2RHBA

Crystal structure of nsp15-h234a mutant- hexamer in asymmetric unit
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
345
structure length
345
Chain Sequence
MSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEAIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
publication title Structural and functional analyses of the severe acute respiratory syndrome coronavirus endoribonuclease Nsp15.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 73
structure length 345
sequence length 345
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rhbA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhbA02
2OZKA 4S1TA 2GTIA 2GTHA 2RHBA 4RS4A 2H85A
chains in the Genus database with same CATH superfamily
1JHQA 1SXJC 4QFMA 5AUQA 1C9MA 4IXNA 1A69A 2WVJA 1NE2A 4O2AB 1UOOA 1SVIA 5IDVA 4JHLA 1KE1A 3T54A 4PHGA 3KZ1E 3VR4D 3NTUA 4F0JA 5BR7A 3FCSB 4DJFC 4U7HA 5KO2A 4FYMA 5EA2A 3OSZA 4IDGA 5HUHA 1UXJA 1POWA 2I5PO 4PNHA 4Y98A 1RWOA 5EJ9A 3FYUB 3G6E1 3LGAA 1B6GA 1I7NA 5J1TB 2O7RA 4J3NA 3TBKA 3WLKX 4MX8A 1GEGA 2PNFA 4EA8A 1GNSA 2EZTA 2AMLA 2EAUA 4Q9NA 2FNAA 4GM1A 4HWTA 4GBGA 4JT4A 5T57A 2QXYA 4YHBA 4XAQA 3CO0S 5B1HA 3WMFA 2CNKA 1AQNA 1MO6A 1SCQA 4JDUA 2X1MA 4PZDA 4X41A 7MDHA 1KI1A 1SUBA 1XRLA 4IX1A 2P9CA 4XH9B 3S5UA 2YJ6A 3KAQA 1I51A 5U4QA 1WKCA 3ZCTA 1WDTA 1JDNA 1I24A 1OTHA 1XX6A 2PGIA 4H4DA 1LDEA 1G63A 5D6NA 1RRMA 4JA2A 3E03A 4JU9A 4HDAA 2QTZA 4JXJA 5B4TA 5KWSA 1E8NA 1BWPA 4FR2A 4DMKA 5LQRA 4UZFA 4MWZA 2FSUA 5I7UA 1S2IA 4UMDA 1AB6A 1SKUA 4I3FA 4DCCA 1M2VB 3FNHA 3MBKA 3O8LA 1KJZA 5FUYA 5U9CA 3U1BA 4A3GI 1IBMB 3SEQA 1N9GA 3IEUA 1C81A 1IIBA 4G1BA 4EAQA 4NL4H 2C57A 2PO7A 3D0KA 5C34B 4JS0A 3EZGA 4QRIA 3RCBA 3DB1A 1H2ZA 5AP9A 3WSTA 1KL7A 3ODPA 3ECSA 4FOPA 5D87A 5TMBA 4E5PA 5A4JA 2J41A 3K0KA 4BGIA 2EW8A 4TUYA 4Z4CA 1LNSA 2FK8A 4NMWA 3DBHA 3PDJA 4EPRA 1VQP1 4FLMA 1NDHA 2NUTB 5A4AA 1ORTA 3QVTA 2OOXB 1ZY2A 5CGQB 2G80A 2IDMA 3KALA 3G02A 4Y6OA 1UZMA 3KUXA 4A9AA 3MT0A 4R3NA 4OLHA 3AMVA 1TKAA 1V5IA 1Y4SA 2BGIA 4DUGA 4HLDA 2HU2A 5J5AA 3BCHA 4RCVA 5AW0A 3HXOA 1CY4A 3OOEA 3Q8KA 3V7FA 4KL8S 3NGLA 4R8RA 1TMGE 2G4CA 5IS2A 4LY9A 4P32A 2PL1A 2PMWB 3KLOA 4O6VA 1SUFA 2E2II 3WTBA 4B3XA 2DFPA 3RU7A 2VAMA 3DZFA 4U00A 3BIOA 4MGYR 4X3CA 4CV0A 1UBTS 4R1TA 1ZKMA 1JJ2Z 3AHCA 4N47A 3FTCA 1KC3A 3MWJA 3QWFA 2P0YA 2P1RA 4P2GA 4R3UC 5MDHA 3NAGA 5GIPE 4PTZA 5HOQA 3FVQA 1GJRA 4A3BI 3OZCA 2VSXA 5FBLB 3WKDA 4CF6A 3BTSA 1W4CA 5GY7A 4IV8A 3WO1A 3INYA 3DZCA 2DTXA 2YICA 3KYBA 3LY9A 1VPDA 2A3NA 4KQWA 5CM2Z 3UJ6A 4HQOA 3GNSA 2DKOA 3EG9B 3SM9A 5LXTA 5ALMA 4YRLA 4TYNA 2W2MA 3H11B 3U48A 5ADVA 2AE2A 2GUWA 3AJDA 2Q0QA 4BN5A 2LE0A 1YQ9A 3HFGA 2C2GA 1Y7PA 4JLMA 3PITA 3PDIB 1CE8A 2QNRA 2QAIA 1O6BA 3K6JA 4ND8A 3Q7TA 3WJ1A 2JGMA 2E7ZA 3DLHA 4AURA 2WU0A 1NVVQ 3LLUA 3Q6NA 1BDHA 1A2KC 1DEAA 1Z8NA 2C7BA 2VZ0A 4E46A 2F55A 4TWZA 3NI2A 3SZGA 1V7QA 1RHJA 3HU5A 5E4JA 2XYGA 1GXSA 2REQB 3G2QA 2H0AA 3IT1A 4RLHA 4JYPA 3MB8A 1NC3A 3D31A 1XAIA 3KU1A 2FP4B 2JAXA 1UDCA 2I4NA 5EQTA 1QYXA 2RBKA 3BSWA 4Q0MA 2OC4A 4PCUA 1M2KA 1EVQA 7REQA 1JHZA 1LX7A 1UPFA 1JEJA 1JEDA 1SKAA 4KBYA 5EZYF 2JG3A 2PUCA 2EERA 3IPYA 5AKKA 4TVOA 3D6AA 2JVIA 3ZDEA 1WPRA 1OLSA 4FK8A 4AP5A 1L7BA 4GVXA 1LRKA 3F9IA 1ZHOA 5EG5A 3ZCPA 5AW4A 5HKAA 4Y52I 3L0SA 1TPZA 4EHKA 1E94E 3QVSA 1KZ6A 2Q62A 4LHWA 1IXRC 2CVFA 4YXWA 1JDUA 5JSQA 1KMCA 4ISBA 1VXRA 3OLCX 4RS3A 2ZEJA 4URFA 3BXGA 3VC3A 2H52A 3IBFA 2BEUA 3G88A 1FMJA 4FQ7A 4RVOA 3HJAA 4F72A 3QOWA 4HQNA 1VZ3A 3HKEB 4M3NA 3H5TA 3PFWO 2QI9F 2ACVA 3B9QA 1P2DA 3JXEA 4DW8A 4EELA 2AH5A 1CK4A 3E53A 4XDZA 3V9PA 5L53A 1Q0RA 2QJOA 1DKQA 3BB1A 3B53X 4W5QA 3MEQA 3R40A 3PEUA 5AQEA 4PE5B 2C00A 2F4NA 5DI9A 1E1RA 4KPGA 1BFKA 1BVUA 2QD3A 1RHUA 5CH8A 1PWZA 4MOWA 1XA4A 2G9NA 4CJXA 3V4RA 4LKOA 1KRWA 2C9MA 1P9NA 2VRBA 5CVEA 4Y9UA 5TGZA 3C3DA 4EDHA 1Y37A 2VDWB 2J5BA 4QEKA 4TMTA 4JBWA 4BO7A 2HI0A 3VHXB 4YRGA 4CEJA 1QQTA 5JAQA 3EDMA 1FDSA 2FW9A 4DNOA 3VGJA 2AEMA 4Q1DA 2JGEA 3IT3A 4HX2A 4L28A 2XKJE 4J2TA 5C2JB 2PUBA 3BMCB 4Q3OA 2JFFA 2DVMA 1M33A 5AI4A 2CJFA 2H5JA 1GKKA 4EHAA 4ZI3A 1GNTA 5AW1A 2CHVA 1PJAA 3RKRA 1ZXXA 1Q0PA 1C4WA 4TVKA 1CJSA 1N7HA 2J08A 3ZS8A 1HE1C 3A1DA 2WHYA 1X0VA 4CLRA 2PMCA 3BC1A 1C1DB 2VDNB 5AESA 5DKFA 4PHTA 4YALA 4KRGA 5AVQA 1ZMXA 2JFYA 1CR6A 2R7KA 4NZOA 3E84A 4IJUA 2PUGA 1WLSA 4IYRA 4F9FA 3H4VA 4L22A 4CLXA 4P58A 5IABA 3N8IA 3O82A 1R5JA 1ISSA 3WFIA 1QP8A 3S1AA 2GCIA 5BO5A 3AESB 3S1SA 4QTYA 5D6OA 4MQEB 1L4MA 4FYPA 1BE0A 3ZZ0A 3C4QA 4FOOA 3Q6IA 4HRYA 2ZIXA 1TFRA 3EE6A 2AX4A 1KAMA 2ZI9A 5JMPA 2H4XA 3UCXA 1VKJA 4P3PA 1U3GA 3DNFA 2EEPA 3ADKA 2AC7A 4J2HA 2ZB8A 3PLRA 4LQ4A 4NP6A 2NU8B 3TD2A 1ZBQA 4E5NA 2REXB 4CIBA 1P9RA 4OMFG 4C7MA 1IB6A 5BVHA 1Z4OA 1T0IA 3PR3A 4KZPA 2EKBA 1K83I 4G4IA 4N6OA 2GETA 5I48A 4MW2A 1VQ91 5KQGA 4F6RB 4A0GA 2WAMA 4G0VA 3K6KA 2BONA 4FC7A 4EPWA 1C9JA 1WPGA 5K0EA 3FNQA 4REQB 3IQXA 3VU9A 2WD7A 4LDZA 1FXWF 3VKGA 3WQQA 3QKSB 3ICOA 2HDWA 1TX4B 4W8GA 5CB4A 4D8XA 4BFYA 2B7CA 3CLTC 4D4JA 5JJ5A 1P62B 5AHOA 1RLJA 3EEBA 1NTOA 4JEIA 5FWYB 3DZHA 3X0DA 4B9EA 3AUUA 1XZJA 4HDOB 4I1VA 4MW4A 4Z0TA 5KJFA 1ZK0A 