 4A93I 3S1MI 4AYBA 2VF1A 3G6EZ 1VQ41 4QTUA 3J80b 4NBFA 3K7AI 2DE7A 2OTL1 5T64A 3GKQA 1KQSY 4RVDA 2RT9A 4A3FI 1QVGZ 3IF8A 2O53A 3CCJZ 5C4XI 4NOZA 1RNIA 5FLMI 1K8A2 3S1QI 1P9NA 3CCL1 1NJI2 1VQOZ 2DE5A 3LUSA 1N8R2 2JA5I 1TWGI 3FQQA 2VUGA 3U50C 3J81b 4E2XA 3NDIA 1KD11 3HOWI 3BG1B 2V8JA 2K3RA 2Y0SA 1Q7Y1 3NH4A 5IP7I 1Z03A 4E2WA 1VQ6Z 2QREB 3P5JB 3CXCY 3F3PC 1YJW1 2JR6A 3RZOI 2LIYA 1KQSZ 3S2HI 1YJWZ 2AKLA 2NVYI 2JA7I 1Q862 4A3CI 1Q821 2E2HI 1VQK1 2O4HA 4NBBA 3TE5B 1Y1WI 1VQKZ 4A3BI 4E2YA 4CL1A 1JWHC 2M48A 3T4NB 3GTLI 1QVFZ 4HGYA 2P3YA 3KIHA 1VQP1 4E2ZA 2HU9A 1M901 3VB9A 1TWFI 1VQ91 3GTJI 1VQ8Z 1VQPZ 1RQFA 3CXCZ 3CCVZ 5IT9b 3CMA1 1VQ9Z 4NBDA 4A3KI 1K8A1 4NBCA 1YUKA 3CMAZ 4DK1A 2JA6I 2M6NA 3FKII 3S1RI 2KPIA 1PFTA 2PK7A 4MD8A 4Y52I 1Q812 1N2FA 2QA41 1L1OC 3FQMA 2W03A 3S17I 4TNUA 5C44I 2QA4Z 2QRDB 1X0TA 4HGZA 4DGLA 2JA8I 5C3EI 2IZ4A 2QR1B 2GTHA 3CQZI 2I3CA 3CCE1 1ML8A 3CCS1 1WIIA 3Q87A 3CCEZ 3CCSZ 2OTJ1 3I561 4BBSI 2E2II 5D1OA 1QYPA 3NFZA 1M1K2 4Y7NI 3JAMf 2OTJZ 3IX0A 2HF1A 1TWCI 1VQL1 1RO0A 3G711 3GTMI 4A3JI 2WB1A 1VQLZ 3G71Z 1VQ4Z 3HOZI 1VQN1 3I4MI 1LQLA 4E30A 2PMZA 2OTLZ 2RHBA 1VQNZ 2GU2A 2JMOA 3CCR1 2F4MA 4X6AI 4XX2A 1KC82 3CCRZ 2ZAEB 1NP6A 4NBEA 1S7MA 1X3WA 1K731 1I3QI 3CCLZ 3EERA 1Q811 4QTTA 2R92I 1QVFY 1NUIA 5FLXb 4HH4A 2VUMI 1TWHI 1WW9A 3NDJA 2WAQA 3CCQ1 4MONA 2E2JI 4MXUA 3CCQZ 2JNYA 1I50I 3PO2I 4NBAA 1USPA 3RZDI 3H3VJ 1M1K1 1VQ71 3HKZA 3NH8A 1K9M2 1VQ7Z 3CC71 4E31A 1KRLA 3CC7Z 3GTGI 2NVQI 4A3LI 3I07A 5A2Qf 3HOVI 2YU9I 5LL6f 4BBRI 2JUBA 1QF8A 4BXXI 1YIJ1 1NJI1 2B63I 1VQM1 3GTKI 1TWAI 1N8R1 1ZH1A 3QWUA 1YIJZ 3S15I 1YHQ1 1VQMZ 5D1PA 2R7ZI 1YJN1 1TFIA 4E32A 1JJ2Y 1YHQZ 1SFOI 1YJNZ 4NH1C 4NB9A 3VTNA 4NB8A 3D9XA 2PM9A 3J80f 3S2DI 1YJ91 3CC21 3GTMS 2BJOA 2QEX1 5C4JI 1RO4A 2V8IA 1YJ9Z 1Q861 4MD7A 1RLYA 3H0GI 2QEXZ 3M3YI 4RVFA 2NVXI 1KD12 2YADA 1Q7Y2 4NFRA 2QKDA 3KIFA 3I56Z 2LFUA 4S1TA 2H85A 3M4OI 4RV9A 3J81f 3S16I 4NBHA 5FLXf 3CPWZ 1JJ2Z 2EGTA 1I6HI 2OOXB 3CCM1 2GTIA 3OW2Z 3BG0B 1Q822 3HOUI 3CCMZ 4E33A 2RBLA 3I4NI 3IFUA 3EEDA 1R9TI 1Y1VI 2NVTI 2Q51A 2Q4ZA 4A3II 1DL6A 