3T4NB

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Carbon catabolite-derepressing protein kinase
total genus 19
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3t4nB01
2QRCB 2QR1B 2QREB 2QRDB 2OOYB 3TE5B 3T4NB 2QLVB 3TDHB 2OOXB
chains in the Genus database with same CATH superfamily
3U50C 4E30A 1N8R1 2PK7A 1I3QI 4QTUA 3CCE1 2I3CA 2Q51A 3KIHA 2V3VA 2VPWA 5A2Qf 2NVTI 2JA6I 1YI2Z 1VQPZ 5FLMI 1VQNZ 3QWUA 2LEXA 1X0TA 1RNIA 2VPYA 4NOZA 4NBHA 1K9M1 1QXFA 4RV9A 3CME1 1K731 1Q7Y2 3CPWY 2R92I 3F3PC 2DE6A 3I4NI 1VQLZ 2P28A 1M902 3G71Z 4BY7I 4BBSI 4RVDA 4E2YA 2JIPA 5T67A 3GTKI 1WIIA 5D1OB 1S72Z 3PO3I 2JIRA 4XX2A 3GTMS 3I4MI 1TWFI 4AYBA 1VQ81 4A3LI 4A3II 3GTMI 5FLXf 3HOWI 1QVFZ 2M48A 2JIQA 2IV2X 3CC7Z 1LQLA 1Q821 2RIQA 4E32A 3TDHB 2AYDA 1Q861 2LIYA 2JIMA 2OOXB 3NH5A 1RO4A 2V8KA 2JS4A 4NBAA 3VB9A 3OW2Z 1YUAA 5D1OA 3CCUZ 2JIOA 2NVYI 2O4HA 1SFOI 5IT9b 3NH4A 1VQ9Z 3J80f 1WJ2A 3G6EZ 1VQ51 1Q812 1R9TI 2NVQI 4NBCA 4E33A 5C4JI 5D1PA 2QRCB 4Y52I 1N2FA 5T64A 1QVGY 1RO2A 3G711 1Q822 3CCV1 1VQL1 2EGTA 2RPRA 3JAMf 2W04A 2IZ3A 1Y1VS 3CCMZ 4QTTA 1YJ91 1YIJZ 1JJ2Y 2J6AA 3GTJI 2QR1B 1VQ8Z 2V8JA 2E2II 3CCSZ 2VPZA 2YU9I 1VQ71 2GTIA 3T4NB 2VPXA 4A93I 3S2DI 2V45A 5AN9F 2JNYA 4BBRI 2QRDB 5LL6f 3D2LA 4NB8A 1Q811 2P3YA 2M6NA 1NP6A 4RVGA 2OZKA 3J80b 2H85A 3CCJZ 2VF1A 1M1K2 3S17I 2IZ4A 2JUBA 3GTPI 2QLVB 2B63I 3HOZI 1WCMI 3CC2Z 4E2XA 2QA4Z 3MZLB 5IP9I 2NAPA 2QKDA 5CM2M 5T6BA 1Z03A 3TE5B 3K7AI 4A3MI 2W03A 3M3YI 4BXXI 1M1K1 4HGYA 3J81f 4TNUA 1YIJ1 1KQSZ 3CCU1 1WZNA 4MONA 3CCJ1 1FDIA 4MD7A 3D6WA 3LUSA 3F3FC 2F4OA 4NBBA 3G4SZ 3S2HI 4S1TA 2R6MA 3CC41 4MD9A 1K9M2 4MD8A 3I551 3CPWZ 1YJW1 1Y1VI 3CCQ1 1Q16A 1KC81 4A3DI 4MH4A 3CCS1 1USPA 3CXCY 4A3KI 1WW9A 5C3EI 5C4XI 1YITZ 1K732 4A3EI 1VQ41 3CQZI 1S721 3I561 4DGLA 1YJNZ 2JA5I 3GTLI 1I6HI 2QA41 3CCRZ 5C44I 4A3FI 1YHQZ 4NBDA 1S7MA 3NH8A 4RVFA 3D9XA 3G6E1 1N8R2 