5P8WA 1MX5A 1KMMA 1KKLA 3HDYA 1EXMA 3ZGYA 3JATB 2RB4A 1CNFA 2NT3A 2Q0SA 3K0AB 4GDFA 1DX9A 5TRTA 3OJLA 1K08A 2F1JA 1S02A 1UMDA 3MLBA 4LI0A 4EUFA 1GGKA 2Q9CA 2GSDA 4QREA 3CEAA 5L9AA 1Z63A 4IWYA 5I9BA 4TQUS 3D6NB 1A82A 2G1AA 3K70B 4JP3A 3KB8A 4KMOA 1FMTA 1LI4A 3WL6A 1QZTA 2W6CX 3M4ZA 2ZSKA 3VVMA 1TU3A 1ZOIA 1SC6A 3QHQA 3ONVA 1RRFA 1TVCA 4G0XA 2HBRA 4O1HA 4PX9A 1DO8A 4EJSB 3OQMA 2HMSA 2PXCA 4F9TA 3DO8A 1JQ5A 1BU5A 3DTNA 1U1DA 1L5WA 4EB6B 1BXZA 2WPNA 3IHTA 4CW7A 4KIJA 3HSKA 1F0KA 1UKBA 1ZW6A 4RA6A 3UB2A 1GG2A 4N0DA 3LUFA 1BG6A 2XWPA 2AC4A 2V7GA 3BJEA 3NT5A 5AXCA 3RJTA 5GAJA 3W7VA 3IEKA 1K9VF 5LJLA 1IOWA 2G06A 4MP6A 5EMHA 1YB4A 4ZZIA 1A9XA 2HMYB 2W48A 3DD5A 4DSNA 3LSTA 3HR7A 2ZT6A 2C9OA 4GMHA 4XFKA 3EXEB 3ZU4A 3RTCA 3FLAA 1N9KA 2BFWA 4ETMA 2WF7A 2Y1FA 1W88A 4M1SA 5EP3A 3TW4A 4XWKA 1W1WA 3KZXA 1F2DA 4EFLA 1G8FA 5T5QA 1X8JA 4RZ3A 5KQPA 5DGXA 1X7DA 4RPIA 4MNTA 2FKNA 2WHPA 2V74B 1BGXT 1PGQA 2Z3WA 2J67A 4LJ7A 4KSCA 1UMCB 1DQYA 1C0EA 1CUVA 2AN3A 3CW9A 3IBTA 5DP2A 3S2GA 3NBYC 1VJ5A 2P3OA 3K35A 3LNTA 3KXPA 4JJ7A 3WNQA 1UAAA 3L93A 4EZBA 3SHVA 4H31A 4MUNA 3GW8A 4HVCA 1TVEA 6GPBA 5G0VA 1CEYA 3V46A 1R9TI 2FWRA 2LEXA 4B85A 1OLOA 1F6BA 2GTPA 1ZMTA 3ANLA 5H83A 1JDJA 1FP4B 1F3LA 3ZWCA 3RYCA 1AXGA 4NXNB 2BCJQ 2XKAA 1X74A 2BMAA 2ZR0A 3QYFA 3TNDA 5JSFA 4TS9A 4QHYA 3IX0A 3CE9A 2IS6A 2AI1A 5JH7F 2XA1A 2AJCA 1Z73A 4RENA 1T5OA 2P0EA 3O1JC 3OFND 1Q5PA 5JJBA 1UPAA 3WC4A 2QX4A 3ACCA 4B3GA 2E4YA 4QEDA 4HH1A 1DCFA 3I8XA 4YBZA 1E5LA 1RYZA 3T1OA 1T9BA 3DE7X 3KHTA 2BGTA 2ECPA 4NARA 2O5VA 4N76A 4NJMB 1HV8A 1DRWA 2VHWA 1VHTA 4JUFA 4JUBA 1M2FA 1W6UA 5H4HA 5BXYA 3CX7A 3FLBA 4JJ6A 2O8CA 2NMVA 4W1QA 5FTLA 4U7FA 3O73A 5BV0A 3O7MA 3KR2A 2QTTA 4M99A 2P5SA 4V0RA 5EZSA 2PZBA 3ZWMA 4B4WA 1NKTA 1P1RA 4WXYB 1OGYA 1YL5A 2KM1A 3N7TA 1WBBA 4IJKA 1HYQA 3C24A 4MUFA 4AECA 5KQRA 1E9RA 3ISJA 4U5QA 4ZT3A 3M4XA 5SZJA 1JALA 3W5DA 5DZSA 1GPMA 1NLYA 3EWSA 3RV3A 3LC7O 1YCFA 4Q05A 3DH0A 2H65A 3CGWA 3GEMA 1V16B 1UZAA 3H75A 4BKQA 1RJ9A 5HNKA 2IXTA 4PS1A 1ZK1A 3UHOA 4DMHA 3CMAZ 4YRRA 1VL1A 3IO5A 1U99A 1ZOLA 2RBEA 5LYJA 4B3BA 4EPTA 3LM8A 3RYHB 1CCWA 4I5EA 1U0RA 4KB5A 4QOJA 1DV2A 1DJQA 1OA1A 1SHZA 1V6CA 3BRWA 3OE7D 1MORA 4B3TB 5DHQA 1COWD 1W47A 4KVAA 5BORA 4C04A 3MJ4A 3RTBA 1XPOA 1EFRD 3OT4A 4DG5A 1UAGA 4KFCA 2BGGA 4A3JI 3HCFA 1QRAA 1RVDA 4KACA 2GYVA 2JNYA 5A9TA 2B7BA 4J6FA 4TTAA 5HVNA 5HZGA 3TLCA 3PYLA 1XK7A 4FNAA 1QK3A 1I1HA 2XQFA 2GESA 4OAPA 3CNQS 2YW2A 5E8RA 2IV2X 2ZAMA 4KPUB 3N28A 3GLGA 4L4YA 3OETA 1AGRA 1SY7A 4NQZA 3U62A 1A5SB 1GNPA 1WTAA 1XMIA 4PNPA 1IC6A 3M4JA 4JKIA 1T43A 3DMGA 1Q83A 4Q37A 4BTVA 4JBGA 3ER8A 2Z1DA 5FOQA 2AQ8A 2X14A 5GMOA 2QSUA 2YASA 3N5CA 2X7JA 1J2TA 4UDNA 4GOJA 5CX1A 3UTDA 1L5KA 3TG2A 2QM7A 3T0FA 4RGYA 2Q9BA 4A3EI 4ZYZA 4E33A 2ZDHA 3KJIA 1RDFA 3ITKA 4NI5A 5CXQA 1Z0UA 4PFSA 3UO8B 2OYSA 1GO2A 3S7ZA 3FFTA 4X6LA 4FT2A 2UXDB 4LJYA 4DSOA 2B4QA 5FBKA 4Z7OB 1E7WA 4ZCTA 2C7PA 5FLXA 2YVQA 2O3RA 2L19A 1NJ6A 2J87A 2X0FA 3HJFA 3GLSA 4O1IA 5L3SB 2FW0A 3A6KA 2PK7A 4QL3A 3ZHQA 5FWNA 2NX2A 3EPPA 3I6YA 4K0KB 3AUAA 3CF4A 3KIPA 2O5EA 2BZSA 3PKIA 3H3VJ 1Y1KE 2C03A 2XH8A 4KE7A 1E77A 4UM5A 1U7WA 4RY0A 1P18A 1T10A 1UMKA 4OB6A 5A6SB 1SVNA 1T2VA 1DT3A 3T7SA 1XJ0A 4IFBA 1A5BB 4W8OA 4OJMX 5I01A 5I4IA 2K7ZA 3TB6A 2LGJA 4C0AC 3A6FA 4FB4A 2IH5A 3JAMA 1QAOA 1YULA 2XVZA 4UUQA 4P4UA 3AL0C 4GNRA 1U80A 1BKDR 4CGZA 5HKOA 1F4LA 4F4CA 1QE5A 4INJA 4IQ0A 3DBRA 4PZZA 3H6GA 2OV8A 2PK3A 4J75A 1QO7A 1QXFA 4EF4A 2GHTA 1DAEA 2F2TA 3SSAA 4IWNA 1O95A 3MF4A 1ZQ1A 5AH0A 4J0HA 1TMYA 4WZBE 5FV7A 4NFRA 4UPVA 2XXAA 3BH7A 4W6QA 1DWOA 3SIXA 1K97A 5DM0A 3GLFE 3NBMA 5EGSA 2H18A 4IJ5A 4U2GA 2G6BA 4OP3A 1CT9A 3UJPA 1J8VA 3C6KA 3OJCA 1S9HA 4G63A 4X6AI 2F17A 4F97A 4ER0A 4C89A 4QEZA 1INLA 2J5QA 1UP7A 5ARCA 1FFEA 1OXVA 2DMRA 2OO5C 4FIDA 4M8KA 3ZD8A 1KOJA 3CWZA 2GD1O 3EEDA 1WQ4A 2FE4A 1HG1A 4URUR 2OZVA 4GNKA 3PEWA 3Q87A 3B5JA 5KDLA 4BDSA 1PS8A 4EF6A 3C7CB 4N7BA 4R2WA 3QGMA 3S3TA 4C0KA 1R64A 3KSMA 2Z09A 4HNAB 4R83A 1N6RA 2E85A 2IP1A 4H1TA 4KXUA 1P7ZA 3R8XA 3A6DA 1NLMA 3BOSA 3L8FA 5BR1A 1DIAA 4DM3A 1ZL2A 1AT1A 1DBQA 2I78A 2QAGC 5AQ1A 4IDCA 3WMXA 5HIMA 4B6RA 3JD3A 4F2GA 2IWHA 1CX9B 1TYBE 2I4IA 3WKAA 4MJ7A 1SHLA 2LIPA 3DHNA 3IMCA 5BPHA 1L5YA 5FA6A 2YYZA 4YECA 3C3AA 1U02A 1PNRA 2JDIA 1ODKA 3L0CA 3DE4X 1HXHA 3C8HA 1GZ4A 1RXYA 2QTVB 1ACLA 2FEOA 4RMNA 5E1DA 3VNQA 3JD1A 1VIDA 1GUZA 1IG3A 2R66A 4CRWB 3CSUA 4RVFA 2JFOA 1EFLA 3KVVA 4KTVE 4U9UA 3Q0TA 2H57A 1JTFA 4HNVA 1P4RA 4DJJA 1IN7A 3NBAA 4LOHA 2OWEA 4GEGA 3VBEA 3H1EA 2OXTA 4AUMA 5BUSA 1FDVA 4ND4A 4WEQA 4X61A 1M67A 1Y3BE 3L6DA 2R9VA 3PHCA 5K0CA 1YNSA 2W2KA 4RCZA 5A6VA 4H17A 1GAQA 2M32A 4NV0A 2O2EA 3P4UA 4L0CA 4RXUA 1HYEA 4IKPA 3MJDA 4UFPA 5FQOA 4BGDA 2QKDA 3JVVA 3VAZA 4C7VA 2G4LA 2VHZA 1ULZA 4DC9A 1U7TA 3PGKA 4GWGA 4L51A 3UOGA 1GM5A 5GV8A 1P9WA 2E55A 5FLXf 3V2HA 1ETUA 2GN6A 3MINB 1FMFA 1DI0A 3BWXA 4MMZB 3UHJA 2WNHA 5F51A 3JVUA 2OOKA 2XMCA 4MUBA 2HK7A 4HGZA 4OP1A 2Z43A 4ISCA 1XTVA 4C0SA 1E6EA 3U4DA 3LP6A 4DIBA 5J4LA 1TA0A 3G82C 1SIOA 2XE4A 2HC9A 3RIGA 3VO2A 4B45A 4RQTA 1BYIA 4YT2A 2V7QA 2BFDB 5GVSA 1WMDA 3OH8A 