3CCJ1 1YUAA 1YIT1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 I;  1K83 I;  2JA6 I;  3FKI I;  4A3G I;  3S1R I;  2KPI A;  1PFT A;  2PK7 A;  4A3M I;  2DE6 A;  4Y52 I;  3D6W A;  3GTG I;  3GTQ I;  2NVQ I;  1N2F A;  1L1O C;  4A3L I;  1X3Z A;  3I07 A;  4A93 I;  3S1M I;  1WCM I;  3HOV I;  2YU9 I;  3S17 I;  5C44 I;  2J6A A;  4BBR I;  4QTU A;  2JA8 I;  2F4O A;  5C3E I;  4NBF A;  3K7A I;  2DE7 A;  3GKQ A;  4BXX I;  3HOY I;  3CQZ I;  2B63 I;  4A3F I;  1ML8 A;  3GTK I;  1TWA I;  2R93 I;  3PO3 S;  3S15 I;  3S14 I;  5C4X I;  3Q87 A;  1ZB8 A;  4NOZ A;  5FLM I;  2R7Z I;  4BBS I;  2E2I I;  1QYP A;  4A3D I;  1TFI A;  4Y7N I;  3S1Q I;  1SFO I;  2HF1 A;  1TWC I;  4NB9 A;  2DE5 A;  4NB8 A;  3LUS A;  3GTM I;  4A3J I;  2JA5 I;  1TWG I;  3U50 C;  3S2D I;  3HOZ I;  3GTM S;  3HOW I;  3S1N I;  2BJO A;  1VLA A;  3I4M I;  5C4J I;  1LQL A;  3PO3 I;  1RO4 A;  3GTP I;  4A3E I;  5IP7 I;  3VMG A;  1RLY A;  3H0G I;  2K5R A;  2JS4 A;  3M3Y I;  4MH4 A;  2F4M A;  2NVX I;  2JR6 A;  4X6A I;  3RZO I;  4NBG A;  4XX2 A;  3GTO I;  3S2H I;  2AKL A;  2NVY I;  4NBE A;  2JA7 I;  1X3W A;  4A3C I;  2E2H I;  1I3Q I;  3M4O I;  3EER A;  4QTT A;  4NBB A;  2R92 I;  1Y1W I;  3S16 I;  1USP B;  4NBH A;  1NUI A;  3VMI A;  4A3B I;  4BY1 I;  3VMH A;  1I6H I;  2VUM I;  1TWH I;  1WW9 A;  3HOX I;  3GCF A;  3ESW A;  3HOU I;  3GTL I;  2RBL A;  2E2J I;  2P3Y A;  3I4N I;  2JNY A;  1I50 I;  1R9T I;  5CM2 M;  3VB9 A;  3PO2 I;  4BY7 I;  1Y1V I;  1TWF I;  1ZB9 A;  3GTJ I;  2NVT I;  4NBA A;  1USP A;  4A3I I;  1Y1V S;  4NBD A;  4A3K I;  3RZD I;  3H3V J;  1DL6 A;  4NBC A;  1YUA A; 
#chains in the Genus database with same CATH topology
 5IP9 I;  1M90 2;  1K83 I;  2QRC B;  1YIT Z;  2V8K A;  1RO2 A;  1VQO 1;  2JIQ A;  3JAM b;  1X3Z A;  5D1O B;  2W04 A;  4MRI A;  1WCM I;  1Q16 A;  1W2B Z;  5AN9 F;  4MD9 A;  2J6A A;  1VQ5 1;  3MON A;  2F4O A;  5IT9 f;  2KI7 B;  2OOY B;  1VQ5 Z;  3HOY I;  1VQ6 1;  2R93 I;  2VPY A;  3J7A 4;  3PO3 S;  3I55 1;  3S14 I;  1ZB8 A;  4A3D I;  3I55 Z;  3CME 1;  1SIW A;  3MZL B;  3CME Z;  3S1N I;  1KC8 1;  1VLA