3T4NB

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
104
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 19
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3t4nB01
3TE5B 2QR1B 2QLVB 2OOXB 2QREB 3T4NB 2OOYB 3TDHB 2QRDB 2QRCB
chains in the Genus database with same CATH superfamily
4TNUA 1VQKZ 4A3II 1K732 2JR6A 1W2BY 3D9XA 1RO4A 3D2LA 3CC21 2VPWA 4E32A 1JJ2Y 2E7ZA 2G2KA 3I551 5A2Qb 1X3WA 1Q7Y1 3ESWA 2WB1A 4A3JI 5D1OA 3J80b 2BJOA 3GKQA 1FDIA 4NBEA 3CCV1 4QTUA 1VQ6Z 4Y7NI 1WZNA 3S14I 2DE6A 1K9M2 2DE5A 1Z01A 3J81f 2JMOA 4NB9A 1KD12 2R7ZI 1QVFZ 1M901 4NBGA 2AYDA 3NH4A 2AKLA 3JAMb 3I561 1FDOA 2QR1B 3CCSZ 2JA8I 4MRIA 3BG0B 2KPIA 1TWGI 4RVGA 4E2WA 1RLYA 5FLMI 1Q822 2W04A 3K7AI 4BY1I 3G4S1 2W03A 1NP6A 1WIIA 1VQMZ 1TWFI 1RNIA 3CC71 3M3YI 1VQ51 3I07A 2QA41 2PK7A 4MD7A 2PMZA 1M1K2 2GTHA 4E33A 3CPWY 4MONA 1ZH1A 2VUGA 1RQFA 1USPA 2JIOA 4DQYB 3M4OI 4E2YA 2V8IA 2VPZA 3CXCZ 4HGZA 3VMIA 1WW9A 2QRCB 2JA7I 2B63I 5C44I 4E2ZA 2LFUA 2PM9A 5T6BA 3I4NI 3GTGI 1Q7Y2 5D1PA 3CCLZ 3P5JB 3KIHA 1KC81 2RPRA 4NH1C 2OTLZ 1R9TI 4A3DI 4MD8A 3CCM1 3S16I 3H3VJ 3G6EZ 1Q821 1N8R1 3OW2Y 1K8A2 4EWCA 2QEXZ 1L1OC 3J7A4 3NFZA 1SIWA 3CQZI 1M902 1QYPA 2Q4ZA 1RO0A 4MXUA 4A3GI 1VQ9Z 1Q812 3S15I 3CCU1 1YUKA 1ZB8A 1Y8CA 3CME1 3GTMI 2IV2X 1Z03A 1ZB9A 1YJ9Z 5IT9f 1I3QI 1I50I 5LL6f 3TDHB 4BBRI 2J6AA 5C4JI 2JIMA 3GTPI 3H0GI 3S1NI 3G71Z 2WAQA 2VUMI 2VPYA 1YIJZ 2JA6I 1YHQZ 4E31A 2E2II 2ZAEB 3LUSA 1VQ61 4NOZA 3GTOI 2Y0SA 3CC2Z 1K8A1 1N2FA 1LQLA 1DL6A 4A3MI 3IX0A 3VB9A 3CMAZ 1X3ZA 3S17I 4DGLA 1KC82 4A93I 3TE5B 3EEDA 2OTJZ 1W2BZ 1QVGY 3S1MI 2R93I 3IF8A 1Q811 3CCS1 3CCVZ 2P3YA 5T64A 3HOXI 2LIYA 1JJ2Z 5D1OB 1RO2A 2H85A 1YITZ 3BG1B 3MONA 4S1TA 1N8R2 4BBSI 1VQNZ 5IP9I 1VQM1 1VQ81 3CCEZ 1S7MA 2IZ3A 1KQSY 3CD6Z 1Q16A 2K5RA 2OOXB 3GTMS 5FLXf 3HOWI 5C4XI 5C3EI 4NBCA 3F3FC 2JUBA 2YADA 3VMGA 3CCR1 5AN9F 3T4NB 1VQ71 2E2JI 3KIFA 