5HBGA 3IX7A 1XYYA 4KVGA 5K5EA 1PL0A 1FTGA 1YB2A 2P2ZA 5B3AA 2XVMA 5AJZA 4ZQHA 1CZRA 5CFMA 4OLBA 1W48A 2QPLA 3SR0A 3JAMf 1CP2A 4OAOA 3QG1A 2WFZA 4DCNA 3ND9A 1K75A 3H1FA 1M901 1UBCA 2Q2VA 3DMHA 2ZYRA 1CQPA 2QG4A 4NLLA 3MCTA 4C4AA 4GKAA 2JIPA 4NBNA 3CUWA 3CPWY 1YBHA 5L6LB 3LDUA 3WLIA 3S2YA 2E37A 4WLVA 3S1QI 4N12A 4ZEOA 2MSDB 3O7WA 1E8MA 4RTPA 2GBCA 2A9OA 2EBHX 2QV0A 4GOKA 2DFDA 5D2CA 5BMVF 5E7MA 3BL6A 3CLHA 5CG1A 4FIZA 5DLPA 5HF9A 3MS4A 1M2NA 3T7DA 3OCUA 5JAHA 4Y2GA 1FQWA 3RYTC 2MSKA 3I1IA 4C2UA 4Y6PA 5AOVA 4C4OA 3NMUF 1W36C 1K0UA 2BFPA 3ZZMA 4X6YA 3NONA 1JTVA 3EH1A 3GJ8A 5K8LA 2R8YA 5KHOC 1WHTA 4PYQA 3KYDB 3DBLB 3OWHA 5JWRA 4FFVA 1M0WA 2EP8A 4YDSA 1XOIA 4KQEA 1GFIA 2OV4A 3TF5A 3ZD7A 1N5RA 2GK6A 2W8ZA 4RABA 3F1KA 2FY8A 5JXGA 3R3XA 2DZDA 2PKRA 4LA4A 5CA0A 1G2OA 3P0IA 4I1YA 3LXXA 1VQMZ 1GPBA 3K30A 3RF6A 5LQJA 2FX3A 2FPWA 1NPYA 1RXCA 1K7CA 2XUQA 5KVQA 3KETA 1OASA 4RTMA 1JL3A 1P0CA 2MHCA 3BWYA 3KDAA 1O03A 1POXA 2KYRA 1SBTA 3BK7A 4WCDA 4IIJA 4IH1A 4Q7KA 4GPTA 3C1TA 2WKWA 3DW3X 5LLSA 4YH1A 4DQKA 1PNTA 4QIHA 5IXYA 5CHEA 4FFMA 1PR0A 3G1TA 1CLEA 1W59A 2GEJA 2J9GA 1SCUB 3U6KA 3CRQA 5ERXA 1EFCA 1R6XA 3DT8A 3PUVA 3RPEA 4A0SA 2XUPA 2FQQA 2Z1NA 3H84A 2IEBA 1LB1B 3N74A 2AG8A 4R8SA 3A1VA 5EIOA 1NAHA 5TPZD 5CNKA 3CZAA 1F60A 2OZLB 2XCIA 5FI5A 3DBOB 3SD7A 2Z04A 3GD7A 3A25A 5LNK1 2V3CC 3JQ6A 2LV8A 3GEEA 5CG2A 4CMIB 4Y1RB 5A2QA 2WAXA 4TKUB 4AULA 4NJEB 1RYFA 1WM1A 4W99A 3NDPA 2POQX 2RK4A 3IUJA 3PNYA 5BVGA 3PFCA 3GJSA 3M9XA 2IHNA 3ISVA 1D8AA 2PGJA 3BXPA 4L4RA 2IUTA 2GAFA 4FE3A 4PVCA 1V9CA 3DAHA 4KGXA 5EJ4A 1N3YA 1KH1A 1XHEA 5IEBA 3ASUA 3BZWA 1D2AA 4IY1A 5BNIA 3GG2A 1HDXA 3JQPA 5FUMA 2ZBFA 5D3KA 1FP6A 3UJBA 1A9TA 1C3XA 4CF3A 4CMBA 1C9YA 1XLTC 2YTZA 3R3SA 3BTUA 1WMAA 4DBLC 1RPAA 2ASVA 4MVJP 1USPA 1I4EB 4AMVA 1VE6A 1SXIA 1KE2A 3B2NA 3J7TA 5REQB 1V9SA 2HQSA 3LUBA 4PPYA 2DR3A 2R5WA 1BGVA 2PQ0A 3EN0A 3BD9A 3I9JA 4WXRA 5DSTA 4QTZA 3C98A 4U6QA 5FA5A 1DC7A 1L7PA 1YRWA 3PGLA 3CVJA 3L05A 1Q50A 4QOIA 3X1ZA 1M2GA 3LQQA 4CYMA 2ZPUA 3HEMA 1BMDA 5G4KA 4RSHA 1NPTO 1HC7A 1USWA 3DM9B 3M2PA 1HTWA 3WLSA 3H9BA 4BVHA 4DGQA 3PTAA 1T3GA 3TPFA 4PQEA 1GOTA 2ZJOA 4LBVA 2WP8J 3EVDA 2FFRA 2Z8XA 4R51A 1H2EA 4OB8A 3NBFA 3PUJA 4Q4CA 1S2MA 2QMUA 4I4CA 4Z0NA 2XZOA 4M1EA 3WNDA 4DCMA 1U2DC 2ZUCA 4QLOA 5D1OA 1QVZA 1RMTA 2WFAA 4MR7A 2IYZA 3Q3JB 4KHZA 2QRDB 4DRXA 5IFKA 2O8EB 4UTZA 1S2LA 4BXOA 1DC5A 4RDCA 3U3OA 2ZYTX 1VCHA 1HRDA 2G0AA 4RFLA 5IT9b 3VVBA 2AMJA 3LO5A 1ZVJA 4MK4A 1CF9A 1E2IA 1HOTA 3M5PA 3PQCA 1OYVA 4E5MA 3SXJA 3ORFA 4X85A 3ZDQA 3B1FA 2C3UA 3KP1A 1E3LA 2HA7A 3H65A 4I2VA 2JRLA 4UVDA 2FJPA 4FQ5A 5EJ2A 1D2GA 4DKXA 5JISA 2AVDA 1SRQA 1U7HA 3AU8A 3EZ7A 1RWBA 2HRZA 2JGKA 3EC1A 3PQDA 3QE3A 4TRNA 4WINA 1FY2A 3RYIB 3G2JA 3KQYA 1C1XB 1WS6A 3CVWA 1XMJA 2C4NA 4IJWA 4DV6B 1NASA 2QEX1 3AF2A 1CY8A 4BNMA 1WW2A 3Q6MA 4FVTA 3NYIA 4W4TA 4MVJE 1ADGA 1HEUA 3U50C 3V4LA 1A72A 2FQWA 1I8TA 3AHHA 3OICA 4WLFA 7MHTA 3QX9A 2BHNA 5B4VA 2AGVA 4RANA 2XMZA 2OTJZ 1SK9A 1ZJ5A 2QRUA 3ANNA 2H92A 4LZAA 1ZQ9A 1CIVA 2DLDA 1PGOA 2D7JA 4OJNA 4ZT2A 4OHYA 3O4VA 1QR2A 3VNUA 2E2HI 3WADA 3RBXA 1XN4A 2JH9A 3C8DA 4F1JA 4UHFA 1A9SA 5EIFA 2BKEA 1I3QI 3L0YA 4QQKA 4ZODA 5L51A 1U63A 2C4TA 1F8FA 2Q3HA 4J29A 1D0VA 3WICA 4O2BF 1RXSA 1DX6A 2O14A 2QLMA 2VP5A 3P4XA 3BH0A 3ILHA 1J0AA 5KKAA 1PJCA 4NSNA 4B7CA 3I07A 3G2KA 3BKWA 5IN4A 2X8BA 4MR8B 1L9XA 3MWEA 1X13A 2EZ9A 3H8SA 4TTQA 2OZPA 3FZYA 5AXAA 1CS0B 3M70A 2EKPA 1X7YB 4Q5IA 1Z5PA 1OIWA 5LBTA 4IWXA 3E82A 3WL8A 4A1FA 1WZCA 1TVKA 4TL8A 5EJGA 5DB4A 4GL4A 2ES4A 3ZHVA 1ISMA 4AXBA 1JHAA 3PXCX 2ZM5A 1MLDA 4AN4A 5BSFA 4X7BA 1KYYA 4GR5A 4AM8A 1KP9A 3N5KA 4IMJB 3LKVA 3HEAA 1IE3A 5ALNA 2R6FA 3GRUA 3BF8A 4FFRA 4E7OA 1FIUA 2QVGA 2CMGA 2BM8A 2E6KA 3DMTA 3SZOA 3FOEC 4AS1A 4UTRA 1GUBA 2XJ4A 5K2OA 1K7SN 3TS1A 4PXSA 3ZD9A 5M2QA 2HH9A 3F6YA 1RQRA 1TGVA 1KZ1A 3K1YA 2FCAA 3LUGA 3O4JA 1V37A 3PE4A 4OUDA 2QW1A 2X5JO 4XQ0A 1LJUA 2ISQA 2PLFA 1W52X 5K0JA 4Y8VA 2FRXA 1ADCA 1MH9A 1Q0LA 2FRDA 3FKII 5DIZA 2JGFA 4JI7B 1EVIA 1FMCA 2J3EA 1R0ZA 4LDNA 2PJDA 4RIFA 2GOYA 3UGQA 4FYIA 4MAMA 5JV5A 1C9NA 1EUYA 1YB7A 2YFQA 1RAAA 3VHLB 3UXEA 5L40A 3GTGI 1N7JA 3G0CA 3W1EA 5CDTA 3KQHA 1JHOA 2FG6C 2NTNA 5I51A 3D8SA 1J70A 4NZPA 4ASUA 5JZSA 1SBQA 4L3VA 2NV6A 4KAXA 1X3WA 1VM6A 4Q9KA 5T4EA 2IS1A 2WSYB 1YDFA 3VYUB 3QK7A 4OHPA 3HBJA 3EZ6A 5IK2A 2WFMA 5IUNC 2X42A 1G2PA 3NB0A 4WZBB 5HJ2A 2N75A 2BVNA 2IEYA 1JT2A 4JJ8A 2C2HA 4XLZA 4Z7QB 2YXDA 1GLNA 4KVFA 1NA5A 1SR8A 3CCFA 4L9AA 3FSEA 3GLFB 3P32A 1ZC3A 3DB2A 1AKUA 4W9NC 1QTRA 1Z0ZA 1FFYA 3OCWA 1Z26A 3IUPA 1EVLA 3IKMB 3IOMA 4R1UA 4FMCF 1QBKC 1V1RA 3LFHA 1WEHA 5ERGB 5GONB 3UXYA 5JSYA 1PI3A 3AYXB 4D6YA 2P9JA 1M0TA 2AIRA 2PMFA 2C5GA 5F1YA 1KDVA 1CJMA 4BP8A 5AVVA 1N2CE 1Z5WA 1KGDA 1WP4A 2HJ9A 2V7XA 3GZNB 4NWIA 4C5BA 5T6MA 5TS2A 1UEJA 4A3CI 1RCUA 4W9RA 5DU2A 2ETXA 2VXYA 2ZYAA 4BQSA 2VF7A 1GG8A 1B8VA 3GROA 3O2JA 4CCSA 3SZ3A 4LF8B 1JMYA 3O4GA 5IF9A 5I7AA 1JEEA 1DG9A 4M7WA 2DE0X 2X0JA 4RK1A 1M74A 3WNZA 1U8TA 4MP3A 2FG5A 2WMDA 2ZW9A 3LLVA 1KEEB 3PSHA 1N1DA 2QTHA 4I2NA 4NE7A 2PQ2A 4F1KA 4ESEA 1SFOI 2EYUA 3MM4A 1P73A 