2OTL1

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otl100
1VQN1 1VQ7Z 1VQ61 1QVGZ 1M1K2 3CCJZ 1VQNZ 1K8A2 3CC71 1VQ6Z 1W2BY 1NJI1 1YJ91 1KD11 3CCQ1 1K9M1 1VQMZ 1YJ9Z 2OTJZ 3CCQZ 1JJ2Z 3CCE1 1YI21 1QVFZ 3G71Z 1YI2Z 3CCJ1 3CXCY 3CMEZ 1Q861 3G4SZ 1Q7Y1 3CCS1 3CPWZ 3CCM1 1VQM1 1Q862 1VQLZ 3CCSZ 3CMA1 1VQ8Z 2OTJ1 3CCMZ 1Q7Y2 1YJN1 1YJW1 3CMAZ 3CC21 1M901 3G711 1W2BZ 1YJNZ 1YJWZ 1NJI2 3CCRZ 1KQSY 3G6EZ 1VQK1 1KD12 3CC2Z 3CME1 1K9M2 1KC81 1VQ4Z 1VQ5Z 3OW2Z 3CCVZ 3G4S1 1M902 1VQKZ 2QA4Z 1KC82 3CD61 1YIJZ 1VQL1 1VQ81 3CD6Z 3CCUZ 3CC4Z 2QEXZ 1YHQZ 1S72Z 1QVGY 1VQPZ 1N8R1 3CCR1 3I561 3G6E1 1M1K1 1VQ41 1VQ51 3CCV1 3I56Z 1VQ9Z 3CCL1 1YITZ 1VQO1 1N8R2 2QA41 1Q811 3CCLZ 1VQOZ 1YIJ1 1JJ2Y 3CCU1 3CC7Z 2OTL1 1QVFY 1KQSZ 3CC41 1Q812 2QEX1 1YHQ1 1S721 3OW2Y 1Q821 3I551 1VQP1 2OTLZ 3CXCZ 1K731 3I55Z 1Q822 1VQ91 1VQ71 3CPWY 1YIT1 1K8A1 3CCEZ 1K732
chains in the Genus database with same CATH superfamily
1JWHC 1VQN1 1VQ61 1P9NA 1M1K2 3CCJZ 3MONA 2EGTA 3CC71 4A3MI 3S16I 3GTJI 2V3VA 2OOXB 3VMHA 2V45A 3CCQ1 1KD11 1VQMZ 2E2HI 4MXUA 5T6BA 3ESWA 2RIQA 5C44I 3GTMI 2OTJZ 3GTPI 4NBFA 3G71Z 2F4OA 3T4NB 3J7A4 1Q861 1Q7Y1 2LIYA 3PO2I 2M48A 1VQ8Z 3CCMZ 2JR6A 2R6MA 1YJW1 3D6WA 1TWFI 3IR7A 2AYDA 4DGLA 3LUSA 1W2BZ 3HOZI 3GTMS 3CCRZ 1USPB 3G6EZ 3CC2Z 1K9M2 1VQ5Z 5FLXf 3RZDI 4A3DI 4E32A 3H0GI 1QYPA 2R92I 2DE5A 1KC82 4A3II 1VQL1 2B63I 3NDJA 3CC4Z 2JIOA 1VQPZ 1Q16A 1TWGI 1N8R1 3I561 5A2Qf 4HH4A 1M1K1 1VQ41 2F4MA 4A3FI 5FLXb 3CCV1 3S1RI 5T67A 2QR1B 2DE7A 4NBDA 3VTNA 5T64A 4A3EI 3OW2Y 5IT9f 3S1MI 2OTLZ 2K5RA 2JIQA 1TFIA 5A2Qb 1Y1VI 1X0TA 1VQ91 4BBSI 2VPZA 3CCEZ 2LEXA 1K732 1I6HI 1VQ7Z 3GKQA 4A3JI 4RVHA 1AA6A 2IZ4A 3VMGA 2E2JI 3HOXI 3PO3S 5IT9b 2IZ3A 1K9M1 3IF8A 5D1OA 3VMIA 1JJ2Z 1KRLA 1N2FA 2VF1A 1QVFZ 1ZH1A 2NVXI 1R9TI 1YI2Z 3CMEZ 4E30A 3GTLI 4RS4A 1I50I 2E9HA 3NH8A 3CPWZ 2DE6A 3CCM1 1WIIA 2RPRA 4Y7NI 4DQYB 3HKZA 1Z02A 3BG0B 3CMAZ 3CC21 4BY1I 1KQSY 3NDIA 3G4S1 1M902 4MD9A 2JA7I 4E2ZA 5LL6f 2QRDB 2H85A 4NBEA 3CD6Z 3CCUZ 2G2KA 2QEXZ 1YHQZ 1NP6A 1S72Z 4MH4A 1QVGY 3S1QI 3Q87A 2JUBA 3GTQI 3M4OI 1YUAA 3IX0A 2QRCB 4RVFA 