1W2BY 3HOUI 3IX0A 1VLAA 4E2WA 4NBFA 3GKQA 1SIWA 2DE7A 3FKII 4A3GI 1K8A1 3IF8A 2F4MA 2AKLA 2YADA 4NBGA 3FQMA 1RQFA 4NB9A 2V8IA 3VMGA 3KIFA 1YJ9Z 2Y0SA 1KRLA 4Y7NI 1NJI1 4NBEA 1TFIA 3CCEZ 3HKZA 2LFUA 1QVFY 3G4S1 3VTNA 2G2KA 3IR7A 1VQ6Z 3I55Z 1Q7Y1 3EERA 1RLYA 4EWCA 3PO3S 5IT9f 3BG1B 4NFRA 2E2JI 3Q87A 3H0GI 4HGZA 3H3VJ 4E31A 3NDIA 3BG0B 1NJI2 3P5JB 1KQSY 3VMHA 1VQ4Z 3NFZA 1VQO1 3HOYI 2E9HA 4A3BI 3CCLZ 1ZB9A 3CCR1 3CMA1 3S1RI 1AA6A 2ZAEB 2JMOA 1W2BZ 1VQ5Z 3CCQZ 1Q862 3CCL1 3EEDA 3S1MI 5FLXb 5A2Qb 2QEXZ 2JR6A 2WB1A 1YIT1 3CD6Z 1VQKZ 3S16I 2PMZA 1JWHC 2R93I 2QEX1 1L1OC 3IFUA 3ESWA 3M4OI 1RO0A 4RS4A 2DE5A 2PM9A 2NVXI 1YUKA 3CCVZ 1VQMZ 1TWHI 3CMAZ 3NDJA 1JJ2Z 3CMEZ 2VUGA 3HOXI 4DK1A 4HH4A 1QF8A 2KI7B 3S15I 4A3JI 2OTJZ 1KD12 3I56Z 1Y1WI 3GTOI 3RZOI 1VQ7Z 1USPB 2OTLZ 2RHBA 4MRIA 1VQK1 3JAMb 1VQN1 2E7ZA 3I07A 2WAQA 4MXUA 1KD11 3PO2I 3GCFA 2R7ZI 1ZB8A 4E2ZA 2BJOA 3S1QI 1QVGZ 1X3ZA 3CC21 3CC4Z 1ZH1A 1VQ91 1VQM1 1YJN1 4NH1C 2RBLA 1Z01A 3MZKB 4BY1I 3GTGI 2OTJ1 3CD61 4A3CI 2O53A 1VQP1 1FDOA 2JA7I 1Z02A 1VQ61 2GU2A 3J81b 1NUIA 2K5RA 2JA8I 2VUMI 3CC71 2E2HI 1YJWZ 1K8A2 1TWAI 1X3WA 1YHQ1 1TWGI 3J7A4 4CL1A 1K83I 1M901 4DQYB 1TWCI 1QYPA 1I50I 1ML8A 1YI21 3S14I 2HF1A 1Y8CA 1VQOZ 3OW2Y 2Q4ZA 2RT9A 1DL6A 3RZDI 2OTL1 3CCM1 1P9NA 3MONA 3CXCZ 2K3RA 3HOVI 3FQQA 2QREB 1PFTA 2OOYB 3VMIA 1KC82 3GTQI 2KPIA 3S1NI 2GTHA 4RVHA 4X6AI 2HU9A 5IP7I
chains in the Genus database with same CATH topology
3U50C 4E30A 1N8R1 2PK7A 1I3QI 4QTUA 3CCE1 2I3CA 2Q51A 3KIHA 5A2Qf 2NVTI 2JA6I 1YI2Z 1VQPZ 5FLMI 1VQNZ 3QWUA 1X0TA 1RNIA 4NOZA 4NBHA 1K9M1 4RV9A 3CME1 1K731 1Q7Y2 3CPWY 2R92I 3F3PC 2DE6A 3I4NI 1VQLZ 2P28A 1M902 3G71Z 4BY7I 4BBSI 4RVDA 4E2YA 3GTKI 5T67A 3PO3I 1WIIA 5D1OB 1S72Z 4XX2A 3GTMS 3I4MI 1TWFI 4AYBA 1VQ81 4A3LI 4A3II 3GTMI 5FLXf 3HOWI 1QVFZ 2M48A 3CC7Z 1LQLA 1Q821 2RIQA 4E32A 3TDHB 1Q861 2LIYA 2OOXB 3NH5A 1RO4A 