4MYTA 3B85A 3ZIDA 1U0BB 5A4MS 3T61A 4YRPA 4GE3A 4QBKA 3CCLZ 4GMGA 3EDYA 2OYCA 2AXPA 4TGLA 4BMSA 5H3CA 3VO9A 2IXAA 1Z0FA 2JD1A 2FPPA 4NZ9A 5JTUA 3PT5A 2XJ9A 4ARCA 1JEQB 5EPUA 3GQBB 1FUUA 1I6WA 1CQIB 1VKNA 1G9XA 3DBIA 3IDOA 4I55A 2F6RA 4LPSA 4QD3A 1GN9A 2CLDX 4BJ3A 2ODTX 5DT2A 3TZEA 1GGJA 3TNLA 1CXZA 5KS2A 1A04A 1HX7A 1NSYA 4K9SA 2NYVA 2CT8A 5FWXB 1JFFB 1G5FA 1WHSA 4JB2A 3VR4H 5JAIA 5HRUA 2AFHE 2GJ4A 3HOWI 3K8QA 2IOQA 4LG1A 2IYXA 1PS0A 2C07A 4HV4A 2HJHA 2H4FA 4K9LA 3SNHA 2IHVA 3IVCA 4TUYF 1JT9A 1DCKA 4HXFB 3TH5A 1Q74A 3KB6A 4K9DA 5NLLA 5BV7A 2O2XA 2GBGA 4ZO9A 5JAOA 2R751 4YUVA 4H08A 4YLEA 1J2RA 1HZZA 3H05A 4MTCA 2PS0A 3FBGA 3OP4A 1XTKA 1GZVA 3DKIA 3OQBA 5EC8A 1H5QA 4TZKA 2CJPA 2IEDA 4YO7A 1YB1A 3EB9A 4ZI5A 4DYVA 1CR4A 1LSJA 1ZGZA 2AS0A 4LHYA 3WXMA 2BMVA 1S2NA 3QTBA 5BNZA 2VP4A 1M10A 5IXJA 4JCOA 5LN1A 1TFUA 3K1JA 3S2IA 3W78A 5T67A 1TRKA 1THZA 3O38A 1J56A 1EDZA 1JN0A 1W9HA 1E5DA 1MKYA 1MQ8B 2ZSBA 1YRQA 1PUXA 3IQWA 5JDIA 4XPZA 4QFBA 1NNUA 3DL7A 2RHCA 4QFDA 4F12A 2K6GA 4RD1A 1IM8A 3CUEF 1U2TA 4V2IA 3W5BA 4QUBA 4R69A 4WNYA 3RFTA 1XU4A 1AK9A 3R6WA 3B6MA 3RGWS 4A36A 4BX0A 4H27A 2HB6A 5LXTF 2B35A 4FUTA 1WMEA 1G66A 3D6MA 3KK0A 3CME1 5KYXB 3VHQA 1H1LA 4FBGA 5AYVA 3NBXX 1N25A 3CF4G 1PV2A 1E6UA 3LOQA 4FFPA 1J25A 1DL5A 1TO2E 2QR2A 2E2JI 4WLUA 3F7OA 4XPIA 5B2ZA 4AWAA 1DRKA 4BNKA 1Y4AE 4W5NA 1V6SA 3CEPB 3TZ6A 4COKA 5ALQA 1AZWA 4PYLA 2ECOA 2I4OA 4M0LA 2HV9A 3E8SA 1LDNA 2FWPA 4PZEA 5LM3A 3S2HI 5EJIA 5EIBD 4WT7A 4MYRA 3OEYA 1ZGCA 4O29A 3NBQA 4J0QA 2JLUA 4E5UA 1G291 1LLCA 2NSYA 4RH3A 1ZOPA 3UK1A 1CVIA 5HZKA 5KYTA 4PPGA 4YP9A 4EW2A 1YQWA 4F38A 3U44B 2YJ3A 4QFCA 5FLYA 4IHQA 5ELXA 5K9ZA 2WOOA 2YV2A 3QLJA 3LUCA 5F21A 1CR2A 3MCVA 5DHTA 1BS9A 2VJMB 1HT1E 4WMLA 1BN6A 2GJ9A 3OQIA 1BH6A 1ENZA 3PVZA 4MDHA 1QVFY 3UWOA 5TMEA 1ECLA 3ZBQA 1Q3KA 1GA6A 5FH9A 1Y6JA 2I1WA 2H2FA 3C3WA 4K40A 4AK9A 2BFAA 1FXSA 3BG1B 5L3RA 4B34A 2P4SA 1VJGA 3A26A 1T5LA 5AIAA 4ZT5A 1G2QA 4U3JA 2E49A 2WZCA 1NM5C 1SBYA 1ADFA 2VP9A 3I42A 3I6IA 2BEKA 3HA5A 4CM4A 4CDRA 1RKXA 4TL6A 3TM4A 4L9SA 2SNIE 4H16A 4XFDA 4PSUA 1SQFA 2F3TA 5ADHA 1ZD3A 4GE0A 3OX2A 1RRPA 2EJTA 4IH4A 1C3LA 1C80A 3C7TA 5IJXA 2B0JA 5KYYA 1ZUIA 5EUMA 2HRRA 3WGVA 4Q82A 1KJ9A 2FX2A 4YMWA 4PFJA 3A0RB 4YONB 1WJGA 1M75A 1V41E 3KOWA 4QTUA 1V1MA 2X1VA 4L8WB 5HKKD 1Z17A 3TEMA 5MN4A 2GM4A 2NVXI 2PLAA 2QYHA 4AY4A 2OFOA 4II3A 4DE5A 4DCSA 3TXXA 1VE9A 4HD8A 2PSDA 2G5GX 3WNCA 1ZW1A 4UUPA 1PFYA 2QUZA 4XOUA 1M7GA 1NUSA 2PUTA 3D3KA 4FHGA 3VTFA 4Y6LA 2RCYA 1ZK3A 4XASA 5GVRA 4DDUA 4MV8A 4YX9A 2OE2A 3UBTA 1G21E 2MSEB 2PX8A 4PICA 5AVZA 3VR3A 3T95A 3L49A 3C3JA 1P2VA 1XB2A 4BQRA 5HW0A 1R66A 3JD4A 2ENWA 1IIRA 2R93I 1TT5B 2I34A 1PEKE 1ZCAA 3TEFA 2AOXA 4YC7A 4DNFA 5HM6A 4WD3A 4ER6A 5K4HA 3G2HA 1E66A 5F9HA 2GZHA 3CRNA 3PWKA 2HZ7A 4IV5A 3OWOA 4ARZA 3KDSE 2LDBA 2IS2A 3V2IA 1H6AA 1W5TA 3L8HA 5DOZA 4YAUA 5KJ6A 4GT1A 3OCYA 4XRGA 1GDDA 2D59A 3CUSA 3RVSA 2II6A 2K2QB 2INGX 3DWFA 5KYNA 4C0BA 4YR7A 3DC2A 2AQHA 2MR6A 2F62A 5KNBD 1ZUWA 3IP9A 4MUXA 1KTVA 1NU8A 4YRQA 1IQRA 3UB4A 2YIDA 3RJ9A 3ELBA 1IB0A 4C7XA 3M6VA 5JQGA 2VR1A 4G85A 4OGGA 2CD7A 4P7GA 1KI6B 1KEVA 4A8HA 3LDAA 4MPPA 4KXXA 4ANFA 4XWWA 1YS6A 4RHCA 3FBTA 5ECYA 3UHPA 2EKDA 4RSMA 4YXWD 3FAKA 4QXQA 3ZVMA 4MUEA 1PN3A 3SVZA 1VSQA 1SUIA 3AQIA 3OZWA 4LS3A 3E7FA 3UMSA 3F6CA 4X8HA 3QOYA 3HBFA 3RSGA 1Q1EA 1F38A 3LUSA 2C9CA 4DIDA 1C1HA 3H1TA 3QKTA 4EHNA 1OJ7A 5SYNA 5C31A 2J0EA 2I6SA 2HPHA 3IAAA 2QD5A 2R6R1 5D1PA 3PC3A 1YJW1 5HZMA 221PA 2KJQA 1DIHA 4OHKA 5KBYA 3Q88A 1E1RD 2H4JA 3EEQA 2I6XA 4M6WB 2C5FA 3NDBB 1FX0B 2C88A 5CP8A 2GSWA 3NTOA 3HO6A 1O58A 1V47A 3JQQA 3UPDA 5C8DA 3G0HA 3ULKA 2B8NA 1MZVA 4EQZA 1EE1A 4TS4A 5KREA 2PH5A 3A04A 1ZBDA 3PF9A 4RAQA 1ZOOA 2IQ5A 2BKXA 4Q7QA 2FN9A 2GCEA 1YJ9Z 3ESRA 3KBBA 2C2BA 5KZMB 2J0VA 3E15A 1TMKA 2V7BA 4KCGA 1VYUA 5EIAA 1JSLA 2R5NA 3EDQA 3W6PA 2QLTA 3GVPA 2A4MA 5FAXA 1PTKA 2FW8A 1J7KA 2VDPB 1TECE 1U0NA 2AXEA 3F3SA 1KC1A 3L3BA 3N3AC 3QYPA 3S6JA 1NJ5A 1C9DB 1B0PA 3M4NA 3OO1A 5TPWB 3E1KA 1O8BA 3SU8A 3AKEA 3ZOZA 3ROFA 4PRKA 1IY2A 1PG5A 1Y3HA 3VU0A 3IBSA 1PJSA 3ZUGA 3DDHA 5F7JA 3CCQ1 2J5KA 2ZUUA 5DIFA 1U7DA 3AJAA 4MR9A 4B2YA 3B36A 3RWBA 3OCJA 5IHPA 1NMEA 4XX0A 5K0NA 2PHZA 2XQJA 3NVDA 4B31A 3ZYZA 4XM0A 1KZYC 1J99A 2ZGVA 5FHRA 1T35A 2IZ0A 1SK8A 1VBFA 2Q5OA 2IHBA 2XLBA 4FONA 4MS4B 1EM8B 3A1UA 3EY4A 1UANA 2HD4A 1PEYA 3CW8X 3QMWA 4HTFB 4L50A 3PFKA 3TJMA 2EKQA 5A03A 1BDIA 4L85A 4YV1A 1ULUA 2FN4A 1BQ3A 1RLUA 4X66B 2FSIA 2PSJA 2OPBA 3IHKA 3TINA 4BO1A 2QT1A 2VPPA 2BFFB 2AOWA 3C5HA 4Z0PA 1J8DA 5D85A 4Z2YA 3ROMA 3W5JA 1PUJA 1UOEA 4NH4A 2WUDA 4YRAA 1HFKA 1NF3A 2F1HA 2HIGA 4Q39A 3ZJVA 3VBCA 3VPCA 3OU6A 3DL0A 4ENRA 4MQ4A 1IN4A 1KMIY 1P3JA 1CETA 3CIFA 2MT9A 3Q2OA 4N1AA 5FHQA 3VZRA 5IAEA 2VP0A 4EUHA 1EX9A 1L4NA 3KQOA 1P4AA 1KHTA 1M2OB 2VOJA 1KSHA 1Q15A 3GLRA 2YZMA 2RGCA 1T8WA 4B84A 4C4PA 2VPQA 4EX7A 2GS9A 4KDEA 1IHXA 2CK3A 1OX4A 3T3EA 1AUVA 2Z2KA 1Y3DE 1WCMI 1UPUA 1TJ4A 2Z5LA 4Y2SA 1YK1A 1T4CB 2HCRA 1E3WB 4FT4A 3LCMA 2I3AA 1D2HA 1JJBA 3CXRA 3I8OA 1ZJZA 4FTWA 1WV1A 4ZQCB 3U7HB 3GA0A 4ZAGA 2A9QA 2VYFA 2IHKA 1V3QE 4INOA 