1TWAI

Rna polymerase ii complexed with atp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twaI02
2KPIA 4NBAA 1WW9A 2JNYA 4X6AI 3K7AI 2JR6A 1R9TI 4BY1I 1YUAA 3VMGA 3Q87A 1I3QI 3GTJI 4A3LI 2R7ZI 3FKII 3S1MI 1RO4A 4NBHA 3RZDI 3I07A 3M3YI 3PO2I 1ZB8A 3HOWI 2PK7A 4A3JI 5IP9I 4NBFA 1LQLA 2RBLA 5C3EI 2JS4A 3GTOI 1Y1WI 4BY7I 1QYPA 4QTTA 3ESWA 3VB9A 4A3MI 3LUSA 4MH4A 4QTUA 5C4JI 1Y1VI 1K83I 2F4OA 2DE7A 2F4MA 4A3DI 1Y1VS 4NBGA 3HOZI 4Y7NI 1TWAI 4NB8A 2R92I 1VLAA 3EERA 1X3ZA 3GKQA 2JA5I 3GTLI 4BBRI 4BXXI 4NB9A 4A93I 3U50C 4NBBA 2YU9I 1I50I 3S17I 2AKLA 1L1OC 5C44I 1SFOI 2HF1A 2VUMI 2P3YA 2DE5A 3HOVI 2E2JI 2BJOA 1WCMI 2J6AA 3VMHA 3GTPI 3M4OI 3S15I 2JA8I 3HOYI 1USPB 3RZOI 4A3GI 2E2II 2NVTI 3D6WA 1TWCI 3H0GI 4Y52I 2E2HI 2JA7I 1ZB9A 3S1NI 2JA6I 1TWHI 3I4NI 1ML8A 3S16I 3CQZI 1N2FA 4NBEA 4NOZA 2NVQI 1I6HI 4A3CI 5C4XI 3PO3I 3S2DI 2R93I 2DE6A 3S14I 4A3II 2B63I 3S1RI 1DL6A 3HOXI 3GTMI 4NBCA 3PO3S 3I4MI 4BBSI 3GTQI 2NVXI 3GCFA 1PFTA 1USPA 2NVYI 5CM2M 3GTMS 3GTGI 1NUIA 2K5RA 1TFIA 4A3BI 4A3FI 1TWGI 3HOUI 4A3EI 3GTKI 1RLYA 3VMIA 4XX2A 3H3VJ 1X3WA 3S2HI 1TWFI 3S1QI 4A3KI 4NBDA 5FLMI 5IP7I
chains in the Genus database with same CATH superfamily
3CXCY 1QVGZ 1WW9A 4X6AI 1YUKA 2P28A 2Y0SA 3Q87A 2R7ZI 3FKII 2E9HA 3S1MI 5D1OA 4NBHA 3MZKB 3I07A 2IZ3A 4HH4A 1ZB8A 4AYBA 2PK7A 4A3JI 1LQLA 3OW2Y 5AN9F 3D9XA 5A2Qf 2QEX1 1VQMZ 1VQN1 4DQYB 1K8A2 1SIWA 3G6EZ 1VQ41 2LEXA 1Q7Y2 2V8JA 1S721 2DE7A 2F4MA 1VQ91 3I561 1QVGY 3MZLB 3CCM1 4NB8A 2R92I 3EERA 2RHBA 4S1TA 3GKQA 3GTLI 4BXXI 2GTIA 4NBBA 1I50I 1YJ91 2P3YA 1VQLZ 2QA4Z 3HOVI 2JIQA 2J6AA 3VMHA 3CCRZ 2WB1A 1VQPZ 1Y8CA 4RV9A 1Z02A 3CCVZ 1VQ61 3CD61 1TWCI 5A2Qb 2E2HI 3CMA1 1ML8A 3S16I 1N2FA 2NVQI 2V8IA 1NP6A 1WJ2A 1NJI1 3IR7A 3G4S1 3KIFA 1DL6A 1Q861 3CC21 2QRCB 1M901 5IT9f 3CCLZ 1YI21 4MD9A 3GTGI 3EEDA 3CC4Z 1TWGI 5D1OB 2K3RA 1RLYA 3CPWZ 1VQL1 1KQSZ 1N8R1 4RVGA 1RNIA 1X3WA 2V8KA 2JNYA 4NH1C 2QREB 2I3CA 2AYDA 1VQ4Z 3NDIA 1YHQZ 2RBLA 3QWUA 2JMOA 1VQ9Z 3I56Z 1ZH1A 1Y1WI 1W2BZ 1QYPA 3CPWY 1KQSY 2GTHA 5IT9b 1M1K1 3MONA 2OOYB 2F4OA 2W04A 1Y1VS 4NBGA 1YJ9Z 1TWAI 2KI7B 2OZKA 3IX0A 1VLAA 4BBRI 3J7A4 3IFUA 4HGZA 3CCU1 4A93I 3U50C 2Q4ZA 2YU9I 