5C44I

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 9
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I02
3H3VJ 3HOUI 3S1RI 1WW9A 1L1OC 4BBRI 3GTLI 2E2JI 4A3MI 1TWFI 2DE7A 3GTJI 5C4XI 2JA5I 5C44I 3LUSA 1ZB9A 3GTOI 2E2II 1DL6A 5IP7I 4A3CI 3VMHA 4BY1I 3M4OI 2AKLA 2JR6A 2JS4A 4NBAA 4NBDA 2PK7A 2JA6I 4QTUA 4A3KI 1RLYA 1TWCI 3HOWI 3HOYI 4MH4A 1TWAI 1USPB 1VLAA 2K5RA 3VMIA 3S15I 1TWGI 4A3FI 1I50I 1TWHI 4NBBA 3VMGA 1R9TI 3M3YI 1X3WA 3I4NI 3GTPI 3S2HI 2DE5A 3I07A 1Y1VS 2DE6A 3GTQI 4Y7NI 4QTTA 3GTKI 1ZB8A 4X6AI 3S17I 2NVXI 5FLMI 4NB8A 5C4JI 3PO3I 3HOZI 3S1QI 3FKII 2F4MA 4NB9A 4A3JI 3S1MI 3S14I 4A3EI 2VUMI 3PO3S 1I3QI 2KPIA 2HF1A 2JA7I 3S16I 4NBEA 3GTMI 1I6HI 1Y1VI 3EERA 2NVTI 3CQZI 3S2DI 4A3GI 3GTMS 1X3ZA 4NBFA 2J6AA 4A93I 5C3EI 2BJOA 2E2HI 4NBCA 1RO4A 1PFTA 4NBGA 3RZOI 3Q87A 1N2FA 4NOZA 4NBHA 3PO2I 3K7AI 3U50C 1SFOI 2R92I 3VB9A 1TFIA 1K83I 4A3II 4BXXI 2JA8I 5CM2M 1NUIA 2P3YA 4A3LI 3GKQA 2F4OA 2NVQI 2RBLA 2R7ZI 3HOVI 2NVYI 4Y52I 1WCMI 2B63I 2JNYA 3D6WA 3H0GI 2YU9I 3S1NI 2R93I 3I4MI 1Y1WI 3RZDI 4A3BI 3ESWA 4BY7I 1YUAA 4A3DI 5IP9I 1ML8A 3GCFA 3GTGI 1USPA 1QYPA 4BBSI 1LQLA 4XX2A 3HOXI
chains in the Genus database with same CATH superfamily
3H3VJ 3S1RI 3NH5A 4TNUA 3CCVZ 5C4XI 2JA5I 2PMZA 4CL1A 1Z03A 1YI2Z 1YIJ1 1K732 2E2II 1VQ51 4E33A 3G71Z 2JIRA 1KQSY 5T67A 2JA6I 1X0TA 1AA6A 1TWCI 3HOWI 4MH4A 3TE5B 1TWAI 2NAPA 2VPXA 1NJI2 3M3YI 2IZ4A 2K3RA 3IR7A 5LL6f 1YJN1 3I4NI 1JJ2Z 3S2HI 3OW2Y 1YIJZ 3CCJ1 1VQ5Z 1ZH1A 1VQL1 4NFRA 2ZAEB 4X6AI 1NP6A 3KIFA 4NB8A 4AYBA 5C4JI 2M48A 3S1QI 3FKII 2F4MA 2OOYB 3NH8A 3F3PC 4NB9A 4A3JI 1KD11 3S14I 1M1K1 4RVDA 2VF1A 4DK1A 3CPWZ 2JA7I 2I3CA 1VQ81 1Y1VI 3EERA 1YJNZ 2NVTI 3JAMf 3S2DI 1Q7Y2 3GTMS 4A3GI 1FDOA 1KD12 2BJOA 2VPZA 4RV9A 2E2HI 3CCJZ 3G6EZ 1PFTA 4NBGA 1M1K2 3RZOI 1VQP1 3PO2I 2W04A 3TDHB 1KC82 3U50C 1SFOI 2O53A 3CC2Z 1K9M2 4BXXI 4A3LI 2F4OA 2RBLA 1VQO1 3G4S1 5FLXb 1WCMI 2R6MA 2QRCB 3CCSZ 3RZDI 5IP9I 1VQK1 4MD9A 1ML8A 1Q861 3MZKB 5A2Qb 1QYPA 1RO2A 4BBSI 3D9XA 3NFZA 2RHBA 3CCRZ 4E30A 1VQPZ 2G2KA 1L1OC 4A3MI 3LUSA 1VQ91 1WJ2A 1YUKA 3CCE1 3J80b 1Q862 1VQOZ 1RQFA 3G4SZ 3M4OI 3MONA 2JS4A 4NBDA 2GTIA 3IX0A 4A3KI 1RLYA 4E2ZA 4MRIA 1VQKZ 1KRLA 1TWGI 1I50I 3I551 4E2YA 3CMEZ 3EEDA 4E31A 1Y8CA 3GTPI 2V8IA 1Q16A 1RO0A 2DE6A 1NJI1 4Y7NI 5AN9F 1VQ71 2QR1B 5FLMI 2QEXZ 5IT9f 2HU9A 3FQMA 2AYDA 2KPIA 2QA41 2V45A 3GTMI 4RVHA 5D1OA 3I55Z 1QVGZ 2OTL1 1VQN1 4E2WA 2P28A 5C3EI 1JJ2Y 4NBCA 1RO4A 3Q87A 1N2FA 4NOZA 1M901 3K7AI 1Q7Y1 2R92I 1S721 1K83I 2GTHA 2JA8I 1NUIA 1N8R2 2RPRA 1KC81 5T64A 4Y52I 2LFUA 4DGLA 1K9M1 2JIQA 1M902 2R93I 3CCQ1 3CPWY 2WAQA 3I4MI 5D1OB 4BY7I 4A3DI 1VQ41 1Z02A 1USPA 3CXCZ 1VQLZ 3QWUA 3I561 2Q4ZA 1WW9A 4BBRI 2OTJ1 1TWFI 2DE7A 3P5JB 3BG1B 2JIPA 5C44I 1S72Z 1ZB9A 2KI7B 2OOXB 3FQQA 1DL6A 2LIYA 3CC41 1RNIA 4A3CI 4E2XA 5A2Qf 1VQ8Z 1VQ61 4NBAA 3CCQZ 4QTUA 4NH1C 1WZNA 3NH4A 3HKZA 1VQ4Z 3HOYI 1USPB 2K5RA 3VMIA 3S15I 4A3FI 3J80f 3VMGA 4NBBA 1R9TI 1VQM1 4HGZA 5D1PA 1X3WA 2OTJZ 3CCL1 1YJW1 2GU2A 2DE5A 2E9HA 3I07A 1Y1VS 3J81b 2V3VA 4E32A 4EWCA 3KIHA 4QTTA 3CMA1 4DQYB 1ZB8A 3S17I 2NVXI 3BG0B 1YHQ1 2VUGA 1W2BZ 3HOZI 3S1MI 1YI21 3PO3S 1JWHC 1I3QI 3CCM1 4MD8A 3S16I 2IZ3A 1Q812 1I6HI 3CCU1 1VQ9Z 3CQZI 2Y0SA 4RS4A 3CCEZ 4NBFA 3CD61 2J6AA 2VPWA 4A93I 1YJ91 4NBHA 1SIWA 4MD7A 3CMAZ 2Q51A 3VB9A 4A3II 5CM2M 1P9NA 2P3YA 1YHQZ 3GKQA 1K8A1 1KQSZ 2R7ZI 1Q822 2EGTA 2NVYI 3CCMZ 2B63I 2JNYA 3H0GI 2YU9I 3S1NI 1N8R1 2O4HA 4RVGA 1Y1WI 3CCUZ 1QVGY 3ESWA 1YUAA 3T4NB 3CD6Z 3GTGI 1Z01A 1K8A2 1YJ9Z 2OZKA 2QKDA 1VQ7Z 3HOUI 3GTLI 2E2JI 5IT9b 2LEXA 1QVFZ 3GTJI 3OW2Z 2RT9A 2JIMA 3GTOI 1QVFY 2QA4Z 5IP7I 3G6E1 3VMHA 4BY1I 2AKLA 2JR6A 2OTLZ 1VQNZ 4HGYA 2PK7A 3CC21 2H85A 2QLVB 3J7A4 1VLAA 3CXCY 1QXFA 3D2LA 4HH4A 1TWHI 1YIT1 2JMOA 2V8JA 5FLXf 1S7MA 3CCS1 3NDJA 2RIQA 3GTQI 3JAMb 3CCR1 3GTKI 3IF8A 2E7ZA 2M6NA 3VTNA 3PO3I 4A3EI 2JUBA 2VUMI 1WIIA 3I56Z 2HF1A 2YADA 5T6BA 4NBEA 3J81f 1YITZ 1QF8A 3CC71 4RVFA 4MXUA 1X3ZA 2W03A 4MONA 1FDIA 3CC4Z 2WB1A 2VPYA 1Q811 3MZLB 1VQ6Z 3NDIA 4S1TA 3CCV1 1TFIA 3CME1 2JIOA 3F3FC 1W2BY 2NVQI 3HOVI 3G711 1VQMZ 3D6WA 3CCLZ 3CC7Z 2QEX1 1YJWZ 4A3BI 2QRDB 1K731 1Q821 2QREB 3GCFA 2V8KA 3IFUA 2IV2X 1LQLA 4XX2A 2PM9A 3HOXI
chains in the Genus database with same CATH topology