5F3RA 2V6FA 2WJAA 4IX9A 2YVAA 2Q27A 2GF2A 1YC5A 5F33A 4MAFA 5SV2A 4F3YA 4II2A 5KI6A 1UDBA 2FFQA 2O57A 3TN7A 2TS1A 2NYRA 1GGNA 2JF0A 3O93A 2VQEB 1HDGO 2NWQA 2QVCA 4J76A 4C6HA 3AF4A 4D45A 1Q0ZA 3VKVA 3EC2A 4DV2B 3QPCA 3HJTA 4ER7A 2QYTA 5EESA 1M1YA 2GVNA 1P33A 4LDJA 3EVCA 3LQYA 5B57C 1Y98A 1EA5A 5A5VA 2VJLA 4TL9A 3ADCA 2GXQA 4EARA 2IEZA 2D3TA 2O7VA 4GXTA 1YI1A 4DSAA 2R97A 2OAGA 4ZYLA 1EWYA 3DF9A 5BRNA 5JRJA 3PEFA 1S7CA 3ZK9A 4C4XA 2O8DB 1IATA 1N2CB 1TAQA 1Z6AA 3ROPA 4AS3A 3BBLA 1WP9A 1EFHA 2FVYA 4ZQIA 4LZWA 2Y05A 4MMXB 1EEXB 2JI8A 3HS3A 1JKFA 4LISA 5LYJF 3S8EA 2Z5GA 4CM8B 1QGOA 5EJ5A 3GLTA 5HE8A 2YJGA 2Q2QA 1Y6GA 2WSSA 3DOEA 1SZDA 4WCVA 1XZHA 1E1CA 1V25A 2IU4A 2Q5FA 2Z98A 2R6CA 1UIRA 3OZXA 4KH1A 4P3XA 4B47A 3SVLA 1FRZA 2NN3C 4DA7A 2P5UA 1XU9A 4MB6A 4ARBA 4BV9A 4MHTA 2A4KA 2OG2A 4UXIA 1E1QD 2OZKA 1QGUB 5D5PA 1SA0B 1DCMA 1SVSA 4FHEA 2VDMB 1XUOA 3C74A 1Q91A 4TZ0A 3AB7A 2RJ3A 2RE8A 1NATA 3E3NA 1ABFA 3TRDA 3ZDXB 1HY3A 4X54A 1EHIA 3KQVA 3WYFA 3DT9A 2C58A 3B60A 1PL6A 2BZGA 2GF9A 1KOLA 2I7XA 1YZUA 1A9ZA 2P9FA 3W3ZB 5A9RA 2C42A 5J2TA 1IJKA 1EWRA 4PNZA 4TLBA 1Y8AA 4NYMR 4I6JA 4OOFA 5JAUA 2QU7A 4NS4A 5E8JA 1WAMA 1C0LA 3JQ9C 4W6ZA 2EG5A 3WRVA 4DR3B 3D8UA 1QV9A 1EQUA 4WCFA 3KEGA 2FLKA 1EK5A 3GUYA 2AFHB 5K99A 3CLVA 3C3PA 5CMLA 5JXWA 1TIKA 3W06A 4IFTA 2Z95A 2V5UA 3A70A 3G5MA 3LHIA 5JJLA 3OIFA 3F78A 3KSRA 1KBOA 2OCBA 3D3WA 2UZIR 1UH5A 2P9HA 4LNUB 4WDRA 2O2ZA 1UK7A 4MI6A 1RLIA 3SG0A 4B0OA 3DR3A 4IOMA 1E18A 2EIXA 1AC5A 3E4CA 1BCSB 5AR1A 1CY0A 4W5HA 1HGXA 4G9EA 3UBMA 4MLZA 3QKRA 5AN9F 4ZOCA 5KC9A 2YBDA 3KXKA 2QL5A 3GPDG 2ROQA 4Q4LA 3LCUA 4OBEA 3TRJA 4EDFA 5L4SA 2QNBA 2CXRA 2YHAA 5GTDA 4H6PA 1SB8A 1ZICA 1Z68A 3EGCA 2ZPAA 4RVDA 5KVCA 1MNQA 2V7EA 2XRZA 1E7MA 2AHRA 1S7MA 2R1VA 3OIDA 4OK6A 3DW1X 5T6BA 1Z4LA 5E4YA 5C0OE 2IWRA 3WVNA 1FPQA 3STUA 1TM2A 4BNGA 1P2SA 4BKMA 1FFCA 5KNLA 1OAKA 4ZVUA 4B4DA 4YP1A 4B4OA 2PWAA 3CWCA 4M8IA 3ZBTA 4QUAA 1L7QA 4MO2A 2ZVDA 3BRWD 3SX2A 2WWYA 3AVWA 5BSKA 1OFTA 1R4MA 5IARA 2X3YA 1G8HA 1GQFA 2B61A 3IV7A 5D51S 5FOSA 3ZWQA 3TTSA 3OM9A 4QO8A 1ICEA 2JATA 2OTLZ 3A36A 1E5VA 1DRVA 3FJOA 3PUWA 2CXPA 2KBEA 4LY3A 5JADA 3V3TA 1CUJA 2PA3A 2N3ZA 2ZYGA 4X1OA 2I1VB 4QWMA 1QE0A 4J0EA 3CCCA 3SBDA 5KTPA 2VUTA 1GUDA 2P9BA 2XXJA 1PR2A 3OFSA 1KI4A 3AR3A 1NI4A 4AMZA 1KO7A 1PRYA 1LNZA 2GEBA 1W85A 1WXFA 1L5SA 3GRCA 3L1UA 3QY9A 2QN8A 1W8DA 5LDHA 4DWWA 5JMTA 1U0HC 5IT5A 3O4RA 4NMXB 2VP6A 2XNJA 1XXHA 4LRXA 3SQWA 3KG2A 3BKXA 2AW3A 3DVQX 4KQFA 4V1CI 5DBHX 5JPDA 3WWZA 1DKPA 2NVUB 4JJFA 4RK6A 5C46F 2XKKA 1HE5A 4HN9A 1JR6A 2OHIA 4A8JB 1TEVA 3HB4X 3G8BA 4MWDA 1FUEA 2HU7A 3SNKA 1RKQA 3NH8A 1P0FA 1CJBA 3G1WA 4CKWB 1TCAA 1A4UA 4YAGA 3PI6A 1D7AA 2WHRA 1A71A 2Z2XA 3EIQA 4RHEA 1OZFA 2R7LA 4RQBA 3RSOA 3E9ZA 3KOUA 2X0NA 4DA6A 1ONSA 3CTPA 1U0OC 4Q4DA 3IO3A 1ZUNA 2EYQA 2ODAA 4I0WB 4GBED 1KZGB 2IS4A 1R50A 1GCIA 1QC5A 3T4NB 2A0XA 3NRCA 3SSMA 5H16A 1WXDA 5HQTA 1DFHA 2G8NA 5KNDH 3PNPA 3JAKB 1F2UB 1F06A 2E48A 3FGZA 3IUMA 4M98A 5C4IA 1W6RA 3DE5X 1LQTA 2O52A 3JS5A 1HURA 5DX0A 2HO4A 3VR0A 1HLGA 3HWWA 3Q0IA 1O97D 4D3SA 2YDXA 2ZSHA 3QWBA 5IEJA 1KXJA 3PBKA 4HP8A 2Z5VA 1Y3AA 3ANMA 1Z5NA 2GD0A 3AWDA 3WB9A 1T2EA 1FFHA 3KIHA 4H59A 4UM7A 4Q4HA 1U1IA 1RWXA 4LGCA 2NXCA 2FMHA 2QY9A 4GO1A 4JL6A 3U1VA 1Z0DA 3O4HA 4IOJA 3DHVA 1J21A 3IIIA 4S3MA 3VR6H 4RCYA 1YV9A 2P69A 1OAOA 1U9IA 4R84A 5DULA 2F1IA 3BHNA 3PQ8A 1JUDA 2JGRA 2QW8A 1T2NA 3ZHCA 1L5HA 5BQFA 2AXNA 4GQBA 1XA3A 4R54A 3TZKA 1WW3A 5IASA 5ENVA 5CYGA 4W5OA 5A02A 3GELA 2JFWA 3THYB 2OXIA 1YS9A 1PFGA 4I66A 3C3YA 1G21B 3FLMA 3TTTA 1ZMOA 3EXAA 2ZYHA 3WQSB 4DKJA 1MX9A 5LKAA 5JHGB 4HRAA 5H02A 4RTNA 5FYQA 1GKLA 1WF6A 1UQUA 4QUDA 4L0MA 1I1QB 4TKVB 3RQIA 1N1EA 4COOA 1FE8A 2V7TA 1Q44A 1XMVA 2OBMA 3D5TA 3HO8A 3QVGB 5D7BA 3G68A 4XX2A 2J4DA 1IHDA 2RGDA 3NHWA 4YUZA 3KEMA 5LQDA 5CT5A 2L18A 4PF1A 4JP2A 4GI1A 4FC6A 4J9VA 2YADA 4AF6A 2ORVA 3Q8WA 1FP2A 1FJHA 1VBMA 3VYRB 2EZ8A 4D81A 1BRMA 3OT1A 3ZDAA 3DDZX 2NM0A 1P29A 2JGJA 2WABA 2WK1A 1VLZA 3MOIA 4I46A 2ZT7A 3GH1A 4URZR 3HY4A 2O19A 3MNFA 2XMDA 1WW9A 1LF0A 2JDID 5TEWA 3THXB 1IN1A 1JEYA 2EJWA 4TLDA 1Q862 3CUYA 4RY9A 3GN1A 3R7DA 2WILA 4OI2A 3V4SA 4U7DA 2NOAA 4DXDA 5C80A 3ZS9A 4B35A 3HH8A 1CEEA 1X7WA 1XE3A 3Q12A 4G5XA 3GC6A 3BL5A 3UFXA 1W93A 3CJRA 3ENVA 1Y42X 1QRRA 3ZKWB 1KPHA 3CZMA 1QX3A 3SAJA 4E15A 5AVUA 1DWUA 4X1YA 5DXAA 5K3FB 1AQIA 2GLUA 3QE0A 4HOYA 3RC2A 2AFIA 2HMAA 3UMGA 4ER3A 3DFUA 2Q21A 2R4UA 3A10A 3QA3E 5FADA 4HVAA 3UMCA 4G6ZA 3GUVA 2IP4A 2X76A 5CA0F 2QJRA 2I9PA 3RJMA 3IVMA 4OHOA 4IEEA 3HKDA 2DH6A 3OY7A 3ETCA 1ZD8A 3N8KA 4DMUB 1P31A 4ZYXA 3G0IA 4L4ZA 4DV4B 3QE9Y 4YMSA 4BB9A 3B9RA 1UZLA 4FX5A 2D4HA 3VUFA 4DV7B 3MXTA 3CF0A 2PFKA 4L4XA 1NQAO 1PDOA 3ESYA 2FW7A 3FWKA 3Q3HA 3FVRA 1OJLA 5CH5A 3J81A 1WA5A 4IIJF 2QQGA 3AONB 4L74A 4M9UA 3ZCSA 1DGQA 1CS4C 1XQWA 3IAUA 1NIJA 4HATA 3FSRA 2XPCA 2W11A 3HB5X 3AT1A 5BW6B 2WUWE 2I6QA 2REOA 1USGA 2VDKB 3BMOB 1LC3A 2CXQA 2V7QD 1D0IA 3A9CA 4CCAA 1TJYA 3GJ5A 2QG9A 1QH1A 2N46A 3ETLA 3LOUA 3WAKA 3M3YI 1U2GC 3EAGA 1M8FA 1YS4A 2QUBA 3N39C 1PJZA 4UAJA 4HO1X 1DFIA 1DUSA 4WNIA 5KTRA 2VBIA 