2OTL1

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otl100
1VQO1 1YIT1 3CCQZ 1S72Z 2OTLZ 3CCSZ 1YJN1 1VQ4Z 3I551 3G71Z 1YJ91 1VQM1 1KQSY 3CCRZ 3CXCZ 1VQ5Z 1VQ61 1K8A1 1JJ2Z 3CCM1 2QEX1 1Q861 1YHQZ 3CCU1 1W2BY 3CC7Z 1VQ6Z 3OW2Z 3CCR1 1YIJZ 1K731 1VQK1 1Q7Y1 1M1K1 1YJWZ 3CMEZ 3CC2Z 1W2BZ 3CCQ1 2QA4Z 1YI21 1QVGZ 1YJNZ 1VQNZ 1JJ2Y 1QVFZ 3CMAZ 3CCE1 3I561 1VQP1 1NJI1 1N8R1 1K732 2OTJZ 1K9M2 1Q7Y2 1M1K2 1KC82 3CCL1 1VQL1 1VQPZ 1K8A2 3CCJZ 3CC71 1Q811 1VQ41 3CCS1 1Q821 1QVFY 3CCUZ 3G4S1 1VQKZ 1QVGY 1Q822 1Q812 1VQMZ 3CCV1 3CC4Z 3G711 3CMA1 3OW2Y 1YJ9Z 3G6E1 3CPWZ 1VQ51 1K9M1 2OTL1 2QEXZ 3CC41 3CCVZ 3I56Z 1VQOZ 1YITZ 1M902 3CD61 3CXCY 1KD11 1KQSZ 1S721 1VQ81 3CCLZ 1VQLZ 3CME1 3CC21 1VQ7Z 3CCJ1 1KC81 1VQN1 1YJW1 3CD6Z 3G4SZ 1VQ9Z 2QA41 1VQ8Z 1YI2Z 3CPWY 3CCEZ 1VQ71 2OTJ1 3CCMZ 1NJI2 1N8R2 1YIJ1 1YHQ1 1KD12 1Q862 3G6EZ 1VQ91 3I55Z 1M901
chains in the Genus database with same CATH superfamily
2JIPA 1S72Z 3D9XA 3J80f 3CCSZ 3HOUI 1YJN1 3I551 3F3FC 3G71Z 1YJ91 3HOYI 3D2LA 3CCRZ 2R92I 2JIOA 4NB8A 4E32A 1S7MA 1X3ZA 4NBEA 4A3II 1RO4A 1YIJZ 2GTIA 2E7ZA 1TWHI 2QKDA 4TNUA 2VF1A 4A3GI 2RBLA 2JMOA 3VMGA 2OTJZ 1K9M2 2W04A 2RT9A 2LIYA 5D1OB 1Q16A 2DE5A 3Q87A 1PFTA 1VQL1 2JIQA 1Q811 3CCS1 4E30A 4EWCA 2GU2A 3PO3S 1RQFA 2LFUA 5AN9F 3GTLI 2K5RA 5T6BA 1Q822 4S1TA 1VQMZ 3GTMI 1FDIA 2LEXA 3CC4Z 3GTMS 2JA6I 2WB1A 3NH4A 1K9M1 3PO3I 4X6AI 2RHBA 1YITZ 3NFZA 1VQOZ 1M902 4NBBA 3IR7A 4HH4A 2K3RA 3CC21 2H85A 3CCJ1 3JAMf 4RVFA 1YJW1 1QYPA 4DK1A 1VQ9Z 3CPWY 1VQ8Z 4RVGA 1TWAI 3CCEZ 4A3MI 1Y1VI 1P9NA 1WCMI 1VQ71 3CCMZ 1NJI2 3ESWA 1YIJ1 3RZOI 5A2Qb 3G6EZ 1VQ91 1VQO1 1YIT1 3PO2I 2RPRA 5FLXf 3T4NB 1VQ4Z 2P28A 3HKZA 3HOXI 5C44I 3LUSA 2V3VA 3S1MI 4MD9A 2VPYA 2F4MA 3IFUA 4NBDA 1VQM1 1R9TI 1KQSY 2E9HA 3CXCZ 1VQ5Z 1VQ61 2QRCB 2Q4ZA 1JJ2Z 3CCM1 1QF8A 2HF1A 4NBFA 3S1RI 2DE7A 4DQYB 1VQ6Z 2EGTA 2JA5I 1K731 2VUMI 1YUAA 1Q7Y1 1M1K1 1YJWZ 3CC2Z 1JWHC 2JIMA 3CCQ1 3H3VJ 2AKLA 1Y1VS 4XX2A 4CL1A 1I50I 2GTHA 3QWUA 2IZ3A 2BJOA 3VTNA 1FDOA 1Z01A 1VQP1 3VB9A 5IT9f 1K83I 5IP9I 2R93I 3KIFA 3TE5B 3EERA 5FLMI 3KIHA 2OOXB 3GKQA 1Q7Y2 1M1K2 