2OTL1

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otl100
1VQ5Z 1KC82 3CC71 1YITZ 1YI2Z 1S72Z 1QVFZ 1YHQ1 1Q861 3CCQZ 1N8R1 1VQ6Z 3G6E1 1YJN1 1M901 3CMAZ 3CCE1 1KQSY 1N8R2 1VQ41 3G4S1 1VQ51 3CCSZ 1YIT1 1YI21 1S721 1JJ2Z 3CCQ1 1YJ9Z 1VQNZ 3CPWY 3CPWZ 3CC21 1QVFY 2QEXZ 2OTJZ 1VQ9Z 1VQMZ 3CCS1 3CCRZ 1VQ7Z 3CXCZ 1YJ91 1VQN1 3CMEZ 3CC4Z 1VQPZ 3CCVZ 3CCMZ 1JJ2Y 2QA4Z 2QEX1 3I55Z 2OTJ1 1K9M2 1VQ91 1VQ61 3CD6Z 1VQM1 1M1K1 1VQOZ 1Q7Y1 1VQKZ 3CMA1 3CCR1 1Q821 1VQLZ 2OTLZ 1NJI2 3OW2Y 1M1K2 3CCLZ 3OW2Z 1Q7Y2 1VQP1 3CCV1 1Q822 3CCM1 3CXCY 2QA41 3I551 1KD11 3CCJZ 1K9M1 3CD61 1VQO1 1VQK1 1K731 1Q812 1YJWZ 3G4SZ 1VQL1 1VQ8Z 1KD12 1YIJZ 2OTL1 1QVGY 1NJI1 1QVGZ 3CCL1 3G71Z 1K732 3CCUZ 3I56Z 1VQ71 3CC7Z 3CCJ1 3CC2Z 1Q862 1YHQZ 1KQSZ 3CME1 3CC41 1K8A1 3G6EZ 1M902 1YJNZ 1YJW1 1Q811 1VQ81 1YIJ1 1KC81 1W2BY 3CCEZ 1W2BZ 3G711 1K8A2 1VQ4Z 3CCU1 3I561
chains in the Genus database with same CATH superfamily
1VQ5Z 1YITZ 4BY7I 1X3WA 3GKQA 2JA8I 4HGZA 3CCQZ 1K83I 1VQ6Z 2E9HA 4E2ZA 3KIHA 2GTIA 1KRLA 3T4NB 3EERA 3GTMI 3CMAZ 1RO2A 4MXUA 3GTJI 2ZAEB 1VLAA 3CQZI 2P3YA 3CCSZ 1YI21 3J7A4 4TNUA 1JJ2Z 3D9XA 2RBLA 3BG0B 3VMHA 5D1OB 2JR6A 3CPWZ 3IR7A 2LIYA 1TWFI 2QEXZ 2EGTA 2JUBA 3MONA 1VQ9Z 1VQMZ 1Q16A 2AKLA 4E30A 2WAQA 2HF1A 1VQ7Z 1YJ91 2JA6I 4DQYB 1FDIA 4RVDA 3HOYI 3CCVZ 2JA5I 1YUKA 3GTGI 2YU9I 5FLXb 4DGLA 1VQOZ 1Z01A 5D1PA 1USPB 1VQLZ 2IZ3A 3IFUA 2I3CA 3HOXI 4NBDA 1M1K2 5A2Qf 1Q822 2VPXA 2QA41 3I551 4AYBA 3HOWI 1Z02A 3CD61 4A3GI 1Q812 1QVGY 3Q87A 4BY1I 3J81f 5T67A 1Z03A 3CCJ1 3HKZA 3NH4A 5C4XI 1X3ZA 1YHQZ 3M4OI 1K8A1 3M3YI 2QRCB 1M902 1YJNZ 1Q811 4E32A 3VMIA 2R93I 1JWHC 2JIOA 1W2BZ 3CCU1 2WB1A 4E2XA 1KC82 4MH4A 2OZKA 1R9TI 2QRDB 2DE6A 1N8R1 1X0TA 4RVGA 1M901 1VQ41 3F3PC 4QTUA 2B63I 1RO4A 5IT9f 1L1OC 3G4S1 1S721 1QF8A 3CPWY 2W03A 1QVFY 2F4OA 4QTTA 4EWCA 2KPIA 4A3EI 2OTJZ 1WCMI 2YADA 3CCRZ 1SFOI 1WW9A 3CXCZ 1VQN1 1P9NA 3QWUA 2E7ZA 2NVYI 3D6WA 3S2HI 3I4MI 4E33A 1K9M2 4MD7A 4NB9A 2RT9A 1N2FA 4NBFA 2Y0SA 4BBSI 4MD9A 4A93I 5A2Qb 3S15I 3OW2Z 1VQP1 2BJOA 2VPZA 2AYDA 4NBBA 3CCM1 5C3EI 3RZDI 1KD11 2LFUA 4HGYA 1K9M1 