3H3VJ 3S1RI 3NH5A 4TNUA 3CCVZ 5C4XI 2JA5I 2PMZA 4CL1A 1Z03A 1YI2Z 1YIJ1 1K732 2E2II 1VQ51 4E33A 3G71Z 1KQSY 5T67A 2JA6I 1X0TA 1TWCI 3HOWI 4MH4A 3TE5B 1TWAI 1NJI2 3M3YI 2IZ4A 2K3RA 5LL6f 1YJN1 3I4NI 1JJ2Z 3S2HI 3OW2Y 1YIJZ 3CCJ1 1VQ5Z 1ZH1A 1VQL1 4NFRA 2ZAEB 4X6AI 1NP6A 3KIFA 4NB8A 4AYBA 5C4JI 2M48A 3S1QI 3FKII 2F4MA 2OOYB 3NH8A 3F3PC 4NB9A 4A3JI 1KD11 3S14I 1M1K1 4RVDA 2VF1A 4DK1A 3CPWZ 2JA7I 2I3CA 1VQ81 1Y1VI 3EERA 1YJNZ 2NVTI 3JAMf 3S2DI 1Q7Y2 3GTMS 4A3GI 1KD12 2BJOA 4RV9A 2E2HI 3CCJZ 3G6EZ 1PFTA 4NBGA 1M1K2 3RZOI 1VQP1 3PO2I 2W04A 3TDHB 1KC82 3U50C 1SFOI 2O53A 3CC2Z 1K9M2 4BXXI 4A3LI 2F4OA 2RBLA 1VQO1 3G4S1 5FLXb 1WCMI 2R6MA 2QRCB 3CCSZ 3RZDI 5IP9I 1VQK1 4MD9A 1ML8A 1Q861 3MZKB 5A2Qb 1QYPA 1RO2A 4BBSI 3D9XA 3NFZA 2RHBA 3CCRZ 4E30A 1VQPZ 2G2KA 1L1OC 4A3MI 3LUSA 1VQ91 1YUKA 3CCE1 3J80b 1Q862 1VQOZ 1RQFA 3G4SZ 3M4OI 3MONA 2JS4A 4NBDA 2GTIA 3IX0A 4A3KI 1RLYA 4E2ZA 4MRIA 1VQKZ 1KRLA 1TWGI 1I50I 3I551 4E2YA 3CMEZ 3EEDA 4E31A 3GTPI 2V8IA 1RO0A 2DE6A 1NJI1 4Y7NI 5AN9F 1VQ71 2QR1B 5FLMI 2QEXZ 5IT9f 2HU9A 3FQMA 2KPIA 2QA41 3GTMI 4RVHA 5D1OA 3I55Z 1QVGZ 2OTL1 1VQN1 4E2WA 2P28A 5C3EI 1JJ2Y 4NBCA 1RO4A 3Q87A 1N2FA 4NOZA 1M901 3K7AI 1Q7Y1 2R92I 1S721 1K83I 2GTHA 2JA8I 1NUIA 1N8R2 2RPRA 1KC81 5T64A 4Y52I 2LFUA 4DGLA 1K9M1 1M902 2R93I 3CCQ1 3CPWY 2WAQA 3I4MI 5D1OB 4BY7I 4A3DI 1VQ41 1Z02A 1USPA 3CXCZ 1VQLZ 3QWUA 3I561 2Q4ZA 1WW9A 4BBRI 2OTJ1 1TWFI 2DE7A 3P5JB 3BG1B 5C44I 1S72Z 1ZB9A 2KI7B 2OOXB 3FQQA 1DL6A 2LIYA 3CC41 1RNIA 4A3CI 4E2XA 5A2Qf 1VQ8Z 1VQ61 4NBAA 3CCQZ 4QTUA 4NH1C 3NH4A 3HKZA 1VQ4Z 3HOYI 1USPB 2K5RA 3VMIA 3S15I 4A3FI 3J80f 3VMGA 4NBBA 1R9TI 1VQM1 4HGZA 5D1PA 1X3WA 2OTJZ 3CCL1 1YJW1 2GU2A 2DE5A 2E9HA 3I07A 1Y1VS 3J81b 4E32A 4EWCA 3KIHA 4QTTA 3CMA1 4DQYB 1ZB8A 3S17I 2NVXI 3BG0B 1YHQ1 2VUGA 1W2BZ 3HOZI 3S1MI 1YI21 3PO3S 1JWHC 1I3QI 3CCM1 4MD8A 3S16I 2IZ3A 1Q812 1I6HI 3CCU1 1VQ9Z 3CQZI 2Y0SA 4RS4A 3CCEZ 4NBFA 3CD61 2J6AA 4A93I 1YJ91 4NBHA 4MD7A 3CMAZ 2Q51A 3VB9A 4A3II 5CM2M 1P9NA 2P3YA 1YHQZ 3GKQA 1K8A1 1KQSZ 2R7ZI 1Q822 2EGTA 2NVYI 3CCMZ 2B63I 2JNYA 3H0GI 2YU9I 3S1NI 1N8R1 2O4HA 4RVGA 1Y1WI 3CCUZ 1QVGY 3ESWA 1YUAA 3T4NB 3CD6Z 3GTGI 1Z01A 1K8A2 1YJ9Z 2OZKA 2QKDA 1VQ7Z 3HOUI 3GTLI 2E2JI 5IT9b 1QVFZ 3GTJI 3OW2Z 2RT9A 3GTOI 1QVFY 2QA4Z 5IP7I 3G6E1 3VMHA 4BY1I 2AKLA 2JR6A 