3T4NB

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3t4nB01
3TDHB 2QLVB 2QRCB 3T4NB 2QRDB 2QREB 2OOYB 2QR1B 2OOXB 3TE5B
chains in the Genus database with same CATH superfamily
1Y1WI 3J7A4 4A3KI 3PO3S 1K731 1WJ2A 3VMIA 3CCV1 3P5JB 2QRCB 4S1TA 1VQPZ 1QVGY 2IZ4A 2PM9A 3GCFA 5C44I 1VQKZ 1Y8CA 1RO0A 1S721 3Q87A 4E2YA 2DE6A 4Y52I 3CXCZ 2V8JA 5FLMI 2OTJ1 3S1RI 3J81b 2YU9I 5D1OA 2QA4Z 5IT9b 1ZH1A 2JIQA 4BY1I 3CPWZ 3S14I 4MXUA 2WB1A 4NBBA 3J81f 1TWGI 1QF8A 1M1K2 1JJ2Z 3GTLI 3S2DI 2PMZA 3K7AI 5IT9f 3M4OI 3CCVZ 5C3EI 3CQZI 3CMA1 1RO2A 4MD9A 3S16I 3GTMI 2JIMA 4QTUA 1Q822 3HKZA 1S72Z 2E2HI 3G711 1Y1VI 4MD7A 3HOZI 3I4MI 3CCU1 1X0TA 2JS4A 3D9XA 3CCE1 3GTOI 2VF1A 1KD12 1TWAI 1USPA 2NVYI 1M901 5D1PA 1R9TI 5D1OB 3CCM1 2RHBA 1LQLA 2G2KA 3MZKB 2RPRA 4MD8A 3G4S1 3GTGI 2I3CA 3FQQA 2VUMI 3S1MI 3OW2Y 2M48A 4A3BI 1QXFA 3CCL1 2JA8I 1X3WA 2LFUA 4X6AI 2E9HA 3TDHB 1WZNA 1Q821 1NUIA 3G71Z 3CCUZ 3CCEZ 5FLXb 1VQLZ 2QRDB 2ZAEB 2OOXB 2DE7A 1VQ51 2E2JI 3GTJI 3T4NB 3VTNA 4NBCA 4BBRI 1SFOI 3CCMZ 4NB8A 3I56Z 3CXCY 1YUKA 1USPB 4RVHA 4MRIA 1QVFY 2QA41 3G4SZ 5FLXf 2V3VA 3ESWA 3PO2I 4A3MI 4EWCA 1PFTA 4DGLA 3CCLZ 4HGYA 3NH8A 3CPWY 5C4JI 1FDIA 3IFUA 1I6HI 2IV2X 3LUSA 1VQM1 2NVQI 2DE5A 1JJ2Y 4RVFA 5IP7I 4NH1C 4A3II 1VQ5Z 2RT9A 2E7ZA 2AKLA 1VQ71 2KPIA 1WIIA 4TNUA 2VUGA 2LIYA 2VPWA 3G6E1 4BXXI 3CC41 2H85A 2B63I 3GKQA 1Z03A 1N8R2 3S2HI 1NP6A 3HOVI 2JUBA 1YI21 2O4HA 2R7ZI 2JMOA 3NDJA 3CCJ1 2V45A 3CC21 1YUAA 1Q862 5CM2M 3U50C 1YIJ1 1VQMZ 3FQMA 3BG1B 4MH4A 1Q7Y2 1Q16A 2K3RA 1K8A2 1W2BZ 1ZB8A 1KQSY 2HF1A 2QKDA 1Q812 3GTPI 5A2Qb 5T67A 1VQ7Z 2LEXA 1VQL1 3IX0A 3G6EZ 2O53A 2V8KA 3CC4Z 1YJ91 3NH4A 3KIFA 2NAPA 1YI2Z 3S15I 2IZ3A 3VMGA 3VMHA 3I561 5A2Qf 4DQYB 3CCJZ 1ZB9A 4E31A 3CC2Z 2W03A 3CMEZ 4RV9A 1M1K1 3NFZA 2V8IA 4NBGA 1TFIA 4E30A 1WCMI 1YIJZ 2P3YA 1Q7Y1 3JAMb 3I551 2JR6A 3PO3I 1X3ZA 1VQN1 4RS4A 1YJN1 1VQ91 