A;  2IZ3 A;  3PO3 I;  3MZK B;  3GTP I;  4A3E I;  3VMG A;  2K5R A;  4EWC A;  2JS4 A;  1Z02 A;  4MH4 A;  3CD6 1;  3CC4 1;  3G4S 1;  4NBG A;  3GTO I;  1VQ8 1;  3CD6 Z;  3CCV 1;  3CC4 Z;  3G4S Z;  3CPW Y;  3TDH B;  2QLV B;  1YI2 1;  3OW2 Y;  2R6M A;  3NH5 A;  1YI2 Z;  1USP B;  3VMI A;  4BY1 I;  3VMH A;  2G2K A;  5T6B A;  3HOX I;  3CC2 Z;  1K73 2;  3GCF A;  3ESW A;  2P28 A;  1S72 1;  2OZK A;  4RVH A;  2RIQ A;  5A2Q b;  3CCU 1;  5CM2 M;  1S72 Z;  1K9M 1;  1WJ2 A;  4BY7 I;  5T67 A;  1ZB9 A;  1QVG Y;  3CCU Z;  4DQY B;  4RS4 A;  2LEX A;  1Y1V S;  3F3F C;  2E9H A;  1Z01 A;  4RVG A;  2RPR A;  4A3G I;  1W2B Y;  4A3M I;  2DE6 A;  3D6W A;  1AA6 A;  3GTQ I;  3G6E 1;  1Y8C A;  1WZN A;  4A93 I;  3S1M I;  4AYB A;  2VF1 A;  3G6E Z;  1VQ4 1;  4QTU A;  3J80 b;  4NBF A;  3K7A I;  2DE7 A;  2OTL 1;  5T64 A;  3GKQ A;  1KQS Y;  4RVD A;  2RT9 A;  4A3F I;  1QVG Z;  3IF8 A;  2O53 A;  3CCJ Z;  5C4X I;  4NOZ A;  1RNI A;  5FLM I;  1K8A 2;  3S1Q I;  2E7Z A;  1P9N A;  3CCL 1;  1NJI 2;  1VQO Z;  2DE5 A;  3LUS A;  1N8R 2;  2JA5 I;  1TWG I;  3FQQ A;  2VUG A;  3U50 C;  3J81 b;  4E2X A;  3NDI A;  1KD1 1;  3HOW I;  3BG1 B;  2V8J A;  2K3R A;  2Y0S A;  1Q7Y 1;  3NH4 A;  2JIM A;  5IP7 I;  1Z03 A;  4E2W A;  1VQ6 Z;  2QRE B;  3P5J B;  3CXC Y;  3F3P C;  1YJW 1;  2JR6 A;  3RZO I;  2LIY A;  1KQS Z;  3S2H I;  1YJW Z;  2AKL A;  2NVY I;  2JA7 I;  1Q86 2;  4A3C I;  1Q82 1;  2E2H I;  1VQK 1;  2O4H A;  2V45 A;  4NBB A;  3TE5 B;  1Y1W I;  1VQK Z;  4A3B I;  4E2Y A;  4CL1 A;  1JWH C;  2M48 A;  3T4N B;  3GTL I;  1QVF Z;  4HGY A;  2P3Y A;  3KIH A;  1VQP 1;  4E2Z A;  2HU9 A;  2VPZ A;  1M90 1;  3VB9 A;  2NAP A;  1TWF I;  1VQ9 1;  3GTJ I;  1VQ8 Z;  1VQP Z;  1RQF A;  3CXC Z;  3CCV Z;  5IT9 b;  3CMA 1;  1VQ9 Z;  4NBD A;  4A3K I;  1K8A 1;  4NBC A;  1YUK A;  3CMA Z;  4DK1 A;  2JA6 I;  2M6N A;  3FKI I;  3S1R I;  2KPI A;  1PFT A;  2PK7 A;  4MD8 A;  4Y52 I;  3IR7 A;  1Q81 2;  1N2F A;  2QA4 1;  1L1O C;  3FQM A;  2W03 A;  3S17 I;  4TNU A;  5C44 I;  2QA4 Z;  2QRD B;  1X0T A;  4HGZ A;  4DGL A;  2JA8 I;  5C3E I;  2IZ4 A;  2QR1 B;  