2JIRA 2QA41 3I4MI 1VQOZ 1YIJ1 2GTHA 3HOUI 3NH4A 3CC7Z 2OTL1 1QF8A 4XX2A 1S7MA 1Q812 1Q821 4MD7A 3KIFA 5D1OB 4A3GI 3CXCZ 1RNIA 1QXFA 3I55Z 5IP9I 2V8KA 3S2HI 4RVGA 2O4HA 5CM2M 3P5JB 4NFRA 1VQ71 1L1OC 1YIT1 3J80f 3J81f 3KIHA 1X3WA 2BJOA 2KI7B 1RO2A 1LQLA 1K8A2 1K83I 3PO3I 1ML8A 4HGYA 4CL1A 3S14I 1ZB8A 4NBGA 2KPIA 1WCMI 3I4NI 2LFUA 4QTTA 1YJ9Z 4MRIA 3J80b 3J81b 3CQZI 1YI21 2E2II 2GU2A 1X3ZA 2OZKA 2QKDA 2JIMA 3MZLB 1SIWA 1YUKA 3CCJ1 2VPXA 4AYBA 5D1PA 3EERA 4BXXI 3FQMA 2VUMI 4QTUA 3NH5A 4BBRI 2I3CA 1VQM1 1Q862 3H3VJ 2WB1A 3CCSZ 1VQLZ 3CMA1 2NVYI 4BY7I 2OTJ1 1Q7Y2 2Q51A 1SFOI 2QLVB 2JA8I 3D9XA 2VPWA 3G711 4A3KI 1YJNZ 1NJI2 1USPA 1WZNA 4RVDA 1FDIA 1VQ4Z 1KC81 4S1TA 2JNYA 3CCVZ 1VQKZ 1ZB9A 2AKLA 2K3RA 4NH1C 5C4JI 2W03A 3U50C 3CD61 2HU9A 2R7ZI 1VQ81 1FDOA 4NB9A 4E2WA 4NBHA 3EEDA 1I3QI 1DL6A 1RQFA 3CCR1 1RLYA 3G6E1 2WAQA 4EWCA 1VQ51 2HF1A 2J6AA 3M3YI 1VQ9Z 2PMZA 3IFUA 1VQO1 1N8R2 4MD8A 3CCLZ 1Z01A 1WW9A 2M6NA 3GCFA 2OOYB 4NB8A 1KQSZ 3CC41 3I551 1TWAI 1VQP1 1PFTA 3S2DI 4X6AI 1K731 1RO0A 2RT9A 5AN9F 4A3LI 5C4XI 4E33A 4NBCA 1NUIA 2QREB 4A3CI 1QVGZ 4A93I 4TNUA 1VQNZ 3F3FC 1VQ6Z 2JA6I 1W2BY 2RHBA 4DK1A 3FQQA 1NJI1 2P28A 1YJ91 4NBBA 3K7AI 2Y0SA 2YU9I 3CCQZ 3CCE1 1Y8CA 2JMOA 3D2LA 4E31A 2NAPA 3CXCY 4E2YA 2GTIA 4NBAA 2VPYA 3G4SZ 3GTKI 3CCS1 3MZKB 3BG1B 4E2XA 1WJ2A 2YADA 3S17I 5FLMI 2JS4A 5IP7I 2O53A 1YJN1 2ZAEB 2IV2X 1M901 1RO4A 1YJWZ 1VLAA 3RZOI 3F3PC 1VQK1 1KD12 2PK7A 3CME1 2V8IA 3OW2Z 4NOZA 3JAMf 3NFZA 3TE5B 3VB9A 3S15I 2QA4Z 3QWUA 1YIJZ 3TDHB 4A3BI 2JA5I 3S1NI 3GTOI 2NVTI 2Q4ZA 2W04A 1Z03A 2R93I 3I56Z 3CCL1 3JAMb 1TWCI 3GTGI 1YITZ 2V8JA 2VUGA 2JIPA 1Q811 3I07A 1TWHI 1Y1WI 2PM9A 4RV9A 1JJ2Y 5C3EI 2NVQI 4HGZA 2P3YA 4Y52I 4MONA 3CCU1 2E7ZA 1QVFY 2QEX1 1YHQ1 1S721 3HOYI 3HOWI 2RBLA 3FKII 1Q822 1Y1VS 3CPWY 1K8A1 3HOVI
chains in the Genus database with same CATH topology