2VPZA 4A3JI 3CC71 5AN9F 2OOYB 2OZKA 3JAMf 4RVDA 3VB9A 1KD11 1YJ9Z 2KI7B 2QEX1 1VLAA 3H0GI 2JIRA 1K9M2 2K5RA 1TWHI 2OTL1 3GTMS 1Y1VS 1YHQ1 2JNYA 4CL1A 2QLVB 4NB9A 1Z02A 1I50I 3I07A 4HH4A 1VQOZ 3I55Z 3CCR1 4DK1A 3NH5A 4NOZA 4Y7NI 4A3GI 4NBDA 3D6WA 1N2FA 1VQNZ 2JA5I 3M3YI 1YJNZ 1VQ9Z 2R92I 3S1NI 3CC7Z 3FKII 2Q51A 4A3CI 2QEXZ 3J80b 1W2BY 5C4XI 1K9M1 2GTHA 2OTLZ 3HOUI 1FDOA 1SIWA 4RVGA 1YHQZ 5LL6f 1YJW1 2AYDA 4NBAA 4A93I 3HOWI 2P28A 3J80f 3CCRZ 4AYBA 3NDIA 3CME1 1QVFZ 5IP9I 3CD61 3I4NI 1NJI2 1VQ8Z 4BY7I 2RIQA 2F4MA 3MZLB 1DL6A 3H3VJ 4NFRA 4QTTA 1S7MA 4A3DI 3CCQ1 3D2LA 2JA6I 1M902 1P9NA 2Y0SA 4MONA 4A3FI 3F3PC 1VQ61 4HGZA 1QVGZ 2F4OA 2YADA 3BG0B 3F3FC 1KRLA 2J6AA 2NVXI 1KC82 1ML8A 2GTIA 2JA7I 2RBLA 4E32A 1N8R1 2M6NA 1YJWZ 1QYPA 2JIOA 3KIHA 1Z01A 2W04A 2E2II 3HOXI 3IR7A 2VPXA 1Q861 3CD6Z 1NJI1 2OTJZ 4XX2A 3CCS1 4NBHA 2PK7A 1AA6A 3EERA 1VQ41 5T64A 2EGTA 2QREB 1VQO1 3CCQZ 2Q4ZA 1K8A1 1K83I 2JIPA 4E2ZA 3S17I 2VPYA 1YIT1 2GU2A 3GTQI 1Q811 1VQ6Z 1TWFI 3RZOI 2R93I 3TE5B 1KC81 3EEDA 4E2XA 2WAQA 4A3LI 3CMAZ 1KQSZ 2BJOA 1K732 3S1QI 4A3EI 1VQP1 5T6BA 3CCSZ 4NBEA 1VQ4Z 3QWUA 1VQK1 3HOYI 1L1OC 2QR1B 3MONA 2HU9A 4BBSI 1YITZ 1RNIA 2R6MA 1VQ81 1WW9A 4E2WA 1I3QI 3GTKI 3OW2Z 1TWCI 3RZDI 2NVTI 3IF8A 1RLYA 1RO4A 4NBFA 1JWHC 4E33A 1RQFA
chains in the Genus database with same CATH topology
1Y1WI 3J7A4 4A3KI 3PO3S 1K731 3VMIA 3CCV1 3P5JB 2QRCB 4S1TA 1VQPZ 1QVGY 2IZ4A 2PM9A 3GCFA 5C44I 1VQKZ 1RO0A 1S721 3Q87A 4E2YA 2DE6A 4Y52I 3CXCZ 2V8JA 5FLMI 2OTJ1 3S1RI 3J81b 2YU9I 5D1OA 2QA4Z 5IT9b 1ZH1A 4BY1I 3CPWZ 3S14I 4MXUA 2WB1A 4NBBA 3J81f 1TWGI 1QF8A 1M1K2 1JJ2Z 3GTLI 3S2DI 2PMZA 3K7AI 5IT9f 3M4OI 3CCVZ 5C3EI 3CQZI 3CMA1 1RO2A 4MD9A 3S16I 3GTMI 4QTUA 1Q822 3HKZA 1S72Z 2E2HI 3G711 1Y1VI 4MD7A 3HOZI 3I4MI 3CCU1 1X0TA 2JS4A 3D9XA 3CCE1 3GTOI 2VF1A 1KD12 1TWAI 1USPA 2NVYI 1M901 5D1PA 1R9TI 5D1OB 