3T4NB

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Carbon catabolite-derepressing protein kinase
total genus 19
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3t4nB01
3T4NB 2QR1B 2QRCB 2QLVB 2QREB 2QRDB 3TE5B 2OOYB 2OOXB 3TDHB
chains in the Genus database with same CATH superfamily
1RQFA 1VQMZ 4NH1C 1VQN1 3G711 3J81f 2PMZA 4BBRI 2K5RA 2NVQI 1YUAA 3IX0A 1RNIA 5IT9f 3I55Z 1YI2Z 4NFRA 2R93I 3CPWZ 2IZ4A 1JWHC 2DE7A 1Y8CA 5LL6f 3CCRZ 3FQMA 3S1QI 2Q51A 4A3DI 4A3FI 3G6E1 1Q7Y1 1VLAA 4RVHA 3CCEZ 3GTOI 4E30A 4BY1I 2JR6A 1YUKA 3GTJI 5C4XI 1YJNZ 3GTKI 3S15I 1K732 3QWUA 1YI21 5A2Qf 3CCS1 1JJ2Y 3CCE1 3D6WA 1YJWZ 4MD8A 3S16I 4A3EI 1QXFA 4BXXI 4NB8A 4RVGA 3VMIA 3CCUZ 3CCL1 1WJ2A 2V45A 4CL1A 4A3LI 1NUIA 5IT9b 2E2JI 2E2II 3CMA1 3P5JB 1Q821 3TE5B 4A3BI 4A3GI 3CC21 4NBHA 4A3CI 1N2FA 1SIWA 2VPXA 3HOWI 4Y7NI 2J6AA 2M48A 1RO0A 2OTLZ 1VQPZ 1Y1WI 1N8R2 3OW2Z 2LIYA 5CM2M 2QRDB 2RBLA 2DE5A 2E9HA 1Y1VI 4E31A 3CME1 2QKDA 2RIQA 4BBSI 3JAMb 1W2BZ 2K3RA 4HGYA 2IZ3A 1KD12 3F3PC 3RZOI 1WW9A 2RHBA 4E32A 2Q4ZA 3H3VJ 2GTIA 1YIJZ 2BJOA 2JMOA 1Q862 1I50I 3G6EZ 4DGLA 1R9TI 2YADA 2EGTA 2KPIA 3CCR1 2YU9I 4E2WA 1JJ2Z 1Q861 3BG1B 1WCMI 4X6AI 2JA7I 3CCV1 3PO2I 3S2DI 5C4JI 2I3CA 1M1K1 2E2HI 2QR1B 5FLXb 1S7MA 2W03A 2AKLA 3VTNA 3CCSZ 2JIOA 4DK1A 1VQM1 2OTJZ 2NVTI 3ESWA 4NBEA 1WIIA 3S2HI 3CXCZ 2PM9A 3S1RI 3LUSA 2JNYA 2JIQA 2B63I 1P9NA 3CCJ1 5A2Qb 4MD9A 3CCJZ 1Q811 1NJI2 3CPWY 3I07A 3K7AI 4RV9A 3M3YI 3HOZI 2R7ZI 2WAQA 3CMAZ 3NFZA 4QTTA 2O53A 1QVGZ 1Z01A 1K731 3CCLZ 2JS4A 3H0GI 3G71Z 2R92I 2GTHA 1RO2A 1USPA 4MRIA 1Q16A 5FLXf 2GU2A 1I6HI 2W04A 2M6NA 1VQ7Z 1SFOI 2VPWA 1KRLA 2VF1A 3MZLB 1VQ91 1YJW1 3NH4A 3EERA 3I4MI 1NP6A 3JAMf 1WZNA 2QA41 2JUBA 1VQO1 2QA4Z 1FDIA 3IF8A 2PK7A 1KQSZ 3GCFA 1Q822 2NAPA 2Y0SA 1K9M1 4A93I 2QRCB 4AYBA 3CC2Z 1I3QI 3CC41 4NBAA 4HGZA 1VQ8Z 3CD61 5D1OA 1USPB 1VQ4Z 3KIFA 1QF8A 2QEX1 3HOUI 