1VQK1 3HOVI 3LUSA 1YJWZ 3G4SZ 1VQ8Z 2V8JA 1YIJZ 4Y7NI 2JS4A 2OTL1 3CCL1 3G71Z 3J81b 2NVTI 4NBEA 3PO3S 2OOXB 2F4MA 4E31A 3RZOI 1RO0A 1Q862 3GCFA 4RS4A 2JIRA 3CC41 1RLYA 2QREB 4A3BI 3S2DI 3EEDA 3I07A 1ZB9A 5T6BA 3GTKI 4A3CI 1W2BY 3NDIA 1K8A2 3I561 2OOYB 2IV2X 2NAPA 3CC71 2W04A 3JAMf 1YI2Z 3GTPI 1Q861 2V45A 3G6E1 2IZ4A 4NOZA 3CCE1 1KQSY 1N8R2 1RNIA 5D1OA 5IT9b 3PO2I 2JNYA 1TWCI 5T64A 1TWGI 1VQ51 2DE5A 1YIT1 2DE7A 2NVXI 2PMZA 3CCQ1 1YJ9Z 3GTQI 3KIFA 3U50C 3NFZA 1I6HI 1Y1VS 3H3VJ 4NB8A 1WZNA 4NBHA 2VPWA 3CCS1 4A3MI 1TWAI 3HOUI 1S7MA 2HU9A 1I50I 4A3KI 3PO3I 1YUAA 3CC4Z 3GTOI 5C4JI 2VUMI 1ZB8A 2VPYA 4RVHA 3TE5B 1JJ2Y 2QA4Z 2QEX1 3I55Z 1VQ91 3CD6Z 1VQM1 1Q7Y1 2R92I 2J6AA 3H0GI 1NJI2 1QYPA 3OW2Y 3D2LA 2O4HA 2GTHA 3J80f 3I4NI 3CCV1 3P5JB 1WJ2A 2JIQA 2QLVB 1PFTA 4S1TA 3BG1B 3GTLI 2M48A 3CCJZ 2P28A 1ZH1A 1VQO1 3FQQA 1QXFA 1K731 1AA6A 1VQL1 5CM2M 1RQFA 1KD12 1NJI1 2E2JI 1FDOA 2R6MA 3CCUZ 2H85A 2JIMA 3MZKB 4E2WA 1NP6A 4RV9A 4A3II 2E2II 3TDHB 3CME1 3S16I 2K3RA 1Y1VI 1SIWA 1I3QI 2O53A 3IF8A 1VQ4Z 3S1MI 2VUGA 4NBAA 3JAMb 1S72Z 3FKII 1QVFZ 1YHQ1 2NVQI 2QR1B 2GU2A 1WIIA 1YJN1 2LEXA 2JIPA 4MONA 2V3VA 3IX0A 2QKDA 3S1NI 2V8IA 3S17I 4A3LI 3F3FC 4MRIA 4HH4A 2JA7I 5LL6f 2PK7A 4X6AI 1DL6A 3HOZI 2RHBA 1VQNZ 4XX2A 3S1QI 4BXXI 4A3FI 3NH8A 3NDJA 5FLMI 1LQLA 3CC21 2KI7B 2R7ZI 4NFRA 3VB9A 4A3JI 2RPRA 5C44I 3CMEZ 1VQPZ 2M6NA 4NBCA 2G2KA 1TFIA 3CCMZ 3S14I 2OTJ1 1VQ61 5AN9F 4A3DI 3GTMS 2RIQA 1NUIA 5FLXf 1M1K1 3MZLB 1VQKZ 2PM9A 2Q4ZA 3CMA1 3CCR1 1Q821 2VF1A 4NH1C 2OTLZ 3CCLZ 1Q7Y2 3J80b 2Q51A 3CXCY 3ESWA 2E2HI 4CL1A 4MD8A 1ML8A 1USPA 3K7AI 4BBRI 3VMGA 4DK1A 4NBGA 1QVGZ 1K732 3I56Z 2K5RA 1VQ71 4E2YA 3CC7Z 3FQMA 3CC2Z 1KQSZ 5IP9I 3G6EZ 1Y8CA 1YJW1 2V8KA 3NH5A 1VQ81 1YIJ1 4Y52I 5IP7I 1TWHI 3S1RI 3VTNA 1KC81 3CCEZ 4RVFA 3G711 2JMOA 1Y1WI
chains in the Genus database with same CATH topology
