3T4NB

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
104
Chain Sequence
b'MEYTTDIPAVFTDPSVMERYYYTLDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 19
structure length 104
sequence length 111
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3t4nB01
2QLVB 3T4NB 3TDHB 3TE5B 2OOYB 2QREB 2QR1B 2QRDB 2OOXB 2QRCB
chains in the Genus database with same CATH superfamily
4RVGA 4A3FI 1WJ2A 4MONA 5FLXb 2QR1B 2NVXI 3S1MI 1P9NA 2HF1A 1VQN1 4RS4A 2RIQA 2PMZA 1W2BY 3CXCY 1K9M2 3J7A4 1Q822 1YUKA 2DE5A 1I3QI 2JIQA 1TFIA 1Q811 2OTJ1 3G711 1X0TA 3OW2Y 1Y1WI 2O4HA 4A3II 3IR7A 5FLXf 4A3DI 4NFRA 2OTL1 2LFUA 2V3VA 5IP7I 4BBRI 4NH1C 2GTHA 1VQL1 3HKZA 1AA6A 3CCQ1 2E2II 2Q4ZA 3CCL1 1YJ91 3EERA 5IP9I 3J80b 4A3JI 5IT9f 3HOXI 4HGZA 3CPWY 1Q861 3P5JB 3D9XA 2QEXZ 1YI21 1USPB 3CXCZ 1YIJ1 4E33A 5FLMI 1M1K1 1NJI1 3OW2Z 3J80f 2W03A 2R6MA 1YJN1 3NDIA 2IV2X 1N8R1 1TWGI 2P28A 2O53A 5AN9F 3HOYI 1S721 1VQ9Z 3S2DI 4AYBA 1VQ71 2NVTI 1JJ2Y 4NOZA 3GKQA 1RLYA 3G4SZ 4A3BI 3CCRZ 1K9M1 3CPWZ 3CC2Z 2ZAEB 3I56Z 3U50C 2QKDA 2E7ZA 5C4JI 5A2Qf 1FDOA 1VQO1 2QLVB 4BY7I 4NBFA 2I3CA 2JIRA 3CCUZ 1VQK1 1KC81 3HOUI 3CMAZ 1YIT1 1VQ4Z 3GTKI 2P3YA 3CC71 4QTUA 5D1PA 3CMEZ 1JWHC 1JJ2Z 3HOZI 2F4MA 3VMHA 1N2FA 2JA6I 3S14I 2BJOA 1K731 3KIFA 1YJWZ 4E2WA 4X6AI 4NB9A 2VPYA 2E2JI 1I50I 3MZKB 2V8KA 2JIMA 4A3MI 2JIPA 2WB1A 3D2LA 3IF8A 4Y7NI 3S1RI 3J81f 1WCMI 2NVYI 1VQ81 4E30A 4HH4A 1VQNZ 2QA41 1ZH1A 3CCSZ 2OZKA 2YADA 3RZDI 3GTJI 3CCVZ 1WIIA 1KRLA 4A3CI 1SFOI 1KQSY 3G71Z 1ML8A 2AYDA 4NBGA 2R7ZI 2E9HA 1FDIA 1VLAA 3S15I 3NH4A 1KD12 4NB8A 1X3WA 4DGLA 1M902 2K3RA 4A93I 2YU9I 3EEDA 2VUMI 2JS4A 1VQ61 4DK1A 1RNIA 4E2ZA 2RHBA 3GCFA 3VMGA 3ESWA 1K8A2 2QRDB 4BY1I 4RVFA 2JA8I 1VQ5Z 1QF8A 1YHQ1 5T6BA 1L1OC 3MONA 2IZ4A 3GTLI 1YIJZ 3TDHB 4E31A 3CD61 2V8IA 1VQM1 3CCMZ 3IX0A 1Z01A 1KQSZ 2VPWA 1X3ZA 4RV9A 4DQYB 3I55Z 3G6EZ 1WZNA 1YJNZ 3GTPI 2LIYA 3TE5B 1VQP1 