3J7A4 2P28A 3NDIA 3NH5A 3CCVZ 1Q7Y2 2V8KA 3MONA 3Q87A 2VUMI 3G4SZ 2VPZA 3CC4Z 1KQSY 3CXCY 3CC7Z 2OZKA 1YJ9Z 2VUGA 4MONA 4NBDA 5T6BA 4RS4A 1DL6A 3NDJA 3EEDA 2JIMA 2O4HA 2QEXZ 4Y52I 4RVFA 3GTLI 4TNUA 3VMHA 1FDOA 4E2ZA 1YJN1 3J80f 1VQOZ 3GTPI 3GTGI 2V8IA 4EWCA 2LEXA 4NBFA 3CCMZ 2RT9A 1S721 3CMEZ 4E33A 1QYPA 2E7ZA 2OOYB 5D1OB 1VQ5Z 1VQ51 1TWGI 1VQP1 3BG0B 3I56Z 2HF1A 3CCM1 3D2LA 3PO3S 2ZAEB 1K9M2 1X3WA 3OW2Y 2NVYI 1Q812 1NJI1 1KC82 1M902 1VQ6Z 3CCQ1 3S17I 4A3KI 4MXUA 1VQLZ 1W2BY 3TDHB 1KC81 1M901 5AN9F 1K8A1 1VQ9Z 4E2XA 3CCU1 2JA8I 4QTUA 1KD11 1VQNZ 1VQL1 4BY7I 3PO3I 3CCQZ 2QLVB 1K8A2 1VQ61 1RLYA 3VMGA 5T64A 2IV2X 5D1PA 4XX2A 1PFTA 3S14I 2JIRA 3GTMI 1X3ZA 2V3VA 5FLMI 1AA6A 1TWFI 3FKII 1VQ41 4NBCA 3CD6Z 2P3YA 2OTJ1 1VQ81 5C3EI 1QVGY 1VQK1 3I4NI 5T67A 1RO4A 1ZB8A 3GTQI 1ZB9A 4MH4A 3IR7A 3VB9A 4E2YA 1TFIA 3CC71 1YHQZ 1QVFZ 2VPYA 5IP7I 2H85A 3RZDI 1YITZ 1Z03A 3G4S1 4NBGA 4NB9A 3HOXI 4A3MI 3I551 1K83I 2HU9A 2NVXI 3FQQA 2JIPA 2F4MA 3U50C 1TWAI 3GKQA 3M4OI 3T4NB 1N8R1 1YIT1 2G2KA 1Z02A 2RPRA 3IFUA 3NH8A 2OOXB 1YHQ1 2DE6A 4RVDA 2QREB 3MZKB 3I561 1TWHI 1YIJ1 1L1OC 4S1TA 2KI7B 2LFUA 3KIHA 4NBBA 2OTL1 2V8JA 4A3JI 1QVFY 4DQYB 1VQKZ 2WB1A 4HH4A 2R6MA 1S72Z 1LQLA 1X0TA 3HOYI 3CQZI 3HOVI 2AYDA 2F4OA 3GTMS 5C44I 3J80b 3F3FC 1ZH1A 3J81b 3HKZA 4NOZA 1Y1VS 2JA6I 2JA5I 3S1NI 1TWCI 3S1MI 1YJ91 1M1K2 1VQ71 4A3II 4MD7A 5IP9I 3D9XA 1ML8A
chains in the Genus database with same CATH topology
1RQFA 1VQMZ 4NH1C 1VQN1 3G711 3J81f 2PMZA 4BBRI 2K5RA 2NVQI 1YUAA 3IX0A 1RNIA 5IT9f 3I55Z 1YI2Z 4NFRA 2R93I 3CPWZ 2IZ4A 1JWHC 2DE7A 5LL6f 3CCRZ 3FQMA 3S1QI 2Q51A 4A3DI 4A3FI 3G6E1 1Q7Y1 1VLAA 4RVHA 3CCEZ 3GTOI 4E30A 4BY1I 2JR6A 1YUKA 3GTJI 5C4XI 1YJNZ 3GTKI 3S15I 1K732 3QWUA 1YI21 5A2Qf 3CCS1 1JJ2Y 3CCE1 3D6WA 1YJWZ 4MD8A 3S16I 4A3EI 4BXXI 4NB8A 4RVGA 3VMIA 3CCUZ 3CCL1 4CL1A 4A3LI 1NUIA 5IT9b 2E2JI 2E2II 3CMA1 3P5JB 