2TRSB 2WT9A 2P9GA 5CEFA 4IIBA 4FHFA 4AZ3B 3QYAA 3P2KA 1VPVA 4LNHA 3SC6A 1CQXA 2A1IA 4IUBS 4JVSB 1MVOA 1G98A 4GAEA 2QORA 3OIUA 3AKCA 2NAFA 1Y7TA 4Y9RA 1Y8RB 4EY4A 2QXTA 1TJ3A 4RLFA 1KYZA 4E5SA 3U4IA 2DR2A 2VUGA 2PTHA 2AOTB 4H1HA 2XUGA 3P0JA 4LXYA 5FR2A 4YJ3A 2IXDA 4JZKA 5DGIA 4BWYA 1QDEA 2FH5B 1U0EA 3PR2B 5DPMA 2CWDA 1VQOZ 1K732 4C07A 2CHUA 1NJFA 4BWGA 1VGRA 2YWEA 4HZIA 2HYIC 2GA9A 5FOUA 3WK8A 4X62B 3AX6A 4JELA 4EZEA 2WUEA 3RFCA 1L7RA 4G84A 2ID7A 4HB3A 5DWVA 3R0VA 4H18A 1TYDE 4QU8A 1M1UA 4MS3A 4V02A 3NWEA 4BGUA 5IG2A 3U3RA 1HUQA 1QWOA 3CC2Z 3EGVA 3TW6A 4ZTZB 4EGJA 2IXGA 3EISA 3NEYA 3I0MA 4V03A 3RSCA 2BGMA 1QIFA 3V3KA 5F76A 5EJEA 3RS4A 2UYOA 4KREA 1MJ5A 2Q5IA 2Y77A 2SKDA 3NFZA 1C30B 3H5LA 3IAHA 2GRUA 3UJ3X 3W9SA 4KPEC 5GWXA 4A4DA 5I7SA 1K8YB 3VNBA 1LDMA 1IHUA 4F85A 5FCDA 2VK8A 3MCAA 4PCVA 3W5IA 4JXXA 3F4LA 2JR6A 5COAA 4R1LA 3Q3CA 3AWIA 2YFKA 5DXFA 4R8LA 2VQFB 3QBJA 5CVTA 1DINA 1AB5A 3GAMA 4TMZA 2X9QA 3NHZA 4EP1A 1LW7A 4Q15A 5EYPA 2ONJA 4MIYA 3N86A 2OZEA 2W0SA 1YZNA 1BQ4A 4GC9A 4GZLA 4DCTA 1X1CA 3NBKA 4HQ6A 5J58A 1Q1BA 3CUVA 3ABIA 1Y8ZA 1DAOA 3UK6A 5IVKA 1DIRA 3D3QA 3FWZA 3RIEA 5GGYA 1B16A 1YRLA 1E5TA 4JA0A 3QFSA 4LOAA 2HRCA 1MAAA 4MCIA 2YC2C 3CMA1 3ZGLA 2V8JA 4GICA 5PNTA 4F56A 3PXUA 1YITZ 3MJEA 3D7SA 2HFKA 3FYUC 3X1KA 4B81A 4C3UA 1UWVA 3ENQA 3G6KA 4CKEA 4II7A 1QYIA 4RMIA 1FFXA 1TZ2A 5FLKA 3V00A 1N36B 1X92A 1G8KA 1V2HE 4ZV7A 4BO3A 4HDNA 4MVYA 4WQMA 3UQYS 1OI2A 3G13A 4FXPA 3J81f 1LLFA 4JI5B 3FFXA 4CTOA 2J7PA 1FLAA 2G07A 5DK6A 5BN5B 1IBCA 3DL4A 3MJRA 5IUKC 1IAVA 4BECA 4CLOA 4XWGA 3CV3A 4IM7A 2H0QA 5KTTA 3X1WA 1YCDA 1F7VA 5DOVA 1D2NA 5FOXA 2WNSA 2I6UA 5A9SA 4LIPD 4OK3A 1H8HD 1RYDA 4LJ9A 4EPYA 1SUWA 3NUQA 4X6UA 2EHJA 3CD6Z 1OX6A 4TVBA 3WTCA 1QZ3A 3PO3S 3L43A 2JHGA 4BNUA 2ZTHA 1JA1A 3SM3A 3E0XA 1P80A 1K1EA 3DHEA 2PGAA 4NCJA 4OREX 5HIKA 3O31A 3KKNA 1TQDA 1IWOA 3KQTA 4LQCA 5EHIA 4RNDB 3SJZA 1YAHA 1DU4A 1YJ5A 2OLJA 3I2JA 1VHLA 3VI3B 4XB2A 2GASA 2PH7A 3AF0A 3GIWA 4IHJA 4ROSA 4DCJA 4DZZA 3KHKA 4Z1MA 3QTLA 3Q1KA 1KDYA 4XVCA 4F5DA 4NFYA 2IITA 4W8HA 4BMDA 2PS9A 3WIDA 3IF8A 5KPJA 4ERNA 5G0WA 2HN9A 3FOZA 3RS0A 1UM9A 3JPWA 5J43A 1Y6FA 1UF9A 4HDSA 4V3BA 3FOWA 3LTEA 3BREA 3R9XB 2JIRA 4DDWA 1VTKA 4HNTA 1G5QA 4J7CA 4BCDA 2ZUFA 4QDKA 5CDGA 3FMGA 1GAXA 3RU2A 2G72A 4DLZA 4MA5A 1XF9A 1GRQA 1M3SA 5A71A 5IC4A 1W2BZ 4Y6RA 4WLOA 4EA9A 1ZH8A 3ZY6A 1EZ4A 5TQ2B 3UY4A 3QKIA 4RMGA 2OFXA 3S2UA 4AMGA 3GTLI 4PLZA 3GT0A 1JKJB 4Y0AA 3TUIC 1Q20A 1T1GA 4JLDA 2BEWA 2ZE5A 2LKDA 1V35A 2D2EA 121PA 1UT5A 2CJWB 3BD6A 3EBLA 1YA8A 4L8LA 5BYBA 1XCLA 4YRTA 3V7WA 4KJZA 5JRZA 2R8RA 3RIMA 3CQ9A 4WECA 1FRVA 2GEFA 3LE8A 5EE1A 1FNCA 3JR7A 1NP6A 5F7XA 2AG6A 3C7KA 3CCEZ 3MGAA 2NVOA 3BMQB 4UC0A 1YQEA 1M72A 5EXEA 1CF4A 2EWMA 1R4ZA 5JZOA 2XIJA 1GTVA 2CFIA 3I4FA 1Z62A 4D9HA 3GVCA 4UQPA 5FULA 2YY7A 4J16C 4C6TA 2XNDD 3T1HB 1JQBA 4JVOA 5GJBA 2FEAA 4F1WA 5JE8A 1LS1A 4YCNA 3LGXA 2D7DA 1EVZA 4DQXA 4N5DA 2ZT5A 1FJXA 2WJWA 3V6MA 2IYOA 5DLYA 4RWEA 3WJ7A 3F7TA 4GEKA 1SB9A 2NVYI 4HQFA 2PVCA 4C4ZA 3OJWA 3RVJA 3PC8C 3FTQA 3T94A 3IEIA 1K6EA 2AZMA 3F49S 4AJHA 3TM5A 5E0OA 5JVDB 4CXMA 4EPXA 1X3LA 5EAIA 2VA9A 2IPLA 1XL0A 5LR6A 1U0GA 2O8BA 1OWMA 5J5VA 1OH6A 4FN5A 1LDBA 5LP6C 1EK1A 1G60A 2QUAA 3QWAA 4KPFC 4M83A 2IIQA 1XZDA 3T7JA 4N5HX 3RJZA 1J8YF 5AI6A 1L7EA 1V45E 2OKCA 3W5SA 2MDTA 2F1RA 2HF8A 1I01A 3EGOA 3T15A 2CJXA 4NMLA 5EMKA 4E08A 2XCTB 1I6HI 2V7WA 3I2FA 1RLYA 5IM5A 1K6XA 1TYCA 3AEKB 2JS4A 2H11A 4DIOA 5EUQB 3LNCA 4E09A 2LBPA 3N0TA 4C88A 1II8A 1JSRA 2XMQA 5MGNA 3BE8A 4NAUA 3U31A 2XRFA 5C5DA 1EP3B 4HB4A 4OP2A 4QODA 3TLZA 2OAP1 3CXCY 1OE0A 4GW3A 3I9V1 4XD2A 3UM9A 3UOAB 4L2IB 1KD12 4ZAYA 2XGGA 1MJNA 3BFXA 4D9JA 1PEAA 1L5RA 1TDJA 1W46A 1XRJA 2RI6A 3BIXA 4KUGA 3WE7A 2XXBA 5EKXA 3RUPA 2HAEA 2WICA 5TQ0A 1T0HB 2H59A 2NXWA 2XV1A 4H1VA 4I55F 1AA9A 4O33A 4QYSA 4KLZA 1AD2A 1BD4A 2DHDA 1NVFA 1EX7A 4JUDX 1HEYA 3B7WA 4Y1GA 1OKKD 4LOJA 3C4VA 3FA2A 5LFAA 1O96A 3RASA 3ZHZA 5JYEA 1UMBA 2WB1A 4EQ6A 1CUSA 4Q3DA 1VFPA 3SZLA 4LYGA 2D0DA 3UPTA 3TLJA 3HXLA 2JCBA 3IPLA 4BE9A 2A58A 4EG8A 2Y4OA 2O5CA 2ZRQA 1NV9A 3K53A 2QLJA 3QXJA 1MHTA 4Z4QA 2FW1A 1C4KA 1GTSA 3ZQ4A 2VTBA 4LV5B 4DMLA 1QG2A 4OXYA 5HJ7A 4R8VA 4RPKA 3MFYA 3VSCA 4CIWA 1NW3A 3PDUA 4QHSA 1JWHC 1QH9A 2NNWB 4TTIA 1PR4A 4I4IA 4ZOLB 3W79A 3X3HA 4ALJA 4BP1A 5IK2D 1PZEA 1W25A 3F0TA 2C2KA 2QL6A 3KKEA 4JSTA 4HF7A 3HJHA 1Y8QA 4L02A 3QQPA 3FPSA 5DN6A 1QLHA 3LXMA 4HUJA 2ZU6A 1N0UA 3B1VA 3G8DA 4BNDA 1QF9A 2OXCA 2AFRA 3ANTA 4JI3B 1L2TA 5KX5A 2A14A 3F4BA 4BY9E 3GGCA 4A10A 4R01A 4M1TA 3KQSA 4JGBA 3EARA 1GTMA 3RTGA 5BQXA 1YH3A 5EE3A 1GV0A 4X63A 2MSNA 2SKEA 4ZIRB 1YTUA 3AETB 3FE2A 5B7PA 4FNMA 4OH7A 3QBEA 2BGWA 3L84A 2IYSA 1LH0A 4OHWA 4WTOA 5CJPA 4CT0A 5JCPA 2EATA 3ZWYA 3N59A 5L6MB 1AO3A 2X15A 3EWIA 4TOIA 4ZGGA 4X7RA 4IBOA 3HV2A 5DTEA 5BR4A 1KK1A 3ROKA 4CUZA 2A59A 4EW3A 1F5SA 3TE7A 2F9FA 1FVXA 3SYKA 4KLNA 5H3LA 4R9RA 1R8XA 2FUG6 2YIVX 3MWGA 2WAQA 4U6NA 2GPJA 2R44A 5AOCA 4MVCA 3PTZA 3ZVLA 2G1UA 3N76A 4FYXA 5AUNB 5KTKA 1VQM1 4NB9A 3HRKA 2HMTA 3DEIA 5DV9A 2QQFA 3V1LA 1GCOA 1K3UB 3RRYA 3HCDA 3WNVA 4IIGA 1UXIA 