2V8KA 2JS4A 4NBAA 3VB9A 3OW2Z 1YUAA 5D1OA 3CCUZ 2O4HA 2NVYI 1SFOI 5IT9b 3NH4A 1VQ9Z 3J80f 3G6EZ 1VQ51 1Q812 1R9TI 2NVQI 4NBCA 4E33A 5C4JI 5D1PA 2QRCB 4Y52I 1N2FA 5T64A 1QVGY 1RO2A 3G711 1Q822 3CCV1 1VQL1 2EGTA 2RPRA 3JAMf 2W04A 2IZ3A 1Y1VS 3CCMZ 4QTTA 1YJ91 1YIJZ 1JJ2Y 2J6AA 3GTJI 2QR1B 1VQ8Z 2V8JA 2E2II 3CCSZ 2YU9I 1VQ71 2GTIA 3T4NB 4A93I 3S2DI 5AN9F 2JNYA 4BBRI 2QRDB 5LL6f 4NB8A 1Q811 2P3YA 2M6NA 1NP6A 4RVGA 2OZKA 3J80b 2H85A 3CCJZ 2VF1A 1M1K2 3S17I 2IZ4A 2JUBA 3GTPI 2QLVB 2B63I 3HOZI 1WCMI 3CC2Z 4E2XA 2QA4Z 3MZLB 5IP9I 2QKDA 5CM2M 5T6BA 1Z03A 3TE5B 3K7AI 4A3MI 2W03A 3M3YI 4BXXI 1M1K1 4HGYA 3J81f 4TNUA 1YIJ1 1KQSZ 3CCU1 4MONA 3CCJ1 4MD7A 3D6WA 3LUSA 3F3FC 2F4OA 4NBBA 3G4SZ 3S2HI 4S1TA 2R6MA 3CC41 4MD9A 1K9M2 4MD8A 3I551 3CPWZ 1YJW1 1Y1VI 3CCQ1 1KC81 4A3DI 4MH4A 3CCS1 1USPA 3CXCY 4A3KI 1WW9A 5C3EI 5C4XI 1YITZ 1K732 4A3EI 1VQ41 3CQZI 1S721 3I561 4DGLA 1YJNZ 2JA5I 3GTLI 1I6HI 2QA41 3CCRZ 5C44I 4A3FI 1YHQZ 4NBDA 1S7MA 3NH8A 4RVFA 3D9XA 3G6E1 1N8R2 1W2BY 3HOUI 3IX0A 1VLAA 4E2WA 4NBFA 3GKQA 2DE7A 3FKII 4A3GI 1K8A1 3IF8A 2F4MA 2AKLA 2YADA 4NBGA 3FQMA 1RQFA 4NB9A 2V8IA 3VMGA 3KIFA 1YJ9Z 2Y0SA 1KRLA 4Y7NI 1NJI1 4NBEA 1TFIA 3CCEZ 3HKZA 2LFUA 1QVFY 3G4S1 3VTNA 2G2KA 1VQ6Z 3I55Z 1Q7Y1 3EERA 1RLYA 4EWCA 3PO3S 3BG1B 4NFRA 5IT9f 2E2JI 3Q87A 3H0GI 4HGZA 3H3VJ 4E31A 3NDIA 3BG0B 1NJI2 3P5JB 1KQSY 3VMHA 1VQ4Z 3NFZA 1VQO1 3HOYI 2E9HA 4A3BI 3CCLZ 1ZB9A 3CCR1 3CMA1 3S1RI 1W2BZ 2ZAEB 2JMOA 1VQ5Z 3CCQZ 1Q862 3CCL1 3EEDA 3S1MI 5FLXb 5A2Qb 2QEXZ 2JR6A 2WB1A 1YIT1 3CD6Z 1VQKZ 3S16I 2PMZA 1JWHC 2R93I 2QEX1 1L1OC 3IFUA 3ESWA 3M4OI 1RO0A 4RS4A 2DE5A 2PM9A 2NVXI 1YUKA 3CCVZ 1VQMZ 1TWHI 3CMAZ 3NDJA 1JJ2Z 3CMEZ 2VUGA 3HOXI 4DK1A 4HH4A 1QF8A 2KI7B 3S15I 4A3JI 2OTJZ 1KD12 3I56Z 1Y1WI 3GTOI 3RZOI 1VQ7Z 1USPB 2OTLZ 2RHBA 4MRIA 1VQK1 3JAMb 1VQN1 3I07A 2WAQA 4MXUA 1KD11 3PO2I 3GCFA 2R7ZI 1ZB8A 4E2ZA 2BJOA 