3S17I 3CCS1 1L1OC 1VQ7Z 2LIYA 4CL1A 1VQ6Z 3CD6Z 2E2JI 1WCMI 5FLXb 1FDIA 4EWCA 1W2BY 3G711 4DGLA 3CMAZ 1YHQ1 1K731 2VPWA 1YIT1 1YJNZ 1K9M2 3CCE1 3G4SZ 2NVTI 4TNUA 3CC2Z 1Z03A 3NH8A 4E2XA 1YI2Z 1YIJZ 3D6WA 2O4HA 3H0GI 2JA7I 3S1NI 1NJI2 1TWHI 3BG0B 3CQZI 1Q862 4A3II 3S1RI 4BBSI 2JIMA 2WAQA 2LFUA 3GTQI 2NVXI 4HGYA 2NVYI 5CM2M 1Z01A 3F3PC 1NUIA 3CCQ1 1TFIA 4A3BI 2JIRA 3CC71 1YJWZ 1N8R2 2IZ4A 1VQ71 5D1PA 3GTKI 3KIHA 1VQ8Z 4XX2A 3H3VJ 3S2HI 3NDJA 1JJ2Z 1TWFI 2M6NA 4A3KI 5FLMI 1YJN1 5IP7I 2JIPA 4NFRA 3CMEZ 1K8A1 1RO0A 1Q16A 3K7AI 2JR6A 2NAPA 1R9TI 4E2YA 4BY1I 1YIJ1 1Q7Y1 4E30A 1I3QI 1QXFA 2QR1B 2HU9A 4A3LI 1RO4A 3I55Z 2ZAEB 2QKDA 5IP9I 2VF1A 2JIOA 1Q812 2JS4A 1QVFZ 4QTTA 3ESWA 3VB9A 4MD8A 1S7MA 4MH4A 1YJW1 1JJ2Y 5C4JI 1VQ81 1Y1VI 1KRLA 1WZNA 2RPRA 3CCUZ 3CCSZ 3NH4A 3HOZI 1RQFA 2VPZA 2O53A 1QF8A 4RS4A 4E33A 3J81f 1VQ5Z 1X3ZA 2VPXA 3CXCZ 3CME1 3G71Z 2E7ZA 4NB9A 1YITZ 2Q51A 3TDHB 3CCEZ 1SFOI 5T6BA 2RIQA 4MXUA 3J80f 5T64A 2DE5A 2G2KA 3BG1B 3D2LA 1QVFY 3I551 3S15I 3HOYI 2QRDB 4A3GI 1KC81 4MRIA 4NBEA 3CCQZ 2R93I 1I6HI 1Q821 4MD7A 3CCJ1 3CC7Z 3T4NB 2V3VA 4RVFA 4E32A 3HOXI 3PO3S 4NBCA 3I4MI 2OTJ1 3IF8A 3GCFA 1VQ51 1USPA 3GTMS 2K5RA 3TE5B 4A3FI 3J81b 1KD11 4NBDA 3J80b 2PM9A 2B63I 1FDOA 1M902 2KPIA 4NBAA 1VQK1 1YUAA 3VMGA 3GTJI 3JAMf 2JUBA 2EGTA 5T67A 4E2ZA 3FQQA 3RZDI 2OTLZ 3M3YI 3PO2I 3HOWI 1P9NA 4NBFA 5C3EI 4DK1A 3GTOI 4BY7I 4A3MI 3LUSA 4QTUA 2RT9A 1K83I 3P5JB 1VQOZ 1VQM1 4A3DI 3F3FC 4Y7NI 2W03A 1K9M1 3G6E1 2JA5I 1JWHC 2M48A 3NH5A 2AKLA 1AA6A 5C44I 2HF1A 1M1K2 3HKZA 2VUMI 2GU2A 2OTL1 1X0TA 2BJOA 3GTPI 3M4OI 1KC82 3JAMb 2PMZA 2JA8I 3NFZA 1USPB 2VPYA 3CCJZ 3RZOI 2E2II 2R6MA 4E31A 2OTJZ 4MONA 2QA41 2QLVB 1RO2A 2V45A 2IV2X 1Q822 4Y52I 1ZB9A 3CCR1 2JA6I 4E2WA 3I4NI 1VQP1 4NOZA 4A3CI 5C4XI 3PO3I 3S2DI 2H85A 1VQO1 2DE6A 4RVHA 3S14I 2YADA 5LL6f 3GTMI 1WIIA 1K732 3CCV1 4RVDA 1PFTA 2QEXZ 5FLXf 1VQNZ 1KD12 2OOXB 3FQMA 3OW2Z 3HOUI 4A3EI 3VMIA 1VQKZ 2VUGA 1S72Z 3CCL1 3S1QI 3VTNA 1Q811 3CC41 3CCMZ
chains in the Genus database with same CATH topology