2B9EA 3L0DA 1MOQA 5BQ5A 3SQMA 2R4QA 1IY9A 1A7JA 1SQ6A 3WYNA 1JSXA 3DLIA 2XD4A 4URXR 5C9ZA 1DQZA 1H2BA 3BSFA 4FGUA 3TMKA 2CBGA 3ED1A 1M2VA 2VJKA 5BR8B 2OBXA 4GP6A 2BHLA 1FLDA 3I6ZA 2G7ZA 3ZHSA 3W3AD 2HK6A 5TV2A 2WU8A 4DT1B 1M73E 3CC7Z 4UHDA 1I2CA 1YA4A 2C82A 3WR5A 1P17A 2QRLA 4NBRA 4AKHA 1C14A 4BEVA 3KJNA 1PFUA 3MT9A 3VR5D 1GQRA 3SC4A 3UH0A 5DCWA 2GO1A 1DQPA 3NWJA 2NUTA 1E0SA 4EJSC 4PLCA 1PAUA 2VF5X 1MB0A 2BDTA 4QOSA 3BD7A 3T1YB 2YHBA 3NETA 2A35A 1R1DA 1PJ8A 2X6TA 1LPAB 3CCJZ 2EX0A 4CBVA 4LSMA 4JI2B 1V48A 1KGSA 2QEQA 5LPNA 3W5CA 5LQMA 4GX0A 4NOKA 3O2NA 3WFZA 2J3QA 3DCJA 1AF4A 4R1SA 5B36A 1KF0A 1FTSA 4GFDA 2AN4A 3M6IA 1W73A 4DDHA 1YTLA 4YTEA 5D00A 4E2XA 5IANA 5THQA 1AGYA 3RAFC 1ZVQA 2EGGA 2VQ6A 5EZYB 3QX8A 3R7AA 5C5CA 5IX8A 5LP1A 3LW7A 4PLTA 3RTDA 1XZ8A 1W0JA 4BKPA 4XE5A 3EG9A 4GYWA 3KZKA 4X60A 4Y6GB 4DBLE 3H11A 3ORYA 2JEOA 4K1XA 4P3OA 1AU9A 2JA7I 1R6UA 3EQ6A 2OV2A 3PKZA 1ORVA 4LF5B 4EEKA 3PDIA 2X7HA 4Q21A 1ESNA 1KNQA 1NGSA 3KLMX 4IGKA 4H35A 1R4NA 2J32A 2KHZA 4IFIA 1N2GA 4O4HB 4UUNA 5BVGB 5JMOA 1Z13A 3K0CA 1Z5ZA 3I5MA 3DGFC 1E9BA 3SEFA 2EZUA 4G36A 2GWRA 3OF5A 4IILA 3PG5A 4ND5A 1N6PA 1CKEA 1GZ5A 2R48A 3NFRA 2UYYA 2REQA 3N05A 4HEA1 1EE2A 2PZGA 3IDSA 4IMPA 1GPYA 4AZ0B 4C0LA 2FP4A 4EATA 1S8OA 4YRZA 1DADA 1MC5A 3ZLVA 3BILA 2ATIA 3LVBA 4YRSA 1FNMA 1T4BA 3HXMA 4EHFA 2XOEA 3DFMA 1QYWA 1KYTA 2IHJA 1NT4A 4ED9A 3JQ8B 3ONNA 1PR3A 3RGGA 5JQGF 3LGSA 4HDCA 1SC3A 1YBAA 5JEDA 2GH1A 3Q0EA 5BWBA 4PHCA 5ALTA 1NURA 2QX6A 2VRNA 2HBQA 5K03A 4Y2TA 1RWKA 2JGLA 3HZHA 4F3RA 4AX4A 4XYEA 5CFLA 1NQ5A 4YMIA 4JN6B 4MZDA 3BT7A 2ZRFA 2X5NA 3UT0A 3ZHYA 2VPIA 2VUMI 5JY1A 3GLIE 1KR2A 2NZJA 2HDHA 1G6Q1 2WIKA 3TXYA 2ZIGA 3S1LA 4ALNA 2CNOA 4YUAA 2FA9A 3I12A 2CDRA 5A62A 2BR4A 3PUXA 1DV1A 1WUYA 3DHWC 4D99A 2Q6IA 3ABRB 3T41A 3C1AA 3TFOA 1NWHA 1JP7A 1RXUA 4QYXA 3ZV7A 3GL9A 1UEXC 3PGJA 4KWEA 3N2ZB 2CVHA 4KX3A 2OTJ1 4PO8A 3TDHB 1JW9B 3Q1LA 3QYJA 5ALYA 1TUGA 4Q3BA 2OC9A 4MJLA 3EJWA 2ZS7A 4XUDA 3NOXA 4MQ5A 1KZHA 5FOTA 4CQMA 3LS2A 1DZ3A 3OLZA 4DABA 3TQFA 3PQ7A 4B3FX 4WKPA 4YUYA 1PQPA 3GPIA 5DFAA 4EIWA 2P9QA 2VDWA 1XNRB 1MO4A 4K81B 3OEWA 3AGQA 2OSBA 1U2PA 3CCMZ 4I4TB 4V39A 5TQVA 2ABWA 3VHXA 4NCAA 1NN1A 3L6OO 4Q4JB 4JC4A 1ZL0A 1M2HA 3TQHA 2ZDGA 1Y9DA 5ICGA 3QIAA 3QBDA 3DQZA 4F4UA 1HK7A 4NR0A 4D9KA 5HGXA 1PX2A 5AM3A 3RQSA 4I1IA 2WWFA 2VEOA 4C3ZA 5EJ8A 3B89A 4WESB 1KAGA 4YIKA 3K4HA 1BJTA 3IR7A 1R3DA 1UBGA 1JHVA 2WA1A 2I03A 3D0OA 2I2XB 4MHOA 5JWHA 4B0PA 5I47A 4YVFA 3X44A 4IP0A 4MQFB 4O3FA 2P7IA 1V7PC 1BHO1 4YLYA 3MJSA 1AF7A 2M9MA 3H5NA 3P7MA 4ZCLA 1Y82A 2PEZA 2BLLA 2JFQA 3GWZA 5CYOA 3E9MA 5JUWA 2YWFA 4WZZA 5L8VA 5E1BA 4IMIB 1LQUA 2OCKA 3LYAA 3CKYA 4PPFA 4G07A 4MW1A 4PM4A 4KXMA 2Z8YA 1J1IA 3COVA 4DADA 3AHGA 3A14A 3C8UA 3AESA 2I71A 4CUJA 1R00A 2WIGA 3NIGB 1ZNQO 4HMQA 2YBEA 3IAM6 4LYFA 4KOAA 2PNJA 1DTSA 1SD2A 5LUBA 1ZIXA 2I67A 1A5ZA 5I4BA 4TXJA 2VJOA 4P53A 3DE3X 1SKQA 4I8IA 2PWYA 4Y9SA 3NKLA 2PFGA 3KLNA 1XDUA 2JCYA 3W05A 5AJYA 1A9OA 1Z12A 3S17I 3INGA 3N1UA 2HWKA 3E7DA 3GFSA 4HX5A 4PYRA 3G8AA 3IFSA 3BWDD 4HXGA 2DU8A 3OPYA 4PGAA 1JLHA 1NVMB 4C2BA 4E3WA 2L42A 3OQ6A 3T1NA 7GPBA 4YACA 3MMZA 2JGIA 4FPXA 3ZQ6A 3IXQA 3KQLA 2I76A 3T4PA 2Z1MA 1ZJ4A 5ESDA 4R7GA 2ST1A 4REQA 4YBRA 1SOVA 3CH5A 1YUBA 4F04A 1Z5UA 2PT5A 1YJXA 1N0HA 3QKSA 4TTJA 4EZIA 5I9LA 1CRQA 3V1MA 1DAMA 2FG7C 2ZREA 3LP8A 4XSHA 4XUCA 2R6AA 2PYIA 3MYRA 1E3EA 2Z57A 3PGMA 1QIHA 2YHSA 4GYJA 3WIUA 2BTOA 4Q6BA 2VSFA 4K6OA 5SZKB 5FWYA 2ZM6B 4K88A 4MUKA 5ULLA 3MLEA 1KY3A 1OV4A 3BB3A 3IALA 4RX1A 1QSGA 1NXSA 1VIVA 2H0RA 2WAOA 1N2XA 2DPHA 1RAFA 4J3JA 5IXSA 2PPLA 3NDIA 1C8LA 1DUVG 2PGLA 3JATA 4RF3A 3H2JA 5HCIA 4H6XA 5A4KA 1E9AA 3EZXA 1OFVA 1K2VN 1I13A 2RIPA 3U9LA 2QG6A 4KAJA 3SDZA 3STXA 4IDBA 1Z7BA 3ANYB 3K5HA 3AUJB 2VPTA 3IL2A 3KXIA 1KJNA 4A03A 1NF9A 2YCBA 1TLTA 4MMYB 4YJFB 5F4ZA 3Q2IA 1PS9A 2H3EA 2J0UB 3JSAA 2H7YA 4JNKA 4BUJA 3BMNB 3QXCA 2BHRA 2OFFA 4XZ3A 3NJRA 1WCYA 3G0DA 3A6PC 2CFSA 2RK3A 3HDVA 2UYCA 4XR9A 1NVTA 3HB9A 4MARA 3W2IA 1CVLA 1BNCA 3LX8A 3PEVA 3JWJA 2A9FA 1FCJA 2QAGB 3CCL1 2EBFX 1XCBA 1H1DA 3H8WA 3MGCA 2GRAA 1YHZA 3ND6A 4JGGA 2OGSA 3T0GA 3V5NA 1XMQB 3T3GA 1HDCA 3O9ZA 4G56A 2H1CA 1AN9A 1IU9A 3T4EA 6REQB 3D3NA 4Y9TA 1YJNZ 4PG4A 3K2EA 1XO1A 1E0KA 3WMEA 5JH7B 1E3IA 2D0PB 4HAUA 2D1YA 3KB2A 3LUKA 4N9WA 3I76A 1MC4A 3PNSA 2A2ZA 4C9BA 3H2IA 3LJKA 3HHPA 3LZDA 4O4JB 1DG3A 3WGQA 4RVGA 2CB0A 1VSTA 1QH0A 2RHRA 4HN4B 4ZKEA 4GBMA 3EXEA 3KSZO 2NACA 1GARA 4MKHA 3K05A 2ERXA 2BGUA 2V4ZA 5IUJC 2QIOA 4D80A 1IHYA 1NT2A 2EQBA 2Q5CA 3AM1A 2XECA 4NMHA 1A3CA 3L4BA 3UG6A 4RFVA 1ZSVA 2VL7A 5FNZA 2CUTA 1AKQA 2J9YB 3DDCA 4NX2A 3IQDB 5J2TF 4UCWA 4RZSA 1J2JA 4OGKA 4ZCRA 1T8TA 3G7NA 1WMSA 1F4VA 4TKLA 1UBHS 1I3LA 1YQUA 3CJQA 2W0MA 1S2OA 5FPSA 1F0NA 4EGFA 3AJEA 4IJVA 3CEJA 1JHMA 2RCNA 3RHZA 2QTBA 2I1QA 2ZBRA 3RVDA 2I2AA 4UCFA 5T8KC 3CF2A 4GXNA 2AZTA 2GPAA 2QP9X 2Q2OA 3VB9A 4KO8A 4FWIB 3GN2A 1L7DA 1QYVA 2WTNA 3KR0A 4KQHA 2O2GA 1NMQA 2D1RA 4P08A 3ZWVA 1Y63A 2XYVA 2P6RA 1RXIA 3TQRA 4KG7A 3IIMA 1HDEA 1JKMA 1Z2EA 2C9YA 3O1HB 1YQQA 3NU1A 1GDTA 4PFQA 1O9BA 1A2QA 3TR6A 1VECA 4C5CA 