3CCM1 2RHBA 1LQLA 2G2KA 3MZKB 2RPRA 4MD8A 3G4S1 3GTGI 2I3CA 3FQQA 2VUMI 3S1MI 3OW2Y 2M48A 4A3BI 2JA8I 3CCL1 1X3WA 2LFUA 4X6AI 2E9HA 3TDHB 1Q821 1NUIA 3G71Z 3CCUZ 3CCEZ 5FLXb 1VQLZ 2QRDB 2ZAEB 2OOXB 2DE7A 1VQ51 2E2JI 3GTJI 3T4NB 3VTNA 4NBCA 4BBRI 1SFOI 3CCMZ 4NB8A 3I56Z 3CXCY 1YUKA 1USPB 4RVHA 4MRIA 1QVFY 2QA41 3G4SZ 5FLXf 3ESWA 3PO2I 4A3MI 4EWCA 1PFTA 4DGLA 3CCLZ 4HGYA 3NH8A 3CPWY 5C4JI 3IFUA 1I6HI 3LUSA 1VQM1 2NVQI 2DE5A 1JJ2Y 4RVFA 5IP7I 4NH1C 4A3II 1VQ5Z 2RT9A 2AKLA 1VQ71 2KPIA 1WIIA 4TNUA 2VUGA 2LIYA 3G6E1 4BXXI 3CC41 2H85A 2B63I 3GKQA 1Z03A 1N8R2 3S2HI 1NP6A 3HOVI 2JUBA 1YI21 2O4HA 2R7ZI 2JMOA 3NDJA 3CCJ1 3CC21 1YUAA 1Q862 5CM2M 3U50C 1YIJ1 1VQMZ 3FQMA 3BG1B 4MH4A 1Q7Y2 2K3RA 1K8A2 1W2BZ 1ZB8A 1KQSY 2HF1A 2QKDA 1Q812 3GTPI 5A2Qb 5T67A 1VQ7Z 1VQL1 3IX0A 3G6EZ 2O53A 2V8KA 3CC4Z 1YJ91 3NH4A 3KIFA 1YI2Z 3S15I 2IZ3A 3VMGA 3VMHA 3I561 5A2Qf 4DQYB 3CCJZ 1ZB9A 4E31A 3CC2Z 2W03A 3CMEZ 4RV9A 1M1K1 3NFZA 2V8IA 4NBGA 1TFIA 4E30A 1WCMI 1YIJZ 2P3YA 1Q7Y1 3JAMb 3I551 2JR6A 3PO3I 1X3ZA 1VQN1 4RS4A 1YJN1 1VQ91 4A3JI 3CC71 5AN9F 2OOYB 2OZKA 3JAMf 4RVDA 3VB9A 1KD11 1YJ9Z 2KI7B 2QEX1 1VLAA 3H0GI 1K9M2 2K5RA 1TWHI 2OTL1 3GTMS 1Y1VS 1YHQ1 2JNYA 4CL1A 2QLVB 4NB9A 1Z02A 1I50I 3I07A 4HH4A 1VQOZ 3I55Z 3CCR1 4DK1A 3NH5A 4NOZA 4Y7NI 4A3GI 4NBDA 3D6WA 1N2FA 1VQNZ 2JA5I 3M3YI 1YJNZ 1VQ9Z 2R92I 3S1NI 3CC7Z 3FKII 2Q51A 4A3CI 2QEXZ 3J80b 1W2BY 5C4XI 1K9M1 2GTHA 2OTLZ 3HOUI 4RVGA 1YHQZ 5LL6f 1YJW1 4NBAA 4A93I 3HOWI 2P28A 3J80f 3CCRZ 4AYBA 3NDIA 3CME1 1QVFZ 5IP9I 3CD61 3I4NI 1NJI2 1VQ8Z 4BY7I 2RIQA 2F4MA 3MZLB 1DL6A 3H3VJ 4NFRA 4QTTA 1S7MA 4A3DI 3CCQ1 2JA6I 1M902 1P9NA 2Y0SA 4MONA 4A3FI 3F3PC 1VQ61 4HGZA 1QVGZ 2F4OA 2YADA 3BG0B 3F3FC 1KRLA 2J6AA 2NVXI 1KC82 1ML8A 2GTIA 2JA7I 2RBLA 4E32A 1N8R1 2M6NA 1YJWZ 1QYPA 3KIHA 1Z01A 2W04A 2E2II 3HOXI 1Q861 3CD6Z 1NJI1 2OTJZ 4XX2A 3CCS1 4NBHA 2PK7A 