2R6MA 2GTIA 3CCJZ 1YJNZ 2V45A 1NJI2 1Y1VI 2JIRA 2KI7B 3NH5A 3CCQZ 5T67A 1Y1WI 2NAPA 3IR7A 4A3CI 1YI21 3CCL1 3EERA 1Z02A 1VQO1 5A2Qf 2HF1A 1AA6A 1K83I 4QTTA 4A3FI 2E9HA 2OTL1 2O4HA 4RVFA 1S721 3S1QI 1VQLZ 3CC41 2OZKA 3HKZA 2JS4A 1QF8A 3G6E1 1I6HI 2LEXA 1USPB 2QEX1 1P9NA 3CPWZ 2P28A 2JNYA 3J81b 1TFIA 4RVDA 2JIQA 1YJWZ 1VQP1 2NVYI 5CM2M 1VQ91 4A3LI 1VQ4Z 3VTNA 4HH4A 1VQK1 4A3KI 1NJI1 1YJ91 1JWHC 2QRDB 3GTJI 3F3PC 3G711 2QKDA 4HGYA 3I4MI 1Y1VS 3OW2Z 2I3CA 2V8KA 4RV9A 1YHQ1 2DE7A 1QVFY 3HOYI 2JIPA 3CMEZ 3NH8A 4BY7I 2NVTI 2QLVB 1TWHI 1X0TA 4A3BI 2R92I 3FQQA 2IZ4A 3CMA1 1ML8A 3I55Z 2RBLA 4Y52I 4MH4A 2F4OA 3FQMA 3RZOI 2OTJ1 2VPXA 4A3EI 1YIT1 1VQN1 3CCE1 3CXCY 4NBFA 1YUAA 3CD61 3VMHA 2E2HI 2OOYB 2V8JA 3I56Z 3NDJA 3HOVI 2Q51A 4CL1A 3QWUA 3CCJ1 1YJN1 2K3RA 3GTLI 1PFTA 1K731 3G4SZ 1VQ8Z 1Q862 3CCQ1 4E30A 5IT9b 3PO3I 3CC7Z 1VQ5Z 1QVGZ 2QA4Z 2M48A 3S2HI 1WJ2A 4E2XA 3Q87A 2EGTA 2HU9A 3MZKB 3CCRZ 1VQ7Z 3FKII 1VQL1 3J80f 2F4MA 3RZDI 4MD9A 4NBBA 4NBAA 3U50C 4BXXI 1KQSZ 4DK1A 1WCMI 2YU9I 3GCFA 1K9M1 4RS4A 3D6WA 1YI2Z 2V3VA 4NB8A 1KD11 1VQOZ 3S2DI 1YJW1 3GTKI 1VQ41 1S72Z 2NVQI 3JAMf 3CCMZ 4NFRA 4RVHA 3CC4Z 2O53A 4NBDA 3S1RI 1TWAI 3PO2I 1TWCI 3GTQI 3HOUI 4NBHA 2QREB 5IP7I 2RIQA 1SFOI 1QXFA 1Q861 1KRLA 3IFUA 2NVXI 2M6NA 4AYBA 1M1K1 2RHBA 4X6AI 1VLAA 3HOZI 5FLXb 1VQPZ 2GU2A 2RT9A 4XX2A 3NDIA 3CCUZ 3PO3S 3MZLB 1NUIA 2VF1A 1YIJ1 2JA5I
chains in the Genus database with same CATH topology
4TNUA 1VQKZ 4A3II 1K732 2JR6A 1W2BY 3D9XA 1RO4A 3CC21 4E32A 1JJ2Y 2G2KA 3I551 5A2Qb 1X3WA 1Q7Y1 3ESWA 2WB1A 4A3JI 5D1OA 3J80b 2BJOA 3GKQA 4NBEA 3CCV1 4QTUA 1VQ6Z 4Y7NI 3S14I 2DE6A 1K9M2 2DE5A 1Z01A 3J81f 2JMOA 4NB9A 1KD12 2R7ZI 1QVFZ 1M901 4NBGA 3NH4A 2AKLA 3JAMb 3I561 2QR1B 3CCSZ 2JA8I 4MRIA 3BG0B 2KPIA 1TWGI 4RVGA 4E2WA 1RLYA 5FLMI 1Q822 2W04A 3K7AI 4BY1I 3G4S1 2W03A 1NP6A 1WIIA 1VQMZ 1TWFI 1RNIA 3CC71 3M3YI 1VQ51 