3GTGI 1Q821 3CC4Z 3HOVI 3CCEZ 1ZB8A 2AKLA 1S72Z 3G4S1 2OOYB 3CCR1 3GTMS 2GTIA 3S16I 3VTNA 1VQ7Z 3I561 3GTMI 1TWFI 3RZOI 1R9TI 1Z03A 3MZLB 3QWUA 3IFUA 1Q812 2M6NA 2JNYA 2V8JA 5D1OA 2W04A 1RQFA 2RBLA 4MD7A 3GTQI 3CCU1 2G2KA 1RO4A 4E2XA 2F4OA 2RPRA 3CCJZ 1ZB9A 3FQMA 5C4XI 2V45A 1Q862 3CME1 1YJW1 4E32A 4MD9A 4Y52I 2M48A 1M1K2 1Q7Y2 2DE6A 1K83I 3S2HI 5C3EI 1NJI2 2Q51A 5T67A 2VUGA 3Q87A 4A3EI 1N8R2 3F3PC 4BBSI 1NP6A 2IZ3A 4TNUA 3I07A 3CCS1 3NFZA 3LUSA 1I6HI 1QVGY 2JA7I 1Y8CA 1QYPA 2E2HI 1VQ8Z 3M4OI 1WW9A 2VPXA 3CCV1 2JR6A 2OOXB 2QA4Z 4HGYA 2OTJZ 3H3VJ 1SIWA 4S1TA 5IT9b 2OTLZ 2EGTA 1Q16A 4QTTA 4RVDA 1VQLZ 3PO2I 4MXUA 2QREB 3CCQZ 3CCLZ 4A3GI 4MRIA 3I4NI 1Y1VS 4CL1A 1YJ9Z 3S1NI 3FQQA 1TWCI 1LQLA 1Y1VI 2JA5I 2QEX1 4A3LI 1YUAA 3FKII 1KC82 1TWHI 1RO2A 2J6AA 4EWCA 3NH8A 1TWAI 2LEXA 3F3FC 1YI2Z 4NBEA 2H85A 4E2YA 1VQ51 1VQ6Z 1QVGZ 2NVQI 4XX2A 2K5RA 3VB9A 3JAMb 1W2BZ 4NBCA 1K732 1Z02A 1YHQZ 1Q7Y1 4NBHA 3CCM1 1VQ91 3M3YI 1DL6A 4NBBA 1USPA 3D6WA 3I551 3CQZI 3G6E1 1QVFY 3CD6Z 3GTOI 1VQMZ 3S17I 2RT9A 3CC41 2NAPA 4NBDA 5D1OB 5A2Qb 3CCE1 3CC21 2R92I 2B63I 2WAQA 3S1QI 3JAMf 3T4NB 1VQPZ 1RO0A 5CM2M 4MD8A 2KI7B 1QXFA 1PFTA 3VMIA 1KD11 4A3KI 2Y0SA 2PK7A 4MH4A 2VF1A 2HU9A 2JMOA 5LL6f 3BG1B 1VQOZ 1M901 2QRCB 2R93I 3K7AI 3CMA1 3H0GI 1NUIA 4NBAA 2VPZA 3HOWI 1VQKZ 1S7MA 3I4MI 1VQ41 3BG0B 5C44I 3CCJ1 2KPIA 5T64A 2GU2A 3NH5A 1QVFZ 2DE7A 1YITZ 2PM9A 3PO3S 4RVHA 1K8A1 2JUBA 3CC7Z 3PO3I 2JIOA 3NDJA 3KIHA 3J81b 4BXXI
chains in the Genus database with same CATH topology
4RVGA 4A3FI 4MONA 5FLXb 2QR1B 2NVXI 3S1MI 1P9NA 2HF1A 1VQN1 4RS4A 2RIQA 2PMZA 1W2BY 3CXCY 1K9M2 3J7A4 1Q822 1YUKA 2DE5A 1I3QI 1TFIA 1Q811 2OTJ1 3G711 1X0TA 3OW2Y 1Y1WI 2O4HA 4A3II 5FLXf 4A3DI 4NFRA 2OTL1 2LFUA 5IP7I 4BBRI 4NH1C 2GTHA 1VQL1 3HKZA 3CCQ1 2E2II 2Q4ZA 3CCL1 1YJ91 3EERA 5IP9I 3J80b 4A3JI 5IT9f 3HOXI 4HGZA 3CPWY 1Q861 3P5JB 3D9XA 2QEXZ 1YI21 