1M901

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m90100
1VQ8Z 1VQM1 3CCU1 1Q7Y2 1S721 3CCUZ 1YJW1 3I551 3G4S1 1Q812 1S72Z 1YJWZ 3CME1 3I55Z 3G4SZ 3CC41 1K9M1 1VQN1 1VQL1 1NJI1 1VQNZ 1VQ91 2OTL1 1N8R2 1W2BY 3CXCY 1QVGY 3CXCZ 1VQ9Z 1QVGZ 1K732 2OTLZ 3CPWZ 1YHQ1 3CPWY 1VQ61 1YI21 1KD11 1VQ6Z 3CCM1 1YIJ1 1VQ41 1YI2Z 1VQ71 3CCMZ 1JJ2Y 1VQ4Z 3CCR1 1VQK1 1VQ7Z 3CCRZ 1VQKZ 1M1K2 3CCS1 1KC81 3G6E1 1Q861 1NJI2 3CCSZ 1VQO1 3G6EZ 3CCJ1 1VQOZ 1KQSY 3CCJZ 3CCV1 1YJN1 1KQSZ 1K8A1 3CMA1 3CCVZ 1YJNZ 3CMAZ 2QEX1 1W2BZ 3I561 2QEXZ 3CCQZ 3CCE1 3I56Z 1M901 1YJ91 3CCEZ 1JJ2Z 1YITZ 1YJ9Z 1K9M2 1VQP1 1Q821 1QVFY 1Q7Y1 3G711 1VQPZ 1Q811 3G71Z 1KD12 3OW2Y 3OW2Z 3CC21 3CCQ1 1N8R1 3CD61 3CC2Z 1K731 3CD6Z 1VQ51 1KC82 1Q862 1YIT1 1VQ5Z 1Q822 1VQMZ 3CC71 2QA41 2OTJ1 1M1K1 3CCL1 1K8A2 3CC7Z 3CMEZ 2QA4Z 2OTJZ 3CCLZ 3CC4Z 1QVFZ 1VQLZ 1M902 1YHQZ 1YIJZ 1VQ81
chains in the Genus database with same CATH superfamily
1TWHI 1ZB8A 1TFIA 4E2XA 1Q7Y2 1S721 3CCUZ 2JR6A 4A93I 3I551 1Q812 4E2WA 1I3QI 1YJWZ 3CME1 2OOXB 3G4SZ 3J7A4 1K9M1 1VQNZ 2OTL1 2E9HA 4TNUA 2E2JI 2JUBA 4DGLA 3CXCZ 3CPWY 1VQ61 4A3JI 2V8KA 3CCM1 1VQ41 3GTQI 1TWFI 3GTKI 2H85A 1Y1VI 3GTPI 3NH4A 1K83I 4Y52I 1NP6A 2V8IA 2JA5I 1SFOI 2VUMI 3BG1B 1KQSZ 2O53A 3KIFA 3J80f 3CMA1 5FLXf 2JMOA 3VTNA 3GTGI 4NBAA 1W2BZ 3F3FC 3S17I 2BJOA 2GTIA 1YUKA 4A3CI 3I56Z 1YUAA 4BXXI 5T67A 1YJ91 1JWHC 3FKII 3P5JB 3NH5A 3GTLI 4E33A 1RLYA 3JAMb 4A3II 1NUIA 2DE7A 3RZDI 5T64A 3J81b 1VQP1 2WAQA 5CM2M 4AYBA 1KD12 2F4MA 3OW2Z 2AKLA 3CC21 2GU2A 3HOZI 5T6BA 3PO3I 3CD6Z 4A3GI 1Q862 1Q822 4DQYB 4RVDA 2P28A 3I07A 4RVHA 3Q87A 1WZNA 3HOVI 3EERA 3H0GI 3T4NB 3CC7Z 2QA4Z 2R92I 3CCLZ 4EWCA 4E30A 2Q4ZA 3IX0A 1LQLA 1N2FA 4NH1C 1RNIA 2OOYB 2VUGA 2IZ4A 1FDIA 2K3RA 3GTMI 4A3BI 4NBBA 2QREB 1Z01A 2NVYI 1I50I 2NVQI 1S72Z 4NB9A 3TDHB 3I55Z 3IF8A 3NDIA 3S1MI 1Y8CA 2PM9A 4MH4A 2Q51A 1W2BY 1QVGZ 2OTLZ 3NDJA 1KRLA 1PFTA 1VQ6Z 2P3YA 3CCMZ 1VQ4Z 2W03A 3CCR1 1VQK1 2JS4A 3ESWA 5LL6f 4HGYA 3CCS1 1KC81 3G6E1 1VQO1 2QRCB 3MZLB 3CCJ1 2E2HI 3S14I 2DE6A 4XX2A 3GKQA 3S1RI 1X0TA 2VPXA 3PO2I 2QLVB 1P9NA 3CMAZ 2QEX1 