2GTH A;  3CQZ I;  2I3C A;  3CCE 1;  1ML8 A;  3CCS 1;  1WII A;  2AYD A;  3Q87 A;  3CCE Z;  3CCS Z;  2OTJ 1;  3I56 1;  4BBS I;  2E2I I;  5D1O A;  1QYP A;  3NFZ A;  1M1K 2;  2JIP A;  4Y7N I;  3JAM f;  2OTJ Z;  3IX0 A;  2HF1 A;  1TWC I;  1VQL 1;  1RO0 A;  3G71 1;  3GTM I;  4A3J I;  2WB1 A;  2V3V A;  2VPW A;  1VQL Z;  3G71 Z;  1VQ4 Z;  3HOZ I;  1VQN 1;  3I4M I;  1LQL A;  4E30 A;  1QXF A;  2PMZ A;  2OTL Z;  2RHB A;  1VQN Z;  2GU2 A;  2JMO A;  3CCR 1;  2F4M A;  4X6A I;  4XX2 A;  1KC8 2;  3CCR Z;  2ZAE B;  1NP6 A;  4NBE A;  1S7M A;  1X3W A;  1K73 1;  1I3Q I;  3CCL Z;  3EER A;  1Q81 1;  4QTT A;  2R92 I;  1QVF Y;  1NUI A;  5FLX b;  4HH4 A;  2VUM I;  1TWH I;  1WW9 A;  3NDJ A;  2WAQ A;  3CCQ 1;  4MON A;  2E2J I;  4MXU A;  3CCQ Z;  2JNY A;  1I50 I;  3PO2 I;  4NBA A;  1USP A;  3RZD I;  3H3V J;  1M1K 1;  1VQ7 1;  3HKZ A;  3NH8 A;  1K9M 2;  1VQ7 Z;  3CC7 1;  4E31 A;  1KRL A;  3CC7 Z;  3GTG I;  2NVQ I;  4A3L I;  3I07 A;  5A2Q f;  3HOV I;  2YU9 I;  5LL6 f;  4BBR I;  2JUB A;  1QF8 A;  4BXX I;  1YIJ 1;  1NJI 1;  2B63 I;  1VQM 1;  3GTK I;  1TWA I;  1N8R 1;  1ZH1 A;  2JIR A;  3QWU A;  1YIJ Z;  3S15 I;  1YHQ 1;  1VQM Z;  5D1P A;  2R7Z I;  1YJN 1;  1TFI A;  4E32 A;  1JJ2 Y;  1YHQ Z;  1SFO I;  1FDI A;  1YJN Z;  4NH1 C;  4NB9 A;  3VTN A;  4NB8 A;  3D9X A;  2PM9 A;  3J80 f;  3S2D I;  1YJ9 1;  3CC2 1;  3GTM S;  2BJO A;  2QEX 1;  3D2L A;  5C4J I;  1RO4 A;  2V8I A;  1YJ9 Z;  1Q86 1;  4MD7 A;  1RLY A;  3H0G I;  2QEX Z;  3M3Y I;  4RVF A;  2NVX I;  1KD1 2;  2YAD A;  1Q7Y 2;  4NFR A;  2QKD A;  3KIF A;  3I56 Z;  2LFU A;  4S1T A;  2H85 A;  2IV2 X;  3M4O I;  4RV9 A;  3J81 f;  3S16 I;  4NBH A;  5FLX f;  3CPW Z;  1JJ2 Z;  2EGT A;  1I6H I;  2OOX B;  1FDO A;  2GTI A;  3CCM 1;  3OW2 Z;  3BG0 B;  1Q82 2;  3HOU I;  3CCM Z;  4E33 A;  2RBL A;  3I4N I;  3IFU A;  3EED A;  1R9T I;  2JIO A;  1Y1V I;  2NVT I;  2Q51 A;  2Q4Z A;  4A3I I;  1DL6 A;  2VPX A;  3CCJ 1;  1YUA A;  1YIT 1; 
#chains in the Genus database with same CATH homology