1JWHC 1VQN1 1VQ61 1P9NA 1M1K2 3CCJZ 3MONA 2EGTA 3CC71 4A3MI 3S16I 3GTJI 2OOXB 3VMHA 1KD11 3CCQ1 2E2HI 1VQMZ 4MXUA 5T6BA 3ESWA 2RIQA 5C44I 3GTMI 2OTJZ 3GTPI 4NBFA 3G71Z 2F4OA 3T4NB 3J7A4 1Q861 1Q7Y1 2LIYA 3PO2I 2M48A 1VQ8Z 3CCMZ 2JR6A 2R6MA 1YJW1 3D6WA 1TWFI 4DGLA 3LUSA 1W2BZ 3HOZI 3GTMS 3CCRZ 1USPB 3G6EZ 3CC2Z 1K9M2 1VQ5Z 5FLXf 3RZDI 4A3DI 4E32A 3H0GI 1QYPA 2R92I 2DE5A 1KC82 4A3II 1VQL1 2B63I 3NDJA 3CC4Z 1VQPZ 1TWGI 1N8R1 3I561 5A2Qf 4HH4A 1M1K1 1VQ41 2F4MA 4A3FI 5FLXb 3CCV1 3S1RI 5T67A 2QR1B 2DE7A 4NBDA 3VTNA 5T64A 4A3EI 3OW2Y 5IT9f 3S1MI 2OTLZ 2K5RA 1TFIA 5A2Qb 1Y1VI 1X0TA 1VQ91 4BBSI 3CCEZ 1K732 1I6HI 1VQ7Z 3GKQA 4A3JI 4RVHA 2IZ4A 3VMGA 2E2JI 3HOXI 3PO3S 5IT9b 2IZ3A 1K9M1 3IF8A 5D1OA 3VMIA 1JJ2Z 1KRLA 1N2FA 2VF1A 1QVFZ 1ZH1A 2NVXI 1R9TI 1YI2Z 3CMEZ 4E30A 3GTLI 4RS4A 1I50I 2E9HA 3NH8A 3CPWZ 2DE6A 3CCM1 1WIIA 2RPRA 4Y7NI 4DQYB 3HKZA 1Z02A 3BG0B 3CMAZ 3CC21 4BY1I 1KQSY 3NDIA 3G4S1 1M902 4MD9A 2JA7I 4E2ZA 5LL6f 2QRDB 2H85A 4NBEA 3CD6Z 3CCUZ 2G2KA 2QEXZ 1YHQZ 1NP6A 1S72Z 4MH4A 1QVGY 3S1QI 3Q87A 2JUBA 3GTQI 3M4OI 1YUAA 3IX0A 2QRCB 4RVFA 2QA41 3I4MI 1VQOZ 1YIJ1 2GTHA 3HOUI 3NH4A 3CC7Z 2OTL1 1QF8A 4XX2A 1S7MA 1Q812 1Q821 4MD7A 3KIFA 5D1OB 4A3GI 3CXCZ 1RNIA 3I55Z 5IP9I 2V8KA 3S2HI 4RVGA 2O4HA 5CM2M 3P5JB 4NFRA 1VQ71 1L1OC 1YIT1 3J80f 3J81f 3KIHA 1X3WA 2BJOA 2KI7B 1RO2A 1LQLA 1K8A2 1K83I 3PO3I 1ML8A 4HGYA 4CL1A 3S14I 1ZB8A 4NBGA 2KPIA 1WCMI 3I4NI 2LFUA 4QTTA 1YJ9Z 4MRIA 3J80b 3J81b 3CQZI 1YI21 2E2II 2GU2A 1X3ZA 2OZKA 2QKDA 3MZLB 1YUKA 3CCJ1 4AYBA 5D1PA 3EERA 4BXXI 3FQMA 2VUMI 4QTUA 3NH5A 4BBRI 2I3CA 1VQM1 1Q862 3H3VJ 2WB1A 3CCSZ 1VQLZ 3CMA1 2NVYI 4BY7I 2OTJ1 1Q7Y2 2Q51A 1SFOI 2QLVB 2JA8I 3D9XA 3G711 4A3KI 1YJNZ 1NJI2 1USPA 4RVDA 1VQ4Z 1KC81 4S1TA 2JNYA 3CCVZ 1VQKZ 1ZB9A 2AKLA 2K3RA 4NH1C 5C4JI 2W03A 3U50C 3CD61 2HU9A 2R7ZI 1VQ81 4NB9A 4E2WA 4NBHA 3EEDA 1I3QI 1DL6A 1RQFA 3CCR1 1RLYA 3G6E1 2WAQA 4EWCA 1VQ51 2HF1A 2J6AA 3M3YI 1VQ9Z 2PMZA 3IFUA 1VQO1 1N8R2 4MD8A 3CCLZ 1Z01A 1WW9A 2M6NA 3GCFA 2OOYB 4NB8A 1KQSZ 3CC41 3I551 1TWAI 1VQP1 1PFTA 3S2DI 4X6AI 1K731 1RO0A 2RT9A 5AN9F 4A3LI 5C4XI 4E33A 4NBCA 1NUIA 2QREB 4A3CI 1QVGZ 4A93I 4TNUA 1VQNZ 3F3FC 1VQ6Z 2JA6I 1W2BY 2RHBA 4DK1A 3FQQA 1NJI1 2P28A 1YJ91 4NBBA 3K7AI 2Y0SA 2YU9I 3CCQZ 3CCE1 2JMOA 4E31A 3CXCY 4E2YA 2GTIA 4NBAA 3G4SZ 3GTKI 3CCS1 3MZKB 3BG1B 4E2XA 2YADA 3S17I 