1VQ5Z 1YITZ 4BY7I 1X3WA 3GKQA 2JA8I 4HGZA 3CCQZ 1K83I 1VQ6Z 2E9HA 4E2ZA 3KIHA 2GTIA 1KRLA 3T4NB 3EERA 3GTMI 3CMAZ 1RO2A 4MXUA 3GTJI 2ZAEB 1VLAA 3CQZI 2P3YA 3CCSZ 1YI21 3J7A4 4TNUA 1JJ2Z 3D9XA 2RBLA 3BG0B 3VMHA 5D1OB 2JR6A 3CPWZ 2LIYA 1TWFI 2QEXZ 2EGTA 2JUBA 3MONA 1VQ9Z 1VQMZ 2AKLA 4E30A 2WAQA 2HF1A 1VQ7Z 1YJ91 2JA6I 4DQYB 4RVDA 3HOYI 3CCVZ 2JA5I 1YUKA 3GTGI 2YU9I 5FLXb 4DGLA 1VQOZ 1Z01A 5D1PA 1USPB 1VQLZ 2IZ3A 3IFUA 2I3CA 3HOXI 4NBDA 1M1K2 5A2Qf 1Q822 2QA41 3I551 4AYBA 3HOWI 1Z02A 3CD61 4A3GI 1Q812 1QVGY 3Q87A 4BY1I 3J81f 5T67A 1Z03A 3CCJ1 3HKZA 3NH4A 5C4XI 1X3ZA 1YHQZ 3M4OI 1K8A1 3M3YI 2QRCB 1M902 1YJNZ 1Q811 4E32A 3VMIA 2R93I 1JWHC 1W2BZ 3CCU1 2WB1A 4E2XA 1KC82 4MH4A 2OZKA 1R9TI 2QRDB 2DE6A 1N8R1 1X0TA 4RVGA 1M901 1VQ41 3F3PC 4QTUA 2B63I 1RO4A 5IT9f 1L1OC 3G4S1 1S721 1QF8A 3CPWY 2W03A 1QVFY 2F4OA 4QTTA 4EWCA 2KPIA 4A3EI 2OTJZ 1WCMI 2YADA 3CCRZ 1SFOI 1WW9A 3CXCZ 1VQN1 1P9NA 3QWUA 2NVYI 3D6WA 3S2HI 3I4MI 4E33A 1K9M2 4MD7A 4NB9A 2RT9A 1N2FA 4NBFA 2Y0SA 4BBSI 4MD9A 4A93I 5A2Qb 3S15I 3OW2Z 1VQP1 2BJOA 4NBBA 3CCM1 5C3EI 3RZDI 1KD11 2LFUA 4HGYA 1K9M1 1VQK1 3HOVI 3LUSA 1YJWZ 3G4SZ 1VQ8Z 2V8JA 1YIJZ 4Y7NI 2JS4A 2OTL1 3CCL1 3G71Z 3J81b 2NVTI 4NBEA 3PO3S 2OOXB 2F4MA 4E31A 3RZOI 1RO0A 1Q862 3GCFA 4RS4A 3CC41 1RLYA 2QREB 4A3BI 3S2DI 3EEDA 3I07A 1ZB9A 5T6BA 3GTKI 4A3CI 1W2BY 3NDIA 1K8A2 3I561 2OOYB 3CC71 2W04A 3JAMf 1YI2Z 3GTPI 1Q861 3G6E1 2IZ4A 4NOZA 3CCE1 1KQSY 1N8R2 1RNIA 5D1OA 5IT9b 3PO2I 2JNYA 1TWCI 5T64A 1TWGI 1VQ51 2DE5A 1YIT1 2DE7A 2NVXI 2PMZA 3CCQ1 1YJ9Z 3GTQI 3KIFA 3U50C 3NFZA 1I6HI 1Y1VS 3H3VJ 4NB8A 4NBHA 3CCS1 4A3MI 1TWAI 3HOUI 1S7MA 2HU9A 1I50I 4A3KI 3PO3I 1YUAA 3CC4Z 3GTOI 5C4JI 2VUMI 1ZB8A 4RVHA 3TE5B 1JJ2Y 2QA4Z 2QEX1 3I55Z 1VQ91 3CD6Z 1VQM1 1Q7Y1 2R92I 2J6AA 3H0GI 1NJI2 1QYPA 3OW2Y 2O4HA 2GTHA 3J80f 3I4NI 3CCV1 3P5JB 2QLVB 1PFTA 4S1TA 3BG1B 3GTLI 2M48A 3CCJZ 2P28A 1ZH1A 1VQO1 3FQQA 1K731 1VQL1 5CM2M 1RQFA 1KD12 1NJI1 2E2JI 2R6MA 3CCUZ 2H85A 3MZKB 4E2WA 1NP6A 4RV9A 4A3II 2E2II 3TDHB 3CME1 3S16I 2K3RA 1Y1VI 1I3QI 2O53A 3IF8A 1VQ4Z 3S1MI 2VUGA 4NBAA 3JAMb 1S72Z 3FKII 1QVFZ 1YHQ1 2NVQI 2QR1B 2GU2A 1WIIA 1YJN1 4MONA 3IX0A 2QKDA 3S1NI 2V8IA 3S17I 4A3LI 3F3FC 4MRIA 4HH4A 2JA7I 5LL6f 2PK7A 4X6AI 1DL6A 3HOZI 2RHBA 1VQNZ 4XX2A 3S1QI 4BXXI 4A3FI 3NH8A 3NDJA 5FLMI 1LQLA 3CC21 2KI7B 2R7ZI 4NFRA 3VB9A 4A3JI 2RPRA 5C44I 