3S1QI 1QVGZ 1X3ZA 3CC21 3CC4Z 1ZH1A 1VQ91 1VQM1 1YJN1 4NH1C 2RBLA 1Z01A 3MZKB 4BY1I 3GTGI 2OTJ1 3CD61 4A3CI 2O53A 1VQP1 2JA7I 1Z02A 1VQ61 2GU2A 3J81b 1NUIA 2K5RA 2JA8I 2VUMI 3CC71 2E2HI 1YJWZ 1K8A2 1TWAI 1X3WA 1YHQ1 1TWGI 3J7A4 4CL1A 1K83I 1M901 4DQYB 1TWCI 1QYPA 1YI21 1I50I 1ML8A 3S14I 2HF1A 1VQOZ 3OW2Y 2Q4ZA 2RT9A 1DL6A 3RZDI 2OTL1 3CCM1 1P9NA 3MONA 3CXCZ 2K3RA 3HOVI 3FQQA 2QREB 1PFTA 2OOYB 3VMIA 1KC82 3GTQI 2KPIA 3S1NI 2GTHA 4RVHA 4X6AI 2HU9A 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRC B;  2QR1 B;  2QRE B;  2QRD B;  2OOY B;  3TE5 B;  3T4N B;  2QLV B;  3TDH B;  2OOX B; 
#chains in the Genus database with same CATH topology
 3U50 C;  4E30 A;  1N8R 1;  2PK7 A;  1I3Q I;  4QTU A;  3CCE 1;  2I3C A;  2Q51 A;  3KIH A;  2V3V A;  2VPW A;  5A2Q f;  2NVT I;  2JA6 I;  1YI2 Z;  1VQP Z;  5FLM I;  1VQN Z;  3QWU A;  2LEX A;  1X0T A;  1RNI A;  2VPY A;  4NOZ A;  4NBH A;  1K9M 1;  1QXF A;  4RV9 A;  3CME 1;  1K73 1;  1Q7Y 2;  3CPW Y;  2R92 I;  3F3P C;  2DE6 A;  3I4N I;  1VQL Z;  2P28 A;  1M90 2;  3G71 Z;  4BY7 I;  4BBS I;  4RVD A;  4E2Y A;  2JIP A;  5T67 A;  3GTK I;  1WII A;  5D1O B;  1S72 Z;  3PO3 I;  2JIR A;  4XX2 A;  3GTM S;  3I4M I;  1TWF I;  4AYB A;  1VQ8 1;  4A3L I;  4A3I I;  3GTM I;  5FLX f;  3HOW I;  1QVF Z;  2M48 A;  2JIQ A;  2IV2 X;  3CC7 Z;  1LQL A;  1Q82 1;  2RIQ A;  4E32 A;  3TDH B;  2AYD A;  1Q86 1;  2LIY A;  2JIM A;  2OOX B;  3NH5 A;  1RO4 A;  2V8K A;  2JS4 A;  4NBA A;  3VB9 A;  3OW2 Z;  1YUA A;  5D1O A;  3CCU Z;  2JIO A;  2NVY I;  2O4H A;  1SFO I;  5IT9 b;  3NH4 A;  1VQ9 Z;  3J80 f;  1WJ2 A;  3G6E Z;  1VQ5 1;  1Q81 2;  1R9T I;  2NVQ I;  4NBC A;  4E33 A;  5C4J I;  5D1P A;  2QRC B;  4Y52 I;  1N2F A;  5T64 A;  1QVG Y;  1RO2 A;  3G71 1;  1Q82 2;  3CCV 1;  1VQL 1;  2EGT A;  2RPR A;  3JAM f;  2W04 A;  2IZ3 A;  1Y1V S;  3CCM Z;  4QTT A;  1YJ9 1;  1YIJ Z;  1JJ2 Y;  2J6A