3I07A 2QA41 2PK7A 4MD7A 2PMZA 1M1K2 2GTHA 4E33A 3CPWY 4MONA 1ZH1A 2VUGA 1RQFA 1USPA 4DQYB 3M4OI 4E2YA 2V8IA 3CXCZ 4HGZA 3VMIA 1WW9A 2QRCB 2JA7I 2B63I 5C44I 4E2ZA 2LFUA 2PM9A 5T6BA 3I4NI 3GTGI 1Q7Y2 5D1PA 3CCLZ 3P5JB 3KIHA 1KC81 2RPRA 4NH1C 2OTLZ 1R9TI 4A3DI 4MD8A 3CCM1 3S16I 3H3VJ 3G6EZ 1Q821 1N8R1 3OW2Y 1K8A2 4EWCA 2QEXZ 1L1OC 3J7A4 3NFZA 3CQZI 1M902 1QYPA 2Q4ZA 1RO0A 4MXUA 4A3GI 1VQ9Z 1Q812 3S15I 3CCU1 1YUKA 1ZB8A 3GTMI 3CME1 1Z03A 1ZB9A 1YJ9Z 5IT9f 1I3QI 1I50I 5LL6f 3TDHB 4BBRI 2J6AA 5C4JI 3GTPI 3H0GI 3S1NI 3G71Z 2WAQA 2VUMI 1YIJZ 2JA6I 1YHQZ 4E31A 2E2II 2ZAEB 3LUSA 1VQ61 4NOZA 3GTOI 2Y0SA 3CC2Z 1K8A1 1N2FA 1LQLA 1DL6A 4A3MI 3IX0A 3VB9A 3CMAZ 1X3ZA 3S17I 4DGLA 1KC82 4A93I 3TE5B 3EEDA 2OTJZ 1W2BZ 1QVGY 3S1MI 2R93I 3IF8A 1Q811 3CCS1 3CCVZ 2P3YA 5T64A 3HOXI 2LIYA 1JJ2Z 5D1OB 1RO2A 2H85A 1YITZ 3BG1B 3MONA 4S1TA 1N8R2 4BBSI 1VQNZ 5IP9I 1VQM1 1VQ81 3CCEZ 1S7MA 2IZ3A 1KQSY 3CD6Z 2K5RA 2OOXB 3GTMS 5FLXf 3HOWI 5C4XI 5C3EI 4NBCA 3F3FC 2JUBA 2YADA 3VMGA 3CCR1 5AN9F 3T4NB 1VQ71 2E2JI 3KIFA 2R6MA 2GTIA 3CCJZ 1YJNZ 1NJI2 1Y1VI 2KI7B 3NH5A 3CCQZ 5T67A 1Y1WI 4A3CI 1YI21 3CCL1 3EERA 1Z02A 1VQO1 5A2Qf 2HF1A 1K83I 4QTTA 4A3FI 2E9HA 2OTL1 2O4HA 4RVFA 1S721 3S1QI 1VQLZ 3CC41 2OZKA 3HKZA 2JS4A 1QF8A 3G6E1 1I6HI 1USPB 2QEX1 1P9NA 3CPWZ 2P28A 2JNYA 3J81b 1TFIA 4RVDA 1YJWZ 1VQP1 2NVYI 5CM2M 1VQ91 4A3LI 1VQ4Z 3VTNA 4HH4A 1VQK1 4A3KI 1NJI1 1YJ91 1JWHC 2QRDB 3GTJI 3F3PC 3G711 2QKDA 4HGYA 3I4MI 1Y1VS 3OW2Z 2I3CA 2V8KA 4RV9A 1YHQ1 2DE7A 1QVFY 3HOYI 3CMEZ 3NH8A 4BY7I 2NVTI 2QLVB 1TWHI 1X0TA 4A3BI 2R92I 3FQQA 2IZ4A 3CMA1 1ML8A 3I55Z 2RBLA 4Y52I 4MH4A 2F4OA 3FQMA 3RZOI 2OTJ1 4A3EI 1YIT1 1VQN1 3CCE1 3CXCY 4NBFA 1YUAA 3CD61 3VMHA 2E2HI 2OOYB 2V8JA 3I56Z 3NDJA 3HOVI 2Q51A 4CL1A 3QWUA 3CCJ1 1YJN1 2K3RA 3GTLI 1PFTA 1K731 3G4SZ 1VQ8Z 1Q862 3CCQ1 4E30A 5IT9b 3PO3I 3CC7Z 1VQ5Z 1QVGZ 2QA4Z 2M48A 3S2HI 4E2XA 3Q87A 