1Q821 3TE5B 4A3BI 4A3GI 3CC21 4NBHA 4A3CI 1N2FA 3HOWI 4Y7NI 2J6AA 2M48A 1RO0A 2OTLZ 1VQPZ 1Y1WI 1N8R2 3OW2Z 2LIYA 5CM2M 2QRDB 2RBLA 2DE5A 2E9HA 1Y1VI 4E31A 3CME1 2QKDA 2RIQA 4BBSI 3JAMb 1W2BZ 2K3RA 4HGYA 2IZ3A 1KD12 3F3PC 3RZOI 1WW9A 2RHBA 4E32A 2Q4ZA 3H3VJ 2GTIA 1YIJZ 2BJOA 2JMOA 1Q862 1I50I 3G6EZ 4DGLA 1R9TI 2YADA 2EGTA 2KPIA 3CCR1 2YU9I 4E2WA 1JJ2Z 1Q861 3BG1B 1WCMI 4X6AI 2JA7I 3CCV1 3PO2I 3S2DI 5C4JI 2I3CA 1M1K1 2E2HI 2QR1B 5FLXb 1S7MA 2W03A 2AKLA 3VTNA 3CCSZ 4DK1A 1VQM1 2OTJZ 2NVTI 3ESWA 4NBEA 1WIIA 3S2HI 3CXCZ 2PM9A 3S1RI 3LUSA 2JNYA 2B63I 1P9NA 3CCJ1 5A2Qb 4MD9A 3CCJZ 1Q811 1NJI2 3CPWY 3I07A 3K7AI 4RV9A 3M3YI 3HOZI 2R7ZI 2WAQA 3CMAZ 3NFZA 4QTTA 2O53A 1QVGZ 1Z01A 1K731 3CCLZ 2JS4A 3H0GI 3G71Z 2R92I 2GTHA 1RO2A 1USPA 4MRIA 5FLXf 2GU2A 1I6HI 2W04A 2M6NA 1VQ7Z 1SFOI 1KRLA 2VF1A 3MZLB 1VQ91 1YJW1 3NH4A 3EERA 3I4MI 1NP6A 3JAMf 2QA41 2JUBA 1VQO1 2QA4Z 3IF8A 2PK7A 1KQSZ 3GCFA 1Q822 2Y0SA 1K9M1 4A93I 2QRCB 4AYBA 3CC2Z 1I3QI 3CC41 4NBAA 4HGZA 1VQ8Z 3CD61 5D1OA 1USPB 1VQ4Z 3KIFA 1QF8A 2QEX1 3HOUI 3J7A4 2P28A 3NDIA 3NH5A 3CCVZ 1Q7Y2 2V8KA 3MONA 3Q87A 2VUMI 3G4SZ 3CC4Z 1KQSY 3CXCY 3CC7Z 2OZKA 1YJ9Z 2VUGA 4MONA 4NBDA 5T6BA 4RS4A 1DL6A 3NDJA 3EEDA 2O4HA 2QEXZ 4Y52I 4RVFA 3GTLI 4TNUA 3VMHA 4E2ZA 1YJN1 3J80f 1VQOZ 3GTPI 3GTGI 2V8IA 4EWCA 4NBFA 3CCMZ 2RT9A 1S721 3CMEZ 4E33A 1QYPA 2OOYB 5D1OB 1VQ5Z 1VQ51 1TWGI 1VQP1 3BG0B 3I56Z 2HF1A 3CCM1 3PO3S 2ZAEB 1K9M2 1X3WA 3OW2Y 2NVYI 1Q812 1NJI1 1KC82 1M902 1VQ6Z 3CCQ1 3S17I 4A3KI 4MXUA 1VQLZ 1W2BY 3TDHB 1KC81 1M901 5AN9F 1K8A1 1VQ9Z 4E2XA 3CCU1 2JA8I 4QTUA 1KD11 1VQNZ 1VQL1 4BY7I 3PO3I 3CCQZ 2QLVB 1K8A2 1VQ61 1RLYA 3VMGA 5T64A 5D1PA 4XX2A 1PFTA 3S14I 3GTMI 1X3ZA 5FLMI 1VQ41 1TWFI 3FKII 4NBCA 3CD6Z 2P3YA 2OTJ1 1VQ81 5C3EI 1QVGY 1VQK1 3I4NI 5T67A 1RO4A 1ZB8A 3GTQI 1ZB9A 4MH4A 3VB9A 4E2YA 1TFIA 3CC71 1YHQZ 1QVFZ 5IP7I 2H85A 3RZDI 1YITZ 1Z03A 