4A3KI 3I07A 3J80b 1QVFY 4BBRI 4BY1I 2OZKA 4NB9A 2YADA 3GCFA 2VPWA 2JR6A 3G711 3VMIA 3OW2Y 1YJ9Z 1VLAA 3F3PC 1LQLA 4A3BI 1SIWA 3P5JB 4E2YA 2QEXZ 3H0GI 2M48A 3IX0A 3CD61 1KD11 2F4OA 1X3WA 1S721 4NBGA 3CCLZ 2O4HA 2WAQA 4RV9A 2E2JI 4HGYA 1KC81 1VQN1 3S16I 4A3EI 2Q51A 3K7AI 3NDJA 3GTQI 2QA41 4A93I 2VPZA 2NVTI 1TWGI 2KPIA 3S14I 2VPXA 1TFIA 3S1NI 4MRIA 1N2FA 1SFOI 2AYDA 3TDHB 3FQMA 3CCQZ 3FKII 4QTUA 1ML8A 3BG0B 4A3LI 4NH1C 3J81f 1K8A1 4A3FI 1L1OC 3GTJI 1YHQZ 2M6NA 1Y1WI 1W2BY 2NVQI 2W03A 3S2DI 3CC7Z 3CQZI 3NH8A 3CCR1 2PMZA 3NDIA 1WW9A 1VQK1 2J6AA 4E2XA 4E33A 1W2BZ 2JNYA 1YI21 4Y7NI 1QVGZ 3D6WA 1YJNZ 1ZB9A 3M3YI 2KI7B 3MZKB 1USPA 2V8IA 2V45A 3BG1B 5CM2M 3M4OI 4MD7A 2NVXI 2NVYI 4E2WA 1RLYA 5LL6f 1KC82 5D1PA 4DGLA 3CCL1 1K8A2 3EEDA 4AYBA 3NH5A 3CCJZ 1Q821 5C3EI 3CCUZ 3VMHA 3G4S1 2ZAEB 1VQKZ 5T64A 5T67A 4E2ZA 1QVGY 1Z03A 2PM9A 1Q812 3HOVI 1RO2A 2R7ZI 3G6E1 2QREB 1DL6A 4RS4A 2OTL1 2PK7A 4MONA 3HOZI 3CC41 1RNIA 2E2HI 3I56Z 4RVDA 1WJ2A 3RZDI 2HU9A 1VQ81 3CME1 1VQ7Z 2YU9I 1NUIA 1X0TA 3CD6Z 2B63I 2O53A 1YI2Z 1I3QI 2OTJ1 1QXFA 1N8R2 3GTGI 1KD12 3IF8A 4NBCA 3MONA 3I55Z 2RIQA 3GTKI 1ZB8A 4MXUA 3MZLB 1USPB 2OTLZ 2JA7I 1Z02A 2JA8I 1KRLA 2IV2X 2V8JA 3S17I 2P3YA 1NP6A 2QEX1 1Q861 4E31A 4HGZA 2VUGA 3CCU1 3U50C 4NBAA 3FQQA 3OW2Z 3J81b 3GTPI 2I3CA 4A3DI 3GTOI 2QLVB 3CMEZ 3S2HI 3HOWI 2QA4Z 4Y52I 1VQNZ 1JJ2Y 5C4JI 2DE6A 1QVFZ 3CMAZ 2JS4A 2G2KA 3I4NI 2NAPA 4A3CI 3CCE1 3I561 1N8R1 1NJI1 5IT9b 4NBHA 1K732 4MD8A 2QR1B 1ZH1A 4QTTA 3S1QI 2R6MA 4RVHA 3S15I 2IZ4A 1VQPZ 3CC71 1VQ41 2Y0SA 5D1OA 4MH4A 1I6HI 2QRDB 5C4XI 1TWCI 3CCV1 1AA6A 3CMA1 2JUBA 5A2Qf 3CPWZ 2OOYB 1VQ51 4NFRA 1Y8CA 3CCVZ 3CXCY 5FLXb 1KQSZ 1RO0A 1VQLZ 2JIRA 1WIIA 3JAMb 4BXXI 4A3JI 5IP7I 3I4MI 3G4SZ 1WZNA 2V8KA 1YHQ1 1YUKA 1Q862 1TWFI 3J7A4 4NOZA 4BY7I 4BBSI 1M901 2E2II
chains in the Genus database with same CATH topology