2EGTA 2HU9A 3MZKB 3CCRZ 1VQ7Z 3FKII 1VQL1 3J80f 2F4MA 3RZDI 4MD9A 4NBBA 4NBAA 3U50C 4BXXI 1KQSZ 4DK1A 1WCMI 2YU9I 3GCFA 1K9M1 4RS4A 3D6WA 1YI2Z 4NB8A 1KD11 1VQOZ 3S2DI 1YJW1 3GTKI 1VQ41 1S72Z 2NVQI 3JAMf 3CCMZ 4NFRA 4RVHA 3CC4Z 2O53A 4NBDA 3S1RI 1TWAI 3PO2I 1TWCI 3GTQI 3HOUI 4NBHA 2QREB 5IP7I 2RIQA 1SFOI 1Q861 1KRLA 3IFUA 2NVXI 2M6NA 4AYBA 1M1K1 2RHBA 4X6AI 1VLAA 3HOZI 5FLXb 1VQPZ 2GU2A 2RT9A 4XX2A 3NDIA 3CCUZ 3PO3S 3MZLB 1NUIA 2VF1A 1YIJ1 2JA5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TE5 B;  2QR1 B;  2QLV B;  2OOX B;  2QRE B;  3T4N B;  2OOY B;  3TDH B;  2QRD B;  2QRC B; 
#chains in the Genus database with same CATH topology
 4TNU A;  1VQK Z;  4A3I I;  1K73 2;  2JR6 A;  1W2B Y;  3D9X A;  1RO4 A;  3D2L A;  3CC2 1;  2VPW A;  4E32 A;  1JJ2 Y;  2E7Z A;  2G2K A;  3I55 1;  5A2Q b;  1X3W A;  1Q7Y 1;  3ESW A;  2WB1 A;  4A3J I;  5D1O A;  3J80 b;  2BJO A;  3GKQ A;  1FDI A;  4NBE A;  3CCV 1;  4QTU A;  1VQ6 Z;  4Y7N I;  1WZN A;  3S14 I;  2DE6 A;  1K9M 2;  2DE5 A;  1Z01 A;  3J81 f;  2JMO A;  4NB9 A;  1KD1 2;  2R7Z I;  1QVF Z;  1M90 1;  4NBG A;  2AYD A;  3NH4 A;  2AKL A;  3JAM b;  3I56 1;  1FDO A;  2QR1 B;  3CCS Z;  2JA8 I;  4MRI A;  3BG0 B;  2KPI A;  1TWG I;  4RVG A;  4E2W A;  1RLY A;  5FLM I;  1Q82 2;  2W04 A;  3K7A I;  4BY1 I;  3G4S 1;  2W03 A;  1NP6 A;  1WII A;  1VQM Z;  1TWF I;  1RNI A;  3CC7 1;  3M3Y I;  1VQ5 1;  3I07 A;  2QA4 1;  2PK7 A;  4MD7 A;  2PMZ A;  1M1K 2;  2GTH A;  4E33 A;  3CPW Y;  4MON A;  1ZH1 A;  2VUG A;  1RQF A;  1USP A;  2JIO A;  4DQY B;  3M4O I;  4E2Y A;  2V8I A;  2VPZ A;  3CXC Z;  4HGZ A;  3VMI A;  1WW9 A;  2QRC B;  2JA7 I;  2B63 I;  5C44 I;  4E2Z A;  2LFU A;  2PM9 A;  5T6B A;  3I4N I;  3GTG I;  1Q7Y 2;  5D1P A;  3CCL Z;  3P5J B;  3KIH A;  1KC8 1;  2RPR A;  4NH1 C;  2OTL Z;  1R9T I;  4A3D I;  4MD8 A;  3CCM 1;  3S16 I;  3H3V J;  3G6E Z;  1Q82 1;  1N8R 