3EERA 1VQ41 5T64A 2EGTA 2QREB 1VQO1 3CCQZ 2Q4ZA 1K8A1 1K83I 4E2ZA 3S17I 1YIT1 2GU2A 3GTQI 1Q811 1VQ6Z 1TWFI 3RZOI 2R93I 3TE5B 1KC81 3EEDA 4E2XA 2WAQA 4A3LI 3CMAZ 1KQSZ 2BJOA 1K732 3S1QI 4A3EI 1VQP1 5T6BA 3CCSZ 4NBEA 1VQ4Z 3QWUA 1VQK1 3HOYI 1L1OC 2QR1B 3MONA 2HU9A 4BBSI 1YITZ 1RNIA 2R6MA 1VQ81 1WW9A 4E2WA 1I3QI 3GTKI 3OW2Z 1TWCI 3RZDI 2NVTI 3IF8A 1RLYA 1RO4A 4NBFA 1JWHC 4E33A 1RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDH B;  2QLV B;  2QRC B;  3T4N B;  2QRD B;  2QRE B;  2OOY B;  2QR1 B;  2OOX B;  3TE5 B; 
#chains in the Genus database with same CATH topology
 1Y1W I;  3J7A 4;  4A3K I;  3PO3 S;  1K73 1;  1WJ2 A;  3VMI A;  3CCV 1;  3P5J B;  2QRC B;  4S1T A;  1VQP Z;  1QVG Y;  2IZ4 A;  2PM9 A;  3GCF A;  5C44 I;  1VQK Z;  1Y8C A;  1RO0 A;  1S72 1;  3Q87 A;  4E2Y A;  2DE6 A;  4Y52 I;  3CXC Z;  2V8J A;  5FLM I;  2OTJ 1;  3S1R I;  3J81 b;  2YU9 I;  5D1O A;  2QA4 Z;  5IT9 b;  1ZH1 A;  2JIQ A;  4BY1 I;  3CPW Z;  3S14 I;  4MXU A;  2WB1 A;  4NBB A;  3J81 f;  1TWG I;  1QF8 A;  1M1K 2;  1JJ2 Z;  3GTL I;  3S2D I;  2PMZ A;  3K7A I;  5IT9 f;  3M4O I;  3CCV Z;  5C3E I;  3CQZ I;  3CMA 1;  1RO2 A;  4MD9 A;  3S16 I;  3GTM I;  2JIM A;  4QTU A;  1Q82 2;  3HKZ A;  1S72 Z;  2E2H I;  3G71 1;  1Y1V I;  4MD7 A;  3HOZ I;  3I4M I;  3CCU 1;  1X0T A;  2JS4 A;  3D9X A;  3CCE 1;  3GTO I;  2VF1 A;  1KD1 2;  1TWA I;  1USP A;  2NVY I;  1M90 1;  5D1P A;  1R9T I;  5D1O B;  3CCM 1;  2RHB A;  1LQL A;  2G2K A;  3MZK B;  2RPR A;  4MD8 A;  3G4S 1;  3GTG I;  2I3C A;  3FQQ A;  2VUM I;  3S1M I;  3OW2 Y;  2M48 A;  4A3B I;  1QXF A;  3CCL 1;  2JA8 I;  1X3W A;  2LFU A;  4X6A I;  2E9H A;  3TDH B;  1WZN A;  1Q82 1;  1NUI A;  3G71 Z;  3CCU Z;  3CCE Z;  5FLX b;  1VQL Z;  2QRD B;  2ZAE B;  2OOX B;  2DE7 A;  1VQ5 1;  2E2J I;  3GTJ I;  3T4N B;  3VTN A;  4NBC A;  4BBR I;  1SFO I;  3CCM Z;  4NB8 A;  3I56 Z;  