4E31A 5FLXb 3CCE1 1TWCI 4Y7NI 2RT9A 5D1OB 5FLMI 4HH4A 5AN9F 2OZKA 4MRIA 1YJ9Z 2JIRA 1Q7Y1 1ZB9A 3G711 1VQPZ 4MONA 1Q811 3CQZI 1Y1VS 4MD8A 1FDOA 3S2DI 3S15I 3S1QI 3CC2Z 1AA6A 2QKDA 3GCFA 3HOWI 2V3VA 2VPYA 3MONA 2RBLA 1K8A2 5IT9f 2NVTI 3EEDA 4NB8A 3CC4Z 1QVFZ 4QTTA 4MXUA 1VQLZ 5C44I 1WCMI 1USPA 2HF1A 1M902 1YHQZ 3IR7A 1QXFA 2PK7A 3FQQA 1YIJZ 1VQ81 2JIMA 1TWAI 2JNYA 3S1NI 2F4OA 2JA7I 3CC41 2RHBA 2LIYA 1VQL1 1NJI1 1VQ91 3PO3S 1N8R2 1RO4A 3CXCY 1R9TI 4MD7A 1K732 3CPWZ 1YHQ1 5C3EI 1YI21 3VMHA 3GTJI 1KD11 1YIJ1 3U50C 1VQ71 4RVGA 1RO0A 4HGZA 3CCRZ 1VQKZ 1WIIA 1M1K2 4BY1I 2I3CA 3TE5B 1Q861 3CCSZ 2LEXA 3G6EZ 1X3WA 1VQOZ 2ZAEB 2HU9A 1KQSY 3CCJZ 3CCV1 1YJN1 2GTHA 2JA6I 2RPRA 4RVFA 2R93I 3GTMS 1ML8A 3RZOI 2QEXZ 3HKZA 3CCQZ 4A3KI 2E2II 1Y1WI 5A2Qf 3CCEZ 1JJ2Z 1X3ZA 1YITZ 1Q16A 1K9M2 3M4OI 1USPB 1Z02A 4X6AI 1Z03A 1QF8A 1QVFY 3G71Z 4A3MI 3OW2Y 2K5RA 4BY7I 2W04A 2VPWA 2JIPA 3CCQ1 3J80b 1VQ51 4NBCA 2R7ZI 3K7AI 1S7MA 1YIT1 2B63I 3I4NI 1VQMZ 2YU9I 3S16I 2JA8I 2OTJ1 2DE5A 5IT9b 4RS4A 3HOUI 4A3EI 4BBSI 4S1TA 1WJ2A 3VMGA 1VQ8Z 1VQM1 3LUSA 3CCU1 2Y0SA 2YADA 1TWGI 2KPIA 1YJW1 4NBDA 3VB9A 3G4S1 1DL6A 2AYDA 1WW9A 4NBHA 1VQN1 2V8JA 2EGTA 2NAPA 4E32A 1QVGY 2M48A 1VQ9Z 3M3YI 1YI2Z 2JIOA 1JJ2Y 1VQ7Z 4BBRI 4NBGA 2O4HA 5C4JI 3HOXI 2WB1A 1NJI2 2QRDB 4NBFA 1ZH1A 3KIHA 2J6AA 1RO2A 3VMIA 1K8A1 3I4MI 3CCVZ 1QYPA 1YJNZ 2VF1A 3FQMA 3D9XA 4E2YA 5IP9I 3I561 3BG0B 2QR1B 1M901 3JAMf 2NVXI 2V45A 4A3DI 3J81f 2LFUA 5A2Qb 4NBEA 5D1OA 1Q821 1I6HI 3HOYI 3F3PC 3NFZA 1SIWA 5C4XI 3NH8A 3GTOI 4RV9A 5D1PA 3H3VJ 2JIQA 3S2HI 3QWUA 4NOZA 1N8R1 3CD61 2M6NA 3IFUA 4DK1A 1K731 1KC82 4NFRA 1RQFA 1VQ5Z 2G2KA 2KI7B 4QTUA 4CL1A 4E2ZA 3D2LA 2E7ZA 3D6WA 4MD9A 2IZ3A 4A3LI 3CC71 2QA41 1VLAA 2RIQA 1M1K1 2VPZA 3CCL1 1L1OC 3CMEZ 4A3FI 2OTJZ 2IV2X 3MZKB 2R6MA 2PMZA 5IP7I
chains in the Genus database with same CATH topology