3CMEZ 1VQPZ 2M6NA 4NBCA 2G2KA 1TFIA 3CCMZ 3S14I 2OTJ1 1VQ61 5AN9F 4A3DI 3GTMS 2RIQA 1NUIA 5FLXf 1M1K1 3MZLB 1VQKZ 2PM9A 2Q4ZA 3CMA1 3CCR1 1Q821 2VF1A 4NH1C 2OTLZ 3CCLZ 1Q7Y2 3J80b 2Q51A 3CXCY 3ESWA 2E2HI 4CL1A 4MD8A 1ML8A 1USPA 3K7AI 4BBRI 3VMGA 4DK1A 4NBGA 1QVGZ 1K732 3I56Z 2K5RA 1VQ71 4E2YA 3CC7Z 3FQMA 3CC2Z 1KQSZ 5IP9I 3G6EZ 1YJW1 2V8KA 3NH5A 1VQ81 1YIJ1 4Y52I 5IP7I 1TWHI 3S1RI 3VTNA 1KC81 3CCEZ 4RVFA 3G711 2JMOA 1Y1WI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 Z;  1KC8 2;  3CC7 1;  1YIT Z;  1YI2 Z;  1S72 Z;  1QVF Z;  1YHQ 1;  1Q86 1;  3CCQ Z;  1N8R 1;  1VQ6 Z;  3G6E 1;  1YJN 1;  1M90 1;  3CMA Z;  3CCE 1;  1KQS Y;  1N8R 2;  1VQ4 1;  3G4S 1;  1VQ5 1;  3CCS Z;  1YIT 1;  1YI2 1;  1S72 1;  1JJ2 Z;  3CCQ 1;  1YJ9 Z;  1VQN Z;  3CPW Y;  3CPW Z;  3CC2 1;  1QVF Y;  2QEX Z;  2OTJ Z;  1VQ9 Z;  1VQM Z;  3CCS 1;  3CCR Z;  1VQ7 Z;  3CXC Z;  1YJ9 1;  1VQN 1;  3CME Z;  3CC4 Z;  1VQP Z;  3CCV Z;  3CCM Z;  1JJ2 Y;  2QA4 Z;  2QEX 1;  3I55 Z;  2OTJ 1;  1K9M 2;  1VQ9 1;  1VQ6 1;  3CD6 Z;  1VQM 1;  1M1K 1;  1VQO Z;  1Q7Y 1;  1VQK Z;  3CMA 1;  3CCR 1;  1Q82 1;  1VQL Z;  2OTL Z;  1NJI 2;  3OW2 Y;  1M1K 2;  3CCL Z;  3OW2 Z;  1Q7Y 2;  1VQP 1;  3CCV 1;  1Q82 2;  3CCM 1;  3CXC Y;  2QA4 1;  3I55 1;  1KD1 1;  3CCJ Z;  1K9M 1;  3CD6 1;  1VQO 1;  1VQK 1;  1K73 1;  1Q81 2;  1YJW Z;  3G4S Z;  1VQL 1;  1VQ8 Z;  1KD1 2;  1YIJ Z;  2OTL 1;  1QVG Y;  1NJI 1;  1QVG Z;  3CCL 1;  3G71 Z;  1K73 2;  3CCU Z;  3I56 Z;  1VQ7 1;  3CC7 Z;  3CCJ 1;  3CC2 Z;  1Q86 2;  1YHQ Z;  1KQS Z;  3CME 1;  3CC4 1;  1K8A 1;  3G6E Z;  1M90 2;  1YJN Z;  1YJW 1;  1Q81 1;  1VQ8 1;  1YIJ 1;  1KC8 1;  1W2B Y;  3CCE Z;  1W2B Z;  3G71 1;  1K8A 2;  1VQ4 Z;  3CCU 1;  3I56 1; 
#chains in the Genus database with same CATH topology
 1VQ5 Z;  1YIT Z;  4BY7 I;  1X3W A;  3GKQ A;  2JA8 I;  4HGZ A;  3CCQ Z;  1K83 I;  1VQ6 Z;  2E9H A;  4E2Z A;  3KIH A;  2GTI A;  1KRL A;  3T4N B;  3EER A;  3GTM I;  3CMA Z;  1RO2 A;  4MXU A;  3GTJ I;  2ZAE B;  1VLA A;  3CQZ I;  2P3Y A;  3CCS Z;  1YI2 1;  3J7A 4;  4TNU A;  1JJ2 Z;  3D9X A;  2RBL A;  3BG0 B;  3VMH A;  5D1O