1USPB 3CXCZ 1YIJ1 4E33A 5FLMI 1M1K1 1NJI1 3OW2Z 3J80f 2W03A 2R6MA 1YJN1 3NDIA 1N8R1 1TWGI 2P28A 2O53A 5AN9F 3HOYI 1S721 1VQ9Z 3S2DI 4AYBA 1VQ71 2NVTI 1JJ2Y 4NOZA 3GKQA 1RLYA 3G4SZ 4A3BI 3CCRZ 1K9M1 3CPWZ 3CC2Z 2ZAEB 3I56Z 3U50C 2QKDA 5C4JI 5A2Qf 1VQO1 2QLVB 4BY7I 4NBFA 2I3CA 3CCUZ 1VQK1 1KC81 3HOUI 3CMAZ 1YIT1 1VQ4Z 3GTKI 2P3YA 3CC71 4QTUA 5D1PA 3CMEZ 1JWHC 1JJ2Z 3HOZI 2F4MA 3VMHA 1N2FA 2JA6I 3S14I 2BJOA 1K731 3KIFA 1YJWZ 4E2WA 4X6AI 4NB9A 2E2JI 1I50I 3MZKB 2V8KA 4A3MI 2WB1A 3IF8A 4Y7NI 3S1RI 3J81f 1WCMI 2NVYI 1VQ81 4E30A 4HH4A 1VQNZ 2QA41 1ZH1A 3CCSZ 2OZKA 2YADA 3RZDI 3GTJI 3CCVZ 1WIIA 1KRLA 4A3CI 1SFOI 1KQSY 3G71Z 1ML8A 4NBGA 2R7ZI 2E9HA 1VLAA 3S15I 3NH4A 1KD12 4NB8A 1X3WA 4DGLA 1M902 2K3RA 4A93I 2YU9I 3EEDA 2VUMI 2JS4A 1VQ61 4DK1A 1RNIA 4E2ZA 2RHBA 3GCFA 3VMGA 3ESWA 1K8A2 2QRDB 4BY1I 4RVFA 2JA8I 1VQ5Z 1QF8A 1YHQ1 5T6BA 1L1OC 3MONA 2IZ4A 3GTLI 1YIJZ 3TDHB 4E31A 3CD61 2V8IA 1VQM1 3CCMZ 3IX0A 1Z01A 1KQSZ 1X3ZA 4RV9A 4DQYB 3I55Z 3G6EZ 1YJNZ 3GTPI 2LIYA 3TE5B 1VQP1 3GTGI 1Q821 3CC4Z 3HOVI 3CCEZ 1ZB8A 2AKLA 1S72Z 3G4S1 2OOYB 3CCR1 3GTMS 2GTIA 3S16I 3VTNA 1VQ7Z 3I561 3GTMI 1TWFI 3RZOI 1R9TI 1Z03A 3MZLB 3QWUA 3IFUA 1Q812 2M6NA 2JNYA 2V8JA 5D1OA 2W04A 1RQFA 2RBLA 4MD7A 3GTQI 3CCU1 2G2KA 1RO4A 4E2XA 2F4OA 2RPRA 3CCJZ 1ZB9A 3FQMA 5C4XI 1Q862 3CME1 1YJW1 4E32A 4MD9A 4Y52I 2M48A 1M1K2 1Q7Y2 2DE6A 1K83I 3S2HI 5C3EI 1NJI2 2Q51A 5T67A 2VUGA 3Q87A 4A3EI 1N8R2 3F3PC 4BBSI 1NP6A 2IZ3A 4TNUA 3I07A 3CCS1 3NFZA 3LUSA 1I6HI 1QVGY 2JA7I 1QYPA 2E2HI 1VQ8Z 3M4OI 1WW9A 3CCV1 2JR6A 2OOXB 2QA4Z 4HGYA 2OTJZ 3H3VJ 4S1TA 5IT9b 2OTLZ 2EGTA 4QTTA 4RVDA 1VQLZ 3PO2I 4MXUA 2QREB 3CCQZ 3CCLZ 4A3GI 4MRIA 3I4NI 1Y1VS 4CL1A 1YJ9Z 3S1NI 3FQQA 1TWCI 1LQLA 1Y1VI 2JA5I 2QEX1 4A3LI 1YUAA 3FKII 1KC82 1TWHI 1RO2A 2J6AA 4EWCA 3NH8A 1TWAI 3F3FC 1YI2Z 4NBEA 2H85A 4E2YA 1VQ51 1VQ6Z 1QVGZ 2NVQI 4XX2A 2K5RA 3VB9A 3JAMb 1W2BZ 4NBCA 