1TWHI 1ZB8A 1TFIA 4E2XA 1Q7Y2 1S721 3CCUZ 2JR6A 4A93I 3I551 1Q812 4E2WA 1I3QI 1YJWZ 3CME1 2OOXB 3G4SZ 3J7A4 1K9M1 1VQNZ 2OTL1 2E9HA 4TNUA 2E2JI 2JUBA 4DGLA 3CXCZ 3CPWY 1VQ61 4A3JI 2V8KA 3CCM1 1VQ41 3GTQI 1TWFI 3GTKI 2H85A 1Y1VI 3GTPI 3NH4A 1K83I 4Y52I 1NP6A 2V8IA 2JA5I 1SFOI 2VUMI 3BG1B 1KQSZ 2O53A 3KIFA 3J80f 3CMA1 5FLXf 2JMOA 3VTNA 3GTGI 4NBAA 1W2BZ 3F3FC 3S17I 2BJOA 2GTIA 1YUKA 4A3CI 3I56Z 1YUAA 4BXXI 5T67A 1YJ91 1JWHC 3FKII 3P5JB 3NH5A 3GTLI 4E33A 1RLYA 3JAMb 4A3II 1NUIA 2DE7A 3RZDI 5T64A 3J81b 1VQP1 2WAQA 5CM2M 4AYBA 1KD12 2F4MA 3OW2Z 2AKLA 3CC21 2GU2A 3HOZI 5T6BA 3PO3I 3CD6Z 4A3GI 1Q862 1Q822 4DQYB 4RVDA 2P28A 3I07A 4RVHA 3Q87A 3HOVI 3EERA 3H0GI 3T4NB 3CC7Z 2QA4Z 2R92I 3CCLZ 4EWCA 4E30A 2Q4ZA 3IX0A 1LQLA 1N2FA 4NH1C 1RNIA 2OOYB 2VUGA 2IZ4A 2K3RA 3GTMI 4A3BI 4NBBA 2QREB 1Z01A 2NVYI 1I50I 2NVQI 1S72Z 4NB9A 3TDHB 3I55Z 3IF8A 3NDIA 3S1MI 2PM9A 4MH4A 2Q51A 1W2BY 1QVGZ 2OTLZ 3NDJA 1KRLA 1PFTA 1VQ6Z 2P3YA 3CCMZ 1VQ4Z 2W03A 3CCR1 1VQK1 2JS4A 3ESWA 5LL6f 4HGYA 3CCS1 1KC81 3G6E1 1VQO1 2QRCB 3MZLB 3CCJ1 2E2HI 3S14I 2DE6A 4XX2A 3GKQA 3S1RI 1X0TA 3PO2I 2QLVB 1P9NA 3CMAZ 2QEX1 4E31A 5FLXb 3CCE1 1TWCI 4Y7NI 2RT9A 5D1OB 5FLMI 4HH4A 5AN9F 2OZKA 4MRIA 1YJ9Z 1Q7Y1 1ZB9A 3G711 1VQPZ 4MONA 1Q811 3CQZI 1Y1VS 4MD8A 3S2DI 3S15I 3S1QI 3CC2Z 2QKDA 3GCFA 3HOWI 3MONA 2RBLA 1K8A2 5IT9f 2NVTI 3EEDA 4NB8A 3CC4Z 1QVFZ 4QTTA 4MXUA 1VQLZ 5C44I 1WCMI 1USPA 2HF1A 1M902 1YHQZ 2PK7A 3FQQA 1YIJZ 1VQ81 1TWAI 2JNYA 3S1NI 2F4OA 2JA7I 3CC41 2RHBA 2LIYA 1VQL1 1NJI1 1VQ91 3PO3S 1N8R2 1RO4A 3CXCY 1R9TI 4MD7A 1K732 3CPWZ 1YHQ1 5C3EI 1YI21 3VMHA 3GTJI 1KD11 1YIJ1 3U50C 1VQ71 4RVGA 1RO0A 4HGZA 3CCRZ 1VQKZ 1WIIA 1M1K2 4BY1I 2I3CA 3TE5B 1Q861 3CCSZ 3G6EZ 1X3WA 1VQOZ 2ZAEB 2HU9A 1KQSY 3CCJZ 3CCV1 1YJN1 2GTHA 2JA6I 2RPRA 4RVFA 2R93I 3GTMS 1ML8A 3RZOI 2QEXZ 3HKZA 3CCQZ 4A3KI 2E2II 1Y1WI 5A2Qf 3CCEZ 1JJ2Z 1X3ZA 1YITZ 1K9M2 3M4OI 1USPB 1Z02A 4X6AI 1Z03A 1QF8A 1QVFY 3G71Z 4A3MI 3OW2Y 2K5RA 4BY7I 2W04A 3CCQ1 3J80b 1VQ51 4NBCA 2R7ZI 3K7AI 1S7MA 1YIT1 2B63I 3I4NI 1VQMZ 2YU9I 3S16I 2JA8I 2OTJ1 2DE5A 5IT9b 4RS4A 3HOUI 4A3EI 4BBSI 4S1TA 3VMGA 1VQ8Z 1VQM1 3LUSA 3CCU1 2Y0SA 2YADA 1TWGI 2KPIA 1YJW1 4NBDA 3VB9A 3G4S1 1DL6A 1WW9A 4NBHA 1VQN1 2V8JA 2EGTA 4E32A 1QVGY 2M48A 1VQ9Z 3M3YI 1YI2Z 1JJ2Y 1VQ7Z 4BBRI 4NBGA 2O4HA 5C4JI 3HOXI 2WB1A 1NJI2 2QRDB 4NBFA 1ZH1A 3KIHA 