2OTLZ 1VQNZ 4HGYA 2PK7A 3CC21 2H85A 2QLVB 3J7A4 1VLAA 3CXCY 4HH4A 1TWHI 1YIT1 2JMOA 2V8JA 5FLXf 1S7MA 3CCS1 3NDJA 2RIQA 3GTQI 3JAMb 3CCR1 3GTKI 3IF8A 2M6NA 3VTNA 3PO3I 4A3EI 2JUBA 2VUMI 1WIIA 3I56Z 2HF1A 2YADA 5T6BA 4NBEA 3J81f 1YITZ 1QF8A 3CC71 4RVFA 4MXUA 1X3ZA 2W03A 4MONA 3CC4Z 2WB1A 1Q811 3MZLB 1VQ6Z 3NDIA 4S1TA 3CCV1 1TFIA 3CME1 3F3FC 1W2BY 2NVQI 3HOVI 3G711 1VQMZ 3D6WA 3CCLZ 3CC7Z 2QEX1 1YJWZ 4A3BI 2QRDB 1K731 1Q821 2QREB 3GCFA 2V8KA 3IFUA 1LQLA 4XX2A 2PM9A 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V J;  3HOU I;  3S1R I;  1WW9 A;  1L1O C;  4BBR I;  3GTL I;  2E2J I;  4A3M I;  1TWF I;  2DE7 A;  3GTJ I;  5C4X I;  2JA5 I;  5C44 I;  3LUS A;  1ZB9 A;  3GTO I;  2E2I I;  1DL6 A;  5IP7 I;  4A3C I;  3VMH A;  4BY1 I;  3M4O I;  2AKL A;  2JR6 A;  2JS4 A;  4NBA A;  4NBD A;  2PK7 A;  2JA6 I;  4QTU A;  4A3K I;  1RLY A;  1TWC I;  3HOW I;  3HOY I;  4MH4 A;  1TWA I;  1USP B;  1VLA A;  2K5R A;  3VMI A;  3S15 I;  1TWG I;  4A3F I;  1I50 I;  1TWH I;  4NBB A;  3VMG A;  1R9T I;  3M3Y I;  1X3W A;  3I4N I;  3GTP I;  3S2H I;  2DE5 A;  3I07 A;  1Y1V S;  2DE6 A;  3GTQ I;  4Y7N I;  4QTT A;  3GTK I;  1ZB8 A;  4X6A I;  3S17 I;  2NVX I;  5FLM I;  4NB8 A;  5C4J I;  3PO3 I;  3HOZ I;  3S1Q I;  3FKI I;  2F4M A;  4NB9 A;  4A3J I;  3S1M I;  3S14 I;  4A3E I;  2VUM I;  3PO3 S;  1I3Q I;  2KPI A;  2HF1 A;  2JA7 I;  3S16 I;  4NBE A;  3GTM I;  1I6H I;  1Y1V I;  3EER A;  2NVT I;  3CQZ I;  3S2D I;  4A3G I;  3GTM S;  1X3Z A;  4NBF A;  2J6A A;  4A93 I;  5C3E I;  2BJO A;  2E2H I;  4NBC A;  1RO4 A;  1PFT A;  4NBG A;  3RZO I;  3Q87 A;  1N2F A;  4NOZ A;  4NBH A;  3PO2 I;  3K7A I;  3U50 C;  1SFO I;  2R92 I;  3VB9 A;  1TFI A;  1K83 I;  4A3I I;  4BXX I;  2JA8 I;  5CM2 M;  1NUI A;  2P3Y A;  4A3L I;  3GKQ A;  2F4O A;  2NVQ I;  2RBL A;  2R7Z I;  3HOV I;  2NVY I;  4Y52 I;  1WCM I;  2B63 I;  2JNY A;  3D6W A;  3H0G I;  2YU9 I;  3S1N I;  2R93 I;  3I4M I;  1Y1W I;  3RZD I;  4A3B I;  3ESW A;  4BY7 I;  1YUA A;  4A3D I;  5IP9 I;  1ML8 A;  3GCF A;  3GTG I;  1USP A;  1QYP A;  4BBS I;  1LQL A;  4XX2 A;  3HOX I; 
#chains in the Genus database with same CATH topology