1K732 1Z02A 1YHQZ 1Q7Y1 4NBHA 3CCM1 1VQ91 3M3YI 1DL6A 4NBBA 1USPA 3D6WA 3I551 3CQZI 3G6E1 1QVFY 3CD6Z 3GTOI 1VQMZ 3S17I 2RT9A 3CC41 4NBDA 5D1OB 5A2Qb 3CCE1 3CC21 2R92I 2B63I 2WAQA 3S1QI 3JAMf 3T4NB 1VQPZ 1RO0A 5CM2M 4MD8A 2KI7B 1PFTA 3VMIA 1KD11 4A3KI 2Y0SA 2PK7A 4MH4A 2VF1A 2HU9A 2JMOA 5LL6f 3BG1B 1VQOZ 1M901 2QRCB 2R93I 3K7AI 3CMA1 3H0GI 1NUIA 4NBAA 3HOWI 1VQKZ 1S7MA 3I4MI 1VQ41 3BG0B 5C44I 3CCJ1 2KPIA 5T64A 2GU2A 3NH5A 1QVFZ 2DE7A 1YITZ 2PM9A 3PO3S 4RVHA 1K8A1 2JUBA 3CC7Z 3PO3I 3NDJA 3KIHA 3J81b 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLV B;  3T4N B;  3TDH B;  3TE5 B;  2OOY B;  2QRE B;  2QR1 B;  2QRD B;  2OOX B;  2QRC B; 
#chains in the Genus database with same CATH topology
 4RVG A;  4A3F I;  1WJ2 A;  4MON A;  5FLX b;  2QR1 B;  2NVX I;  3S1M I;  1P9N A;  2HF1 A;  1VQN 1;  4RS4 A;  2RIQ A;  2PMZ A;  1W2B Y;  3CXC Y;  1K9M 2;  3J7A 4;  1Q82 2;  1YUK A;  2DE5 A;  1I3Q I;  2JIQ A;  1TFI A;  1Q81 1;  2OTJ 1;  3G71 1;  1X0T A;  3OW2 Y;  1Y1W I;  2O4H A;  4A3I I;  3IR7 A;  5FLX f;  4A3D I;  4NFR A;  2OTL 1;  2LFU A;  2V3V A;  5IP7 I;  4BBR I;  4NH1 C;  2GTH A;  1VQL 1;  3HKZ A;  1AA6 A;  3CCQ 1;  2E2I I;  2Q4Z A;  3CCL 1;  1YJ9 1;  3EER A;  5IP9 I;  3J80 b;  4A3J I;  5IT9 f;  3HOX I;  4HGZ A;  3CPW Y;  1Q86 1;  3P5J B;  3D9X A;  2QEX Z;  1YI2 1;  1USP B;  3CXC Z;  1YIJ 1;  4E33 A;  5FLM I;  1M1K 1;  1NJI 1;  3OW2 Z;  3J80 f;  2W03 A;  2R6M A;  1YJN 1;  3NDI A;  2IV2 X;  1N8R 1;  1TWG I;  2P28 A;  2O53 A;  5AN9 F;  3HOY I;  1S72 1;  1VQ9 Z;  3S2D I;  4AYB A;  1VQ7 1;  2NVT I;  1JJ2 Y;  4NOZ A;  3GKQ A;  1RLY A;  3G4S Z;  4A3B I;  3CCR Z;  1K9M 1;  3CPW Z;  3CC2 Z;  2ZAE B;  3I56 Z;  3U50 C;  2QKD A;  2E7Z A;  5C4J I;  5A2Q f;  1FDO A;  1VQO 1;  2QLV B;  4BY7 I;  4NBF A;  2I3C A;  2JIR A;  3CCU Z;  1VQK 1;  1KC8 1;  3HOU I;  3CMA Z;  1YIT 1;  1VQ4 Z;  3GTK I;  2P3Y A;  3CC7 1;  