2J6AA 1RO2A 3VMIA 1K8A1 3I4MI 3CCVZ 1QYPA 1YJNZ 2VF1A 3FQMA 3D9XA 4E2YA 5IP9I 3I561 3BG0B 2QR1B 1M901 3JAMf 2NVXI 4A3DI 3J81f 2LFUA 5A2Qb 4NBEA 5D1OA 1Q821 1I6HI 3HOYI 3F3PC 3NFZA 5C4XI 3NH8A 3GTOI 4RV9A 5D1PA 3H3VJ 3S2HI 3QWUA 4NOZA 1N8R1 3CD61 2M6NA 3IFUA 4DK1A 1K731 1KC82 4NFRA 1RQFA 1VQ5Z 2G2KA 2KI7B 4QTUA 4CL1A 4E2ZA 3D6WA 4MD9A 2IZ3A 4A3LI 3CC71 2QA41 1VLAA 2RIQA 1M1K1 3CCL1 1L1OC 3CMEZ 4A3FI 2OTJZ 3MZKB 2R6MA 2PMZA 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 Z;  1VQM 1;  3CCU 1;  1Q7Y 2;  1S72 1;  3CCU Z;  1YJW 1;  3I55 1;  3G4S 1;  1Q81 2;  1S72 Z;  1YJW Z;  3CME 1;  3I55 Z;  3G4S Z;  3CC4 1;  1K9M 1;  1VQN 1;  1VQL 1;  1NJI 1;  1VQN Z;  1VQ9 1;  2OTL 1;  1N8R 2;  1W2B Y;  3CXC Y;  1QVG Y;  3CXC Z;  1VQ9 Z;  1QVG Z;  1K73 2;  2OTL Z;  3CPW Z;  1YHQ 1;  3CPW Y;  1VQ6 1;  1YI2 1;  1KD1 1;  1VQ6 Z;  3CCM 1;  1YIJ 1;  1VQ4 1;  1YI2 Z;  1VQ7 1;  3CCM Z;  1JJ2 Y;  1VQ4 Z;  3CCR 1;  1VQK 1;  1VQ7 Z;  3CCR Z;  1VQK Z;  1M1K 2;  3CCS 1;  1KC8 1;  3G6E 1;  1Q86 1;  1NJI 2;  3CCS Z;  1VQO 1;  3G6E Z;  3CCJ 1;  1VQO Z;  1KQS Y;  3CCJ Z;  3CCV 1;  1YJN 1;  1KQS Z;  1K8A 1;  3CMA 1;  3CCV Z;  1YJN Z;  3CMA Z;  2QEX 1;  1W2B Z;  3I56 1;  2QEX Z;  3CCQ Z;  3CCE 1;  3I56 Z;  1M90 1;  1YJ9 1;  3CCE Z;  1JJ2 Z;  1YIT Z;  1YJ9 Z;  1K9M 2;  1VQP 1;  1Q82 1;  1QVF Y;  1Q7Y 1;  3G71 1;  1VQP Z;  1Q81 1;  3G71 Z;  1KD1 2;  3OW2 Y;  3OW2 Z;  3CC2 1;  3CCQ 1;  1N8R 1;  3CD6 1;  3CC2 Z;  1K73 1;  3CD6 Z;  1VQ5 1;  1KC8 2;  1Q86 2;  1YIT 1;  1VQ5 Z;  1Q82 2;  1VQM Z;  3CC7 1;  2QA4 1;  2OTJ 1;  1M1K 1;  3CCL 1;  1K8A 2;  3CC7 Z;  3CME Z;  2QA4 Z;  2OTJ Z;  3CCL Z;  3CC4 Z;  1QVF Z;  1VQL Z;  1M90 2;  1YHQ Z;  1YIJ Z;  1VQ8 1; 
#chains in the Genus database with same CATH topology
 1TWH I;  1ZB8 A;  1TFI A;  4E2X A;  1Q7Y 2;  1S72 1;  3CCU Z;  2JR6 A;  4A93 I;  3I55 1;  1Q81 2;  4E2W A;  1I3Q I;  1YJW Z;  3CME 1;  2OOX B;  3G4S Z;  3J7A 4;  1K9M 1;  1VQN Z;  2OTL 1;  2E9H A;  4TNU A;  2E2J I;  2JUB A;  4DGL A;  3CXC Z;  3CPW Y;  1VQ6 1;  4A3J I;  2V8K A;  3CCM 1;  1VQ4 1;  3GTQ I;  1TWF I;  