 5IP9 I;  1M90 2;  1K83 I;  2QRC B;  1YIT Z;  2V8K A;  1RO2 A;  1VQO 1;  3JAM b;  1X3Z A;  5D1O B;  2W04 A;  4MRI A;  1WCM I;  1W2B Z;  5AN9 F;  4MD9 A;  2J6A A;  1VQ5 1;  3MON A;  2F4O A;  5IT9 f;  2KI7 B;  2OOY B;  1VQ5 Z;  3HOY I;  1VQ6 1;  2R93 I;  3J7A 4;  3PO3 S;  3I55 1;  3S14 I;  1ZB8 A;  4A3D I;  3I55 Z;  3CME 1;  3MZL B;  3CME Z;  3S1N I;  1KC8 1;  1VLA A;  2IZ3 A;  3PO3 I;  3MZK B;  3GTP I;  4A3E I;  3VMG A;  2K5R A;  4EWC A;  2JS4 A;  1Z02 A;  4MH4 A;  3CD6 1;  3CC4 1;  3G4S 1;  4NBG A;  3GTO I;  1VQ8 1;  3CD6 Z;  3CCV 1;  3CC4 Z;  3G4S Z;  3CPW Y;  3TDH B;  2QLV B;  1YI2 1;  3OW2 Y;  2R6M A;  3NH5 A;  1YI2 Z;  1USP B;  3VMI A;  4BY1 I;  3VMH A;  2G2K A;  5T6B A;  3HOX I;  3CC2 Z;  1K73 2;  3GCF A;  3ESW A;  2P28 A;  1S72 1;  2OZK A;  4RVH A;  2RIQ A;  5A2Q b;  3CCU 1;  5CM2 M;  1S72 Z;  1K9M 1;  4BY7 I;  5T67 A;  1ZB9 A;  1QVG Y;  3CCU Z;  4DQY B;  4RS4 A;  1Y1V S;  3F3F C;  2E9H A;  1Z01 A;  4RVG A;  2RPR A;  4A3G I;  1W2B Y;  4A3M I;  2DE6 A;  3D6W A;  3GTQ I;  3G6E 1;  4A93 I;  3S1M I;  4AYB A;  2VF1 A;  3G6E Z;  1VQ4 1;  4QTU A;  3J80 b;  4NBF A;  3K7A I;  2DE7 A;  2OTL 1;  5T64 A;  3GKQ A;  1KQS Y;  4RVD A;  2RT9 A;  4A3F I;  1QVG Z;  3IF8 A;  2O53 A;  3CCJ Z;  5C4X I;  4NOZ A;  1RNI A;  5FLM I;  1K8A 2;  3S1Q I;  1P9N A;  3CCL 1;  1NJI 2;  1VQO Z;  2DE5 A;  3LUS A;  1N8R 2;  2JA5 I;  1TWG I;  3FQQ A;  2VUG A;  3U50 C;  3J81 b;  4E2X A;  3NDI A;  1KD1 1;  3HOW I;  3BG1 B;  2V8J A;  2K3R A;  2Y0S A;  1Q7Y 1;  3NH4 A;  5IP7 I;  1Z03 A;  4E2W A;  1VQ6 Z;  2QRE B;  3P5J B;  3CXC Y;  3F3P C;  1YJW 1;  2JR6 A;  3RZO I;  2LIY A;  1KQS Z;  3S2H I;  1YJW Z;  2AKL A;  2NVY I;  2JA7 I;  1Q86 2;  4A3C I;  1Q82 1;  2E2H I;  1VQK 1;  2O4H A;  4NBB A;  3TE5 B;  1Y1W I;  1VQK Z;  4A3B I;  4E2Y A;  4CL1 A;  1JWH C;  2M48 A;  3T4N B;  3GTL I;  1QVF Z;  4HGY A;  2P3Y A;  3KIH A;  1VQP 1;  4E2Z A;  2HU9 A;  1M90 1;  3VB9 A;  1TWF I;  1VQ9 1;  3GTJ I;  1VQ8 Z;  1VQP Z;  1RQF A;  3CXC Z;  3CCV Z;  5IT9 b;  3CMA 1;  1VQ9 Z;  4NBD A;  4A3K I;  1K8A 1;  4NBC A;  1YUK A;  3CMA Z;  4DK1 A;  2JA6 I;  2M6N A;  3FKI I;  3S1R I;  2KPI A;  1PFT A;  