3CXCY 1QVGZ 1WW9A 4X6AI 1YUKA 2P28A 2Y0SA 3Q87A 2R7ZI 3FKII 2E9HA 3S1MI 5D1OA 4NBHA 3MZKB 3I07A 2IZ3A 4HH4A 1ZB8A 4AYBA 2PK7A 4A3JI 1LQLA 3OW2Y 5AN9F 3D9XA 5A2Qf 2QEX1 1VQMZ 1VQN1 4DQYB 1K8A2 3G6EZ 1VQ41 1Q7Y2 2V8JA 1S721 2DE7A 2F4MA 1VQ91 3I561 1QVGY 3MZLB 3CCM1 4NB8A 2R92I 3EERA 2RHBA 4S1TA 3GKQA 3GTLI 4BXXI 2GTIA 4NBBA 1I50I 1YJ91 2P3YA 1VQLZ 2QA4Z 3HOVI 2J6AA 3VMHA 3CCRZ 2WB1A 1VQPZ 4RV9A 1Z02A 3CCVZ 1VQ61 3CD61 1TWCI 5A2Qb 2E2HI 3CMA1 1ML8A 3S16I 1N2FA 2NVQI 2V8IA 1NP6A 1NJI1 3G4S1 3KIFA 1DL6A 1Q861 3CC21 2QRCB 1M901 5IT9f 3CCLZ 1YI21 4MD9A 3GTGI 3EEDA 3CC4Z 1TWGI 5D1OB 2K3RA 1RLYA 3CPWZ 1VQL1 1KQSZ 1N8R1 4RVGA 1RNIA 1X3WA 2V8KA 2JNYA 4NH1C 2QREB 2I3CA 1VQ4Z 3NDIA 1YHQZ 2RBLA 3QWUA 2JMOA 1VQ9Z 3I56Z 1ZH1A 1Y1WI 1W2BZ 1QYPA 3CPWY 1KQSY 2GTHA 5IT9b 1M1K1 3MONA 2OOYB 2F4OA 2W04A 1Y1VS 4NBGA 1YJ9Z 1TWAI 2KI7B 2OZKA 3IX0A 1VLAA 4BBRI 3J7A4 3IFUA 4HGZA 3CCU1 4A93I 3U50C 2Q4ZA 2YU9I 3S17I 3CCS1 1L1OC 1VQ7Z 2LIYA 4CL1A 1VQ6Z 3CD6Z 2E2JI 1WCMI 5FLXb 1W2BY 4EWCA 3G711 4DGLA 3CMAZ 1YHQ1 1K731 1YIT1 1YJNZ 1K9M2 3CCE1 3G4SZ 2NVTI 4TNUA 3CC2Z 1Z03A 3NH8A 4E2XA 1YI2Z 1YIJZ 3D6WA 2O4HA 3H0GI 2JA7I 3S1NI 1NJI2 1TWHI 3BG0B 3CQZI 1Q862 4A3II 3S1RI 4BBSI 2WAQA 2LFUA 3GTQI 2NVXI 4HGYA 2NVYI 5CM2M 1Z01A 3F3PC 1NUIA 3CCQ1 1TFIA 4A3BI 3CC71 1YJWZ 1N8R2 2IZ4A 1VQ71 5D1PA 3GTKI 3KIHA 1VQ8Z 4XX2A 3H3VJ 3S2HI 3NDJA 1JJ2Z 1TWFI 2M6NA 4A3KI 5FLMI 1YJN1 5IP7I 4NFRA 3CMEZ 1K8A1 1RO0A 3K7AI 2JR6A 1R9TI 4BY1I 4E2YA 1YIJ1 1Q7Y1 4E30A 1I3QI 2QR1B 2HU9A 4A3LI 1RO4A 3I55Z 2ZAEB 2QKDA 5IP9I 2VF1A 1Q812 2JS4A 1QVFZ 4QTTA 3ESWA 3VB9A 4MD8A 1S7MA 4MH4A 1YJW1 1JJ2Y 5C4JI 1VQ81 1Y1VI 1KRLA 2RPRA 3CCUZ 3CCSZ 3NH4A 3HOZI 1RQFA 2O53A 1QF8A 4RS4A 4E33A 3J81f 1VQ5Z 1X3ZA 3CME1 3CXCZ 3G71Z 4NB9A 1YITZ 2Q51A 3TDHB 3CCEZ 1SFOI 5T6BA 2RIQA 4MXUA 3J80f 5T64A 2DE5A 2G2KA 3BG1B 1QVFY 3I551 3S15I 3HOYI 2QRDB 4A3GI 1KC81 4MRIA 4NBEA 3CCQZ 2R93I 1I6HI 1Q821 4MD7A 3CCJ1 3CC7Z 3T4NB 4RVFA 4E32A 3HOXI 3PO3S 4NBCA 3I4MI 2OTJ1 3IF8A 3GCFA 1VQ51 1USPA 3GTMS 2K5RA 3TE5B 4A3FI 3J81b 1KD11 4NBDA 3J80b 2PM9A 2B63I 1M902 2KPIA 4NBAA 1VQK1 1YUAA 3VMGA 3GTJI 3JAMf 2JUBA 2EGTA 5T67A 4E2ZA 3FQQA 3RZDI 2OTLZ 3M3YI 3PO2I 3HOWI 1P9NA 4NBFA 5C3EI 4DK1A 3GTOI 4BY7I 4A3MI 3LUSA 4QTUA 2RT9A 1K83I 3P5JB 1VQOZ 1VQM1 4A3DI 3F3FC 4Y7NI 2W03A 1K9M1 