3GTK I;  2H85 A;  1Y1V I;  3GTP I;  3NH4 A;  1K83 I;  4Y52 I;  1NP6 A;  2V8I A;  2JA5 I;  1SFO I;  2VUM I;  3BG1 B;  1KQS Z;  2O53 A;  3KIF A;  3J80 f;  3CMA 1;  5FLX f;  2JMO A;  3VTN A;  3GTG I;  4NBA A;  1W2B Z;  3F3F C;  3S17 I;  2BJO A;  2GTI A;  1YUK A;  4A3C I;  3I56 Z;  1YUA A;  4BXX I;  5T67 A;  1YJ9 1;  1JWH C;  3FKI I;  3P5J B;  3NH5 A;  3GTL I;  4E33 A;  1RLY A;  3JAM b;  4A3I I;  1NUI A;  2DE7 A;  3RZD I;  5T64 A;  3J81 b;  1VQP 1;  2WAQ A;  5CM2 M;  4AYB A;  1KD1 2;  2F4M A;  3OW2 Z;  2AKL A;  3CC2 1;  2GU2 A;  3HOZ I;  5T6B A;  3PO3 I;  3CD6 Z;  4A3G I;  1Q86 2;  1Q82 2;  4DQY B;  4RVD A;  2P28 A;  3I07 A;  4RVH A;  3Q87 A;  1WZN A;  3HOV I;  3EER A;  3H0G I;  3T4N B;  3CC7 Z;  2QA4 Z;  2R92 I;  3CCL Z;  4EWC A;  4E30 A;  2Q4Z A;  3IX0 A;  1LQL A;  1N2F A;  4NH1 C;  1RNI A;  2OOY B;  2VUG A;  2IZ4 A;  1FDI A;  2K3R A;  3GTM I;  4A3B I;  4NBB A;  2QRE B;  1Z01 A;  2NVY I;  1I50 I;  2NVQ I;  1S72 Z;  4NB9 A;  3TDH B;  3I55 Z;  3IF8 A;  3NDI A;  3S1M I;  1Y8C A;  2PM9 A;  4MH4 A;  2Q51 A;  1W2B Y;  1QVG Z;  2OTL Z;  3NDJ A;  1KRL A;  1PFT A;  1VQ6 Z;  2P3Y A;  3CCM Z;  1VQ4 Z;  2W03 A;  3CCR 1;  1VQK 1;  2JS4 A;  3ESW A;  5LL6 f;  4HGY A;  3CCS 1;  1KC8 1;  3G6E 1;  1VQO 1;  2QRC B;  3MZL B;  3CCJ 1;  2E2H I;  3S14 I;  2DE6 A;  4XX2 A;  3GKQ A;  3S1R I;  1X0T A;  2VPX A;  3PO2 I;  2QLV B;  1P9N A;  3CMA Z;  2QEX 1;  4E31 A;  5FLX b;  3CCE 1;  1TWC I;  4Y7N I;  2RT9 A;  5D1O B;  5FLM I;  4HH4 A;  5AN9 F;  2OZK A;  4MRI A;  1YJ9 Z;  2JIR A;  1Q7Y 1;  1ZB9 A;  3G71 1;  1VQP Z;  4MON A;  1Q81 1;  3CQZ I;  1Y1V S;  4MD8 A;  1FDO A;  3S2D I;  3S15 I;  3S1Q I;  3CC2 Z;  1AA6 A;  2QKD A;  3GCF A;  3HOW I;  2V3V A;  2VPY A;  3MON A;  2RBL A;  1K8A 2;  5IT9 f;  2NVT I;  3EED A;  4NB8 A;  3CC4 Z;  1QVF Z;  4QTT A;  4MXU A;  1VQL Z;  5C44 I;  1WCM I;  1USP A;  2HF1 A;  1M90 2;  1YHQ Z;  3IR7 A;  1QXF A;  2PK7 A;  3FQQ A;  1YIJ Z;  1VQ8 1;  2JIM A;  1TWA I;  2JNY A;  3S1N I;  2F4O A;  2JA7 I;  3CC4 1;  2RHB A;  2LIY A;  1VQL 1;  1NJI 1;  1VQ9 1;  3PO3 S;  1N8R 2;  1RO4 A;  3CXC Y;  