3G4S1 4NBGA 4NB9A 3HOXI 4A3MI 3I551 1K83I 2HU9A 2NVXI 3FQQA 2F4MA 3U50C 1TWAI 3GKQA 3M4OI 3T4NB 1N8R1 1YIT1 2G2KA 1Z02A 2RPRA 3IFUA 3NH8A 2OOXB 1YHQ1 2DE6A 4RVDA 2QREB 3MZKB 3I561 1TWHI 1YIJ1 1L1OC 4S1TA 2KI7B 2LFUA 3KIHA 4NBBA 2OTL1 2V8JA 4A3JI 1QVFY 4DQYB 1VQKZ 1S72Z 2WB1A 2R6MA 4HH4A 1LQLA 1X0TA 3HOYI 3CQZI 3HOVI 2F4OA 3GTMS 5C44I 3J80b 3F3FC 1ZH1A 3J81b 3HKZA 4NOZA 1Y1VS 2JA6I 2JA5I 3S1NI 1TWCI 3S1MI 1YJ91 1M1K2 1VQ71 4A3II 4MD7A 5IP9I 3D9XA 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4N B;  2QR1 B;  2QRC B;  2QLV B;  2QRE B;  2QRD B;  3TE5 B;  2OOY B;  2OOX B;  3TDH B; 
#chains in the Genus database with same CATH topology
 1RQF A;  1VQM Z;  4NH1 C;  1VQN 1;  3G71 1;  3J81 f;  2PMZ A;  4BBR I;  2K5R A;  2NVQ I;  1YUA A;  3IX0 A;  1RNI A;  5IT9 f;  3I55 Z;  1YI2 Z;  4NFR A;  2R93 I;  3CPW Z;  2IZ4 A;  1JWH C;  2DE7 A;  1Y8C A;  5LL6 f;  3CCR Z;  3FQM A;  3S1Q I;  2Q51 A;  4A3D I;  4A3F I;  3G6E 1;  1Q7Y 1;  1VLA A;  4RVH A;  3CCE Z;  3GTO I;  4E30 A;  4BY1 I;  2JR6 A;  1YUK A;  3GTJ I;  5C4X I;  1YJN Z;  3GTK I;  3S15 I;  1K73 2;  3QWU A;  1YI2 1;  5A2Q f;  3CCS 1;  1JJ2 Y;  3CCE 1;  3D6W A;  1YJW Z;  4MD8 A;  3S16 I;  4A3E I;  1QXF A;  4BXX I;  4NB8 A;  4RVG A;  3VMI A;  3CCU Z;  3CCL 1;  1WJ2 A;  2V45 A;  4CL1 A;  4A3L I;  1NUI A;  5IT9 b;  2E2J I;  2E2I I;  3CMA 1;  3P5J B;  1Q82 1;  3TE5 B;  4A3B I;  4A3G I;  3CC2 1;  4NBH A;  4A3C I;  1N2F A;  1SIW A;  2VPX A;  3HOW I;  4Y7N I;  2J6A A;  2M48 A;  1RO0 A;  2OTL Z;  1VQP Z;  1Y1W I;  1N8R 2;  3OW2 Z;  2LIY A;  5CM2 M;  2QRD B;  2RBL A;  2DE5 A;  2E9H A;  1Y1V I;  4E31 A;  3CME 1;  2QKD A;  2RIQ A;  4BBS I;  3JAM b;  1W2B Z;  2K3R A;  4HGY A;  2IZ3 A;  1KD1 2;  3F3P C;  3RZO I;  1WW9 A;  2RHB A;  4E32 A;  2Q4Z A;  3H3V J;  2GTI A;  1YIJ Z;  2BJO A;  2JMO A;  1Q86 2;  1I50 I;  3G6E Z;  4DGL A;  1R9T I;  2YAD