5FLMI 2JS4A 5IP7I 2O53A 1YJN1 2ZAEB 1M901 1RO4A 1YJWZ 1VLAA 3RZOI 3F3PC 1VQK1 1KD12 2PK7A 3CME1 2V8IA 3OW2Z 4NOZA 3JAMf 3NFZA 3TE5B 3VB9A 3S15I 2QA4Z 3QWUA 1YIJZ 3TDHB 4A3BI 2JA5I 3S1NI 3GTOI 2NVTI 2Q4ZA 2W04A 1Z03A 2R93I 3I56Z 3CCL1 3JAMb 1TWCI 3GTGI 1YITZ 2V8JA 2VUGA 1Q811 3I07A 1TWHI 1Y1WI 2PM9A 4RV9A 1JJ2Y 5C3EI 2NVQI 4HGZA 2P3YA 4Y52I 4MONA 3CCU1 1QVFY 2QEX1 1YHQ1 1S721 3HOYI 3HOWI 2RBLA 3FKII 1Q822 1Y1VS 3CPWY 1K8A1 3HOVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN 1;  1VQ7 Z;  1VQ6 1;  1QVG Z;  1M1K 2;  3CCJ Z;  1VQN Z;  1K8A 2;  3CC7 1;  1VQ6 Z;  1W2B Y;  1NJI 1;  1YJ9 1;  1KD1 1;  3CCQ 1;  1K9M 1;  1VQM Z;  1YJ9 Z;  2OTJ Z;  3CCQ Z;  1JJ2 Z;  3CCE 1;  1YI2 1;  1QVF Z;  3G71 Z;  1YI2 Z;  3CCJ 1;  3CXC Y;  3CME Z;  1Q86 1;  3G4S Z;  1Q7Y 1;  3CCS 1;  3CPW Z;  3CCM 1;  1VQM 1;  1Q86 2;  1VQL Z;  3CCS Z;  3CMA 1;  1VQ8 Z;  2OTJ 1;  3CCM Z;  1Q7Y 2;  1YJN 1;  1YJW 1;  3CMA Z;  3CC2 1;  1M90 1;  3G71 1;  1W2B Z;  1YJN Z;  1YJW Z;  1NJI 2;  3CCR Z;  1KQS Y;  3G6E Z;  1VQK 1;  1KD1 2;  3CC2 Z;  3CME 1;  1K9M 2;  1KC8 1;  1VQ4 Z;  1VQ5 Z;  3OW2 Z;  3CCV Z;  3G4S 1;  1M90 2;  1VQK Z;  2QA4 Z;  1KC8 2;  3CD6 1;  1YIJ Z;  1VQL 1;  1VQ8 1;  3CD6 Z;  3CCU Z;  3CC4 Z;  2QEX Z;  1YHQ Z;  1S72 Z;  1QVG Y;  1VQP Z;  1N8R 1;  3CCR 1;  3I56 1;  3G6E 1;  1M1K 1;  1VQ4 1;  1VQ5 1;  3CCV 1;  3I56 Z;  1VQ9 Z;  3CCL 1;  1YIT Z;  1VQO 1;  1N8R 2;  2QA4 1;  1Q81 1;  3CCL Z;  1VQO Z;  1YIJ 1;  1JJ2 Y;  3CCU 1;  3CC7 Z;  2OTL 1;  1QVF Y;  1KQS Z;  3CC4 1;  1Q81 2;  2QEX 1;  1YHQ 1;  1S72 1;  3OW2 Y;  1Q82 1;  3I55 1;  1VQP 1;  2OTL Z;  3CXC Z;  1K73 1;  3I55 Z;  1Q82 2;  1VQ9 1;  1VQ7 1;  3CPW Y;  1YIT 1;  1K8A 1;  3CCE Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 1JWH C;  1VQN 1;  1VQ6 1;  1P9N A;  1M1K 2;  3CCJ Z;  3MON A;  2EGT A;  3CC7 1;  4A3M I;  3S16 I;  3GTJ I;  2V3V A;  2OOX B;  3VMH A;  2V45 A;  3CCQ 1;  1KD1 1;  1VQM Z;  2E2H I;  4MXU A;  5T6B A;  3ESW A;  2RIQ A;  5C44 I;  3GTM I;  2OTJ Z;  3GTP I;  4NBF A;  3G71 Z;  2F4O A;  3T4N B;  3J7A 4;  1Q86 1;  1Q7Y 1;  2LIY A;  