5C44I

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
114
structure length
114
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 9
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I02
1TWHI 1WW9A 4NBBA 2F4OA 3I4MI 4BY1I 3VMGA 4A3KI 3S1MI 3M4OI 2AKLA 4NBHA 2VUMI 2RBLA 4A93I 5CM2M 4A3LI 4A3II 1VLAA 3EERA 2YU9I 1ML8A 4Y7NI 3S15I 4A3CI 4NB9A 1I3QI 3H3VJ 4NOZA 2F4MA 4BBSI 3HOVI 3RZDI 3VMIA 3M3YI 1R9TI 1LQLA 3HOZI 1X3ZA 3S16I 3VMHA 3RZOI 2E2JI 4NB8A 4QTTA 4NBEA 1TWFI 4NBDA 3FKII 2DE6A 1Y1WI 3S1RI 4BXXI 1X3WA 3Q87A 3ESWA 4A3MI 1ZB8A 3I07A 2E2II 2NVQI 1NUIA 1WCMI 4XX2A 5C3EI 1I6HI 3LUSA 2NVTI 4X6AI 2DE7A 2K5RA 3PO3I 1I50I 2R93I 4QTUA 4MH4A 4NBCA 2HF1A 1DL6A 3HOYI 3S1NI 3HOUI 3GTQI 3I4NI 4A3FI 5IP7I 3S2HI 5FLMI 2DE5A 3GTLI 3S17I 4Y52I 3S1QI 3GTJI 3GTMI 4A3GI 3GTOI 1RLYA 4NBFA 4NBGA 1L1OC 1ZB9A 3D6WA 3K7AI 3GTGI 2JA5I 1TFIA 1PFTA 2J6AA 1TWGI 4A3BI 4NBAA 2PK7A 1RO4A 2JS4A 3HOXI 3HOWI 2JR6A 2KPIA 4A3DI 4A3JI 3S14I 3GCFA 1USPB 1USPA 2JNYA 2JA6I 1YUAA 5C44I 1SFOI 4BY7I 2BJOA 3VB9A 3GTMS 2R92I 3GKQA 2NVXI 1K83I 1QYPA 1Y1VS 3CQZI 1N2FA 2P3YA 1TWCI 1Y1VI 4BBRI 3H0GI 5C4JI 2E2HI 1TWAI 5C4XI 2B63I 3S2DI 3U50C 2R7ZI 5IP9I 2JA7I 3GTKI 3PO2I 2NVYI 3PO3S 2JA8I 4A3EI 3GTPI
chains in the Genus database with same CATH superfamily
4MD8A 4E2YA 1WZNA 4CL1A 2QREB 1WW9A 4NBBA 3EEDA 2AKLA 1JJ2Z 1K9M2 3OW2Y 1ML8A 1YHQ1 2RIQA 2QKDA 3NH5A 2QRDB 4NOZA 2F4MA 1M1K1 3RZDI 2OTJ1 3CCM1 1LQLA 1K9M1 4RVFA 1VQ61 2QA4Z 1TWFI 1YJWZ 4RVGA 5FLXf 3CCSZ 3S1RI 1VQKZ 1K8A1 2JIPA 1KRLA 3IX0A 3ESWA 5FLXb 1Q822 1NJI1 1FDOA 1NUIA 1WCMI 2M48A 3LUSA 2M6NA 3CCVZ 3S1NI 2JIRA 4E2XA 4A3FI 5IP7I 1WIIA 5IT9f 1NJI2 3I56Z 2DE5A 5T67A 4MONA 4Y52I 4MXUA 1VQ71 5LL6f 1Q16A 4NBGA 1ZB9A 3GTGI 1TWGI 4NBAA 3CMAZ 2PK7A 3J80b 3QWUA 3CCUZ 3CCMZ 3CD61 2VF1A 2JA6I 1USPA 2OOXB 3CXCY 