A;  2EGT A;  2KPI A;  3CCR 1;  2YU9 I;  4E2W A;  1JJ2 Z;  1Q86 1;  3BG1 B;  1WCM I;  4X6A I;  2JA7 I;  3CCV 1;  3PO2 I;  3S2D I;  5C4J I;  2I3C A;  1M1K 1;  2E2H I;  2QR1 B;  5FLX b;  1S7M A;  2W03 A;  2AKL A;  3VTN A;  3CCS Z;  2JIO A;  4DK1 A;  1VQM 1;  2OTJ Z;  2NVT I;  3ESW A;  4NBE A;  1WII A;  3S2H I;  3CXC Z;  2PM9 A;  3S1R I;  3LUS A;  2JNY A;  2JIQ A;  2B63 I;  1P9N A;  3CCJ 1;  5A2Q b;  4MD9 A;  3CCJ Z;  1Q81 1;  1NJI 2;  3CPW Y;  3I07 A;  3K7A I;  4RV9 A;  3M3Y I;  3HOZ I;  2R7Z I;  2WAQ A;  3CMA Z;  3NFZ A;  4QTT A;  2O53 A;  1QVG Z;  1Z01 A;  1K73 1;  3CCL Z;  2JS4 A;  3H0G I;  3G71 Z;  2R92 I;  2GTH A;  1RO2 A;  1USP A;  4MRI A;  1Q16 A;  5FLX f;  2GU2 A;  1I6H I;  2W04 A;  2M6N A;  1VQ7 Z;  1SFO I;  2VPW A;  1KRL A;  2VF1 A;  3MZL B;  1VQ9 1;  1YJW 1;  3NH4 A;  3EER A;  3I4M I;  1NP6 A;  3JAM f;  1WZN A;  2QA4 1;  2JUB A;  1VQO 1;  2QA4 Z;  1FDI A;  3IF8 A;  2PK7 A;  1KQS Z;  3GCF A;  1Q82 2;  2NAP A;  2Y0S A;  1K9M 1;  4A93 I;  2QRC B;  4AYB A;  3CC2 Z;  1I3Q I;  3CC4 1;  4NBA A;  4HGZ A;  1VQ8 Z;  3CD6 1;  5D1O A;  1USP B;  1VQ4 Z;  3KIF A;  1QF8 A;  2QEX 1;  3HOU I;  3J7A 4;  2P28 A;  3NDI A;  3NH5 A;  3CCV Z;  1Q7Y 2;  2V8K A;  3MON A;  3Q87 A;  2VUM I;  3G4S Z;  2VPZ A;  3CC4 Z;  1KQS Y;  3CXC Y;  3CC7 Z;  2OZK A;  1YJ9 Z;  2VUG A;  4MON A;  4NBD A;  5T6B A;  4RS4 A;  1DL6 A;  3NDJ A;  3EED A;  2JIM A;  2O4H A;  2QEX Z;  4Y52 I;  4RVF A;  3GTL I;  4TNU A;  3VMH A;  1FDO A;  4E2Z A;  1YJN 1;  3J80 f;  1VQO Z;  3GTP I;  3GTG I;  2V8I A;  4EWC A;  2LEX A;  4NBF A;  3CCM Z;  2RT9 A;  1S72 1;  3CME Z;  4E33 A;  1QYP A;  2E7Z A;  2OOY B;  5D1O B;  1VQ5 Z;  1VQ5 1;  1TWG I;  1VQP 1;  3BG0 B;  3I56 Z;  2HF1 A;  3CCM 1;  3D2L A;  3PO3 S;  2ZAE B;  1K9M 2;  1X3W A;  3OW2 Y;  2NVY I;  1Q81 2;  1NJI 1;  1KC8 2;  1M90 2;  1VQ6 Z;  3CCQ 1;  3S17 I;  4A3K I;  4MXU A;  