 3H3V J;  3S1R I;  3NH5 A;  4TNU A;  3CCV Z;  5C4X I;  2JA5 I;  2PMZ A;  4CL1 A;  1Z03 A;  1YI2 Z;  1YIJ 1;  1K73 2;  2E2I I;  1VQ5 1;  4E33 A;  3G71 Z;  2JIR A;  1KQS Y;  5T67 A;  2JA6 I;  1X0T A;  1AA6 A;  1TWC I;  3HOW I;  4MH4 A;  3TE5 B;  1TWA I;  2NAP A;  2VPX A;  1NJI 2;  3M3Y I;  2IZ4 A;  2K3R A;  3IR7 A;  5LL6 f;  1YJN 1;  3I4N I;  1JJ2 Z;  3S2H I;  3OW2 Y;  1YIJ Z;  3CCJ 1;  1VQ5 Z;  1ZH1 A;  1VQL 1;  4NFR A;  2ZAE B;  4X6A I;  1NP6 A;  3KIF A;  4NB8 A;  4AYB A;  5C4J I;  2M48 A;  3S1Q I;  3FKI I;  2F4M A;  2OOY B;  3NH8 A;  3F3P C;  4NB9 A;  4A3J I;  1KD1 1;  3S14 I;  1M1K 1;  4RVD A;  2VF1 A;  4DK1 A;  3CPW Z;  2JA7 I;  2I3C A;  1VQ8 1;  1Y1V I;  3EER A;  1YJN Z;  2NVT I;  3JAM f;  3S2D I;  1Q7Y 2;  3GTM S;  4A3G I;  1FDO A;  1KD1 2;  2BJO A;  2VPZ A;  4RV9 A;  2E2H I;  3CCJ Z;  3G6E Z;  1PFT A;  4NBG A;  1M1K 2;  3RZO I;  1VQP 1;  3PO2 I;  2W04 A;  3TDH B;  1KC8 2;  3U50 C;  1SFO I;  2O53 A;  3CC2 Z;  1K9M 2;  4BXX I;  4A3L I;  2F4O A;  2RBL A;  1VQO 1;  3G4S 1;  5FLX b;  1WCM I;  2R6M A;  2QRC B;  3CCS Z;  3RZD I;  5IP9 I;  1VQK 1;  4MD9 A;  1ML8 A;  1Q86 1;  3MZK B;  5A2Q b;  1QYP A;  1RO2 A;  4BBS I;  3D9X A;  3NFZ A;  2RHB A;  3CCR Z;  4E30 A;  1VQP Z;  2G2K A;  1L1O C;  4A3M I;  3LUS A;  1VQ9 1;  1WJ2 A;  1YUK A;  3CCE 1;  3J80 b;  1Q86 2;  1VQO Z;  1RQF A;  3G4S Z;  3M4O I;  3MON A;  2JS4 A;  4NBD A;  2GTI A;  3IX0 A;  4A3K I;  1RLY A;  4E2Z A;  4MRI A;  1VQK Z;  1KRL A;  1TWG I;  1I50 I;  3I55 1;  4E2Y A;  3CME Z;  3EED A;  4E31 A;  1Y8C A;  3GTP I;  2V8I A;  1Q16 A;  1RO0 A;  2DE6 A;  1NJI 1;  4Y7N I;  5AN9 F;  1VQ7 1;  2QR1 B;  5FLM I;  2QEX Z;  5IT9 f;  2HU9 A;  3FQM A;  2AYD A;  2KPI A;  2QA4 1;  2V45 A;  3GTM I;  4RVH A;  5D1O A;  3I55 Z;  1QVG Z;  2OTL 1;  1VQN 1;  4E2W A;  2P28 A;  5C3E I;  1JJ2 Y;  4NBC A;  1RO4 A;  3Q87 A;  1N2F A;  4NOZ A;  1M90 1;  3K7A I;  1Q7Y 1;  2R92 I;  1S72 1;  1K83 I;  2GTH A;  2JA8 I;  1NUI A;  1N8R 2;  2RPR A;  1KC8 1;  5T64 A;  4Y52 I;  2LFU A;  4DGL A;  1K9M 1;  2JIQ A;  1M90 2;  2R93 I;  3CCQ 1;  3CPW Y;  2WAQ A;  3I4M I;  5D1O B;  4BY7 I;  4A3D I;  1VQ4 1;  1Z02 A;  1USP A;  3CXC Z;  1VQL Z;  3QWU A;  3I56 1;  2Q4Z A;  1WW9 