4QTU A;  5D1P A;  3CME Z;  1JWH C;  1JJ2 Z;  3HOZ I;  2F4M A;  3VMH A;  1N2F A;  2JA6 I;  3S14 I;  2BJO A;  1K73 1;  3KIF A;  1YJW Z;  4E2W A;  4X6A I;  4NB9 A;  2VPY A;  2E2J I;  1I50 I;  3MZK B;  2V8K A;  2JIM A;  4A3M I;  2JIP A;  2WB1 A;  3D2L A;  3IF8 A;  4Y7N I;  3S1R I;  3J81 f;  1WCM I;  2NVY I;  1VQ8 1;  4E30 A;  4HH4 A;  1VQN Z;  2QA4 1;  1ZH1 A;  3CCS Z;  2OZK A;  2YAD A;  3RZD I;  3GTJ I;  3CCV Z;  1WII A;  1KRL A;  4A3C I;  1SFO I;  1KQS Y;  3G71 Z;  1ML8 A;  2AYD A;  4NBG A;  2R7Z I;  2E9H A;  1FDI A;  1VLA A;  3S15 I;  3NH4 A;  1KD1 2;  4NB8 A;  1X3W A;  4DGL A;  1M90 2;  2K3R A;  4A93 I;  2YU9 I;  3EED A;  2VUM I;  2JS4 A;  1VQ6 1;  4DK1 A;  1RNI A;  4E2Z A;  2RHB A;  3GCF A;  3VMG A;  3ESW A;  1K8A 2;  2QRD B;  4BY1 I;  4RVF A;  2JA8 I;  1VQ5 Z;  1QF8 A;  1YHQ 1;  5T6B A;  1L1O C;  3MON A;  2IZ4 A;  3GTL I;  1YIJ Z;  3TDH B;  4E31 A;  3CD6 1;  2V8I A;  1VQM 1;  3CCM Z;  3IX0 A;  1Z01 A;  1KQS Z;  2VPW A;  1X3Z A;  4RV9 A;  4DQY B;  3I55 Z;  3G6E Z;  1WZN A;  1YJN Z;  3GTP I;  2LIY A;  3TE5 B;  1VQP 1;  3GTG I;  1Q82 1;  3CC4 Z;  3HOV I;  3CCE Z;  1ZB8 A;  2AKL A;  1S72 Z;  3G4S 1;  2OOY B;  3CCR 1;  3GTM S;  2GTI A;  3S16 I;  3VTN A;  1VQ7 Z;  3I56 1;  3GTM I;  1TWF I;  3RZO I;  1R9T I;  1Z03 A;  3MZL B;  3QWU A;  3IFU A;  1Q81 2;  2M6N A;  2JNY A;  2V8J A;  5D1O A;  2W04 A;  1RQF A;  2RBL A;  4MD7 A;  3GTQ I;  3CCU 1;  2G2K A;  1RO4 A;  4E2X A;  2F4O A;  2RPR A;  3CCJ Z;  1ZB9 A;  3FQM A;  5C4X I;  2V45 A;  1Q86 2;  3CME 1;  1YJW 1;  4E32 A;  4MD9 A;  4Y52 I;  2M48 A;  1M1K 2;  1Q7Y 2;  2DE6 A;  1K83 I;  3S2H I;  5C3E I;  1NJI 2;  2Q51 A;  5T67 A;  2VUG A;  3Q87 A;  4A3E I;  1N8R 2;  3F3P C;  4BBS I;  1NP6 A;  2IZ3 A;  4TNU A;  3I07 A;  3CCS 1;  3NFZ A;  3LUS A;  1I6H I;  1QVG Y;  2JA7 I;  1Y8C A;  1QYP A;  2E2H I;  1VQ8 Z;  3M4O I;  1WW9 A;  2VPX A;  3CCV 1;  2JR6 