B;  2JR6 A;  3CPW Z;  3IR7 A;  2LIY A;  1TWF I;  2QEX Z;  2EGT A;  2JUB A;  3MON A;  1VQ9 Z;  1VQM Z;  1Q16 A;  2AKL A;  4E30 A;  2WAQ A;  2HF1 A;  1VQ7 Z;  1YJ9 1;  2JA6 I;  4DQY B;  1FDI A;  4RVD A;  3HOY I;  3CCV Z;  2JA5 I;  1YUK A;  3GTG I;  2YU9 I;  5FLX b;  4DGL A;  1VQO Z;  1Z01 A;  5D1P A;  1USP B;  1VQL Z;  2IZ3 A;  3IFU A;  2I3C A;  3HOX I;  4NBD A;  1M1K 2;  5A2Q f;  1Q82 2;  2VPX A;  2QA4 1;  3I55 1;  4AYB A;  3HOW I;  1Z02 A;  3CD6 1;  4A3G I;  1Q81 2;  1QVG Y;  3Q87 A;  4BY1 I;  3J81 f;  5T67 A;  1Z03 A;  3CCJ 1;  3HKZ A;  3NH4 A;  5C4X I;  1X3Z A;  1YHQ Z;  3M4O I;  1K8A 1;  3M3Y I;  2QRC B;  1M90 2;  1YJN Z;  1Q81 1;  4E32 A;  3VMI A;  2R93 I;  1JWH C;  2JIO A;  1W2B Z;  3CCU 1;  2WB1 A;  4E2X A;  1KC8 2;  4MH4 A;  2OZK A;  1R9T I;  2QRD B;  2DE6 A;  1N8R 1;  1X0T A;  4RVG A;  1M90 1;  1VQ4 1;  3F3P C;  4QTU A;  2B63 I;  1RO4 A;  5IT9 f;  1L1O C;  3G4S 1;  1S72 1;  1QF8 A;  3CPW Y;  2W03 A;  1QVF Y;  2F4O A;  4QTT A;  4EWC A;  2KPI A;  4A3E I;  2OTJ Z;  1WCM I;  2YAD A;  3CCR Z;  1SFO I;  1WW9 A;  3CXC Z;  1VQN 1;  1P9N A;  3QWU A;  2E7Z A;  2NVY I;  3D6W A;  3S2H I;  3I4M I;  4E33 A;  1K9M 2;  4MD7 A;  4NB9 A;  2RT9 A;  1N2F A;  4NBF A;  2Y0S A;  4BBS I;  4MD9 A;  4A93 I;  5A2Q b;  3S15 I;  3OW2 Z;  1VQP 1;  2BJO A;  2VPZ A;  2AYD A;  4NBB A;  3CCM 1;  5C3E I;  3RZD I;  1KD1 1;  2LFU A;  4HGY A;  1K9M 1;  1VQK 1;  3HOV I;  3LUS A;  1YJW Z;  3G4S Z;  1VQ8 Z;  2V8J A;  1YIJ Z;  4Y7N I;  2JS4 A;  2OTL 1;  3CCL 1;  3G71 Z;  3J81 b;  2NVT I;  4NBE A;  3PO3 S;  2OOX B;  2F4M A;  4E31 A;  3RZO I;  1RO0 A;  1Q86 2;  3GCF A;  4RS4 A;  2JIR A;  3CC4 1;  1RLY A;  2QRE B;  4A3B I;  3S2D I;  3EED A;  3I07 A;  1ZB9 A;  5T6B A;  3GTK I;  4A3C I;  1W2B Y;  3NDI A;  1K8A 2;  3I56 1;  2OOY B;  2IV2 X;  2NAP A;  3CC7 1;  2W04 A;  3JAM f;  1YI2 Z;  3GTP I;  1Q86 1;  2V45 A;  3G6E 1;  2IZ4 A;  4NOZ A;  3CCE 1;  1KQS Y;  1N8R 2;  1RNI A;  5D1O A;  5IT9 b;  3PO2 I;  2JNY A;  1TWC I;  5T64 A;  1TWG I;  1VQ5 1;  2DE5 A;  1YIT 1;  2DE7 A;  2NVX I;  2PMZ A;  3CCQ 1;  1YJ9 Z;  3GTQ I;  