3CXC Y;  1YUK A;  1USP B;  4RVH A;  4MRI A;  1QVF Y;  2QA4 1;  3G4S Z;  5FLX f;  2V3V A;  3ESW A;  3PO2 I;  4A3M I;  4EWC A;  1PFT A;  4DGL A;  3CCL Z;  4HGY A;  3NH8 A;  3CPW Y;  5C4J I;  1FDI A;  3IFU A;  1I6H I;  2IV2 X;  3LUS A;  1VQM 1;  2NVQ I;  2DE5 A;  1JJ2 Y;  4RVF A;  5IP7 I;  4NH1 C;  4A3I I;  1VQ5 Z;  2RT9 A;  2E7Z A;  2AKL A;  1VQ7 1;  2KPI A;  1WII A;  4TNU A;  2VUG A;  2LIY A;  2VPW A;  3G6E 1;  4BXX I;  3CC4 1;  2H85 A;  2B63 I;  3GKQ A;  1Z03 A;  1N8R 2;  3S2H I;  1NP6 A;  3HOV I;  2JUB A;  1YI2 1;  2O4H A;  2R7Z I;  2JMO A;  3NDJ A;  3CCJ 1;  2V45 A;  3CC2 1;  1YUA A;  1Q86 2;  5CM2 M;  3U50 C;  1YIJ 1;  1VQM Z;  3FQM A;  3BG1 B;  4MH4 A;  1Q7Y 2;  1Q16 A;  2K3R A;  1K8A 2;  1W2B Z;  1ZB8 A;  1KQS Y;  2HF1 A;  2QKD A;  1Q81 2;  3GTP I;  5A2Q b;  5T67 A;  1VQ7 Z;  2LEX A;  1VQL 1;  3IX0 A;  3G6E Z;  2O53 A;  2V8K A;  3CC4 Z;  1YJ9 1;  3NH4 A;  3KIF A;  2NAP A;  1YI2 Z;  3S15 I;  2IZ3 A;  3VMG A;  3VMH A;  3I56 1;  5A2Q f;  4DQY B;  3CCJ Z;  1ZB9 A;  4E31 A;  3CC2 Z;  2W03 A;  3CME Z;  4RV9 A;  1M1K 1;  3NFZ A;  2V8I A;  4NBG A;  1TFI A;  4E30 A;  1WCM I;  1YIJ Z;  2P3Y A;  1Q7Y 1;  3JAM b;  3I55 1;  2JR6 A;  3PO3 I;  1X3Z A;  1VQN 1;  4RS4 A;  1YJN 1;  1VQ9 1;  2VPZ A;  4A3J I;  3CC7 1;  5AN9 F;  2OOY B;  2OZK A;  3JAM f;  4RVD A;  3VB9 A;  1KD1 1;  1YJ9 Z;  2KI7 B;  2QEX 1;  1VLA A;  3H0G I;  2JIR A;  1K9M 2;  2K5R A;  1TWH I;  2OTL 1;  3GTM S;  1Y1V S;  1YHQ 1;  2JNY A;  4CL1 A;  2QLV B;  4NB9 A;  1Z02 A;  1I50 I;  3I07 A;  4HH4 A;  1VQO Z;  3I55 Z;  3CCR 1;  4DK1 A;  3NH5 A;  4NOZ A;  4Y7N I;  4A3G I;  4NBD A;  3D6W A;  1N2F A;  1VQN Z;  2JA5 I;  3M3Y I;  1YJN Z;  1VQ9 Z;  2R92 I;  3S1N I;  3CC7 Z;  3FKI I;  2Q51 A;  4A3C I;  2QEX Z;  3J80 b;  1W2B Y;  5C4X I;  1K9M 1;  2GTH A;  2OTL Z;  3HOU I;  1FDO A;  1SIW A;  4RVG A;  1YHQ Z;  5LL6 f;  