1VQL Z;  1W2B Y;  3TDH B;  1KC8 1;  1M90 1;  5AN9 F;  1K8A 1;  1VQ9 Z;  4E2X A;  3CCU 1;  2JA8 I;  4QTU A;  1KD1 1;  1VQN Z;  1VQL 1;  4BY7 I;  3PO3 I;  3CCQ Z;  2QLV B;  1K8A 2;  1VQ6 1;  1RLY A;  3VMG A;  5T64 A;  2IV2 X;  5D1P A;  4XX2 A;  1PFT A;  3S14 I;  2JIR A;  3GTM I;  1X3Z A;  2V3V A;  5FLM I;  1AA6 A;  1TWF I;  3FKI I;  1VQ4 1;  4NBC A;  3CD6 Z;  2P3Y A;  2OTJ 1;  1VQ8 1;  5C3E I;  1QVG Y;  1VQK 1;  3I4N I;  5T67 A;  1RO4 A;  1ZB8 A;  3GTQ I;  1ZB9 A;  4MH4 A;  3IR7 A;  3VB9 A;  4E2Y A;  1TFI A;  3CC7 1;  1YHQ Z;  1QVF Z;  2VPY A;  5IP7 I;  2H85 A;  3RZD I;  1YIT Z;  1Z03 A;  3G4S 1;  4NBG A;  4NB9 A;  3HOX I;  4A3M I;  3I55 1;  1K83 I;  2HU9 A;  2NVX I;  3FQQ A;  2JIP A;  2F4M A;  3U50 C;  1TWA I;  3GKQ A;  3M4O I;  3T4N B;  1N8R 1;  1YIT 1;  2G2K A;  1Z02 A;  2RPR A;  3IFU A;  3NH8 A;  2OOX B;  1YHQ 1;  2DE6 A;  4RVD A;  2QRE B;  3MZK B;  3I56 1;  1TWH I;  1YIJ 1;  1L1O C;  4S1T A;  2KI7 B;  2LFU A;  3KIH A;  4NBB A;  2OTL 1;  2V8J A;  4A3J I;  1QVF Y;  4DQY B;  1VQK Z;  2WB1 A;  4HH4 A;  2R6M A;  1S72 Z;  1LQL A;  1X0T A;  3HOY I;  3CQZ I;  3HOV I;  2AYD A;  2F4O A;  3GTM S;  5C44 I;  3J80 b;  3F3F C;  1ZH1 A;  3J81 b;  3HKZ A;  4NOZ A;  1Y1V S;  2JA6 I;  2JA5 I;  3S1N I;  1TWC I;  3S1M I;  1YJ9 1;  1M1K 2;  1VQ7 1;  4A3I I;  4MD7 A;  5IP9 I;  3D9X A;  1ML8 A; 
#chains in the Genus database with same CATH homology
 1RQF A;  1VQM Z;  4NH1 C;  1VQN 1;  3G71 1;  3J81 f;  2PMZ A;  4BBR I;  2K5R A;  2NVQ I;  1YUA A;  3IX0 A;  1RNI A;  5IT9 f;  3I55 Z;  1YI2 Z;  4NFR A;  2R93 I;  3CPW Z;  2IZ4 A;  1JWH C;  2DE7 A;  5LL6 f;  3CCR Z;  3FQM A;  3S1Q I;  2Q51 A;  4A3D I;  4A3F I;  3G6E 1;  1Q7Y 1;  1VLA A;  4RVH A;  3CCE Z;  3GTO I;  4E30 A;  4BY1 I;  2JR6 A;  1YUK A;  3GTJ I;  5C4X I;  1YJN Z;  3GTK I;  3S15 I;  1K73 2;  3QWU A;  1YI2 1;  5A2Q f;  3CCS 1;  1JJ2 Y;  