1R9T I;  4MD7 A;  1K73 2;  3CPW Z;  1YHQ 1;  5C3E I;  1YI2 1;  3VMH A;  3GTJ I;  1KD1 1;  1YIJ 1;  3U50 C;  1VQ7 1;  4RVG A;  1RO0 A;  4HGZ A;  3CCR Z;  1VQK Z;  1WII A;  1M1K 2;  4BY1 I;  2I3C A;  3TE5 B;  1Q86 1;  3CCS Z;  2LEX A;  3G6E Z;  1X3W A;  1VQO Z;  2ZAE B;  2HU9 A;  1KQS Y;  3CCJ Z;  3CCV 1;  1YJN 1;  2GTH A;  2JA6 I;  2RPR A;  4RVF A;  2R93 I;  3GTM S;  1ML8 A;  3RZO I;  2QEX Z;  3HKZ A;  3CCQ Z;  4A3K I;  2E2I I;  1Y1W I;  5A2Q f;  3CCE Z;  1JJ2 Z;  1X3Z A;  1YIT Z;  1Q16 A;  1K9M 2;  3M4O I;  1USP B;  1Z02 A;  4X6A I;  1Z03 A;  1QF8 A;  1QVF Y;  3G71 Z;  4A3M I;  3OW2 Y;  2K5R A;  4BY7 I;  2W04 A;  2VPW A;  2JIP A;  3CCQ 1;  3J80 b;  1VQ5 1;  4NBC A;  2R7Z I;  3K7A I;  1S7M A;  1YIT 1;  2B63 I;  3I4N I;  1VQM Z;  2YU9 I;  3S16 I;  2JA8 I;  2OTJ 1;  2DE5 A;  5IT9 b;  4RS4 A;  3HOU I;  4A3E I;  4BBS I;  4S1T A;  1WJ2 A;  3VMG A;  1VQ8 Z;  1VQM 1;  3LUS A;  3CCU 1;  2Y0S A;  2YAD A;  1TWG I;  2KPI A;  1YJW 1;  4NBD A;  3VB9 A;  3G4S 1;  1DL6 A;  2AYD A;  1WW9 A;  4NBH A;  1VQN 1;  2V8J A;  2EGT A;  2NAP A;  4E32 A;  1QVG Y;  2M48 A;  1VQ9 Z;  3M3Y I;  1YI2 Z;  2JIO A;  1JJ2 Y;  1VQ7 Z;  4BBR I;  4NBG A;  2O4H A;  5C4J I;  3HOX I;  2WB1 A;  1NJI 2;  2QRD B;  4NBF A;  1ZH1 A;  3KIH A;  2J6A A;  1RO2 A;  3VMI A;  1K8A 1;  3I4M I;  3CCV Z;  1QYP A;  1YJN Z;  2VF1 A;  3FQM A;  3D9X A;  4E2Y A;  5IP9 I;  3I56 1;  3BG0 B;  2QR1 B;  1M90 1;  3JAM f;  2NVX I;  2V45 A;  4A3D I;  3J81 f;  2LFU A;  5A2Q b;  4NBE A;  5D1O A;  1Q82 1;  1I6H I;  3HOY I;  3F3P C;  3NFZ A;  1SIW A;  5C4X I;  3NH8 A;  3GTO I;  4RV9 A;  5D1P A;  3H3V J;  2JIQ A;  3S2H I;  3QWU A;  4NOZ A;  1N8R 1;  3CD6 1;  2M6N A;  3IFU A;  4DK1 A;  1K73 1;  1KC8 2;  4NFR A;  1RQF A;  1VQ5 Z;  2G2K A;  2KI7 B;  4QTU A;  4CL1 A;  4E2Z A;  3D2L A;  2E7Z A;  3D6W A;  4MD9 A;  2IZ3 A;  4A3L I;  3CC7 1;  2QA4 1;  1VLA A;  2RIQ A;  1M1K 1;  2VPZ A;  3CCL 1;  1L1O C;  3CME Z;  4A3F I;  2OTJ Z;  2IV2 X;  3MZK B;  2R6M A;  2PMZ A;  5IP7 I; 
#chains in the Genus database with same CATH homology