1S72Z 3D9XA 3J80f 3CCSZ 3HOUI 1YJN1 3I551 3F3FC 3G71Z 1YJ91 3HOYI 3CCRZ 2R92I 4NB8A 4E32A 1S7MA 1X3ZA 4NBEA 4A3II 1RO4A 1YIJZ 2GTIA 1TWHI 2QKDA 4TNUA 2VF1A 4A3GI 2RBLA 2JMOA 3VMGA 2OTJZ 1K9M2 2W04A 2RT9A 2LIYA 5D1OB 2DE5A 3Q87A 1PFTA 1VQL1 1Q811 3CCS1 4E30A 4EWCA 2GU2A 3PO3S 1RQFA 2LFUA 5AN9F 3GTLI 2K5RA 5T6BA 1Q822 4S1TA 1VQMZ 3GTMI 3CC4Z 3GTMS 2JA6I 2WB1A 3NH4A 1K9M1 3PO3I 4X6AI 2RHBA 1YITZ 3NFZA 1VQOZ 1M902 4NBBA 4HH4A 2K3RA 3CC21 2H85A 3CCJ1 3JAMf 4RVFA 1YJW1 1QYPA 4DK1A 1VQ9Z 3CPWY 1VQ8Z 4RVGA 1TWAI 3CCEZ 4A3MI 1Y1VI 1P9NA 1WCMI 1VQ71 3CCMZ 1NJI2 3ESWA 1YIJ1 3RZOI 5A2Qb 3G6EZ 1VQ91 1VQO1 1YIT1 3PO2I 2RPRA 5FLXf 3T4NB 1VQ4Z 2P28A 3HKZA 3HOXI 5C44I 3LUSA 3S1MI 4MD9A 2F4MA 3IFUA 4NBDA 1VQM1 1R9TI 1KQSY 2E9HA 3CXCZ 1VQ5Z 1VQ61 2QRCB 2Q4ZA 1JJ2Z 3CCM1 1QF8A 2HF1A 4NBFA 3S1RI 2DE7A 4DQYB 1VQ6Z 2EGTA 2JA5I 1K731 2VUMI 1YUAA 1Q7Y1 1M1K1 1YJWZ 3CC2Z 1JWHC 3CCQ1 3H3VJ 2AKLA 1Y1VS 4XX2A 4CL1A 1I50I 2GTHA 3QWUA 2IZ3A 2BJOA 3VTNA 1Z01A 1VQP1 3VB9A 5IT9f 1K83I 5IP9I 2R93I 3KIFA 3TE5B 3EERA 5FLMI 3KIHA 2OOXB 3GKQA 1Q7Y2 1M1K2 4A3KI 3I07A 3J80b 1QVFY 4BBRI 4BY1I 2OZKA 4NB9A 2YADA 3GCFA 2JR6A 3G711 3VMIA 3OW2Y 1YJ9Z 1VLAA 3F3PC 1LQLA 4A3BI 3P5JB 4E2YA 2QEXZ 3H0GI 2M48A 3IX0A 3CD61 1KD11 2F4OA 1X3WA 1S721 4NBGA 3CCLZ 2O4HA 2WAQA 4RV9A 2E2JI 4HGYA 1KC81 1VQN1 3S16I 4A3EI 2Q51A 3K7AI 3NDJA 3GTQI 2QA41 4A93I 2NVTI 1TWGI 2KPIA 3S14I 1TFIA 3S1NI 4MRIA 1N2FA 1SFOI 3TDHB 3FQMA 3CCQZ 3FKII 4QTUA 1ML8A 3BG0B 4A3LI 4NH1C 3J81f 1K8A1 4A3FI 1L1OC 3GTJI 1YHQZ 2M6NA 1Y1WI 1W2BY 2NVQI 2W03A 3S2DI 3CC7Z 3CQZI 3NH8A 3CCR1 2PMZA 3NDIA 1WW9A 1VQK1 2J6AA 4E2XA 4E33A 1W2BZ 2JNYA 1YI21 4Y7NI 1QVGZ 3D6WA 1YJNZ 1ZB9A 3M3YI 2KI7B 3MZKB 1USPA 2V8IA 3BG1B 5CM2M 3M4OI 4MD7A 2NVXI 2NVYI 4E2WA 1RLYA 5LL6f 1KC82 5D1PA 4DGLA 3CCL1 1K8A2 3EEDA 4AYBA 3NH5A 3CCJZ 1Q821 5C3EI 3CCUZ 3VMHA 3G4S1 2ZAEB 1VQKZ 5T64A 5T67A 4E2ZA 1QVGY 1Z03A 2PM9A 1Q812 3HOVI 1RO2A 2R7ZI 3G6E1 2QREB 1DL6A 4RS4A 2OTL1 2PK7A 4MONA 3HOZI 3CC41 1RNIA 2E2HI 3I56Z 4RVDA 3RZDI 2HU9A 1VQ81 3CME1 1VQ7Z 2YU9I 1NUIA 1X0TA 3CD6Z 2B63I 2O53A 1YI2Z 1I3QI 2OTJ1 1N8R2 3GTGI 1KD12 3IF8A 4NBCA 3MONA 3I55Z 2RIQA 3GTKI 1ZB8A 4MXUA 3MZLB 1USPB 2OTLZ 2JA7I 1Z02A 2JA8I 1KRLA 2V8JA 3S17I 2P3YA 1NP6A 2QEX1 1Q861 4E31A 4HGZA 2VUGA 3CCU1 3U50C 4NBAA 3FQQA 3OW2Z 3J81b 3GTPI 2I3CA 4A3DI 3GTOI 2QLVB 3CMEZ 3S2HI 