A;  3GTJ I;  2QR1 B;  1VQ8 Z;  2V8J A;  2E2I I;  3CCS Z;  2VPZ A;  2YU9 I;  1VQ7 1;  2GTI A;  3T4N B;  2VPX A;  4A93 I;  3S2D I;  2V45 A;  5AN9 F;  2JNY A;  4BBR I;  2QRD B;  5LL6 f;  3D2L A;  4NB8 A;  1Q81 1;  2P3Y A;  2M6N A;  1NP6 A;  4RVG A;  2OZK A;  3J80 b;  2H85 A;  3CCJ Z;  2VF1 A;  1M1K 2;  3S17 I;  2IZ4 A;  2JUB A;  3GTP I;  2QLV B;  2B63 I;  3HOZ I;  1WCM I;  3CC2 Z;  4E2X A;  2QA4 Z;  3MZL B;  5IP9 I;  2NAP A;  2QKD A;  5CM2 M;  5T6B A;  1Z03 A;  3TE5 B;  3K7A I;  4A3M I;  2W03 A;  3M3Y I;  4BXX I;  1M1K 1;  4HGY A;  3J81 f;  4TNU A;  1YIJ 1;  1KQS Z;  3CCU 1;  1WZN A;  4MON A;  3CCJ 1;  1FDI A;  4MD7 A;  3D6W A;  3LUS A;  3F3F C;  2F4O A;  4NBB A;  3G4S Z;  3S2H I;  4S1T A;  2R6M A;  3CC4 1;  4MD9 A;  1K9M 2;  4MD8 A;  3I55 1;  3CPW Z;  1YJW 1;  1Y1V I;  3CCQ 1;  1Q16 A;  1KC8 1;  4A3D I;  4MH4 A;  3CCS 1;  1USP A;  3CXC Y;  4A3K I;  1WW9 A;  5C3E I;  5C4X I;  1YIT Z;  1K73 2;  4A3E I;  1VQ4 1;  3CQZ I;  1S72 1;  3I56 1;  4DGL A;  1YJN Z;  2JA5 I;  3GTL I;  1I6H I;  2QA4 1;  3CCR Z;  5C44 I;  4A3F I;  1YHQ Z;  4NBD A;  1S7M A;  3NH8 A;  4RVF A;  3D9X A;  3G6E 1;  1N8R 2;  1W2B Y;  3HOU I;  3IX0 A;  1VLA A;  4E2W A;  4NBF A;  3GKQ A;  1SIW A;  2DE7 A;  3FKI I;  4A3G I;  1K8A 1;  3IF8 A;  2F4M A;  2AKL A;  2YAD A;  4NBG A;  3FQM A;  1RQF A;  4NB9 A;  2V8I A;  3VMG A;  3KIF A;  1YJ9 Z;  2Y0S A;  1KRL A;  4Y7N I;  1NJI 1;  4NBE A;  1TFI A;  3CCE Z;  3HKZ A;  2LFU A;  1QVF Y;  3G4S 1;  3VTN A;  2G2K A;  3IR7 A;  1VQ6 Z;  3I55 Z;  1Q7Y 1;  3EER A;  1RLY A;  4EWC A;  3PO3 S;  5IT9 f;  3BG1 B;  4NFR A;  2E2J I;  3Q87 A;  3H0G I;  4HGZ A;  3H3V J;  4E31 A;  3NDI A;  3BG0 B;  1NJI 2;  3P5J B;  1KQS Y;  3VMH A;  1VQ4 Z;  3NFZ A;  1VQO 1;  3HOY I;  2E9H A;  4A3B I;  3CCL Z;  1ZB9 A;  3CCR 1;  3CMA 1;  3S1R I;  1AA6 A;  2ZAE B;  2JMO A;  1W2B Z;  1VQ5 Z;  3CCQ Z;  1Q86 2;  