 1TWH I;  1ZB8 A;  1TFI A;  4E2X A;  1Q7Y 2;  1S72 1;  3CCU Z;  2JR6 A;  4A93 I;  3I55 1;  1Q81 2;  4E2W A;  1I3Q I;  1YJW Z;  3CME 1;  2OOX B;  3G4S Z;  3J7A 4;  1K9M 1;  1VQN Z;  2OTL 1;  2E9H A;  4TNU A;  2E2J I;  2JUB A;  4DGL A;  3CXC Z;  3CPW Y;  1VQ6 1;  4A3J I;  2V8K A;  3CCM 1;  1VQ4 1;  3GTQ I;  1TWF I;  3GTK I;  2H85 A;  1Y1V I;  3GTP I;  3NH4 A;  1K83 I;  4Y52 I;  1NP6 A;  2V8I A;  2JA5 I;  1SFO I;  2VUM I;  3BG1 B;  1KQS Z;  2O53 A;  3KIF A;  3J80 f;  3CMA 1;  5FLX f;  2JMO A;  3VTN A;  3GTG I;  4NBA A;  1W2B Z;  3F3F C;  3S17 I;  2BJO A;  2GTI A;  1YUK A;  4A3C I;  3I56 Z;  1YUA A;  4BXX I;  5T67 A;  1YJ9 1;  1JWH C;  3FKI I;  3P5J B;  3NH5 A;  3GTL I;  4E33 A;  1RLY A;  3JAM b;  4A3I I;  1NUI A;  2DE7 A;  3RZD I;  5T64 A;  3J81 b;  1VQP 1;  2WAQ A;  5CM2 M;  4AYB A;  1KD1 2;  2F4M A;  3OW2 Z;  2AKL A;  3CC2 1;  2GU2 A;  3HOZ I;  5T6B A;  3PO3 I;  3CD6 Z;  4A3G I;  1Q86 2;  1Q82 2;  4DQY B;  4RVD A;  2P28 A;  3I07 A;  4RVH A;  3Q87 A;  3HOV I;  3EER A;  3H0G I;  3T4N B;  3CC7 Z;  2QA4 Z;  2R92 I;  3CCL Z;  4EWC A;  4E30 A;  2Q4Z A;  3IX0 A;  1LQL A;  1N2F A;  4NH1 C;  1RNI A;  2OOY B;  2VUG A;  2IZ4 A;  2K3R A;  3GTM I;  4A3B I;  4NBB A;  2QRE B;  1Z01 A;  2NVY I;  1I50 I;  2NVQ I;  1S72 Z;  4NB9 A;  3TDH B;  3I55 Z;  3IF8 A;  3NDI A;  3S1M I;  2PM9 A;  4MH4 A;  2Q51 A;  1W2B Y;  1QVG Z;  2OTL Z;  3NDJ A;  1KRL A;  1PFT A;  1VQ6 Z;  2P3Y A;  3CCM Z;  1VQ4 Z;  2W03 A;  3CCR 1;  1VQK 1;  2JS4 A;  3ESW A;  5LL6 f;  4HGY A;  3CCS 1;  1KC8 1;  3G6E 1;  1VQO 1;  2QRC B;  3MZL B;  3CCJ 1;  2E2H I;  3S14 I;  2DE6 A;  4XX2 A;  3GKQ A;  3S1R I;  1X0T A;  3PO2 I;  2QLV B;  1P9N A;  3CMA Z;  2QEX 1;  4E31 A;  5FLX b;  3CCE 1;  1TWC I;  4Y7N I;  2RT9 A;  5D1O B;  5FLM I;  4HH4 A;  5AN9 F;  2OZK A;  4MRI A;  1YJ9 Z;  1Q7Y 1;  1ZB9 A;  3G71 1;  1VQP Z;  4MON A;  1Q81 1;  3CQZ I;  1Y1V S;  4MD8 A;  3S2D I;  3S15 I;  3S1Q I;  3CC2 Z;  2QKD A;  3GCF A;  3HOW I;  3MON A;  2RBL A;  1K8A 2;  5IT9 f;  2NVT I;  3EED A;  4NB8 A;  3CC4 Z;  1QVF Z;  4QTT A;  4MXU A;  1VQL Z;  5C44 I;  1WCM I;  1USP A;  2HF1 A;  1M90 2;  