3HOWI 2QA4Z 4Y52I 1VQNZ 1JJ2Y 5C4JI 2DE6A 1QVFZ 3CMAZ 2G2KA 2JS4A 3I4NI 4A3CI 3CCE1 3I561 1N8R1 1NJI1 5IT9b 4NBHA 1K732 4MD8A 2QR1B 1ZH1A 4QTTA 3S1QI 2R6MA 4RVHA 3S15I 2IZ4A 1VQPZ 3CC71 1VQ41 2Y0SA 5D1OA 4MH4A 1I6HI 2QRDB 5C4XI 1TWCI 3CCV1 3CMA1 2JUBA 5A2Qf 3CPWZ 2OOYB 1VQ51 4NFRA 3CCVZ 3CXCY 5FLXb 1KQSZ 1RO0A 1VQLZ 1WIIA 3JAMb 4BXXI 4A3JI 5IP7I 3I4MI 3G4SZ 2V8KA 1YHQ1 1YUKA 1Q862 1TWFI 3J7A4 4NOZA 4BY7I 4BBSI 1M901 2E2II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO 1;  1YIT 1;  3CCQ Z;  1S72 Z;  2OTL Z;  3CCS Z;  1YJN 1;  1VQ4 Z;  3I55 1;  3G71 Z;  1YJ9 1;  1VQM 1;  1KQS Y;  3CCR Z;  3CXC Z;  1VQ5 Z;  1VQ6 1;  1K8A 1;  1JJ2 Z;  3CCM 1;  2QEX 1;  1Q86 1;  1YHQ Z;  3CCU 1;  1W2B Y;  3CC7 Z;  1VQ6 Z;  3OW2 Z;  3CCR 1;  1YIJ Z;  1K73 1;  1VQK 1;  1Q7Y 1;  1M1K 1;  1YJW Z;  3CME Z;  3CC2 Z;  1W2B Z;  3CCQ 1;  2QA4 Z;  1YI2 1;  1QVG Z;  1YJN Z;  1VQN Z;  1JJ2 Y;  1QVF Z;  3CMA Z;  3CCE 1;  3I56 1;  1VQP 1;  1NJI 1;  1N8R 1;  1K73 2;  2OTJ Z;  1K9M 2;  1Q7Y 2;  1M1K 2;  1KC8 2;  3CCL 1;  1VQL 1;  1VQP Z;  1K8A 2;  3CCJ Z;  3CC7 1;  1Q81 1;  1VQ4 1;  3CCS 1;  1Q82 1;  1QVF Y;  3CCU Z;  3G4S 1;  1VQK Z;  1QVG Y;  1Q82 2;  1Q81 2;  1VQM Z;  3CCV 1;  3CC4 Z;  3G71 1;  3CMA 1;  3OW2 Y;  1YJ9 Z;  3G6E 1;  3CPW Z;  1VQ5 1;  1K9M 1;  2OTL 1;  2QEX Z;  3CC4 1;  3CCV Z;  3I56 Z;  1VQO Z;  1YIT Z;  1M90 2;  3CD6 1;  3CXC Y;  1KD1 1;  1KQS Z;  1S72 1;  1VQ8 1;  3CCL Z;  1VQL Z;  3CME 1;  3CC2 1;  1VQ7 Z;  3CCJ 1;  1KC8 1;  1VQN 1;  1YJW 1;  3CD6 Z;  3G4S Z;  1VQ9 Z;  2QA4 1;  1VQ8 Z;  1YI2 Z;  3CPW Y;  3CCE Z;  1VQ7 1;  2OTJ 1;  3CCM Z;  1NJI 2;  1N8R 2;  1YIJ 1;  1YHQ 1;  1KD1 2;  1Q86 2;  3G6E Z;  1VQ9 1;  3I55 Z;  1M90 1; 
#chains in the Genus database with same CATH topology
 2JIP A;  1S72 Z;  3D9X A;  3J80 f;  3CCS Z;  3HOU I;  1YJN 1;  3I55 1;  3F3F C;  3G71 Z;  1YJ9 1;  3HOY I;  3D2L A;  3CCR Z;  2R92 I;  2JIO A;  4NB8 A;  4E32 A;  1S7M A;  1X3Z A;  4NBE A;  4A3I I;  1RO4 A;  1YIJ Z;  2GTI A;  2E7Z A;  1TWH I;  2QKD A;  4TNU A;  2VF1 A;  4A3G I;  2RBL A;  2JMO A;  3VMG A;  2OTJ Z;  