1;  3OW2 Y;  1K8A 2;  4EWC A;  2QEX Z;  1L1O C;  3J7A 4;  3NFZ A;  1SIW A;  3CQZ I;  1M90 2;  1QYP A;  2Q4Z A;  1RO0 A;  4MXU A;  4A3G I;  1VQ9 Z;  1Q81 2;  3S15 I;  3CCU 1;  1YUK A;  1ZB8 A;  1Y8C A;  3CME 1;  3GTM I;  2IV2 X;  1Z03 A;  1ZB9 A;  1YJ9 Z;  5IT9 f;  1I3Q I;  1I50 I;  5LL6 f;  3TDH B;  4BBR I;  2J6A A;  5C4J I;  2JIM A;  3GTP I;  3H0G I;  3S1N I;  3G71 Z;  2WAQ A;  2VUM I;  2VPY A;  1YIJ Z;  2JA6 I;  1YHQ Z;  4E31 A;  2E2I I;  2ZAE B;  3LUS A;  1VQ6 1;  4NOZ A;  3GTO I;  2Y0S A;  3CC2 Z;  1K8A 1;  1N2F A;  1LQL A;  1DL6 A;  4A3M I;  3IX0 A;  3VB9 A;  3CMA Z;  1X3Z A;  3S17 I;  4DGL A;  1KC8 2;  4A93 I;  3TE5 B;  3EED A;  2OTJ Z;  1W2B Z;  1QVG Y;  3S1M I;  2R93 I;  3IF8 A;  1Q81 1;  3CCS 1;  3CCV Z;  2P3Y A;  5T64 A;  3HOX I;  2LIY A;  1JJ2 Z;  5D1O B;  1RO2 A;  2H85 A;  1YIT Z;  3BG1 B;  3MON A;  4S1T A;  1N8R 2;  4BBS I;  1VQN Z;  5IP9 I;  1VQM 1;  1VQ8 1;  3CCE Z;  1S7M A;  2IZ3 A;  1KQS Y;  3CD6 Z;  1Q16 A;  2K5R A;  2OOX B;  3GTM S;  5FLX f;  3HOW I;  5C4X I;  5C3E I;  4NBC A;  3F3F C;  2JUB A;  2YAD A;  3VMG A;  3CCR 1;  5AN9 F;  3T4N B;  1VQ7 1;  2E2J I;  3KIF A;  2R6M A;  2GTI A;  3CCJ Z;  1YJN Z;  2V45 A;  1NJI 2;  1Y1V I;  2JIR A;  2KI7 B;  3NH5 A;  3CCQ Z;  5T67 A;  1Y1W I;  2NAP A;  3IR7 A;  4A3C I;  1YI2 1;  3CCL 1;  3EER A;  1Z02 A;  1VQO 1;  5A2Q f;  2HF1 A;  1AA6 A;  1K83 I;  4QTT A;  4A3F I;  2E9H A;  2OTL 1;  2O4H A;  4RVF A;  1S72 1;  3S1Q I;  1VQL Z;  3CC4 1;  2OZK A;  3HKZ A;  2JS4 A;  1QF8 A;  3G6E 1;  1I6H I;  2LEX A;  1USP B;  2QEX 1;  1P9N A;  3CPW Z;  2P28 A;  2JNY A;  3J81 b;  1TFI A;  4RVD A;  2JIQ A;  1YJW Z;  1VQP 1;  2NVY I;  5CM2 M;  1VQ9 1;  4A3L I;  1VQ4 Z;  3VTN A;  4HH4 A;  1VQK 1;  4A3K I;  1NJI 1;  1YJ9 1;  1JWH C;  2QRD B;  3GTJ I;  3F3P C;  3G71 1;  2QKD A;  4HGY A;  3I4M I;  1Y1V S;  3OW2 Z;  2I3C A;  2V8K A;  4RV9 A;  