A;  4BBR I;  2OTJ 1;  1TWF I;  2DE7 A;  3P5J B;  3BG1 B;  2JIP A;  5C44 I;  1S72 Z;  1ZB9 A;  2KI7 B;  2OOX B;  3FQQ A;  1DL6 A;  2LIY A;  3CC4 1;  1RNI A;  4A3C I;  4E2X A;  5A2Q f;  1VQ8 Z;  1VQ6 1;  4NBA A;  3CCQ Z;  4QTU A;  4NH1 C;  1WZN A;  3NH4 A;  3HKZ A;  1VQ4 Z;  3HOY I;  1USP B;  2K5R A;  3VMI A;  3S15 I;  4A3F I;  3J80 f;  3VMG A;  4NBB A;  1R9T I;  1VQM 1;  4HGZ A;  5D1P A;  1X3W A;  2OTJ Z;  3CCL 1;  1YJW 1;  2GU2 A;  2DE5 A;  2E9H A;  3I07 A;  1Y1V S;  3J81 b;  2V3V A;  4E32 A;  4EWC A;  3KIH A;  4QTT A;  3CMA 1;  4DQY B;  1ZB8 A;  3S17 I;  2NVX I;  3BG0 B;  1YHQ 1;  2VUG A;  1W2B Z;  3HOZ I;  3S1M I;  1YI2 1;  3PO3 S;  1JWH C;  1I3Q I;  3CCM 1;  4MD8 A;  3S16 I;  2IZ3 A;  1Q81 2;  1I6H I;  3CCU 1;  1VQ9 Z;  3CQZ I;  2Y0S A;  4RS4 A;  3CCE Z;  4NBF A;  3CD6 1;  2J6A A;  2VPW A;  4A93 I;  1YJ9 1;  4NBH A;  1SIW A;  4MD7 A;  3CMA Z;  2Q51 A;  3VB9 A;  4A3I I;  5CM2 M;  1P9N A;  2P3Y A;  1YHQ Z;  3GKQ A;  1K8A 1;  1KQS Z;  2R7Z I;  1Q82 2;  2EGT A;  2NVY I;  3CCM Z;  2B63 I;  2JNY A;  3H0G I;  2YU9 I;  3S1N I;  1N8R 1;  2O4H A;  4RVG A;  1Y1W I;  3CCU Z;  1QVG Y;  3ESW A;  1YUA A;  3T4N B;  3CD6 Z;  3GTG I;  1Z01 A;  1K8A 2;  1YJ9 Z;  2OZK A;  2QKD A;  1VQ7 Z;  3HOU I;  3GTL I;  2E2J I;  5IT9 b;  2LEX A;  1QVF Z;  3GTJ I;  3OW2 Z;  2RT9 A;  2JIM A;  3GTO I;  1QVF Y;  2QA4 Z;  5IP7 I;  3G6E 1;  3VMH A;  4BY1 I;  2AKL A;  2JR6 A;  2OTL Z;  1VQN Z;  4HGY A;  2PK7 A;  3CC2 1;  2H85 A;  2QLV B;  3J7A 4;  1VLA A;  3CXC Y;  1QXF A;  3D2L A;  4HH4 A;  1TWH I;  1YIT 1;  2JMO A;  2V8J A;  5FLX f;  1S7M A;  3CCS 1;  3NDJ A;  2RIQ A;  3GTQ I;  3JAM b;  3CCR 1;  3GTK I;  3IF8 A;  2E7Z A;  2M6N A;  3VTN A;  3PO3 I;  4A3E I;  2JUB A;  2VUM I;  1WII A;  3I56 Z;  2HF1 A;  2YAD A;  5T6B A;  4NBE A;  3J81 f;  1YIT Z;  1QF8 A;  3CC7 1;  4RVF A;  4MXU A;  1X3Z A;  2W03 A;  4MON A;  1FDI A;  3CC4 Z;  2WB1 A;  2VPY A;  1Q81 1;  3MZL B;  1VQ6 Z;  3NDI A;  4S1T A;  3CCV 1;  1TFI A;  3CME 1;  2JIO A;  3F3F C;  1W2B Y;  2NVQ I;  3HOV I;  3G71 1;  1VQM Z;  3D6W A;  3CCL Z;  3CC7 Z;  2QEX 1;  1YJW Z;  4A3B I;  2QRD B;  1K73 1;  1Q82 1;  2QRE B;  3GCF A;  2V8K A;  3IFU A;  2IV2 X;  1LQL A;  4XX2 A;  2PM9 A;  3HOX I; 