3PO2 I;  2M48 A;  1VQ8 Z;  3CCM Z;  2JR6 A;  2R6M A;  1YJW 1;  3D6W A;  1TWF I;  3IR7 A;  2AYD A;  4DGL A;  3LUS A;  1W2B Z;  3HOZ I;  3GTM S;  3CCR Z;  1USP B;  3G6E Z;  3CC2 Z;  1K9M 2;  1VQ5 Z;  5FLX f;  3RZD I;  4A3D I;  4E32 A;  3H0G I;  1QYP A;  2R92 I;  2DE5 A;  1KC8 2;  4A3I I;  1VQL 1;  2B63 I;  3NDJ A;  3CC4 Z;  2JIO A;  1VQP Z;  1Q16 A;  1TWG I;  1N8R 1;  3I56 1;  5A2Q f;  4HH4 A;  1M1K 1;  1VQ4 1;  2F4M A;  4A3F I;  5FLX b;  3CCV 1;  3S1R I;  5T67 A;  2QR1 B;  2DE7 A;  4NBD A;  3VTN A;  5T64 A;  4A3E I;  3OW2 Y;  5IT9 f;  3S1M I;  2OTL Z;  2K5R A;  2JIQ A;  1TFI A;  5A2Q b;  1Y1V I;  1X0T A;  1VQ9 1;  4BBS I;  2VPZ A;  3CCE Z;  2LEX A;  1K73 2;  1I6H I;  1VQ7 Z;  3GKQ A;  4A3J I;  4RVH A;  1AA6 A;  2IZ4 A;  3VMG A;  2E2J I;  3HOX I;  3PO3 S;  5IT9 b;  2IZ3 A;  1K9M 1;  3IF8 A;  5D1O A;  3VMI A;  1JJ2 Z;  1KRL A;  1N2F A;  2VF1 A;  1QVF Z;  1ZH1 A;  2NVX I;  1R9T I;  1YI2 Z;  3CME Z;  4E30 A;  3GTL I;  4RS4 A;  1I50 I;  2E9H A;  3NH8 A;  3CPW Z;  2DE6 A;  3CCM 1;  1WII A;  2RPR A;  4Y7N I;  4DQY B;  3HKZ A;  1Z02 A;  3BG0 B;  3CMA Z;  3CC2 1;  4BY1 I;  1KQS Y;  3NDI A;  3G4S 1;  1M90 2;  4MD9 A;  2JA7 I;  4E2Z A;  5LL6 f;  2QRD B;  2H85 A;  4NBE A;  3CD6 Z;  3CCU Z;  2G2K A;  2QEX Z;  1YHQ Z;  1NP6 A;  1S72 Z;  4MH4 A;  1QVG Y;  3S1Q I;  3Q87 A;  2JUB A;  3GTQ I;  3M4O I;  1YUA A;  3IX0 A;  2QRC B;  4RVF A;  2JIR A;  2QA4 1;  3I4M I;  1VQO Z;  1YIJ 1;  2GTH A;  3HOU I;  3NH4 A;  3CC7 Z;  2OTL 1;  1QF8 A;  4XX2 A;  1S7M A;  1Q81 2;  1Q82 1;  4MD7 A;  3KIF A;  5D1O B;  4A3G I;  3CXC Z;  1RNI A;  1QXF A;  3I55 Z;  5IP9 I;  2V8K A;  3S2H I;  4RVG A;  2O4H A;  5CM2 M;  3P5J B;  4NFR A;  1VQ7 1;  1L1O C;  1YIT 1;  3J80 f;  3J81 f;  3KIH A;  1X3W A;  2BJO A;  2KI7 B;  1RO2 A;  1LQL A;  1K8A 2;  1K83 I;  3PO3 I;  1ML8 A;  4HGY A;  4CL1 A;  3S14 I;  1ZB8 A;  4NBG A;  2KPI A;  1WCM I;  3I4N I;  2LFU A;  4QTT A;  1YJ9 Z;  4MRI A;  3J80 b;  3J81 b;  3CQZ I;  1YI2 1;  2E2I I;  2GU2 A;  1X3Z A;  2OZK A;  2QKD A;  2JIM A;  3MZL B;  1SIW A;  1YUK A;  3CCJ 1;  2VPX A;  4AYB A;  5D1P