3EZFA 2ZRJA 3FMPB 4P5EA 3TO5A 3WGOA 4NJMA 2SCUB 3WFJA 1KZ9A 2P1ZA 5E7JA 4YHHB 2PUHA 5EHXA 4Q7MB 5E7IA 4BCCA 5FL7D 3E3MA 3HXQA 3LBAA 1QHGA 1EGQA 4OHCA 4PYJA 2I91A 5JS6A 2IOFA 1O1YA 1PT8A 2QDXA 3I6MA 3SMQA 4DL9A 3R8CA 2OQVA 5DM4A 2Q5QA 2HSDA 2OVBA 5ANRB 3WMWA 3UMBA 1V16A 3KOOA 3THSA 2AVNA 2P68A 1OI7A 1SU7A 3CPJB 1YS2X 3UXMA 1XRMA 4WXEA 5L95A 3VVCA 1E69A 3U7QA 2R8PA 1Q861 1CB0A 2CNWA 1QPGA 3W6OA 4OYLA 1QCZA 3E61A 3VDNB 2A86A 2UUAB 2ZRPA 2JIQA 2WD9A 1L1OC 4GZ5A 4U2CA 3OTGA 3AI1A 3W5VA 4C87A 4QZVA 3BE4A 3I6BA 4UTNA 4IRMA 2OK7A 2W6JA 3G7UA 4IEFB 2J3JA 2VS1A 4L7VA 1EESA 2BR3A 5IFLA 1JJ2Y 2FN8A 3U13A 1NZFA 2YOHA 4HLNA 4R1NA 1MB3A 2PFSA 2ID9A 2QP4A 3RZOI 2ZE8A 2ZLBA 3IV6A 1D2CA 1J0CA 2COKA 3W2TA 1TEZA 1Q1GA 3FZQA 4DM4A 1UKVY 5DWQA 3NDRA 3ZZTA 4FDTA 2PT7A 3GBSA 1J0BA 4EYEA 4AB1A 3GV0A 4N4AA 4DDMA 2VUIB 3OZBA 1B1AA 1BH2A 1T5DX 3FLEA 3GDWA 1GV1A 5B3JC 2CXHA 2OUKA 3CONA 2Y1OA 1YBMA 3FFAA 3Q7RA 3GBPA 4UNSA 2WY2D 1AUQA 1HNNA 2O1WA 3WLEA 2CXUA 5FUXA 1BS1A 2EL7A 4LK3A 4CDGA 4J7UA 2AF4C 4FFOA 4DEVA 2XF2A 3NHJA 4JR0A 4H60A 5HCUA 3KFXA 3O9VA 1UBOS 3VJLA 4X64B 5EKUA 3EYAA 4G81A 5U1PA 3X43A 3ESWA 3H3XA 5K8JB 1BXGA 1EP9A 3PDCA 1CERA 4H7FA 4RD2A 5CX4A 2X0IA 5L3SA 3JQEA 2X22A 5E6UB 1IUKA 3ESQA 3O8OB 5AKJA 4HY3A 3AVOA 3CCVZ 1ELOA 2QMYA 4JLAA 4MHSA 4WRRA 1ZM2A 3BZUA 4KQ2A 3ILYA 1SM4A 1YIOA 3TLGB 1WD5A 2JLXA 3QPUA 3B3JA 5A6SA 3EVAA 4UU0A 2LDXA 2FP3A 1AURA 3IDZA 3PD1A 3D1VA 5CA1F 1D6MA 3EHEA 4IIDA 1EH5A 2NUAB 4EGSA 2A3RA 2QYOA 2ZYDA 3LHSA 1UK8A 5F64A 3RRFA 4BBPA 1PZHA 3JAWB 3T3MB 3LOPA 3B9BA 1K731 4ZFNA 2GNOA 4OH1A 3PPWA 1OT3A 3ND8A 3D3EA 3KC2A 1UWCA 3KVRA 4IW3B 2ETVA 5CLLA 3T7CA 3WMGA 1Z36A 3R23A 5AJXA 1HLPA 4F5EA 2V6BA 2ZITA 3OHPA 3CWQA 1C41A 3HZRA 4AI6A 3NQ41 1Z56C 1DOAA 5DYTA 2VWHA 4G1UC 1G5RA 2GCNA 2VCYA 2W93A 4IICA 3K9FC 4TROA 4M0CA 3SS7X 2GJSA 4MLCA 3W9UA 3T34A 2F9LA 4C43A 4NBWA 4PR0A 4ZYYA 1HMPA 1PF7E 2P5YA 5K1ZA 4AJ4A 2IF0A 4PSKA 4LSZA 2IYUA 1R8SA 4QPPA 3DXFA 2JB9A 3WL7A 2XR1A 3REQA 2O8FB 4D02A 4DN6A 3FZNA 1VJ0A 2IK8A 2J59A 5C4MA 3IMEA 5KCMA 1IRIA 3PKJA 3JQBC 1XXLA 3OW2Y 3H97A 3GDGA 1M6EX 3OUUA 4HNAA 3WLLA 3MTBA 4NBVA 4C7OB 2SECE 1VQKZ 4A0QA 4EY7A 3PJFA 4YV2A 1X0XA 2B7LA 2VAVA 2VHCA 4JC0A 5SYAA 5K0FA 4RGBA 1PU2A 3NHUA 4TYQA 4HNHA 1S89A 2PL9A 2R87A 5T4HA 1WKVA 1HG0A 3AKDA 4GLOA 1V11B 3I9KA 4M8LA 4FGZA 4ZVKA 1CVRA 1KJWA 2HDNB 4J2OA 2IX9A 5A4IS 1VJRA 4AO6A 1KRLA 1RRGA 5H0IA 1QRUA 1C5KA 2IEAA 4TWBA 1WB4A 4XJXA 3NYWA 3C48A 2RGWA 1QYRA 1OC2A 2YUIA 4AYBA 2F3SA 5KSOA 4OF4A 4DPLA 2CLCX 5BUQA 1ECBA 3ASVA 3GLIB 2VRCA 521PA 1E6CA 2I87A 3STVA 2NVBA 3QF4A 4LMRA 3EA4A 4ZOEA 5HP4A 3TKYA 3U4MA 5ALWA 2BGNA 3A4IA 4TS1A 3BFVA 1K86A 1IMOA 4BVLA 3I5YA 1MW8X 3PQEA 4QPZA 2VLBA 4UU1A 3D6FA 5EXDA 1R0XA 2QM8A 3I4CA 4FLEA 1MIOB 2B6NA 1DO2A 1NVKA 3OLXA 4PXAA 1L5NA 4XM1A 4Z8XA 2G1JA 1N77A 4WOJA 3MINA 2V9CA 5BMVB 2PSFA 4KI7A 2PBFA 4QPDA 1QK4A 2QDKA 3N0RA 3L7KA 3CA8A 3NJ8A 4MITA 4B3HA 4XJSA 1T1JA 3WRXC 4QM6A 2C0PA 1EUCA 3DV0B 5FR1A 1J06A 3E35A 3HFJA 2KLBA 1ZH6A 2Y1LA 5CFRA 2YINC 3K94A 4U8GA 4FMDF 3X2SA 1NFRA 4B8WA 1QYDA 3B6EA 1BVYF 1CUCA 3W1VA 4UUAA 1I94B 3B38A 3KOYA 2VLIA 4CFZA 4OX9B 2NZVG 5IJ0B 2XNKA 3K7AI 1G18A 2ID4A 1N2FA 2WM9B 3H2HA 2YWJA 1GSOA 2OD9A 2ZFUA 3EBOA 4EY5A 4Q03A 1RPTA 3D64A 3HVRA 2VYVA 3RUDA 3TQOA 3OSUA 3ILVA 1N9ZA 1QOZA 3EXHC 3OHSX 4NCKA 5BV2P 5FEMA 1XJCA 4J94A 4YJ3F 3SE0A 4G5YA 2VCHA 5FO0A 1I4OA 1L6IA 1P8AA 2M48A 3W4IA 2RHMA 4CM9A 5JAPA 2G76A 4OHZA 5KWIA 3ZCRA 2R79A 1Z3IX 1KVQA 2WDPA 2KB0A 2QMOA 4WY2A 1RJFA 4OD0A 2ZJBA 3F1LA 1L4UA 1BXRB 4Y2RA 5D3ZA 1N5DA 3LCVB 1GYRA 1MRNA 2I2BA 4TVSA 4LGYA 3LXRA 2X1LA 2ANCA 2YZ2A 2ZYVX 2EDCA 1PEDA 1CHNA 3FF4A 4LV8B 4Y2VA 3UJ7A 4DANA 2YMLA 3ZLUA 4GX2A 1N7GA 5CM9C 3OC6A 4X1KB 1LCIA 3G5UA 2DJIA 3DBLA 1KS9A 3LO8A 1NXTA 2LW7A 2OCGA 1RRCA 1RABA 3LY8A 1DVRA 4RE6A 2J31A 3S68A 4KIGA 4E5YA 1M8JA 1FC0A 3PXBA 4OQMA 3UMJA 4ITVA 1KQFA 2QR5A 2PZLA 4ENPA 3OTOB 2XE8A 4WFIA 4CLHA 1IOZA 3OM1A 1VJDA 2Y1XA 3B1YA 3U9SA 2AEJA 2VNKA 1J39A 2FQXA 4V1CB 3RK0A 2JFUA 4KQCA 3OC0A 1ZM7A 2V8BA 2I6TA 3S1RI 2YHUA 1OWLA 4EF5A 4F3TA 4MW6A 4NH0A 3EULA 1E9FA 1Y1QA 1AJEA 1LTHR 1O77A 4FE7A 5TMPA 2HHJA 1S01A 4I99A 3H0KA 2B78A 4PZYA 2PUJA 2CVQA 1SCUA 5GGXA 1LPBB 5JNTA 5JT1A 4RF2A 3PFFA 1CJTC 3TR0A 3F7NA 1E58A 1K98A 1DKNA 1QYCA 4G4SO 2YWRA 4YQFA 3BZBA 2D13A 2D74A 4H0NA 1W96A 3E6AA 2XUJA 4GSLA 2OZLA 4ZAXA 3U5TA 2ZWAA 1BGWA 2AKLA 1MAWA 3EXFA 3WZMA 1S5PA 4GKJB 4MV1A 2TMDA 4RA9A 2BM1A 2RHOA 4FCWA 3TNJA 2G36A 3JZMA 1VG8A 3PQ2A 5DXJA 4A6XA 2ZJ2A 4KXWA 3DZDA 3CNHA 4Q6WA 3S8YA 1VLMA 1QH8A 2V8KA 1E60A 2ZIVB 3RT9A 2AHOA 2BMWA 2Y2VA 3AEQA 4C7BA 4DCUA 1Y1RA 5GIOE 1SAYA 1MRSA 4JBNA 4OXKA 1EWQA 4JVNA 3GDFA 1KD11 4JJIA 4YCMA 2NV0A 3S2ZA 1DIBA 1X7XA 2E9SA 2J3KA 2XDAA 2FXVA 2COEA 2FPIB 3OZDA 1HSOA 2ZIWB 4PSAA 4R71A 3II6X 3AZOA 3GLHE 4UDYX 1EP1B 2R00C 2WMYA 3F5SA 3H4TA 4IG4A 2XBMA 1YJQA 4TV9B 1AKNA 3FPJA 2HSWA 1FX1A 3DE1X 2HA5A 2R4TA 3ONDA 3NIFB 3QU9A 4OPMA 3OAAD 2BCGY 4PG8A 4EB8A 4CMEC 3T9BA 5REQA 2QBYB 3KB1A 2UAGA 1QOPB 2JZNA 1RP1A 2NPFA 3JRXA 2HXSA 2XF8A 5EUCA 4ND6A 1J5EB 1U3CA 3TX6A 3OX4A 3S8