3CCE 1;  3D6W A;  1YJW Z;  4MD8 A;  3S16 I;  4A3E I;  4BXX I;  4NB8 A;  4RVG A;  3VMI A;  3CCU Z;  3CCL 1;  4CL1 A;  4A3L I;  1NUI A;  5IT9 b;  2E2J I;  2E2I I;  3CMA 1;  3P5J B;  1Q82 1;  3TE5 B;  4A3B I;  4A3G I;  3CC2 1;  4NBH A;  4A3C I;  1N2F A;  3HOW I;  4Y7N I;  2J6A A;  2M48 A;  1RO0 A;  2OTL Z;  1VQP Z;  1Y1W I;  1N8R 2;  3OW2 Z;  2LIY A;  5CM2 M;  2QRD B;  2RBL A;  2DE5 A;  2E9H A;  1Y1V I;  4E31 A;  3CME 1;  2QKD A;  2RIQ A;  4BBS I;  3JAM b;  1W2B Z;  2K3R A;  4HGY A;  2IZ3 A;  1KD1 2;  3F3P C;  3RZO I;  1WW9 A;  2RHB A;  4E32 A;  2Q4Z A;  3H3V J;  2GTI A;  1YIJ Z;  2BJO A;  2JMO A;  1Q86 2;  1I50 I;  3G6E Z;  4DGL A;  1R9T I;  2YAD A;  2EGT A;  2KPI A;  3CCR 1;  2YU9 I;  4E2W A;  1JJ2 Z;  1Q86 1;  3BG1 B;  1WCM I;  4X6A I;  2JA7 I;  3CCV 1;  3PO2 I;  3S2D I;  5C4J I;  2I3C A;  1M1K 1;  2E2H I;  2QR1 B;  5FLX b;  1S7M A;  2W03 A;  2AKL A;  3VTN A;  3CCS Z;  4DK1 A;  1VQM 1;  2OTJ Z;  2NVT I;  3ESW A;  4NBE A;  1WII A;  3S2H I;  3CXC Z;  2PM9 A;  3S1R I;  3LUS A;  2JNY A;  2B63 I;  1P9N A;  3CCJ 1;  5A2Q b;  4MD9 A;  3CCJ Z;  1Q81 1;  1NJI 2;  3CPW Y;  3I07 A;  3K7A I;  4RV9 A;  3M3Y I;  3HOZ I;  2R7Z I;  2WAQ A;  3CMA Z;  3NFZ A;  4QTT A;  2O53 A;  1QVG Z;  1Z01 A;  1K73 1;  3CCL Z;  2JS4 A;  3H0G I;  3G71 Z;  2R92 I;  2GTH A;  1RO2 A;  1USP A;  4MRI A;  5FLX f;  2GU2 A;  1I6H I;  2W04 A;  2M6N A;  1VQ7 Z;  1SFO I;  1KRL A;  2VF1 A;  3MZL B;  1VQ9 1;  1YJW 1;  3NH4 A;  3EER A;  3I4M I;  1NP6 A;  3JAM f;  2QA4 1;  2JUB A;  1VQO 1;  2QA4 Z;  3IF8 A;  2PK7 A;  1KQS Z;  3GCF A;  1Q82 2;  2Y0S A;  1K9M 1;  4A93 I;  2QRC B;  4AYB A;  3CC2 Z;  1I3Q I;  3CC4 1;  4NBA A;  4HGZ A;  1VQ8 Z;  3CD6 1;  5D1O A;  1USP B;  1VQ4 Z;  3KIF A;  1QF8 A;  2QEX 1;  3HOU I;  3J7A 4;  2P28 A;  3NDI A;  3NH5 A;  3CCV Z;  1Q7Y 2;  2V8K A;  3MON A;  3Q87 A;  2VUM I;  3G4S Z;  3CC4 Z;  1KQS