A;  2OOX B;  2QA4 Z;  4HGY A;  2OTJ Z;  3H3V J;  1SIW A;  4S1T A;  5IT9 b;  2OTL Z;  2EGT A;  1Q16 A;  4QTT A;  4RVD A;  1VQL Z;  3PO2 I;  4MXU A;  2QRE B;  3CCQ Z;  3CCL Z;  4A3G I;  4MRI A;  3I4N I;  1Y1V S;  4CL1 A;  1YJ9 Z;  3S1N I;  3FQQ A;  1TWC I;  1LQL A;  1Y1V I;  2JA5 I;  2QEX 1;  4A3L I;  1YUA A;  3FKI I;  1KC8 2;  1TWH I;  1RO2 A;  2J6A A;  4EWC A;  3NH8 A;  1TWA I;  2LEX A;  3F3F C;  1YI2 Z;  4NBE A;  2H85 A;  4E2Y A;  1VQ5 1;  1VQ6 Z;  1QVG Z;  2NVQ I;  4XX2 A;  2K5R A;  3VB9 A;  3JAM b;  1W2B Z;  4NBC A;  1K73 2;  1Z02 A;  1YHQ Z;  1Q7Y 1;  4NBH A;  3CCM 1;  1VQ9 1;  3M3Y I;  1DL6 A;  4NBB A;  1USP A;  3D6W A;  3I55 1;  3CQZ I;  3G6E 1;  1QVF Y;  3CD6 Z;  3GTO I;  1VQM Z;  3S17 I;  2RT9 A;  3CC4 1;  2NAP A;  4NBD A;  5D1O B;  5A2Q b;  3CCE 1;  3CC2 1;  2R92 I;  2B63 I;  2WAQ A;  3S1Q I;  3JAM f;  3T4N B;  1VQP Z;  1RO0 A;  5CM2 M;  4MD8 A;  2KI7 B;  1QXF A;  1PFT A;  3VMI A;  1KD1 1;  4A3K I;  2Y0S A;  2PK7 A;  4MH4 A;  2VF1 A;  2HU9 A;  2JMO A;  5LL6 f;  3BG1 B;  1VQO Z;  1M90 1;  2QRC B;  2R93 I;  3K7A I;  3CMA 1;  3H0G I;  1NUI A;  4NBA A;  2VPZ A;  3HOW I;  1VQK Z;  1S7M A;  3I4M I;  1VQ4 1;  3BG0 B;  5C44 I;  3CCJ 1;  2KPI A;  5T64 A;  2GU2 A;  3NH5 A;  1QVF Z;  2DE7 A;  1YIT Z;  2PM9 A;  3PO3 S;  4RVH A;  1K8A 1;  2JUB A;  3CC7 Z;  3PO3 I;  2JIO A;  3NDJ A;  3KIH A;  3J81 b;  4BXX I; 
#chains in the Genus database with same CATH homology
 4RVG A;  4A3F I;  4MON A;  5FLX b;  2QR1 B;  2NVX I;  3S1M I;  1P9N A;  2HF1 A;  1VQN 1;  4RS4 A;  2RIQ A;  2PMZ A;  1W2B Y;  3CXC Y;  1K9M 2;  3J7A 4;  1Q82 2;  1YUK A;  2DE5 A;  1I3Q I;  1TFI A;  1Q81 1;  2OTJ 1;  3G71 1;  1X0T A;  3OW2 Y;  1Y1W I;  2O4H A;  4A3I I;  5FLX f;  4A3D I;  4NFR A;  2OTL 1;  2LFU A;  5IP7 I;  4BBR I;  4NH1 C;  2GTH A;  1VQL 1;  3HKZ A;  3CCQ 1;  2E2I I;  2Q4Z A;  3CCL 1;  1YJ9 1;  3EER A;  5IP9 I;  