A;  3EER A;  4BXX I;  3FQM A;  2VUM I;  4QTU A;  3NH5 A;  4BBR I;  2I3C A;  1VQM 1;  1Q86 2;  3H3V J;  2WB1 A;  3CCS Z;  1VQL Z;  3CMA 1;  2NVY I;  4BY7 I;  2OTJ 1;  1Q7Y 2;  2Q51 A;  1SFO I;  2QLV B;  2JA8 I;  3D9X A;  2VPW A;  3G71 1;  4A3K I;  1YJN Z;  1NJI 2;  1USP A;  1WZN A;  4RVD A;  1FDI A;  1VQ4 Z;  1KC8 1;  4S1T A;  2JNY A;  3CCV Z;  1VQK Z;  1ZB9 A;  2AKL A;  2K3R A;  4NH1 C;  5C4J I;  2W03 A;  3U50 C;  3CD6 1;  2HU9 A;  2R7Z I;  1VQ8 1;  1FDO A;  4NB9 A;  4E2W A;  4NBH A;  3EED A;  1I3Q I;  1DL6 A;  1RQF A;  3CCR 1;  1RLY A;  3G6E 1;  2WAQ A;  4EWC A;  1VQ5 1;  2HF1 A;  2J6A A;  3M3Y I;  1VQ9 Z;  2PMZ A;  3IFU A;  1VQO 1;  1N8R 2;  4MD8 A;  3CCL Z;  1Z01 A;  1WW9 A;  2M6N A;  3GCF A;  2OOY B;  4NB8 A;  1KQS Z;  3CC4 1;  3I55 1;  1TWA I;  1VQP 1;  1PFT A;  3S2D I;  4X6A I;  1K73 1;  1RO0 A;  2RT9 A;  5AN9 F;  4A3L I;  5C4X I;  4E33 A;  4NBC A;  1NUI A;  2QRE B;  4A3C I;  1QVG Z;  4A93 I;  4TNU A;  1VQN Z;  3F3F C;  1VQ6 Z;  2JA6 I;  1W2B Y;  2RHB A;  4DK1 A;  3FQQ A;  1NJI 1;  2P28 A;  1YJ9 1;  4NBB A;  3K7A I;  2Y0S A;  2YU9 I;  3CCQ Z;  3CCE 1;  1Y8C A;  2JMO A;  3D2L A;  4E31 A;  2NAP A;  3CXC Y;  4E2Y A;  2GTI A;  4NBA A;  2VPY A;  3G4S Z;  3GTK I;  3CCS 1;  3MZK B;  3BG1 B;  4E2X A;  1WJ2 A;  2YAD A;  3S17 I;  5FLM I;  2JS4 A;  5IP7 I;  2O53 A;  1YJN 1;  2ZAE B;  2IV2 X;  1M90 1;  1RO4 A;  1YJW Z;  1VLA A;  3RZO I;  3F3P C;  1VQK 1;  1KD1 2;  2PK7 A;  3CME 1;  2V8I A;  3OW2 Z;  4NOZ A;  3JAM f;  3NFZ A;  3TE5 B;  3VB9 A;  3S15 I;  2QA4 Z;  3QWU A;  1YIJ Z;  3TDH B;  4A3B I;  2JA5 I;  3S1N I;  3GTO I;  2NVT I;  2Q4Z A;  2W04 A;  1Z03 A;  2R93 I;  3I56 Z;  3CCL 1;  3JAM b;  1TWC I;  3GTG I;  1YIT Z;  2V8J A;  2VUG A;  2JIP A;  1Q81 1;  3I07 A;  1TWH I;  1Y1W I;  2PM9 A;  4RV9 A;  1JJ2 Y;  5C3E I;  2NVQ I;  4HGZ A;  2P3Y A;  4Y52 I;  4MON A;  3CCU 1;  2E7Z A;  1QVF Y;  2QEX 1;  1YHQ 1;  1S72 1;  3HOY I;  3HOW I;  2RBL A;  3FKI I;  1Q82 2;  1Y1V S;  3CPW Y;  1K8A 1;  3HOV I; 
#chains in the Genus database with same CATH homology