1K9M 2;  2W04 A;  2RT9 A;  2LIY A;  5D1O B;  1Q16 A;  2DE5 A;  3Q87 A;  1PFT A;  1VQL 1;  2JIQ A;  1Q81 1;  3CCS 1;  4E30 A;  4EWC A;  2GU2 A;  3PO3 S;  1RQF A;  2LFU A;  5AN9 F;  3GTL I;  2K5R A;  5T6B A;  1Q82 2;  4S1T A;  1VQM Z;  3GTM I;  1FDI A;  2LEX A;  3CC4 Z;  3GTM S;  2JA6 I;  2WB1 A;  3NH4 A;  1K9M 1;  3PO3 I;  4X6A I;  2RHB A;  1YIT Z;  3NFZ A;  1VQO Z;  1M90 2;  4NBB A;  3IR7 A;  4HH4 A;  2K3R A;  3CC2 1;  2H85 A;  3CCJ 1;  3JAM f;  4RVF A;  1YJW 1;  1QYP A;  4DK1 A;  1VQ9 Z;  3CPW Y;  1VQ8 Z;  4RVG A;  1TWA I;  3CCE Z;  4A3M I;  1Y1V I;  1P9N A;  1WCM I;  1VQ7 1;  3CCM Z;  1NJI 2;  3ESW A;  1YIJ 1;  3RZO I;  5A2Q b;  3G6E Z;  1VQ9 1;  1VQO 1;  1YIT 1;  3PO2 I;  2RPR A;  5FLX f;  3T4N B;  1VQ4 Z;  2P28 A;  3HKZ A;  3HOX I;  5C44 I;  3LUS A;  2V3V A;  3S1M I;  4MD9 A;  2VPY A;  2F4M A;  3IFU A;  4NBD A;  1VQM 1;  1R9T I;  1KQS Y;  2E9H A;  3CXC Z;  1VQ5 Z;  1VQ6 1;  2QRC B;  2Q4Z A;  1JJ2 Z;  3CCM 1;  1QF8 A;  2HF1 A;  4NBF A;  3S1R I;  2DE7 A;  4DQY B;  1VQ6 Z;  2EGT A;  2JA5 I;  1K73 1;  2VUM I;  1YUA A;  1Q7Y 1;  1M1K 1;  1YJW Z;  3CC2 Z;  1JWH C;  2JIM A;  3CCQ 1;  3H3V J;  2AKL A;  1Y1V S;  4XX2 A;  4CL1 A;  1I50 I;  2GTH A;  3QWU A;  2IZ3 A;  2BJO A;  3VTN A;  1FDO A;  1Z01 A;  1VQP 1;  3VB9 A;  5IT9 f;  1K83 I;  5IP9 I;  2R93 I;  3KIF A;  3TE5 B;  3EER A;  5FLM I;  3KIH A;  2OOX B;  3GKQ A;  1Q7Y 2;  1M1K 2;  4A3K I;  3I07 A;  3J80 b;  1QVF Y;  4BBR I;  4BY1 I;  2OZK A;  4NB9 A;  2YAD A;  3GCF A;  2VPW A;  2JR6 A;  3G71 1;  3VMI A;  3OW2 Y;  1YJ9 Z;  1VLA A;  3F3P C;  1LQL A;  4A3B I;  1SIW A;  3P5J B;  4E2Y A;  2QEX Z;  3H0G I;  2M48 A;  3IX0 A;  3CD6 1;  1KD1 1;  2F4O A;  1X3W A;  1S72 1;  4NBG A;  3CCL Z;  2O4H A;  2WAQ A;  4RV9 A;  2E2J I;  4HGY A;  1KC8 1;  1VQN 1;  3S16 I;  4A3E I;  2Q51 A;  3K7A I;  3NDJ A;  3GTQ I;  2QA4 1;  4A93 I;  2VPZ A;  2NVT I;  1TWG I;  2KPI A;  3S14 I;  2VPX A;  1TFI A;  3S1N I;  4MRI A;  1N2F A;  1SFO I;  2AYD A;  3TDH B;  3FQM A;  3CCQ Z;  3FKI I;  4QTU A;  1ML8 A;  3BG0 B;  4A3L I;  4NH1 C;  3J81 f;  1K8A 1;  4A3F I;  1L1O C;  