1YHQ 1;  2DE7 A;  1QVF Y;  3HOY I;  2JIP A;  3CME Z;  3NH8 A;  4BY7 I;  2NVT I;  2QLV B;  1TWH I;  1X0T A;  4A3B I;  2R92 I;  3FQQ A;  2IZ4 A;  3CMA 1;  1ML8 A;  3I55 Z;  2RBL A;  4Y52 I;  4MH4 A;  2F4O A;  3FQM A;  3RZO I;  2OTJ 1;  2VPX A;  4A3E I;  1YIT 1;  1VQN 1;  3CCE 1;  3CXC Y;  4NBF A;  1YUA A;  3CD6 1;  3VMH A;  2E2H I;  2OOY B;  2V8J A;  3I56 Z;  3NDJ A;  3HOV I;  2Q51 A;  4CL1 A;  3QWU A;  3CCJ 1;  1YJN 1;  2K3R A;  3GTL I;  1PFT A;  1K73 1;  3G4S Z;  1VQ8 Z;  1Q86 2;  3CCQ 1;  4E30 A;  5IT9 b;  3PO3 I;  3CC7 Z;  1VQ5 Z;  1QVG Z;  2QA4 Z;  2M48 A;  3S2H I;  1WJ2 A;  4E2X A;  3Q87 A;  2EGT A;  2HU9 A;  3MZK B;  3CCR Z;  1VQ7 Z;  3FKI I;  1VQL 1;  3J80 f;  2F4M A;  3RZD I;  4MD9 A;  4NBB A;  4NBA A;  3U50 C;  4BXX I;  1KQS Z;  4DK1 A;  1WCM I;  2YU9 I;  3GCF A;  1K9M 1;  4RS4 A;  3D6W A;  1YI2 Z;  2V3V A;  4NB8 A;  1KD1 1;  1VQO Z;  3S2D I;  1YJW 1;  3GTK I;  1VQ4 1;  1S72 Z;  2NVQ I;  3JAM f;  3CCM Z;  4NFR A;  4RVH A;  3CC4 Z;  2O53 A;  4NBD A;  3S1R I;  1TWA I;  3PO2 I;  1TWC I;  3GTQ I;  3HOU I;  4NBH A;  2QRE B;  5IP7 I;  2RIQ A;  1SFO I;  1QXF A;  1Q86 1;  1KRL A;  3IFU A;  2NVX I;  2M6N A;  4AYB A;  1M1K 1;  2RHB A;  4X6A I;  1VLA A;  3HOZ I;  5FLX b;  1VQP Z;  2GU2 A;  2RT9 A;  4XX2 A;  3NDI A;  3CCU Z;  3PO3 S;  3MZL B;  1NUI A;  2VF1 A;  1YIJ 1;  2JA5 I; 
#chains in the Genus database with same CATH homology
 4TNU A;  1VQK Z;  4A3I I;  1K73 2;  2JR6 A;  1W2B Y;  3D9X A;  1RO4 A;  3CC2 1;  4E32 A;  1JJ2 Y;  2G2K A;  3I55 1;  5A2Q b;  1X3W A;  1Q7Y 1;  3ESW A;  2WB1 A;  4A3J I;  5D1O A;  3J80 b;  2BJO A;  3GKQ A;  4NBE A;  3CCV 1;  4QTU A;  1VQ6 Z;  4Y7N I;  3S14 I;  2DE6 A;  1K9M 2;  2DE5 A;  1Z01 A;  3J81 f;  2JMO A;  4NB9 A;  1KD1 2;  2R7Z I;  1QVF Z;  1M90 1;  4NBG A;  3NH4 A;  2AKL A;  3JAM b;  3I56 1;  2QR1 B;  3CCS Z;  2JA8 I;  4MRI A;  3BG0 B;  2KPI