 1JWH C;  1VQN 1;  1VQ6 1;  1P9N A;  1M1K 2;  3CCJ Z;  3MON A;  2EGT A;  3CC7 1;  4A3M I;  3S16 I;  3GTJ I;  2OOX B;  3VMH A;  1KD1 1;  3CCQ 1;  2E2H I;  1VQM Z;  4MXU A;  5T6B A;  3ESW A;  2RIQ A;  5C44 I;  3GTM I;  2OTJ Z;  3GTP I;  4NBF A;  3G71 Z;  2F4O A;  3T4N B;  3J7A 4;  1Q86 1;  1Q7Y 1;  2LIY A;  3PO2 I;  2M48 A;  1VQ8 Z;  3CCM Z;  2JR6 A;  2R6M A;  1YJW 1;  3D6W A;  1TWF I;  4DGL A;  3LUS A;  1W2B Z;  3HOZ I;  3GTM S;  3CCR Z;  1USP B;  3G6E Z;  3CC2 Z;  1K9M 2;  1VQ5 Z;  5FLX f;  3RZD I;  4A3D I;  4E32 A;  3H0G I;  1QYP A;  2R92 I;  2DE5 A;  1KC8 2;  4A3I I;  1VQL 1;  2B63 I;  3NDJ A;  3CC4 Z;  1VQP Z;  1TWG I;  1N8R 1;  3I56 1;  5A2Q f;  4HH4 A;  1M1K 1;  1VQ4 1;  2F4M A;  4A3F I;  5FLX b;  3CCV 1;  3S1R I;  5T67 A;  2QR1 B;  2DE7 A;  4NBD A;  3VTN A;  5T64 A;  4A3E I;  3OW2 Y;  5IT9 f;  3S1M I;  2OTL Z;  2K5R A;  1TFI A;  5A2Q b;  1Y1V I;  1X0T A;  1VQ9 1;  4BBS I;  3CCE Z;  1K73 2;  1I6H I;  1VQ7 Z;  3GKQ A;  4A3J I;  4RVH A;  2IZ4 A;  3VMG A;  2E2J I;  3HOX I;  3PO3 S;  5IT9 b;  2IZ3 A;  1K9M 1;  3IF8 A;  5D1O A;  3VMI A;  1JJ2 Z;  1KRL A;  1N2F A;  2VF1 A;  1QVF Z;  1ZH1 A;  2NVX I;  1R9T I;  1YI2 Z;  3CME Z;  4E30 A;  3GTL I;  4RS4 A;  1I50 I;  2E9H A;  3NH8 A;  3CPW Z;  2DE6 A;  3CCM 1;  1WII A;  2RPR A;  4Y7N I;  4DQY B;  3HKZ A;  1Z02 A;  3BG0 B;  3CMA Z;  3CC2 1;  4BY1 I;  1KQS Y;  3NDI A;  3G4S 1;  1M90 2;  4MD9 A;  2JA7 I;  4E2Z A;  5LL6 f;  2QRD B;  2H85 A;  4NBE A;  3CD6 Z;  3CCU Z;  2G2K A;  2QEX Z;  1YHQ Z;  1NP6 A;  1S72 Z;  4MH4 A;  1QVG Y;  3S1Q I;  3Q87 A;  2JUB A;  3GTQ I;  3M4O I;  1YUA A;  3IX0 A;  2QRC B;  4RVF A;  2QA4 1;  3I4M I;  1VQO Z;  1YIJ 1;  2GTH A;  3HOU I;  3NH4 A;  3CC7 Z;  2OTL 1;  1QF8 A;  4XX2 A;  1S7M A;  1Q81 2;  1Q82 1;  4MD7 A;  3KIF A;  5D1O B;  4A3G I;  3CXC Z;  1RNI A;  3I55 Z;  5IP9 I;  2V8K A;  3S2H I;  4RVG A;  2O4H A;  5CM2 M;  3P5J B;  4NFR A;  1VQ7 1;  1L1O C;  1YIT 1;  3J80 f;  3J81 f;  3KIH A;  1X3W A;  2BJO A;  2KI7 B;  1RO2 A;  1LQL A;  1K8A 2;  1K83 I;  3PO3 I;  1ML8 A;  4HGY A;  4CL1 A;  3S14 I;  1ZB8 A;  4NBG A;  2KPI A;  1WCM I;  3I4N I;  2LFU A;  