3GTJ I;  1YHQ Z;  2M6N A;  1Y1W I;  1W2B Y;  2NVQ I;  2W03 A;  3S2D I;  3CC7 Z;  3CQZ I;  3NH8 A;  3CCR 1;  2PMZ A;  3NDI A;  1WW9 A;  1VQK 1;  2J6A A;  4E2X A;  4E33 A;  1W2B Z;  2JNY A;  1YI2 1;  4Y7N I;  1QVG Z;  3D6W A;  1YJN Z;  1ZB9 A;  3M3Y I;  2KI7 B;  3MZK B;  1USP A;  2V8I A;  2V45 A;  3BG1 B;  5CM2 M;  3M4O I;  4MD7 A;  2NVX I;  2NVY I;  4E2W A;  1RLY A;  5LL6 f;  1KC8 2;  5D1P A;  4DGL A;  3CCL 1;  1K8A 2;  3EED A;  4AYB A;  3NH5 A;  3CCJ Z;  1Q82 1;  5C3E I;  3CCU Z;  3VMH A;  3G4S 1;  2ZAE B;  1VQK Z;  5T64 A;  5T67 A;  4E2Z A;  1QVG Y;  1Z03 A;  2PM9 A;  1Q81 2;  3HOV I;  1RO2 A;  2R7Z I;  3G6E 1;  2QRE B;  1DL6 A;  4RS4 A;  2OTL 1;  2PK7 A;  4MON A;  3HOZ I;  3CC4 1;  1RNI A;  2E2H I;  3I56 Z;  4RVD A;  1WJ2 A;  3RZD I;  2HU9 A;  1VQ8 1;  3CME 1;  1VQ7 Z;  2YU9 I;  1NUI A;  1X0T A;  3CD6 Z;  2B63 I;  2O53 A;  1YI2 Z;  1I3Q I;  2OTJ 1;  1QXF A;  1N8R 2;  3GTG I;  1KD1 2;  3IF8 A;  4NBC A;  3MON A;  3I55 Z;  2RIQ A;  3GTK I;  1ZB8 A;  4MXU A;  3MZL B;  1USP B;  2OTL Z;  2JA7 I;  1Z02 A;  2JA8 I;  1KRL A;  2IV2 X;  2V8J A;  3S17 I;  2P3Y A;  1NP6 A;  2QEX 1;  1Q86 1;  4E31 A;  4HGZ A;  2VUG A;  3CCU 1;  3U50 C;  4NBA A;  3FQQ A;  3OW2 Z;  3J81 b;  3GTP I;  2I3C A;  4A3D I;  3GTO I;  2QLV B;  3CME Z;  3S2H I;  3HOW I;  2QA4 Z;  4Y52 I;  1VQN Z;  1JJ2 Y;  5C4J I;  2DE6 A;  1QVF Z;  3CMA Z;  2JS4 A;  2G2K A;  3I4N I;  2NAP A;  4A3C I;  3CCE 1;  3I56 1;  1N8R 1;  1NJI 1;  5IT9 b;  4NBH A;  1K73 2;  4MD8 A;  2QR1 B;  1ZH1 A;  4QTT A;  3S1Q I;  2R6M A;  4RVH A;  3S15 I;  2IZ4 A;  1VQP Z;  3CC7 1;  1VQ4 1;  2Y0S A;  5D1O A;  4MH4 A;  1I6H I;  2QRD B;  5C4X I;  1TWC I;  3CCV 1;  1AA6 A;  3CMA 1;  2JUB A;  5A2Q f;  3CPW Z;  2OOY B;  1VQ5 1;  4NFR A;  1Y8C A;  3CCV Z;  3CXC Y;  5FLX b;  1KQS Z;  1RO0 A;  1VQL Z;  2JIR A;  1WII A;  3JAM b;  4BXX I;  4A3J I;  5IP7 I;  3I4M I;  3G4S Z;  1WZN A;  2V8K A;  1YHQ 1;  1YUK A;  1Q86 2;  1TWF I;  3J7A 4;  4NOZ A;  4BY7 I;  4BBS I;  1M90 1;  2E2I I; 
#chains in the Genus database with same CATH homology