3J80 b;  4A3J I;  5IT9 f;  3HOX I;  4HGZ A;  3CPW Y;  1Q86 1;  3P5J B;  3D9X A;  2QEX Z;  1YI2 1;  1USP B;  3CXC Z;  1YIJ 1;  4E33 A;  5FLM I;  1M1K 1;  1NJI 1;  3OW2 Z;  3J80 f;  2W03 A;  2R6M A;  1YJN 1;  3NDI A;  1N8R 1;  1TWG I;  2P28 A;  2O53 A;  5AN9 F;  3HOY I;  1S72 1;  1VQ9 Z;  3S2D I;  4AYB A;  1VQ7 1;  2NVT I;  1JJ2 Y;  4NOZ A;  3GKQ A;  1RLY A;  3G4S Z;  4A3B I;  3CCR Z;  1K9M 1;  3CPW Z;  3CC2 Z;  2ZAE B;  3I56 Z;  3U50 C;  2QKD A;  5C4J I;  5A2Q f;  1VQO 1;  2QLV B;  4BY7 I;  4NBF A;  2I3C A;  3CCU Z;  1VQK 1;  1KC8 1;  3HOU I;  3CMA Z;  1YIT 1;  1VQ4 Z;  3GTK I;  2P3Y A;  3CC7 1;  4QTU A;  5D1P A;  3CME Z;  1JWH C;  1JJ2 Z;  3HOZ I;  2F4M A;  3VMH A;  1N2F A;  2JA6 I;  3S14 I;  2BJO A;  1K73 1;  3KIF A;  1YJW Z;  4E2W A;  4X6A I;  4NB9 A;  2E2J I;  1I50 I;  3MZK B;  2V8K A;  4A3M I;  2WB1 A;  3IF8 A;  4Y7N I;  3S1R I;  3J81 f;  1WCM I;  2NVY I;  1VQ8 1;  4E30 A;  4HH4 A;  1VQN Z;  2QA4 1;  1ZH1 A;  3CCS Z;  2OZK A;  2YAD A;  3RZD I;  3GTJ I;  3CCV Z;  1WII A;  1KRL A;  4A3C I;  1SFO I;  1KQS Y;  3G71 Z;  1ML8 A;  4NBG A;  2R7Z I;  2E9H A;  1VLA A;  3S15 I;  3NH4 A;  1KD1 2;  4NB8 A;  1X3W A;  4DGL A;  1M90 2;  2K3R A;  4A93 I;  2YU9 I;  3EED A;  2VUM I;  2JS4 A;  1VQ6 1;  4DK1 A;  1RNI A;  4E2Z A;  2RHB A;  3GCF A;  3VMG A;  3ESW A;  1K8A 2;  2QRD B;  4BY1 I;  4RVF A;  2JA8 I;  1VQ5 Z;  1QF8 A;  1YHQ 1;  5T6B A;  1L1O C;  3MON A;  2IZ4 A;  3GTL I;  1YIJ Z;  3TDH B;  4E31 A;  3CD6 1;  2V8I A;  1VQM 1;  3CCM Z;  3IX0 A;  1Z01 A;  1KQS Z;  1X3Z A;  4RV9 A;  4DQY B;  3I55 Z;  3G6E Z;  1YJN Z;  3GTP I;  2LIY A;  3TE5 B;  1VQP 1;  3GTG I;  1Q82 1;  3CC4 Z;  3HOV I;  3CCE Z;  1ZB8 A;  2AKL A;  1S72 Z;  3G4S 1;  2OOY B;  3CCR 1;  3GTM S;  2GTI A;  3S16 I;  3VTN A;  1VQ7 Z;  3I56 1;  3GTM I;  1TWF I;  3RZO I;  1R9T I;  1Z03 A;  3MZL B;  3QWU A;  3IFU A;  1Q81 2;  2M6N A;  2JNY