3KIF A;  3U50 C;  3NFZ A;  1I6H I;  1Y1V S;  3H3V J;  4NB8 A;  1WZN A;  4NBH A;  2VPW A;  3CCS 1;  4A3M I;  1TWA I;  3HOU I;  1S7M A;  2HU9 A;  1I50 I;  4A3K I;  3PO3 I;  1YUA A;  3CC4 Z;  3GTO I;  5C4J I;  2VUM I;  1ZB8 A;  2VPY A;  4RVH A;  3TE5 B;  1JJ2 Y;  2QA4 Z;  2QEX 1;  3I55 Z;  1VQ9 1;  3CD6 Z;  1VQM 1;  1Q7Y 1;  2R92 I;  2J6A A;  3H0G I;  1NJI 2;  1QYP A;  3OW2 Y;  3D2L A;  2O4H A;  2GTH A;  3J80 f;  3I4N I;  3CCV 1;  3P5J B;  1WJ2 A;  2JIQ A;  2QLV B;  1PFT A;  4S1T A;  3BG1 B;  3GTL I;  2M48 A;  3CCJ Z;  2P28 A;  1ZH1 A;  1VQO 1;  3FQQ A;  1QXF A;  1K73 1;  1AA6 A;  1VQL 1;  5CM2 M;  1RQF A;  1KD1 2;  1NJI 1;  2E2J I;  1FDO A;  2R6M A;  3CCU Z;  2H85 A;  2JIM A;  3MZK B;  4E2W A;  1NP6 A;  4RV9 A;  4A3I I;  2E2I I;  3TDH B;  3CME 1;  3S16 I;  2K3R A;  1Y1V I;  1SIW A;  1I3Q I;  2O53 A;  3IF8 A;  1VQ4 Z;  3S1M I;  2VUG A;  4NBA A;  3JAM b;  1S72 Z;  3FKI I;  1QVF Z;  1YHQ 1;  2NVQ I;  2QR1 B;  2GU2 A;  1WII A;  1YJN 1;  2LEX A;  2JIP A;  4MON A;  2V3V A;  3IX0 A;  2QKD A;  3S1N I;  2V8I A;  3S17 I;  4A3L I;  3F3F C;  4MRI A;  4HH4 A;  2JA7 I;  5LL6 f;  2PK7 A;  4X6A I;  1DL6 A;  3HOZ I;  2RHB A;  1VQN Z;  4XX2 A;  3S1Q I;  4BXX I;  4A3F I;  3NH8 A;  3NDJ A;  5FLM I;  1LQL A;  3CC2 1;  2KI7 B;  2R7Z I;  4NFR A;  3VB9 A;  4A3J I;  2RPR A;  5C44 I;  3CME Z;  1VQP Z;  2M6N A;  4NBC A;  2G2K A;  1TFI A;  3CCM Z;  3S14 I;  2OTJ 1;  1VQ6 1;  5AN9 F;  4A3D I;  3GTM S;  2RIQ A;  1NUI A;  5FLX f;  1M1K 1;  3MZL B;  1VQK Z;  2PM9 A;  2Q4Z A;  3CMA 1;  3CCR 1;  1Q82 1;  2VF1 A;  4NH1 C;  2OTL Z;  3CCL Z;  1Q7Y 2;  3J80 b;  2Q51 A;  3CXC Y;  3ESW A;  2E2H I;  4CL1 A;  4MD8 A;  1ML8 A;  1USP A;  3K7A I;  4BBR I;  3VMG A;  4DK1 A;  4NBG A;  1QVG Z;  1K73 2;  3I56 Z;  2K5R A;  1VQ7 1;  4E2Y A;  3CC7 Z;  3FQM A;  3CC2 Z;  1KQS Z;  5IP9 I;  3G6E Z;  1Y8C A;  1YJW 1;  2V8K A;  3NH5 A;  1VQ8 1;  1YIJ 1;  4Y52 I;  5IP7 I;  1TWH I;  3S1R I;  3VTN A;  1KC8 1;  3CCE Z;  4RVF A;  3G71 1;  2JMO A;  1Y1W I; 
#chains in the Genus database with same CATH homology