3CCL 1;  3EED A;  3S1M I;  5FLX b;  5A2Q b;  2QEX Z;  2JR6 A;  2WB1 A;  1YIT 1;  3CD6 Z;  1VQK Z;  3S16 I;  2PMZ A;  1JWH C;  2R93 I;  2QEX 1;  1L1O C;  3IFU A;  3ESW A;  3M4O I;  1RO0 A;  4RS4 A;  2DE5 A;  2PM9 A;  2NVX I;  1YUK A;  3CCV Z;  1VQM Z;  1TWH I;  3CMA Z;  3NDJ A;  1JJ2 Z;  3CME Z;  2VUG A;  3HOX I;  4DK1 A;  4HH4 A;  1QF8 A;  2KI7 B;  3S15 I;  4A3J I;  2OTJ Z;  1KD1 2;  3I56 Z;  1Y1W I;  3GTO I;  3RZO I;  1VQ7 Z;  1USP B;  2OTL Z;  2RHB A;  4MRI A;  1VQK 1;  3JAM b;  1VQN 1;  2E7Z A;  3I07 A;  2WAQ A;  4MXU A;  1KD1 1;  3PO2 I;  3GCF A;  2R7Z I;  1ZB8 A;  4E2Z A;  2BJO A;  3S1Q I;  1QVG Z;  1X3Z A;  3CC2 1;  3CC4 Z;  1ZH1 A;  1VQ9 1;  1VQM 1;  1YJN 1;  4NH1 C;  2RBL A;  1Z01 A;  3MZK B;  4BY1 I;  3GTG I;  2OTJ 1;  3CD6 1;  4A3C I;  2O53 A;  1VQP 1;  1FDO A;  2JA7 I;  1Z02 A;  1VQ6 1;  2GU2 A;  3J81 b;  1NUI A;  2K5R A;  2JA8 I;  2VUM I;  3CC7 1;  2E2H I;  1YJW Z;  1K8A 2;  1TWA I;  1X3W A;  1YHQ 1;  1TWG I;  3J7A 4;  4CL1 A;  1K83 I;  1M90 1;  4DQY B;  1TWC I;  1QYP A;  1I50 I;  1ML8 A;  1YI2 1;  3S14 I;  2HF1 A;  1Y8C A;  1VQO Z;  3OW2 Y;  2Q4Z A;  2RT9 A;  1DL6 A;  3RZD I;  2OTL 1;  3CCM 1;  1P9N A;  3MON A;  3CXC Z;  2K3R A;  3HOV I;  3FQQ A;  2QRE B;  1PFT A;  2OOY B;  3VMI A;  1KC8 2;  3GTQ I;  2KPI A;  3S1N I;  2GTH A;  4RVH A;  4X6A I;  2HU9 A;  5IP7 I; 
#chains in the Genus database with same CATH homology
 3U50 C;  4E30 A;  1N8R 1;  2PK7 A;  1I3Q I;  4QTU A;  3CCE 1;  2I3C A;  2Q51 A;  3KIH A;  5A2Q f;  2NVT I;  2JA6 I;  1YI2 Z;  1VQP Z;  5FLM I;  1VQN Z;  3QWU A;  1X0T A;  1RNI A;  4NOZ A;  4NBH A;  1K9M 1;  4RV9 A;  3CME 1;  1K73 1;  1Q7Y 2;  3CPW Y;  2R92 I;  3F3P C;  2DE6 A;  3I4N I;  1VQL Z;  2P28 A;  1M90 2;  3G71 Z;  4BY7 I;  4BBS I;  4RVD A;  4E2Y A;  3GTK I;  5T67 A;  3PO3 I;  1WII A;  5D1O B;  1S72 Z;  4XX2 A;  3GTM S;  3I4M I;  1TWF I;  