 1S72 Z;  3D9X A;  3J80 f;  3CCS Z;  3HOU I;  1YJN 1;  3I55 1;  3F3F C;  3G71 Z;  1YJ9 1;  3HOY I;  3CCR Z;  2R92 I;  4NB8 A;  4E32 A;  1S7M A;  1X3Z A;  4NBE A;  4A3I I;  1RO4 A;  1YIJ Z;  2GTI A;  1TWH I;  2QKD A;  4TNU A;  2VF1 A;  4A3G I;  2RBL A;  2JMO A;  3VMG A;  2OTJ Z;  1K9M 2;  2W04 A;  2RT9 A;  2LIY A;  5D1O B;  2DE5 A;  3Q87 A;  1PFT A;  1VQL 1;  1Q81 1;  3CCS 1;  4E30 A;  4EWC A;  2GU2 A;  3PO3 S;  1RQF A;  2LFU A;  5AN9 F;  3GTL I;  2K5R A;  5T6B A;  1Q82 2;  4S1T A;  1VQM Z;  3GTM I;  3CC4 Z;  3GTM S;  2JA6 I;  2WB1 A;  3NH4 A;  1K9M 1;  3PO3 I;  4X6A I;  2RHB A;  1YIT Z;  3NFZ A;  1VQO Z;  1M90 2;  4NBB A;  4HH4 A;  2K3R A;  3CC2 1;  2H85 A;  3CCJ 1;  3JAM f;  4RVF A;  1YJW 1;  1QYP A;  4DK1 A;  1VQ9 Z;  3CPW Y;  1VQ8 Z;  4RVG A;  1TWA I;  3CCE Z;  4A3M I;  1Y1V I;  1P9N A;  1WCM I;  1VQ7 1;  3CCM Z;  1NJI 2;  3ESW A;  1YIJ 1;  3RZO I;  5A2Q b;  3G6E Z;  1VQ9 1;  1VQO 1;  1YIT 1;  3PO2 I;  2RPR A;  5FLX f;  3T4N B;  1VQ4 Z;  2P28 A;  3HKZ A;  3HOX I;  5C44 I;  3LUS A;  3S1M I;  4MD9 A;  2F4M A;  3IFU A;  4NBD A;  1VQM 1;  1R9T I;  1KQS Y;  2E9H A;  3CXC Z;  1VQ5 Z;  1VQ6 1;  2QRC B;  2Q4Z A;  1JJ2 Z;  3CCM 1;  1QF8 A;  2HF1 A;  4NBF A;  3S1R I;  2DE7 A;  4DQY B;  1VQ6 Z;  2EGT A;  2JA5 I;  1K73 1;  2VUM I;  1YUA A;  1Q7Y 1;  1M1K 1;  1YJW Z;  3CC2 Z;  1JWH C;  3CCQ 1;  3H3V J;  2AKL A;  1Y1V S;  4XX2 A;  4CL1 A;  1I50 I;  2GTH A;  3QWU A;  2IZ3 A;  2BJO A;  3VTN A;  1Z01 A;  1VQP 1;  3VB9 A;  5IT9 f;  1K83 I;  5IP9 I;  2R93 I;  3KIF A;  3TE5 B;  3EER A;  5FLM I;  3KIH A;  2OOX B;  3GKQ A;  1Q7Y 2;  1M1K 2;  4A3K I;  3I07 A;  3J80 b;  1QVF Y;  4BBR I;  4BY1 I;  2OZK A;  4NB9 A;  2YAD A;  3GCF A;  2JR6 A;  3G71 1;  3VMI A;  3OW2 Y;  1YJ9 Z;  1VLA A;  3F3P C;  1LQL A;  4A3B I;  3P5J B;  4E2Y A;  2QEX Z;  3H0G I;  2M48 A;  3IX0 A;  3CD6 1;  1KD1 1;  2F4O A;  1X3W A;  1S72 1;  4NBG A;  3CCL Z;  2O4H A;  2WAQ A;  4RV9 A;  2E2J I;  4HGY A;  1KC8 1;  1VQN 1;  3S16 I;  4A3E I;  2Q51 A;  3K7A I;  3NDJ A;  3GTQ I;  2QA4 1;  4A93 I;  2NVT I;  1TWG I;  2KPI A;  3S14 I;  1TFI A;  3S1N I;  4MRI A;  1N2F A;  1SFO