3G6E1 2JA5I 1JWHC 2M48A 3NH5A 2AKLA 5C44I 2HF1A 1M1K2 3HKZA 2VUMI 2GU2A 2OTL1 1X0TA 2BJOA 3GTPI 3M4OI 1KC82 3JAMb 2PMZA 2JA8I 3NFZA 1USPB 3CCJZ 3RZOI 2E2II 2R6MA 4E31A 2OTJZ 4MONA 2QA41 2QLVB 1RO2A 1Q822 4Y52I 1ZB9A 3CCR1 2JA6I 4E2WA 3I4NI 1VQP1 4NOZA 4A3CI 5C4XI 3PO3I 3S2DI 2H85A 1VQO1 2DE6A 4RVHA 3S14I 2YADA 5LL6f 3GTMI 1WIIA 1K732 3CCV1 4RVDA 1PFTA 2QEXZ 5FLXf 1VQNZ 1KD12 2OOXB 3FQMA 3OW2Z 3HOUI 4A3EI 3VMIA 1VQKZ 2VUGA 1S72Z 3CCL1 3S1QI 3VTNA 1Q811 3CC41 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  4NBA A;  1WW9 A;  2JNY A;  4X6A I;  3K7A I;  2JR6 A;  1R9T I;  4BY1 I;  1YUA A;  3VMG A;  3Q87 A;  1I3Q I;  3GTJ I;  4A3L I;  2R7Z I;  3FKI I;  3S1M I;  1RO4 A;  4NBH A;  3RZD I;  3I07 A;  3M3Y I;  3PO2 I;  1ZB8 A;  3HOW I;  2PK7 A;  4A3J I;  5IP9 I;  4NBF A;  1LQL A;  2RBL A;  5C3E I;  2JS4 A;  3GTO I;  1Y1W I;  4BY7 I;  1QYP A;  4QTT A;  3ESW A;  3VB9 A;  4A3M I;  3LUS A;  4MH4 A;  4QTU A;  5C4J I;  1Y1V I;  1K83 I;  2F4O A;  2DE7 A;  2F4M A;  4A3D I;  1Y1V S;  4NBG A;  3HOZ I;  4Y7N I;  1TWA I;  4NB8 A;  2R92 I;  1VLA A;  3EER A;  1X3Z A;  3GKQ A;  2JA5 I;  3GTL I;  4BBR I;  4BXX I;  4NB9 A;  4A93 I;  3U50 C;  4NBB A;  2YU9 I;  1I50 I;  3S17 I;  2AKL A;  1L1O C;  5C44 I;  1SFO I;  2HF1 A;  2VUM I;  2P3Y A;  2DE5 A;  3HOV I;  2E2J I;  2BJO A;  1WCM I;  2J6A A;  3VMH A;  3GTP I;  3M4O I;  3S15 I;  2JA8 I;  3HOY I;  1USP B;  3RZO I;  4A3G I;  2E2I I;  2NVT I;  3D6W A;  1TWC I;  3H0G I;  4Y52 I;  2E2H I;  2JA7 I;  1ZB9 A;  3S1N I;  2JA6 I;  1TWH I;  3I4N I;  1ML8 A;  3S16 I;  3CQZ I;  1N2F A;  4NBE A;  4NOZ A;  2NVQ I;  1I6H I;  4A3C I;  5C4X I;  3PO3 I;  3S2D I;  2R93 I;  2DE6 A;  3S14 I;  4A3I I;  2B63 I;  3S1R I;  1DL6 A;  3HOX I;  3GTM I;  4NBC A;  3PO3 S;  3I4M I;  4BBS I;  3GTQ I;  2NVX I;  3GCF A;  1PFT A;  1USP A;  2NVY I;  5CM2 M;  3GTM S;  3GTG I;  1NUI A;  2K5R A;  1TFI A;  4A3B I;  4A3F I;  1TWG I;  3HOU I;  4A3E I;  3GTK I;  1RLY A;  3VMI A;  4XX2 A;  3H3V J;  1X3W A;  3S2H I;  1TWF I;  3S1Q I;  4A3K I;  4NBD A;  5FLM I;  5IP7 I; 
#chains in the Genus database with same CATH topology