Y;  3CXC Y;  3CC7 Z;  2OZK A;  1YJ9 Z;  2VUG A;  4MON A;  4NBD A;  5T6B A;  4RS4 A;  1DL6 A;  3NDJ A;  3EED A;  2O4H A;  2QEX Z;  4Y52 I;  4RVF A;  3GTL I;  4TNU A;  3VMH A;  4E2Z A;  1YJN 1;  3J80 f;  1VQO Z;  3GTP I;  3GTG I;  2V8I A;  4EWC A;  4NBF A;  3CCM Z;  2RT9 A;  1S72 1;  3CME Z;  4E33 A;  1QYP A;  2OOY B;  5D1O B;  1VQ5 Z;  1VQ5 1;  1TWG I;  1VQP 1;  3BG0 B;  3I56 Z;  2HF1 A;  3CCM 1;  3PO3 S;  2ZAE B;  1K9M 2;  1X3W A;  3OW2 Y;  2NVY I;  1Q81 2;  1NJI 1;  1KC8 2;  1M90 2;  1VQ6 Z;  3CCQ 1;  3S17 I;  4A3K I;  4MXU A;  1VQL Z;  1W2B Y;  3TDH B;  1KC8 1;  1M90 1;  5AN9 F;  1K8A 1;  1VQ9 Z;  4E2X A;  3CCU 1;  2JA8 I;  4QTU A;  1KD1 1;  1VQN Z;  1VQL 1;  4BY7 I;  3PO3 I;  3CCQ Z;  2QLV B;  1K8A 2;  1VQ6 1;  1RLY A;  3VMG A;  5T64 A;  5D1P A;  4XX2 A;  1PFT A;  3S14 I;  3GTM I;  1X3Z A;  5FLM I;  1VQ4 1;  1TWF I;  3FKI I;  4NBC A;  3CD6 Z;  2P3Y A;  2OTJ 1;  1VQ8 1;  5C3E I;  1QVG Y;  1VQK 1;  3I4N I;  5T67 A;  1RO4 A;  1ZB8 A;  3GTQ I;  1ZB9 A;  4MH4 A;  3VB9 A;  4E2Y A;  1TFI A;  3CC7 1;  1YHQ Z;  1QVF Z;  5IP7 I;  2H85 A;  3RZD I;  1YIT Z;  1Z03 A;  3G4S 1;  4NBG A;  4NB9 A;  3HOX I;  4A3M I;  3I55 1;  1K83 I;  2HU9 A;  2NVX I;  3FQQ A;  2F4M A;  3U50 C;  1TWA I;  3GKQ A;  3M4O I;  3T4N B;  1N8R 1;  1YIT 1;  2G2K A;  1Z02 A;  2RPR A;  3IFU A;  3NH8 A;  2OOX B;  1YHQ 1;  2DE6 A;  4RVD A;  2QRE B;  3MZK B;  3I56 1;  1TWH I;  1YIJ 1;  1L1O C;  4S1T A;  2KI7 B;  2LFU A;  3KIH A;  4NBB A;  2OTL 1;  2V8J A;  4A3J I;  1QVF Y;  4DQY B;  1VQK Z;  1S72 Z;  2WB1 A;  2R6M A;  4HH4 A;  1LQL A;  1X0T A;  3HOY I;  3CQZ I;  3HOV I;  2F4O A;  3GTM S;  5C44 I;  3J80 b;  3F3F C;  1ZH1 A;  3J81 b;  3HKZ A;  4NOZ A;  1Y1V S;  2JA6 I;  2JA5 I;  3S1N I;  1TWC I;  3S1M I;  1YJ9 1;  1M1K 2;  1VQ7 1;  4A3I I;  4MD7 A;  5IP9 I;  3D9X A;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...