1YJW 1;  2AYD A;  4NBA A;  4A93 I;  3HOW I;  2P28 A;  3J80 f;  3CCR Z;  4AYB A;  3NDI A;  3CME 1;  1QVF Z;  5IP9 I;  3CD6 1;  3I4N I;  1NJI 2;  1VQ8 Z;  4BY7 I;  2RIQ A;  2F4M A;  3MZL B;  1DL6 A;  3H3V J;  4NFR A;  4QTT A;  1S7M A;  4A3D I;  3CCQ 1;  3D2L A;  2JA6 I;  1M90 2;  1P9N A;  2Y0S A;  4MON A;  4A3F I;  3F3P C;  1VQ6 1;  4HGZ A;  1QVG Z;  2F4O A;  2YAD A;  3BG0 B;  3F3F C;  1KRL A;  2J6A A;  2NVX I;  1KC8 2;  1ML8 A;  2GTI A;  2JA7 I;  2RBL A;  4E32 A;  1N8R 1;  2M6N A;  1YJW Z;  1QYP A;  2JIO A;  3KIH A;  1Z01 A;  2W04 A;  2E2I I;  3HOX I;  3IR7 A;  2VPX A;  1Q86 1;  3CD6 Z;  1NJI 1;  2OTJ Z;  4XX2 A;  3CCS 1;  4NBH A;  2PK7 A;  1AA6 A;  3EER A;  1VQ4 1;  5T64 A;  2EGT A;  2QRE B;  1VQO 1;  3CCQ Z;  2Q4Z A;  1K8A 1;  1K83 I;  2JIP A;  4E2Z A;  3S17 I;  2VPY A;  1YIT 1;  2GU2 A;  3GTQ I;  1Q81 1;  1VQ6 Z;  1TWF I;  3RZO I;  2R93 I;  3TE5 B;  1KC8 1;  3EED A;  4E2X A;  2WAQ A;  4A3L I;  3CMA Z;  1KQS Z;  2BJO A;  1K73 2;  3S1Q I;  4A3E I;  1VQP 1;  5T6B A;  3CCS Z;  4NBE A;  1VQ4 Z;  3QWU A;  1VQK 1;  3HOY I;  1L1O C;  2QR1 B;  3MON A;  2HU9 A;  4BBS I;  1YIT Z;  1RNI A;  2R6M A;  1VQ8 1;  1WW9 A;  4E2W A;  1I3Q I;  3GTK I;  3OW2 Z;  1TWC I;  3RZD I;  2NVT I;  3IF8 A;  1RLY A;  1RO4 A;  4NBF A;  1JWH C;  4E33 A;  1RQF A; 
#chains in the Genus database with same CATH homology
 1Y1W I;  3J7A 4;  4A3K I;  3PO3 S;  1K73 1;  3VMI A;  3CCV 1;  3P5J B;  2QRC B;  4S1T A;  1VQP Z;  1QVG Y;  2IZ4 A;  2PM9 A;  3GCF A;  5C44 I;  1VQK Z;  1RO0 A;  1S72 1;  3Q87 A;  4E2Y A;  2DE6 A;  4Y52 I;  3CXC Z;  2V8J A;  5FLM I;  2OTJ 1;  3S1R I;  3J81 b;  2YU9 I;  5D1O A;  2QA4 Z;  5IT9 b;  1ZH1 A;  4BY1 I;  3CPW Z;  3S14 I;  4MXU A;  2WB1 A;  4NBB A;  3J81 f;  1TWG I;  1QF8 A;  1M1K 2;  1JJ2 Z;  3GTL I;  3S2D I;  2PMZ A;  3K7A I;  5IT9 f;  3M4O I;  3CCV Z;  5C3E I;  3CQZ I;  3CMA 1;  1RO2 A;  4MD9 A;  3S16 I;  3GTM I;  4QTU A;  1Q82 2;  3HKZ A;  1S72 Z;  2E2H I;  3G71 1;  1Y1V I;  4MD7 A;  3HOZ I;  3I4M I;  3CCU 1;  1X0T A;  2JS4 A;  3D9X A;  3CCE 1;  3GTO I;  2VF1 A;  1KD1 2;  1TWA I;  1USP A;  2NVY I;  1M90 1;  5D1P A;  1R9T I;  5D1O B;  3CCM 1;  2RHB A;  1LQL A;  2G2K A;  3MZK B;  2RPR A;  4MD8 A;  3G4S 1;  3GTG I;  2I3C A;  3FQQ A;  2VUM I;  3S1M I;  3OW2 Y;  2M48 A;  4A3B I;  2JA8 I;  3CCL 1;  1X3W A;  2LFU A;  4X6A I;  2E9H A;  3TDH B;  1Q82 1;  1NUI A;  3G71 Z;  3CCU Z;  3CCE Z;  5FLX b;  1VQL Z;  2QRD B;  2ZAE B;  2OOX B;  2DE7 A;  1VQ5 1;  2E2J I;  3GTJ I;  3T4N B;  3VTN A;  4NBC A;  4BBR I;  1SFO I;  3CCM Z;  4NB8 A;  3I56 Z;  3CXC Y;  1YUK A;  1USP B;  4RVH A;  4MRI A;  1QVF Y;  2QA4 1;  3G4S Z;  5FLX f;  3ESW A;  3PO2 I;  4A3M I;  4EWC A;  1PFT A;  4DGL A;  3CCL Z;  4HGY A;  3NH8 A;  3CPW Y;  5C4J I;  3IFU A;  1I6H I;  3LUS A;  1VQM 1;  2NVQ I;  2DE5 A;  1JJ2 Y;  4RVF A;  5IP7 I;  4NH1 C;  4A3I I;  1VQ5 Z;  2RT9 A;  2AKL A;  1VQ7 1;  2KPI A;  1WII A;  4TNU A;  2VUG A;  2LIY A;  3G6E 1;  4BXX I;  3CC4 1;  2H85 A;  2B63 I;  3GKQ A;  1Z03 A;  1N8R 2;  3S2H I;  1NP6 A;  3HOV I;  2JUB A;  1YI2 1;  2O4H A;  2R7Z I;  2JMO A;  3NDJ A;  3CCJ 1;  3CC2 1;  1YUA A;  1Q86 2;  5CM2 M;  3U50 C;  1YIJ 1;  1VQM Z;  3FQM A;  3BG1 B;  4MH4 A;  1Q7Y 2;  2K3R A;  1K8A 2;  1W2B Z;  1ZB8 A;  1KQS Y;  2HF1 A;  2QKD A;  1Q81 2;  3GTP I;  5A2Q b;  5T67 A;  1VQ7 Z;  1VQL 1;  3IX0 A;  3G6E Z;  2O53 A;  2V8K A;  3CC4 Z;  1YJ9 1;  3NH4 A;  3KIF A;  1YI2 Z;  3S15 I;  2IZ3 A;  3VMG A;  3VMH A;  3I56 1;  5A2Q f;  4DQY B;  3CCJ Z;  1ZB9 A;  4E31 A;  3CC2 Z;  2W03 A;  3CME Z;  4RV9 A;  1M1K 1;  3NFZ A;  2V8I A;  4NBG A;  1TFI A;  4E30 A;  1WCM I;  1YIJ Z;  2P3Y A;  1Q7Y 1;  3JAM b;  3I55 1;  2JR6 A;  3PO3 I;  1X3Z A;  1VQN 1;  4RS4 A;  1YJN 1;  1VQ9 