 3CXC Y;  1QVG Z;  1WW9 A;  4X6A I;  1YUK A;  2P28 A;  2Y0S A;  3Q87 A;  2R7Z I;  3FKI I;  2E9H A;  3S1M I;  5D1O A;  4NBH A;  3MZK B;  3I07 A;  2IZ3 A;  4HH4 A;  1ZB8 A;  4AYB A;  2PK7 A;  4A3J I;  1LQL A;  3OW2 Y;  5AN9 F;  3D9X A;  5A2Q f;  2QEX 1;  1VQM Z;  1VQN 1;  4DQY B;  1K8A 2;  1SIW A;  3G6E Z;  1VQ4 1;  2LEX A;  1Q7Y 2;  2V8J A;  1S72 1;  2DE7 A;  2F4M A;  1VQ9 1;  3I56 1;  1QVG Y;  3MZL B;  3CCM 1;  4NB8 A;  2R92 I;  3EER A;  2RHB A;  4S1T A;  3GKQ A;  3GTL I;  4BXX I;  2GTI A;  4NBB A;  1I50 I;  1YJ9 1;  2P3Y A;  1VQL Z;  2QA4 Z;  3HOV I;  2JIQ A;  2J6A A;  3VMH A;  3CCR Z;  2WB1 A;  1VQP Z;  1Y8C A;  4RV9 A;  1Z02 A;  3CCV Z;  1VQ6 1;  3CD6 1;  1TWC I;  5A2Q b;  2E2H I;  3CMA 1;  1ML8 A;  3S16 I;  1N2F A;  2NVQ I;  2V8I A;  1NP6 A;  1WJ2 A;  1NJI 1;  3IR7 A;  3G4S 1;  3KIF A;  1DL6 A;  1Q86 1;  3CC2 1;  2QRC B;  1M90 1;  5IT9 f;  3CCL Z;  1YI2 1;  4MD9 A;  3GTG I;  3EED A;  3CC4 Z;  1TWG I;  5D1O B;  2K3R A;  1RLY A;  3CPW Z;  1VQL 1;  1KQS Z;  1N8R 1;  4RVG A;  1RNI A;  1X3W A;  2V8K A;  2JNY A;  4NH1 C;  2QRE B;  2I3C A;  2AYD A;  1VQ4 Z;  3NDI A;  1YHQ Z;  2RBL A;  3QWU A;  2JMO A;  1VQ9 Z;  3I56 Z;  1ZH1 A;  1Y1W I;  1W2B Z;  1QYP A;  3CPW Y;  1KQS Y;  2GTH A;  5IT9 b;  1M1K 1;  3MON A;  2OOY B;  2F4O A;  2W04 A;  1Y1V S;  4NBG A;  1YJ9 Z;  1TWA I;  2KI7 B;  2OZK A;  3IX0 A;  1VLA A;  4BBR I;  3J7A 4;  3IFU A;  4HGZ A;  3CCU 1;  4A93 I;  3U50 C;  2Q4Z A;  2YU9 I;  3S17 I;  3CCS 1;  1L1O C;  1VQ7 Z;  2LIY A;  4CL1 A;  1VQ6 Z;  3CD6 Z;  2E2J I;  1WCM I;  5FLX b;  1FDI A;  4EWC A;  1W2B Y;  3G71 1;  4DGL A;  3CMA Z;  1YHQ 1;  1K73 1;  2VPW A;  1YIT 1;  1YJN Z;  1K9M 2;  3CCE 1;  3G4S Z;  2NVT I;  4TNU A;  3CC2 Z;  1Z03 A;  3NH8 A;  4E2X A;  1YI2 Z;  1YIJ Z;  3D6W A;  2O4H A;  3H0G I;  2JA7 I;  3S1N I;  1NJI 2;  1TWH I;  3BG0 B;  3CQZ I;  1Q86 2;  4A3I I;  3S1R I;  4BBS I;  2JIM A;  2WAQ A;  2LFU A;  3GTQ I;  2NVX I;  4HGY A;  2NVY I;  5CM2 M;  1Z01 A;  3F3P C;  1NUI A;  3CCQ 1;  1TFI A;  4A3B I;  2JIR A;  3CC7 1;  1YJW Z;  1N8R 2;  2IZ4 A;  1VQ7 1;  5D1P A;  3GTK I;  3KIH A;  1VQ8 Z;  4XX2 A;  3H3V J;  3S2H I;  3NDJ A;  1JJ2 Z;  1TWF I;  2M6N A;  4A3K I;  5FLM I;  1YJN 1;  