#chains in the Genus database with same CATH homology
 3H3V J;  3S1R I;  3NH5 A;  4TNU A;  3CCV Z;  5C4X I;  2JA5 I;  2PMZ A;  4CL1 A;  1Z03 A;  1YI2 Z;  1YIJ 1;  1K73 2;  2E2I I;  1VQ5 1;  4E33 A;  3G71 Z;  1KQS Y;  5T67 A;  2JA6 I;  1X0T A;  1TWC I;  3HOW I;  4MH4 A;  3TE5 B;  1TWA I;  1NJI 2;  3M3Y I;  2IZ4 A;  2K3R A;  5LL6 f;  1YJN 1;  3I4N I;  1JJ2 Z;  3S2H I;  3OW2 Y;  1YIJ Z;  3CCJ 1;  1VQ5 Z;  1ZH1 A;  1VQL 1;  4NFR A;  2ZAE B;  4X6A I;  1NP6 A;  3KIF A;  4NB8 A;  4AYB A;  5C4J I;  2M48 A;  3S1Q I;  3FKI I;  2F4M A;  2OOY B;  3NH8 A;  3F3P C;  4NB9 A;  4A3J I;  1KD1 1;  3S14 I;  1M1K 1;  4RVD A;  2VF1 A;  4DK1 A;  3CPW Z;  2JA7 I;  2I3C A;  1VQ8 1;  1Y1V I;  3EER A;  1YJN Z;  2NVT I;  3JAM f;  3S2D I;  1Q7Y 2;  3GTM S;  4A3G I;  1KD1 2;  2BJO A;  4RV9 A;  2E2H I;  3CCJ Z;  3G6E Z;  1PFT A;  4NBG A;  1M1K 2;  3RZO I;  1VQP 1;  3PO2 I;  2W04 A;  3TDH B;  1KC8 2;  3U50 C;  1SFO I;  2O53 A;  3CC2 Z;  1K9M 2;  4BXX I;  4A3L I;  2F4O A;  2RBL A;  1VQO 1;  3G4S 1;  5FLX b;  1WCM I;  2R6M A;  2QRC B;  3CCS Z;  3RZD I;  5IP9 I;  1VQK 1;  4MD9 A;  1ML8 A;  1Q86 1;  3MZK B;  5A2Q b;  1QYP A;  1RO2 A;  4BBS I;  3D9X A;  3NFZ A;  2RHB A;  3CCR Z;  4E30 A;  1VQP Z;  2G2K A;  1L1O C;  4A3M I;  3LUS A;  1VQ9 1;  1YUK A;  3CCE 1;  3J80 b;  1Q86 2;  1VQO Z;  1RQF A;  3G4S Z;  3M4O I;  3MON A;  2JS4 A;  4NBD A;  2GTI A;  3IX0 A;  4A3K I;  1RLY A;  4E2Z A;  4MRI A;  1VQK Z;  1KRL A;  1TWG I;  1I50 I;  3I55 1;  4E2Y A;  3CME Z;  3EED A;  4E31 A;  3GTP I;  2V8I A;  1RO0 A;  2DE6 A;  1NJI 1;  4Y7N I;  5AN9 F;  1VQ7 1;  2QR1 B;  5FLM I;  2QEX Z;  5IT9 f;  2HU9 A;  3FQM A;  2KPI A;  2QA4 1;  3GTM I;  4RVH A;  5D1O A;  3I55 Z;  1QVG Z;  2OTL 1;  1VQN 1;  4E2W A;  2P28 A;  5C3E I;  1JJ2 Y;  4NBC A;  1RO4 A;  3Q87 A;  1N2F A;  4NOZ A;  1M90 1;  3K7A I;  1Q7Y 1;  2R92 I;  1S72 1;  1K83 I;  2GTH A;  2JA8 I;  1NUI A;  1N8R 2;  2RPR A;  1KC8 1;  5T64 A;  4Y52 I;  2LFU A;  4DGL A;  1K9M 1;  1M90 2;  2R93 I;  3CCQ 1;  3CPW Y;  2WAQ A;  3I4M I;  5D1O B;  4BY7 I;  4A3D I;  1VQ4 1;  1Z02 A;  1USP A;  3CXC Z;  1VQL Z;  3QWU