I;  3TDH B;  3FQM A;  3CCQ Z;  3FKI I;  4QTU A;  1ML8 A;  3BG0 B;  4A3L I;  4NH1 C;  3J81 f;  1K8A 1;  4A3F I;  1L1O C;  3GTJ I;  1YHQ Z;  2M6N A;  1Y1W I;  1W2B Y;  2NVQ I;  2W03 A;  3S2D I;  3CC7 Z;  3CQZ I;  3NH8 A;  3CCR 1;  2PMZ A;  3NDI A;  1WW9 A;  1VQK 1;  2J6A A;  4E2X A;  4E33 A;  1W2B Z;  2JNY A;  1YI2 1;  4Y7N I;  1QVG Z;  3D6W A;  1YJN Z;  1ZB9 A;  3M3Y I;  2KI7 B;  3MZK B;  1USP A;  2V8I A;  3BG1 B;  5CM2 M;  3M4O I;  4MD7 A;  2NVX I;  2NVY I;  4E2W A;  1RLY A;  5LL6 f;  1KC8 2;  5D1P A;  4DGL A;  3CCL 1;  1K8A 2;  3EED A;  4AYB A;  3NH5 A;  3CCJ Z;  1Q82 1;  5C3E I;  3CCU Z;  3VMH A;  3G4S 1;  2ZAE B;  1VQK Z;  5T64 A;  5T67 A;  4E2Z A;  1QVG Y;  1Z03 A;  2PM9 A;  1Q81 2;  3HOV I;  1RO2 A;  2R7Z I;  3G6E 1;  2QRE B;  1DL6 A;  4RS4 A;  2OTL 1;  2PK7 A;  4MON A;  3HOZ I;  3CC4 1;  1RNI A;  2E2H I;  3I56 Z;  4RVD A;  3RZD I;  2HU9 A;  1VQ8 1;  3CME 1;  1VQ7 Z;  2YU9 I;  1NUI A;  1X0T A;  3CD6 Z;  2B63 I;  2O53 A;  1YI2 Z;  1I3Q I;  2OTJ 1;  1N8R 2;  3GTG I;  1KD1 2;  3IF8 A;  4NBC A;  3MON A;  3I55 Z;  2RIQ A;  3GTK I;  1ZB8 A;  4MXU A;  3MZL B;  1USP B;  2OTL Z;  2JA7 I;  1Z02 A;  2JA8 I;  1KRL A;  2V8J A;  3S17 I;  2P3Y A;  1NP6 A;  2QEX 1;  1Q86 1;  4E31 A;  4HGZ A;  2VUG A;  3CCU 1;  3U50 C;  4NBA A;  3FQQ A;  3OW2 Z;  3J81 b;  3GTP I;  2I3C A;  4A3D I;  3GTO I;  2QLV B;  3CME Z;  3S2H I;  3HOW I;  2QA4 Z;  4Y52 I;  1VQN Z;  1JJ2 Y;  5C4J I;  2DE6 A;  1QVF Z;  3CMA Z;  2G2K A;  2JS4 A;  3I4N I;  4A3C I;  3CCE 1;  3I56 1;  1N8R 1;  1NJI 1;  5IT9 b;  4NBH A;  1K73 2;  4MD8 A;  2QR1 B;  1ZH1 A;  4QTT A;  3S1Q I;  2R6M A;  4RVH A;  3S15 I;  2IZ4 A;  1VQP Z;  3CC7 1;  1VQ4 1;  2Y0S A;  5D1O A;  4MH4 A;  1I6H I;  2QRD B;  5C4X I;  1TWC I;  3CCV 1;  3CMA 1;  2JUB A;  5A2Q f;  3CPW Z;  2OOY B;  1VQ5 1;  4NFR A;  3CCV Z;  3CXC Y;  5FLX b;  1KQS Z;  1RO0 A;  1VQL Z;  1WII A;  3JAM b;  4BXX I;  4A3J I;  5IP7 I;  3I4M I;  3G4S Z;  2V8K A;  1YHQ 1;  1YUK A;  1Q86 2;  1TWF I;  3J7A 4;  4NOZ A;  4BY7 I;  4BBS I;  1M90 1;  2E2I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...