 1VQ5 Z;  1YIT Z;  4BY7 I;  1X3W A;  3GKQ A;  2JA8 I;  4HGZ A;  3CCQ Z;  1K83 I;  1VQ6 Z;  2E9H A;  4E2Z A;  3KIH A;  2GTI A;  1KRL A;  3T4N B;  3EER A;  3GTM I;  3CMA Z;  1RO2 A;  4MXU A;  3GTJ I;  2ZAE B;  1VLA A;  3CQZ I;  2P3Y A;  3CCS Z;  1YI2 1;  3J7A 4;  4TNU A;  1JJ2 Z;  3D9X A;  2RBL A;  3BG0 B;  3VMH A;  5D1O B;  2JR6 A;  3CPW Z;  2LIY A;  1TWF I;  2QEX Z;  2EGT A;  2JUB A;  3MON A;  1VQ9 Z;  1VQM Z;  2AKL A;  4E30 A;  2WAQ A;  2HF1 A;  1VQ7 Z;  1YJ9 1;  2JA6 I;  4DQY B;  4RVD A;  3HOY I;  3CCV Z;  2JA5 I;  1YUK A;  3GTG I;  2YU9 I;  5FLX b;  4DGL A;  1VQO Z;  1Z01 A;  5D1P A;  1USP B;  1VQL Z;  2IZ3 A;  3IFU A;  2I3C A;  3HOX I;  4NBD A;  1M1K 2;  5A2Q f;  1Q82 2;  2QA4 1;  3I55 1;  4AYB A;  3HOW I;  1Z02 A;  3CD6 1;  4A3G I;  1Q81 2;  1QVG Y;  3Q87 A;  4BY1 I;  3J81 f;  5T67 A;  1Z03 A;  3CCJ 1;  3HKZ A;  3NH4 A;  5C4X I;  1X3Z A;  1YHQ Z;  3M4O I;  1K8A 1;  3M3Y I;  2QRC B;  1M90 2;  1YJN Z;  1Q81 1;  4E32 A;  3VMI A;  2R93 I;  1JWH C;  1W2B Z;  3CCU 1;  2WB1 A;  4E2X A;  1KC8 2;  4MH4 A;  2OZK A;  1R9T I;  2QRD B;  2DE6 A;  1N8R 1;  1X0T A;  4RVG A;  1M90 1;  1VQ4 1;  3F3P C;  4QTU A;  2B63 I;  1RO4 A;  5IT9 f;  1L1O C;  3G4S 1;  1S72 1;  1QF8 A;  3CPW Y;  2W03 A;  1QVF Y;  2F4O A;  4QTT A;  4EWC A;  2KPI A;  4A3E I;  2OTJ Z;  1WCM I;  2YAD A;  3CCR Z;  1SFO I;  1WW9 A;  3CXC Z;  1VQN 1;  1P9N A;  3QWU A;  2NVY I;  3D6W A;  3S2H I;  3I4M I;  4E33 A;  1K9M 2;  4MD7 A;  4NB9 A;  2RT9 A;  1N2F A;  4NBF A;  2Y0S A;  4BBS I;  4MD9 A;  4A93 I;  5A2Q b;  3S15 I;  3OW2 Z;  1VQP 1;  2BJO A;  4NBB A;  3CCM 1;  5C3E I;  3RZD I;  1KD1 1;  2LFU A;  4HGY A;  1K9M 1;  1VQK 1;  3HOV I;  3LUS A;  1YJW Z;  3G4S Z;  1VQ8 Z;  2V8J A;  1YIJ Z;  4Y7N I;  2JS4 A;  2OTL 1;  3CCL 1;  3G71 Z;  3J81 b;  2NVT I;  4NBE A;  3PO3 S;  2OOX B;  2F4M A;  4E31 A;  3RZO I;  1RO0 A;  1Q86 2;  3GCF A;  4RS4 A;  3CC4 1;  1RLY A;  2QRE B;  4A3B I;  3S2D I;  3EED A;  3I07 A;  1ZB9 A;  5T6B A;  3GTK I;  4A3C I;  1W2B Y;  3NDI A;  1K8A 2;  3I56 1;  2OOY B;  3CC7 1;  2W04 A;  3JAM f;  1YI2 Z;  3GTP I;  1Q86 1;  3G6E 1;  2IZ4 A;  4NOZ A;  3CCE 1;  