4QTT A;  1YJ9 Z;  4MRI A;  3J80 b;  3J81 b;  3CQZ I;  1YI2 1;  2E2I I;  2GU2 A;  1X3Z A;  2OZK A;  2QKD A;  3MZL B;  1YUK A;  3CCJ 1;  4AYB A;  5D1P A;  3EER A;  4BXX I;  3FQM A;  2VUM I;  4QTU A;  3NH5 A;  4BBR I;  2I3C A;  1VQM 1;  1Q86 2;  3H3V J;  2WB1 A;  3CCS Z;  1VQL Z;  3CMA 1;  2NVY I;  4BY7 I;  2OTJ 1;  1Q7Y 2;  2Q51 A;  1SFO I;  2QLV B;  2JA8 I;  3D9X A;  3G71 1;  4A3K I;  1YJN Z;  1NJI 2;  1USP A;  4RVD A;  1VQ4 Z;  1KC8 1;  4S1T A;  2JNY A;  3CCV Z;  1VQK Z;  1ZB9 A;  2AKL A;  2K3R A;  4NH1 C;  5C4J I;  2W03 A;  3U50 C;  3CD6 1;  2HU9 A;  2R7Z I;  1VQ8 1;  4NB9 A;  4E2W A;  4NBH A;  3EED A;  1I3Q I;  1DL6 A;  1RQF A;  3CCR 1;  1RLY A;  3G6E 1;  2WAQ A;  4EWC A;  1VQ5 1;  2HF1 A;  2J6A A;  3M3Y I;  1VQ9 Z;  2PMZ A;  3IFU A;  1VQO 1;  1N8R 2;  4MD8 A;  3CCL Z;  1Z01 A;  1WW9 A;  2M6N A;  3GCF A;  2OOY B;  4NB8 A;  1KQS Z;  3CC4 1;  3I55 1;  1TWA I;  1VQP 1;  1PFT A;  3S2D I;  4X6A I;  1K73 1;  1RO0 A;  2RT9 A;  5AN9 F;  4A3L I;  5C4X I;  4E33 A;  4NBC A;  1NUI A;  2QRE B;  4A3C I;  1QVG Z;  4A93 I;  4TNU A;  1VQN Z;  3F3F C;  1VQ6 Z;  2JA6 I;  1W2B Y;  2RHB A;  4DK1 A;  3FQQ A;  1NJI 1;  2P28 A;  1YJ9 1;  4NBB A;  3K7A I;  2Y0S A;  2YU9 I;  3CCQ Z;  3CCE 1;  2JMO A;  4E31 A;  3CXC Y;  4E2Y A;  2GTI A;  4NBA A;  3G4S Z;  3GTK I;  3CCS 1;  3MZK B;  3BG1 B;  4E2X A;  2YAD A;  3S17 I;  5FLM I;  2JS4 A;  5IP7 I;  2O53 A;  1YJN 1;  2ZAE B;  1M90 1;  1RO4 A;  1YJW Z;  1VLA A;  3RZO I;  3F3P C;  1VQK 1;  1KD1 2;  2PK7 A;  3CME 1;  2V8I A;  3OW2 Z;  4NOZ A;  3JAM f;  3NFZ A;  3TE5 B;  3VB9 A;  3S15 I;  2QA4 Z;  3QWU A;  1YIJ Z;  3TDH B;  4A3B I;  2JA5 I;  3S1N I;  3GTO I;  2NVT I;  2Q4Z A;  2W04 A;  1Z03 A;  2R93 I;  3I56 Z;  3CCL 1;  3JAM b;  1TWC I;  3GTG I;  1YIT Z;  2V8J A;  2VUG A;  1Q81 1;  3I07 A;  1TWH I;  1Y1W I;  2PM9 A;  4RV9 A;  1JJ2 Y;  5C3E I;  2NVQ I;  4HGZ A;  2P3Y A;  4Y52 I;  4MON A;  3CCU 1;  1QVF Y;  2QEX 1;  1YHQ 1;  1S72 1;  3HOY I;  3HOW I;  2RBL A;  3FKI I;  1Q82 2;  1Y1V S;  3CPW Y;  1K8A 1;  3HOV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...