2PK7 A;  4MD8 A;  4Y52 I;  1Q81 2;  1N2F A;  2QA4 1;  1L1O C;  3FQM A;  2W03 A;  3S17 I;  4TNU A;  5C44 I;  2QA4 Z;  2QRD B;  1X0T A;  4HGZ A;  4DGL A;  2JA8 I;  5C3E I;  2IZ4 A;  2QR1 B;  2GTH A;  3CQZ I;  2I3C A;  3CCE 1;  1ML8 A;  3CCS 1;  1WII A;  3Q87 A;  3CCE Z;  3CCS Z;  2OTJ 1;  3I56 1;  4BBS I;  2E2I I;  5D1O A;  1QYP A;  3NFZ A;  1M1K 2;  4Y7N I;  3JAM f;  2OTJ Z;  3IX0 A;  2HF1 A;  1TWC I;  1VQL 1;  1RO0 A;  3G71 1;  3GTM I;  4A3J I;  2WB1 A;  1VQL Z;  3G71 Z;  1VQ4 Z;  3HOZ I;  1VQN 1;  3I4M I;  1LQL A;  4E30 A;  2PMZ A;  2OTL Z;  2RHB A;  1VQN Z;  2GU2 A;  2JMO A;  3CCR 1;  2F4M A;  4X6A I;  4XX2 A;  1KC8 2;  3CCR Z;  2ZAE B;  1NP6 A;  4NBE A;  1S7M A;  1X3W A;  1K73 1;  1I3Q I;  3CCL Z;  3EER A;  1Q81 1;  4QTT A;  2R92 I;  1QVF Y;  1NUI A;  5FLX b;  4HH4 A;  2VUM I;  1TWH I;  1WW9 A;  3NDJ A;  2WAQ A;  3CCQ 1;  4MON A;  2E2J I;  4MXU A;  3CCQ Z;  2JNY A;  1I50 I;  3PO2 I;  4NBA A;  1USP A;  3RZD I;  3H3V J;  1M1K 1;  1VQ7 1;  3HKZ A;  3NH8 A;  1K9M 2;  1VQ7 Z;  3CC7 1;  4E31 A;  1KRL A;  3CC7 Z;  3GTG I;  2NVQ I;  4A3L I;  3I07 A;  5A2Q f;  3HOV I;  2YU9 I;  5LL6 f;  4BBR I;  2JUB A;  1QF8 A;  4BXX I;  1YIJ 1;  1NJI 1;  2B63 I;  1VQM 1;  3GTK I;  1TWA I;  1N8R 1;  1ZH1 A;  3QWU A;  1YIJ Z;  3S15 I;  1YHQ 1;  1VQM Z;  5D1P A;  2R7Z I;  1YJN 1;  1TFI A;  4E32 A;  1JJ2 Y;  1YHQ Z;  1SFO I;  1YJN Z;  4NH1 C;  4NB9 A;  3VTN A;  4NB8 A;  3D9X A;  2PM9 A;  3J80 f;  3S2D I;  1YJ9 1;  3CC2 1;  3GTM S;  2BJO A;  2QEX 1;  5C4J I;  1RO4 A;  2V8I A;  1YJ9 Z;  1Q86 1;  4MD7 A;  1RLY A;  3H0G I;  2QEX Z;  3M3Y I;  4RVF A;  2NVX I;  1KD1 2;  2YAD A;  1Q7Y 2;  4NFR A;  2QKD A;  3KIF A;  3I56 Z;  2LFU A;  4S1T A;  2H85 A;  3M4O I;  4RV9 A;  3J81 f;  3S16 I;  4NBH A;  5FLX f;  3CPW Z;  1JJ2 Z;  2EGT A;  1I6H I;  2OOX B;  3CCM 1;  2GTI A;  3OW2 Z;  3BG0 B;  1Q82 2;  3HOU I;  3CCM Z;  4E33 A;  2RBL A;  3I4N I;  3IFU A;  3EED A;  1R9T I;  1Y1V I;  2NVT I;  2Q51 A;  2Q4Z A;  4A3I I;  1DL6 A;  3CCJ 1;  1YUA A;  1YIT 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...