A;  3I56 1;  2Q4Z A;  1WW9 A;  4BBR I;  2OTJ 1;  1TWF I;  2DE7 A;  3P5J B;  3BG1 B;  5C44 I;  1S72 Z;  1ZB9 A;  2KI7 B;  2OOX B;  3FQQ A;  1DL6 A;  2LIY A;  3CC4 1;  1RNI A;  4A3C I;  4E2X A;  5A2Q f;  1VQ8 Z;  1VQ6 1;  4NBA A;  3CCQ Z;  4QTU A;  4NH1 C;  3NH4 A;  3HKZ A;  1VQ4 Z;  3HOY I;  1USP B;  2K5R A;  3VMI A;  3S15 I;  4A3F I;  3J80 f;  3VMG A;  4NBB A;  1R9T I;  1VQM 1;  4HGZ A;  5D1P A;  1X3W A;  2OTJ Z;  3CCL 1;  1YJW 1;  2GU2 A;  2DE5 A;  2E9H A;  3I07 A;  1Y1V S;  3J81 b;  4E32 A;  4EWC A;  3KIH A;  4QTT A;  3CMA 1;  4DQY B;  1ZB8 A;  3S17 I;  2NVX I;  3BG0 B;  1YHQ 1;  2VUG A;  1W2B Z;  3HOZ I;  3S1M I;  1YI2 1;  3PO3 S;  1JWH C;  1I3Q I;  3CCM 1;  4MD8 A;  3S16 I;  2IZ3 A;  1Q81 2;  1I6H I;  3CCU 1;  1VQ9 Z;  3CQZ I;  2Y0S A;  4RS4 A;  3CCE Z;  4NBF A;  3CD6 1;  2J6A A;  4A93 I;  1YJ9 1;  4NBH A;  4MD7 A;  3CMA Z;  2Q51 A;  3VB9 A;  4A3I I;  5CM2 M;  1P9N A;  2P3Y A;  1YHQ Z;  3GKQ A;  1K8A 1;  1KQS Z;  2R7Z I;  1Q82 2;  2EGT A;  2NVY I;  3CCM Z;  2B63 I;  2JNY A;  3H0G I;  2YU9 I;  3S1N I;  1N8R 1;  2O4H A;  4RVG A;  1Y1W I;  3CCU Z;  1QVG Y;  3ESW A;  1YUA A;  3T4N B;  3CD6 Z;  3GTG I;  1Z01 A;  1K8A 2;  1YJ9 Z;  2OZK A;  2QKD A;  1VQ7 Z;  3HOU I;  3GTL I;  2E2J I;  5IT9 b;  1QVF Z;  3GTJ I;  3OW2 Z;  2RT9 A;  3GTO I;  1QVF Y;  2QA4 Z;  5IP7 I;  3G6E 1;  3VMH A;  4BY1 I;  2AKL A;  2JR6 A;  2OTL Z;  1VQN Z;  4HGY A;  2PK7 A;  3CC2 1;  2H85 A;  2QLV B;  3J7A 4;  1VLA A;  3CXC Y;  4HH4 A;  1TWH I;  1YIT 1;  2JMO A;  2V8J A;  5FLX f;  1S7M A;  3CCS 1;  3NDJ A;  2RIQ A;  3GTQ I;  3JAM b;  3CCR 1;  3GTK I;  3IF8 A;  2M6N A;  3VTN A;  3PO3 I;  4A3E I;  2JUB A;  2VUM I;  1WII A;  3I56 Z;  2HF1 A;  2YAD A;  5T6B A;  4NBE A;  3J81 f;  1YIT Z;  1QF8 A;  3CC7 1;  4RVF A;  4MXU A;  1X3Z A;  2W03 A;  4MON A;  3CC4 Z;  2WB1 A;  1Q81 1;  3MZL B;  1VQ6 Z;  3NDI A;  4S1T A;  3CCV 1;  1TFI A;  3CME 1;  3F3F C;  1W2B Y;  2NVQ I;  3HOV I;  3G71 1;  1VQM Z;  3D6W A;  3CCL Z;  3CC7 Z;  2QEX 1;  1YJW Z;  4A3B I;  2QRD B;  1K73 1;  1Q82 1;  2QRE B;  3GCF A;  2V8K A;  3IFU A;  1LQL A;  4XX2 A;  2PM9 A;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...