5IP7 I;  2JIP A;  4NFR A;  3CME Z;  1K8A 1;  1RO0 A;  1Q16 A;  3K7A I;  2JR6 A;  2NAP A;  1R9T I;  4E2Y A;  4BY1 I;  1YIJ 1;  1Q7Y 1;  4E30 A;  1I3Q I;  1QXF A;  2QR1 B;  2HU9 A;  4A3L I;  1RO4 A;  3I55 Z;  2ZAE B;  2QKD A;  5IP9 I;  2VF1 A;  2JIO A;  1Q81 2;  2JS4 A;  1QVF Z;  4QTT A;  3ESW A;  3VB9 A;  4MD8 A;  1S7M A;  4MH4 A;  1YJW 1;  1JJ2 Y;  5C4J I;  1VQ8 1;  1Y1V I;  1KRL A;  1WZN A;  2RPR A;  3CCU Z;  3CCS Z;  3NH4 A;  3HOZ I;  1RQF A;  2VPZ A;  2O53 A;  1QF8 A;  4RS4 A;  4E33 A;  3J81 f;  1VQ5 Z;  1X3Z A;  2VPX A;  3CXC Z;  3CME 1;  3G71 Z;  2E7Z A;  4NB9 A;  1YIT Z;  2Q51 A;  3TDH B;  3CCE Z;  1SFO I;  5T6B A;  2RIQ A;  4MXU A;  3J80 f;  5T64 A;  2DE5 A;  2G2K A;  3BG1 B;  3D2L A;  1QVF Y;  3I55 1;  3S15 I;  3HOY I;  2QRD B;  4A3G I;  1KC8 1;  4MRI A;  4NBE A;  3CCQ Z;  2R93 I;  1I6H I;  1Q82 1;  4MD7 A;  3CCJ 1;  3CC7 Z;  3T4N B;  2V3V A;  4RVF A;  4E32 A;  3HOX I;  3PO3 S;  4NBC A;  3I4M I;  2OTJ 1;  3IF8 A;  3GCF A;  1VQ5 1;  1USP A;  3GTM S;  2K5R A;  3TE5 B;  4A3F I;  3J81 b;  1KD1 1;  4NBD A;  3J80 b;  2PM9 A;  2B63 I;  1FDO A;  1M90 2;  2KPI A;  4NBA A;  1VQK 1;  1YUA A;  3VMG A;  3GTJ I;  3JAM f;  2JUB A;  2EGT A;  5T67 A;  4E2Z A;  3FQQ A;  3RZD I;  2OTL Z;  3M3Y I;  3PO2 I;  3HOW I;  1P9N A;  4NBF A;  5C3E I;  4DK1 A;  3GTO I;  4BY7 I;  4A3M I;  3LUS A;  4QTU A;  2RT9 A;  1K83 I;  3P5J B;  1VQO Z;  1VQM 1;  4A3D I;  3F3F C;  4Y7N I;  2W03 A;  1K9M 1;  3G6E 1;  2JA5 I;  1JWH C;  2M48 A;  3NH5 A;  2AKL A;  1AA6 A;  5C44 I;  2HF1 A;  1M1K 2;  3HKZ A;  2VUM I;  2GU2 A;  2OTL 1;  1X0T A;  2BJO A;  3GTP I;  3M4O I;  1KC8 2;  3JAM b;  2PMZ A;  2JA8 I;  3NFZ A;  1USP B;  2VPY A;  3CCJ Z;  3RZO I;  2E2I I;  2R6M A;  4E31 A;  2OTJ Z;  4MON A;  2QA4 1;  2QLV B;  1RO2 A;  2V45 A;  2IV2 X;  1Q82 2;  4Y52 I;  1ZB9 A;  3CCR 1;  2JA6 I;  4E2W A;  3I4N I;  1VQP 1;  4NOZ A;  4A3C I;  5C4X I;  3PO3 I;  3S2D I;  2H85 A;  1VQO 1;  2DE6 A;  4RVH A;  3S14 I;  2YAD A;  5LL6 f;  3GTM I;  1WII A;  1K73 2;  3CCV 1;  4RVD A;  1PFT A;  2QEX Z;  5FLX f;  1VQN Z;  1KD1 2;  2OOX B;  3FQM A;  3OW2 Z;  3HOU I;  4A3E I;  3VMI A;  1VQK Z;  2VUG A;  1S72 Z;  3CCL 1;  3S1Q I;  3VTN A;  1Q81 1;  3CC4 1;  3CCM Z; 