A;  1TWG I;  4RVG A;  4E2W A;  1RLY A;  5FLM I;  1Q82 2;  2W04 A;  3K7A I;  4BY1 I;  3G4S 1;  2W03 A;  1NP6 A;  1WII A;  1VQM Z;  1TWF I;  1RNI A;  3CC7 1;  3M3Y I;  1VQ5 1;  3I07 A;  2QA4 1;  2PK7 A;  4MD7 A;  2PMZ A;  1M1K 2;  2GTH A;  4E33 A;  3CPW Y;  4MON A;  1ZH1 A;  2VUG A;  1RQF A;  1USP A;  4DQY B;  3M4O I;  4E2Y A;  2V8I A;  3CXC Z;  4HGZ A;  3VMI A;  1WW9 A;  2QRC B;  2JA7 I;  2B63 I;  5C44 I;  4E2Z A;  2LFU A;  2PM9 A;  5T6B A;  3I4N I;  3GTG I;  1Q7Y 2;  5D1P A;  3CCL Z;  3P5J B;  3KIH A;  1KC8 1;  2RPR A;  4NH1 C;  2OTL Z;  1R9T I;  4A3D I;  4MD8 A;  3CCM 1;  3S16 I;  3H3V J;  3G6E Z;  1Q82 1;  1N8R 1;  3OW2 Y;  1K8A 2;  4EWC A;  2QEX Z;  1L1O C;  3J7A 4;  3NFZ A;  3CQZ I;  1M90 2;  1QYP A;  2Q4Z A;  1RO0 A;  4MXU A;  4A3G I;  1VQ9 Z;  1Q81 2;  3S15 I;  3CCU 1;  1YUK A;  1ZB8 A;  3GTM I;  3CME 1;  1Z03 A;  1ZB9 A;  1YJ9 Z;  5IT9 f;  1I3Q I;  1I50 I;  5LL6 f;  3TDH B;  4BBR I;  2J6A A;  5C4J I;  3GTP I;  3H0G I;  3S1N I;  3G71 Z;  2WAQ A;  2VUM I;  1YIJ Z;  2JA6 I;  1YHQ Z;  4E31 A;  2E2I I;  2ZAE B;  3LUS A;  1VQ6 1;  4NOZ A;  3GTO I;  2Y0S A;  3CC2 Z;  1K8A 1;  1N2F A;  1LQL A;  1DL6 A;  4A3M I;  3IX0 A;  3VB9 A;  3CMA Z;  1X3Z A;  3S17 I;  4DGL A;  1KC8 2;  4A93 I;  3TE5 B;  3EED A;  2OTJ Z;  1W2B Z;  1QVG Y;  3S1M I;  2R93 I;  3IF8 A;  1Q81 1;  3CCS 1;  3CCV Z;  2P3Y A;  5T64 A;  3HOX I;  2LIY A;  1JJ2 Z;  5D1O B;  1RO2 A;  2H85 A;  1YIT Z;  3BG1 B;  3MON A;  4S1T A;  1N8R 2;  4BBS I;  1VQN Z;  5IP9 I;  1VQM 1;  1VQ8 1;  3CCE Z;  1S7M A;  2IZ3 A;  1KQS Y;  3CD6 Z;  2K5R A;  2OOX B;  3GTM S;  5FLX f;  3HOW I;  5C4X I;  5C3E I;  4NBC A;  3F3F C;  2JUB A;  2YAD A;  3VMG A;  3CCR 1;  5AN9 F;  3T4N B;  1VQ7 1;  2E2J I;  3KIF A;  2R6M A;  2GTI A;  3CCJ Z;  1YJN Z;  1NJI 2;  1Y1V I;  2KI7 B;  3NH5 A;  3CCQ Z;  5T67 A;  1Y1W I;  4A3C I;  1YI2 1;  3CCL 1;  3EER A;  