4AYB A;  1VQ8 1;  4A3L I;  4A3I I;  3GTM I;  5FLX f;  3HOW I;  1QVF Z;  2M48 A;  3CC7 Z;  1LQL A;  1Q82 1;  2RIQ A;  4E32 A;  3TDH B;  1Q86 1;  2LIY A;  2OOX B;  3NH5 A;  1RO4 A;  2V8K A;  2JS4 A;  4NBA A;  3VB9 A;  3OW2 Z;  1YUA A;  5D1O A;  3CCU Z;  2O4H A;  2NVY I;  1SFO I;  5IT9 b;  3NH4 A;  1VQ9 Z;  3J80 f;  3G6E Z;  1VQ5 1;  1Q81 2;  1R9T I;  2NVQ I;  4NBC A;  4E33 A;  5C4J I;  5D1P A;  2QRC B;  4Y52 I;  1N2F A;  5T64 A;  1QVG Y;  1RO2 A;  3G71 1;  1Q82 2;  3CCV 1;  1VQL 1;  2EGT A;  2RPR A;  3JAM f;  2W04 A;  2IZ3 A;  1Y1V S;  3CCM Z;  4QTT A;  1YJ9 1;  1YIJ Z;  1JJ2 Y;  2J6A A;  3GTJ I;  2QR1 B;  1VQ8 Z;  2V8J A;  2E2I I;  3CCS Z;  2YU9 I;  1VQ7 1;  2GTI A;  3T4N B;  4A93 I;  3S2D I;  5AN9 F;  2JNY A;  4BBR I;  2QRD B;  5LL6 f;  4NB8 A;  1Q81 1;  2P3Y A;  2M6N A;  1NP6 A;  4RVG A;  2OZK A;  3J80 b;  2H85 A;  3CCJ Z;  2VF1 A;  1M1K 2;  3S17 I;  2IZ4 A;  2JUB A;  3GTP I;  2QLV B;  2B63 I;  3HOZ I;  1WCM I;  3CC2 Z;  4E2X A;  2QA4 Z;  3MZL B;  5IP9 I;  2QKD A;  5CM2 M;  5T6B A;  1Z03 A;  3TE5 B;  3K7A I;  4A3M I;  2W03 A;  3M3Y I;  4BXX I;  1M1K 1;  4HGY A;  3J81 f;  4TNU A;  1YIJ 1;  1KQS Z;  3CCU 1;  4MON A;  3CCJ 1;  4MD7 A;  3D6W A;  3LUS A;  3F3F C;  2F4O A;  4NBB A;  3G4S Z;  3S2H I;  4S1T A;  2R6M A;  3CC4 1;  4MD9 A;  1K9M 2;  4MD8 A;  3I55 1;  3CPW Z;  1YJW 1;  1Y1V I;  3CCQ 1;  1KC8 1;  4A3D I;  4MH4 A;  3CCS 1;  1USP A;  3CXC Y;  4A3K I;  1WW9 A;  5C3E I;  5C4X I;  1YIT Z;  1K73 2;  4A3E I;  1VQ4 1;  3CQZ I;  1S72 1;  3I56 1;  4DGL A;  1YJN Z;  2JA5 I;  3GTL I;  1I6H I;  2QA4 1;  3CCR Z;  5C44 I;  4A3F I;  1YHQ Z;  4NBD A;  1S7M A;  3NH8 A;  4RVF A;  3D9X A;  3G6E 1;  1N8R 2;  1W2B Y;  3HOU I;  3IX0 A;  1VLA A;  4E2W A;  4NBF A;  3GKQ A;  2DE7 A;  3FKI I;  4A3G I;  1K8A 1;  3IF8 A;  2F4M A;  2AKL A;  2YAD A;  4NBG A;  3FQM A;  1RQF A;  4NB9 A;  2V8I A;  3VMG