#chains in the Genus database with same CATH homology
 3CXC Y;  1QVG Z;  1WW9 A;  4X6A I;  1YUK A;  2P28 A;  2Y0S A;  3Q87 A;  2R7Z I;  3FKI I;  2E9H A;  3S1M I;  5D1O A;  4NBH A;  3MZK B;  3I07 A;  2IZ3 A;  4HH4 A;  1ZB8 A;  4AYB A;  2PK7 A;  4A3J I;  1LQL A;  3OW2 Y;  5AN9 F;  3D9X A;  5A2Q f;  2QEX 1;  1VQM Z;  1VQN 1;  4DQY B;  1K8A 2;  3G6E Z;  1VQ4 1;  1Q7Y 2;  2V8J A;  1S72 1;  2DE7 A;  2F4M A;  1VQ9 1;  3I56 1;  1QVG Y;  3MZL B;  3CCM 1;  4NB8 A;  2R92 I;  3EER A;  2RHB A;  4S1T A;  3GKQ A;  3GTL I;  4BXX I;  2GTI A;  4NBB A;  1I50 I;  1YJ9 1;  2P3Y A;  1VQL Z;  2QA4 Z;  3HOV I;  2J6A A;  3VMH A;  3CCR Z;  2WB1 A;  1VQP Z;  4RV9 A;  1Z02 A;  3CCV Z;  1VQ6 1;  3CD6 1;  1TWC I;  5A2Q b;  2E2H I;  3CMA 1;  1ML8 A;  3S16 I;  1N2F A;  2NVQ I;  2V8I A;  1NP6 A;  1NJI 1;  3G4S 1;  3KIF A;  1DL6 A;  1Q86 1;  3CC2 1;  2QRC B;  1M90 1;  5IT9 f;  3CCL Z;  1YI2 1;  4MD9 A;  3GTG I;  3EED A;  3CC4 Z;  1TWG I;  5D1O B;  2K3R A;  1RLY A;  3CPW Z;  1VQL 1;  1KQS Z;  1N8R 1;  4RVG A;  1RNI A;  1X3W A;  2V8K A;  2JNY A;  4NH1 C;  2QRE B;  2I3C A;  1VQ4 Z;  3NDI A;  1YHQ Z;  2RBL A;  3QWU A;  2JMO A;  1VQ9 Z;  3I56 Z;  1ZH1 A;  1Y1W I;  1W2B Z;  1QYP A;  3CPW Y;  1KQS Y;  2GTH A;  5IT9 b;  1M1K 1;  3MON A;  2OOY B;  2F4O A;  2W04 A;  1Y1V S;  4NBG A;  1YJ9 Z;  1TWA I;  2KI7 B;  2OZK A;  3IX0 A;  1VLA A;  4BBR I;  3J7A 4;  3IFU A;  4HGZ A;  3CCU 1;  4A93 I;  3U50 C;  2Q4Z A;  2YU9 I;  3S17 I;  3CCS 1;  1L1O C;  1VQ7 Z;  2LIY A;  4CL1 A;  1VQ6 Z;  3CD6 Z;  2E2J I;  1WCM I;  5FLX b;  1W2B Y;  4EWC A;  3G71 1;  4DGL A;  3CMA Z;  1YHQ 1;  1K73 1;  1YIT 1;  1YJN Z;  1K9M 2;  3CCE 1;  3G4S Z;  2NVT I;  4TNU A;  3CC2 Z;  1Z03 A;  3NH8 A;  4E2X A;  1YI2 Z;  1YIJ Z;  3D6W A;  2O4H A;  3H0G I;  2JA7 I;  3S1N I;  1NJI 2;  1TWH I;  3BG0 B;  3CQZ I;  1Q86 2;  4A3I I;  3S1R I;  4BBS I;  2WAQ A;  2LFU A;  3GTQ I;  2NVX I;  4HGY A;  2NVY I;  5CM2 M;  1Z01 A;  3F3P C;  1NUI A;  3CCQ 1;  1TFI A;  4A3B I;  3CC7 1;  1YJW Z;  1N8R 2;  2IZ4 A;  1VQ7 1;  5D1P A;  3GTK I;  3KIH A;  1VQ8 Z;  4XX2 A;  3H3V J;  3S2H I;  3NDJ A;  1JJ2 