1Z02 A;  1VQO 1;  5A2Q f;  2HF1 A;  1K83 I;  4QTT A;  4A3F I;  2E9H A;  2OTL 1;  2O4H A;  4RVF A;  1S72 1;  3S1Q I;  1VQL Z;  3CC4 1;  2OZK A;  3HKZ A;  2JS4 A;  1QF8 A;  3G6E 1;  1I6H I;  1USP B;  2QEX 1;  1P9N A;  3CPW Z;  2P28 A;  2JNY A;  3J81 b;  1TFI A;  4RVD A;  1YJW Z;  1VQP 1;  2NVY I;  5CM2 M;  1VQ9 1;  4A3L I;  1VQ4 Z;  3VTN A;  4HH4 A;  1VQK 1;  4A3K I;  1NJI 1;  1YJ9 1;  1JWH C;  2QRD B;  3GTJ I;  3F3P C;  3G71 1;  2QKD A;  4HGY A;  3I4M I;  1Y1V S;  3OW2 Z;  2I3C A;  2V8K A;  4RV9 A;  1YHQ 1;  2DE7 A;  1QVF Y;  3HOY I;  3CME Z;  3NH8 A;  4BY7 I;  2NVT I;  2QLV B;  1TWH I;  1X0T A;  4A3B I;  2R92 I;  3FQQ A;  2IZ4 A;  3CMA 1;  1ML8 A;  3I55 Z;  2RBL A;  4Y52 I;  4MH4 A;  2F4O A;  3FQM A;  3RZO I;  2OTJ 1;  4A3E I;  1YIT 1;  1VQN 1;  3CCE 1;  3CXC Y;  4NBF A;  1YUA A;  3CD6 1;  3VMH A;  2E2H I;  2OOY B;  2V8J A;  3I56 Z;  3NDJ A;  3HOV I;  2Q51 A;  4CL1 A;  3QWU A;  3CCJ 1;  1YJN 1;  2K3R A;  3GTL I;  1PFT A;  1K73 1;  3G4S Z;  1VQ8 Z;  1Q86 2;  3CCQ 1;  4E30 A;  5IT9 b;  3PO3 I;  3CC7 Z;  1VQ5 Z;  1QVG Z;  2QA4 Z;  2M48 A;  3S2H I;  4E2X A;  3Q87 A;  2EGT A;  2HU9 A;  3MZK B;  3CCR Z;  1VQ7 Z;  3FKI I;  1VQL 1;  3J80 f;  2F4M A;  3RZD I;  4MD9 A;  4NBB A;  4NBA A;  3U50 C;  4BXX I;  1KQS Z;  4DK1 A;  1WCM I;  2YU9 I;  3GCF A;  1K9M 1;  4RS4 A;  3D6W A;  1YI2 Z;  4NB8 A;  1KD1 1;  1VQO Z;  3S2D I;  1YJW 1;  3GTK I;  1VQ4 1;  1S72 Z;  2NVQ I;  3JAM f;  3CCM Z;  4NFR A;  4RVH A;  3CC4 Z;  2O53 A;  4NBD A;  3S1R I;  1TWA I;  3PO2 I;  1TWC I;  3GTQ I;  3HOU I;  4NBH A;  2QRE B;  5IP7 I;  2RIQ A;  1SFO I;  1Q86 1;  1KRL A;  3IFU A;  2NVX I;  2M6N A;  4AYB A;  1M1K 1;  2RHB A;  4X6A I;  1VLA A;  3HOZ I;  5FLX b;  1VQP Z;  2GU2 A;  2RT9 A;  4XX2 A;  3NDI A;  3CCU Z;  3PO3 S;  3MZL B;  1NUI A;  2VF1 A;  1YIJ 1;  2JA5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...