A;  3KIF A;  1YJ9 Z;  2Y0S A;  1KRL A;  4Y7N I;  1NJI 1;  4NBE A;  1TFI A;  3CCE Z;  3HKZ A;  2LFU A;  1QVF Y;  3G4S 1;  3VTN A;  2G2K A;  1VQ6 Z;  3I55 Z;  1Q7Y 1;  3EER A;  1RLY A;  4EWC A;  3PO3 S;  3BG1 B;  4NFR A;  5IT9 f;  2E2J I;  3Q87 A;  3H0G I;  4HGZ A;  3H3V J;  4E31 A;  3NDI A;  3BG0 B;  1NJI 2;  3P5J B;  1KQS Y;  3VMH A;  1VQ4 Z;  3NFZ A;  1VQO 1;  3HOY I;  2E9H A;  4A3B I;  3CCL Z;  1ZB9 A;  3CCR 1;  3CMA 1;  3S1R I;  1W2B Z;  2ZAE B;  2JMO A;  1VQ5 Z;  3CCQ Z;  1Q86 2;  3CCL 1;  3EED A;  3S1M I;  5FLX b;  5A2Q b;  2QEX Z;  2JR6 A;  2WB1 A;  1YIT 1;  3CD6 Z;  1VQK Z;  3S16 I;  2PMZ A;  1JWH C;  2R93 I;  2QEX 1;  1L1O C;  3IFU A;  3ESW A;  3M4O I;  1RO0 A;  4RS4 A;  2DE5 A;  2PM9 A;  2NVX I;  1YUK A;  3CCV Z;  1VQM Z;  1TWH I;  3CMA Z;  3NDJ A;  1JJ2 Z;  3CME Z;  2VUG A;  3HOX I;  4DK1 A;  4HH4 A;  1QF8 A;  2KI7 B;  3S15 I;  4A3J I;  2OTJ Z;  1KD1 2;  3I56 Z;  1Y1W I;  3GTO I;  3RZO I;  1VQ7 Z;  1USP B;  2OTL Z;  2RHB A;  4MRI A;  1VQK 1;  3JAM b;  1VQN 1;  3I07 A;  2WAQ A;  4MXU A;  1KD1 1;  3PO2 I;  3GCF A;  2R7Z I;  1ZB8 A;  4E2Z A;  2BJO A;  3S1Q I;  1QVG Z;  1X3Z A;  3CC2 1;  3CC4 Z;  1ZH1 A;  1VQ9 1;  1VQM 1;  1YJN 1;  4NH1 C;  2RBL A;  1Z01 A;  3MZK B;  4BY1 I;  3GTG I;  2OTJ 1;  3CD6 1;  4A3C I;  2O53 A;  1VQP 1;  2JA7 I;  1Z02 A;  1VQ6 1;  2GU2 A;  3J81 b;  1NUI A;  2K5R A;  2JA8 I;  2VUM I;  3CC7 1;  2E2H I;  1YJW Z;  1K8A 2;  1TWA I;  1X3W A;  1YHQ 1;  1TWG I;  3J7A 4;  4CL1 A;  1K83 I;  1M90 1;  4DQY B;  1TWC I;  1QYP A;  1YI2 1;  1I50 I;  1ML8 A;  3S14 I;  2HF1 A;  1VQO Z;  3OW2 Y;  2Q4Z A;  2RT9 A;  1DL6 A;  3RZD I;  2OTL 1;  3CCM 1;  1P9N A;  3MON A;  3CXC Z;  2K3R A;  3HOV I;  3FQQ A;  2QRE B;  1PFT A;  2OOY B;  3VMI A;  1KC8 2;  3GTQ I;  2KPI A;  3S1N I;  2GTH A;  4RVH A;  4X6A I;  2HU9 A;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...