Z;  1TWF I;  2M6N A;  4A3K I;  5FLM I;  1YJN 1;  5IP7 I;  4NFR A;  3CME Z;  1K8A 1;  1RO0 A;  3K7A I;  2JR6 A;  1R9T I;  4BY1 I;  4E2Y A;  1YIJ 1;  1Q7Y 1;  4E30 A;  1I3Q I;  2QR1 B;  2HU9 A;  4A3L I;  1RO4 A;  3I55 Z;  2ZAE B;  2QKD A;  5IP9 I;  2VF1 A;  1Q81 2;  2JS4 A;  1QVF Z;  4QTT A;  3ESW A;  3VB9 A;  4MD8 A;  1S7M A;  4MH4 A;  1YJW 1;  1JJ2 Y;  5C4J I;  1VQ8 1;  1Y1V I;  1KRL A;  2RPR A;  3CCU Z;  3CCS Z;  3NH4 A;  3HOZ I;  1RQF A;  2O53 A;  1QF8 A;  4RS4 A;  4E33 A;  3J81 f;  1VQ5 Z;  1X3Z A;  3CME 1;  3CXC Z;  3G71 Z;  4NB9 A;  1YIT Z;  2Q51 A;  3TDH B;  3CCE Z;  1SFO I;  5T6B A;  2RIQ A;  4MXU A;  3J80 f;  5T64 A;  2DE5 A;  2G2K A;  3BG1 B;  1QVF Y;  3I55 1;  3S15 I;  3HOY I;  2QRD B;  4A3G I;  1KC8 1;  4MRI A;  4NBE A;  3CCQ Z;  2R93 I;  1I6H I;  1Q82 1;  4MD7 A;  3CCJ 1;  3CC7 Z;  3T4N B;  4RVF A;  4E32 A;  3HOX I;  3PO3 S;  4NBC A;  3I4M I;  2OTJ 1;  3IF8 A;  3GCF A;  1VQ5 1;  1USP A;  3GTM S;  2K5R A;  3TE5 B;  4A3F I;  3J81 b;  1KD1 1;  4NBD A;  3J80 b;  2PM9 A;  2B63 I;  1M90 2;  2KPI A;  4NBA A;  1VQK 1;  1YUA A;  3VMG A;  3GTJ I;  3JAM f;  2JUB A;  2EGT A;  5T67 A;  4E2Z A;  3FQQ A;  3RZD I;  2OTL Z;  3M3Y I;  3PO2 I;  3HOW I;  1P9N A;  4NBF A;  5C3E I;  4DK1 A;  3GTO I;  4BY7 I;  4A3M I;  3LUS A;  4QTU A;  2RT9 A;  1K83 I;  3P5J B;  1VQO Z;  1VQM 1;  4A3D I;  3F3F C;  4Y7N I;  2W03 A;  1K9M 1;  3G6E 1;  2JA5 I;  1JWH C;  2M48 A;  3NH5 A;  2AKL A;  5C44 I;  2HF1 A;  1M1K 2;  3HKZ A;  2VUM I;  2GU2 A;  2OTL 1;  1X0T A;  2BJO A;  3GTP I;  3M4O I;  1KC8 2;  3JAM b;  2PMZ A;  2JA8 I;  3NFZ A;  1USP B;  3CCJ Z;  3RZO I;  2E2I I;  2R6M A;  4E31 A;  2OTJ Z;  4MON A;  2QA4 1;  2QLV B;  1RO2 A;  1Q82 2;  4Y52 I;  1ZB9 A;  3CCR 1;  2JA6 I;  4E2W A;  3I4N I;  1VQP 1;  4NOZ A;  4A3C I;  5C4X I;  3PO3 I;  3S2D I;  2H85 A;  1VQO 1;  2DE6 A;  4RVH A;  3S14 I;  2YAD A;  5LL6 f;  3GTM I;  1WII A;  1K73 2;  3CCV 1;  4RVD A;  1PFT A;  2QEX Z;  5FLX f;  1VQN Z;  1KD1 2;  2OOX B;  3FQM A;  3OW2 Z;  3HOU I;  4A3E I;  3VMI A;  1VQK Z;  2VUG A;  1S72 Z;  3CCL 1;  3S1Q I;  3VTN A;  1Q81 1;  3CC4 1;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...