1;  4A3J I;  3CC7 1;  5AN9 F;  2OOY B;  2OZK A;  3JAM f;  4RVD A;  3VB9 A;  1KD1 1;  1YJ9 Z;  2KI7 B;  2QEX 1;  1VLA A;  3H0G I;  1K9M 2;  2K5R A;  1TWH I;  2OTL 1;  3GTM S;  1Y1V S;  1YHQ 1;  2JNY A;  4CL1 A;  2QLV B;  4NB9 A;  1Z02 A;  1I50 I;  3I07 A;  4HH4 A;  1VQO Z;  3I55 Z;  3CCR 1;  4DK1 A;  3NH5 A;  4NOZ A;  4Y7N I;  4A3G I;  4NBD A;  3D6W A;  1N2F A;  1VQN Z;  2JA5 I;  3M3Y I;  1YJN Z;  1VQ9 Z;  2R92 I;  3S1N I;  3CC7 Z;  3FKI I;  2Q51 A;  4A3C I;  2QEX Z;  3J80 b;  1W2B Y;  5C4X I;  1K9M 1;  2GTH A;  2OTL Z;  3HOU I;  4RVG A;  1YHQ Z;  5LL6 f;  1YJW 1;  4NBA A;  4A93 I;  3HOW I;  2P28 A;  3J80 f;  3CCR Z;  4AYB A;  3NDI A;  3CME 1;  1QVF Z;  5IP9 I;  3CD6 1;  3I4N I;  1NJI 2;  1VQ8 Z;  4BY7 I;  2RIQ A;  2F4M A;  3MZL B;  1DL6 A;  3H3V J;  4NFR A;  4QTT A;  1S7M A;  4A3D I;  3CCQ 1;  2JA6 I;  1M90 2;  1P9N A;  2Y0S A;  4MON A;  4A3F I;  3F3P C;  1VQ6 1;  4HGZ A;  1QVG Z;  2F4O A;  2YAD A;  3BG0 B;  3F3F C;  1KRL A;  2J6A A;  2NVX I;  1KC8 2;  1ML8 A;  2GTI A;  2JA7 I;  2RBL A;  4E32 A;  1N8R 1;  2M6N A;  1YJW Z;  1QYP A;  3KIH A;  1Z01 A;  2W04 A;  2E2I I;  3HOX I;  1Q86 1;  3CD6 Z;  1NJI 1;  2OTJ Z;  4XX2 A;  3CCS 1;  4NBH A;  2PK7 A;  3EER A;  1VQ4 1;  5T64 A;  2EGT A;  2QRE B;  1VQO 1;  3CCQ Z;  2Q4Z A;  1K8A 1;  1K83 I;  4E2Z A;  3S17 I;  1YIT 1;  2GU2 A;  3GTQ I;  1Q81 1;  1VQ6 Z;  1TWF I;  3RZO I;  2R93 I;  3TE5 B;  1KC8 1;  3EED A;  4E2X A;  2WAQ A;  4A3L I;  3CMA Z;  1KQS Z;  2BJO A;  1K73 2;  3S1Q I;  4A3E I;  1VQP 1;  5T6B A;  3CCS Z;  4NBE A;  1VQ4 Z;  3QWU A;  1VQK 1;  3HOY I;  1L1O C;  2QR1 B;  3MON A;  2HU9 A;  4BBS I;  1YIT Z;  1RNI A;  2R6M A;  1VQ8 1;  1WW9 A;  4E2W A;  1I3Q I;  3GTK I;  3OW2 Z;  1TWC I;  3RZD I;  2NVT I;  3IF8 A;  1RLY A;  1RO4 A;  4NBF A;  1JWH C;  4E33 A;  1RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...