1YHQ Z;  2PK7 A;  3FQQ A;  1YIJ Z;  1VQ8 1;  1TWA I;  2JNY A;  3S1N I;  2F4O A;  2JA7 I;  3CC4 1;  2RHB A;  2LIY A;  1VQL 1;  1NJI 1;  1VQ9 1;  3PO3 S;  1N8R 2;  1RO4 A;  3CXC Y;  1R9T I;  4MD7 A;  1K73 2;  3CPW Z;  1YHQ 1;  5C3E I;  1YI2 1;  3VMH A;  3GTJ I;  1KD1 1;  1YIJ 1;  3U50 C;  1VQ7 1;  4RVG A;  1RO0 A;  4HGZ A;  3CCR Z;  1VQK Z;  1WII A;  1M1K 2;  4BY1 I;  2I3C A;  3TE5 B;  1Q86 1;  3CCS Z;  3G6E Z;  1X3W A;  1VQO Z;  2ZAE B;  2HU9 A;  1KQS Y;  3CCJ Z;  3CCV 1;  1YJN 1;  2GTH A;  2JA6 I;  2RPR A;  4RVF A;  2R93 I;  3GTM S;  1ML8 A;  3RZO I;  2QEX Z;  3HKZ A;  3CCQ Z;  4A3K I;  2E2I I;  1Y1W I;  5A2Q f;  3CCE Z;  1JJ2 Z;  1X3Z A;  1YIT Z;  1K9M 2;  3M4O I;  1USP B;  1Z02 A;  4X6A I;  1Z03 A;  1QF8 A;  1QVF Y;  3G71 Z;  4A3M I;  3OW2 Y;  2K5R A;  4BY7 I;  2W04 A;  3CCQ 1;  3J80 b;  1VQ5 1;  4NBC A;  2R7Z I;  3K7A I;  1S7M A;  1YIT 1;  2B63 I;  3I4N I;  1VQM Z;  2YU9 I;  3S16 I;  2JA8 I;  2OTJ 1;  2DE5 A;  5IT9 b;  4RS4 A;  3HOU I;  4A3E I;  4BBS I;  4S1T A;  3VMG A;  1VQ8 Z;  1VQM 1;  3LUS A;  3CCU 1;  2Y0S A;  2YAD A;  1TWG I;  2KPI A;  1YJW 1;  4NBD A;  3VB9 A;  3G4S 1;  1DL6 A;  1WW9 A;  4NBH A;  1VQN 1;  2V8J A;  2EGT A;  4E32 A;  1QVG Y;  2M48 A;  1VQ9 Z;  3M3Y I;  1YI2 Z;  1JJ2 Y;  1VQ7 Z;  4BBR I;  4NBG A;  2O4H A;  5C4J I;  3HOX I;  2WB1 A;  1NJI 2;  2QRD B;  4NBF A;  1ZH1 A;  3KIH A;  2J6A A;  1RO2 A;  3VMI A;  1K8A 1;  3I4M I;  3CCV Z;  1QYP A;  1YJN Z;  2VF1 A;  3FQM A;  3D9X A;  4E2Y A;  5IP9 I;  3I56 1;  3BG0 B;  2QR1 B;  1M90 1;  3JAM f;  2NVX I;  4A3D I;  3J81 f;  2LFU A;  5A2Q b;  4NBE A;  5D1O A;  1Q82 1;  1I6H I;  3HOY I;  3F3P C;  3NFZ A;  5C4X I;  3NH8 A;  3GTO I;  4RV9 A;  5D1P A;  3H3V J;  3S2H I;  3QWU A;  4NOZ A;  1N8R 1;  3CD6 1;  2M6N A;  3IFU A;  4DK1 A;  1K73 1;  1KC8 2;  4NFR A;  1RQF A;  1VQ5 Z;  2G2K A;  2KI7 B;  4QTU A;  4CL1 A;  4E2Z A;  3D6W A;  4MD9 A;  2IZ3 A;  4A3L I;  3CC7 1;  2QA4 1;  1VLA A;  2RIQ A;  1M1K 1;  3CCL 1;  1L1O C;  3CME Z;  4A3F I;  2OTJ Z;  3MZK B;  2R6M A;  2PMZ A;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...