1KQS Y;  1N8R 2;  1RNI A;  5D1O A;  5IT9 b;  3PO2 I;  2JNY A;  1TWC I;  5T64 A;  1TWG I;  1VQ5 1;  2DE5 A;  1YIT 1;  2DE7 A;  2NVX I;  2PMZ A;  3CCQ 1;  1YJ9 Z;  3GTQ I;  3KIF A;  3U50 C;  3NFZ A;  1I6H I;  1Y1V S;  3H3V J;  4NB8 A;  4NBH A;  3CCS 1;  4A3M I;  1TWA I;  3HOU I;  1S7M A;  2HU9 A;  1I50 I;  4A3K I;  3PO3 I;  1YUA A;  3CC4 Z;  3GTO I;  5C4J I;  2VUM I;  1ZB8 A;  4RVH A;  3TE5 B;  1JJ2 Y;  2QA4 Z;  2QEX 1;  3I55 Z;  1VQ9 1;  3CD6 Z;  1VQM 1;  1Q7Y 1;  2R92 I;  2J6A A;  3H0G I;  1NJI 2;  1QYP A;  3OW2 Y;  2O4H A;  2GTH A;  3J80 f;  3I4N I;  3CCV 1;  3P5J B;  2QLV B;  1PFT A;  4S1T A;  3BG1 B;  3GTL I;  2M48 A;  3CCJ Z;  2P28 A;  1ZH1 A;  1VQO 1;  3FQQ A;  1K73 1;  1VQL 1;  5CM2 M;  1RQF A;  1KD1 2;  1NJI 1;  2E2J I;  2R6M A;  3CCU Z;  2H85 A;  3MZK B;  4E2W A;  1NP6 A;  4RV9 A;  4A3I I;  2E2I I;  3TDH B;  3CME 1;  3S16 I;  2K3R A;  1Y1V I;  1I3Q I;  2O53 A;  3IF8 A;  1VQ4 Z;  3S1M I;  2VUG A;  4NBA A;  3JAM b;  1S72 Z;  3FKI I;  1QVF Z;  1YHQ 1;  2NVQ I;  2QR1 B;  2GU2 A;  1WII A;  1YJN 1;  4MON A;  3IX0 A;  2QKD A;  3S1N I;  2V8I A;  3S17 I;  4A3L I;  3F3F C;  4MRI A;  4HH4 A;  2JA7 I;  5LL6 f;  2PK7 A;  4X6A I;  1DL6 A;  3HOZ I;  2RHB A;  1VQN Z;  4XX2 A;  3S1Q I;  4BXX I;  4A3F I;  3NH8 A;  3NDJ A;  5FLM I;  1LQL A;  3CC2 1;  2KI7 B;  2R7Z I;  4NFR A;  3VB9 A;  4A3J I;  2RPR A;  5C44 I;  3CME Z;  1VQP Z;  2M6N A;  4NBC A;  2G2K A;  1TFI A;  3CCM Z;  3S14 I;  2OTJ 1;  1VQ6 1;  5AN9 F;  4A3D I;  3GTM S;  2RIQ A;  1NUI A;  5FLX f;  1M1K 1;  3MZL B;  1VQK Z;  2PM9 A;  2Q4Z A;  3CMA 1;  3CCR 1;  1Q82 1;  2VF1 A;  4NH1 C;  2OTL Z;  3CCL Z;  1Q7Y 2;  3J80 b;  2Q51 A;  3CXC Y;  3ESW A;  2E2H I;  4CL1 A;  4MD8 A;  1ML8 A;  1USP A;  3K7A I;  4BBR I;  3VMG A;  4DK1 A;  4NBG A;  1QVG Z;  1K73 2;  3I56 Z;  2K5R A;  1VQ7 1;  4E2Y A;  3CC7 Z;  3FQM A;  3CC2 Z;  1KQS Z;  5IP9 I;  3G6E Z;  1YJW 1;  2V8K A;  3NH5 A;  1VQ8 1;  1YIJ 1;  4Y52 I;  5IP7 I;  1TWH I;  3S1R I;  3VTN A;  1KC8 1;  3CCE Z;  4RVF A;  3G71 1;  2JMO A;  1Y1W I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...