A;  2V8J A;  5D1O A;  2W04 A;  1RQF A;  2RBL A;  4MD7 A;  3GTQ I;  3CCU 1;  2G2K A;  1RO4 A;  4E2X A;  2F4O A;  2RPR A;  3CCJ Z;  1ZB9 A;  3FQM A;  5C4X I;  1Q86 2;  3CME 1;  1YJW 1;  4E32 A;  4MD9 A;  4Y52 I;  2M48 A;  1M1K 2;  1Q7Y 2;  2DE6 A;  1K83 I;  3S2H I;  5C3E I;  1NJI 2;  2Q51 A;  5T67 A;  2VUG A;  3Q87 A;  4A3E I;  1N8R 2;  3F3P C;  4BBS I;  1NP6 A;  2IZ3 A;  4TNU A;  3I07 A;  3CCS 1;  3NFZ A;  3LUS A;  1I6H I;  1QVG Y;  2JA7 I;  1QYP A;  2E2H I;  1VQ8 Z;  3M4O I;  1WW9 A;  3CCV 1;  2JR6 A;  2OOX B;  2QA4 Z;  4HGY A;  2OTJ Z;  3H3V J;  4S1T A;  5IT9 b;  2OTL Z;  2EGT A;  4QTT A;  4RVD A;  1VQL Z;  3PO2 I;  4MXU A;  2QRE B;  3CCQ Z;  3CCL Z;  4A3G I;  4MRI A;  3I4N I;  1Y1V S;  4CL1 A;  1YJ9 Z;  3S1N I;  3FQQ A;  1TWC I;  1LQL A;  1Y1V I;  2JA5 I;  2QEX 1;  4A3L I;  1YUA A;  3FKI I;  1KC8 2;  1TWH I;  1RO2 A;  2J6A A;  4EWC A;  3NH8 A;  1TWA I;  3F3F C;  1YI2 Z;  4NBE A;  2H85 A;  4E2Y A;  1VQ5 1;  1VQ6 Z;  1QVG Z;  2NVQ I;  4XX2 A;  2K5R A;  3VB9 A;  3JAM b;  1W2B Z;  4NBC A;  1K73 2;  1Z02 A;  1YHQ Z;  1Q7Y 1;  4NBH A;  3CCM 1;  1VQ9 1;  3M3Y I;  1DL6 A;  4NBB A;  1USP A;  3D6W A;  3I55 1;  3CQZ I;  3G6E 1;  1QVF Y;  3CD6 Z;  3GTO I;  1VQM Z;  3S17 I;  2RT9 A;  3CC4 1;  4NBD A;  5D1O B;  5A2Q b;  3CCE 1;  3CC2 1;  2R92 I;  2B63 I;  2WAQ A;  3S1Q I;  3JAM f;  3T4N B;  1VQP Z;  1RO0 A;  5CM2 M;  4MD8 A;  2KI7 B;  1PFT A;  3VMI A;  1KD1 1;  4A3K I;  2Y0S A;  2PK7 A;  4MH4 A;  2VF1 A;  2HU9 A;  2JMO A;  5LL6 f;  3BG1 B;  1VQO Z;  1M90 1;  2QRC B;  2R93 I;  3K7A I;  3CMA 1;  3H0G I;  1NUI A;  4NBA A;  3HOW I;  1VQK Z;  1S7M A;  3I4M I;  1VQ4 1;  3BG0 B;  5C44 I;  3CCJ 1;  2KPI A;  5T64 A;  2GU2 A;  3NH5 A;  1QVF Z;  2DE7 A;  1YIT Z;  2PM9 A;  3PO3 S;  4RVH A;  1K8A 1;  2JUB A;  3CC7 Z;  3PO3 I;  3NDJ A;  3KIH A;  3J81 b;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...