3BG0B 1QVFY 4RS4A 4RVHA 2VPWA 4S1TA 1S721 3GKQA 1K83I 2JIOA 2JIQA 1VQ4Z 1FDIA 2JMOA 4BBRI 1YJNZ 3G711 3H0GI 4E32A 2E2HI 1Q861 1Y8CA 2H85A 4MD7A 3CCV1 1KD11 3S2DI 3U50C 5AN9F 5IP9I 2W04A 2NVYI 1VQ9Z 2P28A 3P5JB 3I551 2F4OA 2GTIA 1KD12 3VMGA 2QA41 1AA6A 2YADA 2LEXA 3F3PC 4A93I 3CCJ1 2QEX1 3CCU1 3EERA 2YU9I 3CD6Z 3FQMA 2PMZA 3J81b 4A3CI 3H3VJ 2RT9A 3VMIA 1R9TI 3HOZI 3CCE1 5D1OB 2ZAEB 1QXFA 2V8IA 1VQ41 1VQL1 1VQO1 1VQ5Z 5A2Qb 3NDJA 4NBEA 3T4NB 2DE6A 1VQ81 1VQ7Z 2V8JA 1YJW1 1X3WA 1P9NA 1JWHC 1ZB8A 2PM9A 3CCS1 2E2II 2Q51A 4XX2A 1I6HI 5C3EI 2GU2A 2VPYA 2LFUA 2K5RA 1KC81 2QLVB 2E9HA 1KC82 2HF1A 1DL6A 3HOYI 3S2HI 5FLMI 3NDIA 2IV2X 3GTLI 4DQYB 2WAQA 3GTMI 1JJ2Y 3I561 1RLYA 1L1OC 3D6WA 2QEXZ 1TFIA 2V3VA 3CPWY 2I3CA 3CC71 3HOXI 2EGTA 3HOWI 2KPIA 4E33A 3OW2Z 1Z02A 2QRCB 1USPB 4AYBA 1VQLZ 1SFOI 1VQ91 3NH8A 3D9XA 1Q812 3J7A4 1Q821 1M901 3I55Z 1M902 4NFRA 1YJ91 1N8R2 4HGZA 1N2FA 1Q7Y1 1Y1VI 1Z01A 5C4JI 3CCJZ 3CC4Z 1TWAI 5C4XI 3G71Z 1YHQZ 1M1K2 3NFZA 2VUGA 1K8A2 1YITZ 2K3RA 4RVDA 2Y0SA 1QVGY 4E30A 2GTHA 3I4MI 4BY1I 3M4OI 3KIFA 5D1OA 2OTL1 1QF8A 2RBLA 2KI7B 1VQ8Z 5CM2M 4A3LI 1Z03A 4E2ZA 3S15I 2WB1A 1VQM1 1I3QI 1VQPZ 1X3ZA 1SIWA 1W2BZ 3CCEZ 3RZOI 4QTTA 4NBDA 2O53A 3FKII 1Y1WI 1VQ51 4BXXI 4TNUA 3CMA1 3CPWZ 2NAPA 3Q87A 1VQNZ 4A3MI 1YI21 3I07A 1QVGZ 3CC7Z 5D1PA 3D2LA 2R93I 1I50I 4QTUA 4NBCA 3HKZA 2HU9A 4E2WA 2VPZA 3S17I 4HGYA 3S1QI 4A3GI 2RPRA 2W03A 3K7AI 4RV9A 2JA5I 1PFTA 3G6E1 4A3BI 2JS4A 3CMEZ 4A3DI 1Q862 4A3JI 3S14I 3GCFA 3CCLZ 1Q7Y2 3IF8A 4DK1A 5A2Qf 3CCQZ 3CCRZ 1YIT1 3GTMS 1K732 3IFUA 1K731 1Y1VS 3BG1B 3G4S1 1KQSZ 1VQN1 4MD9A 2OTLZ 2E7ZA 1TWCI 3CXCZ 1ZH1A 4E31A 1NP6A 2V8KA 2B63I 3CC41 1X0TA 2R7ZI 3J81f 2G2KA 3PO2I 5IT9b 1VQP1 1TWHI 3VTNA 2VPXA 3MONA 2V45A 2QR1B 4A3KI 3S1MI 4NBHA 2VUMI 3F3FC 3TDHB 2RHBA 1RO0A 1YJN1 4A3II 3CC2Z 1VLAA 2IZ3A 4Y7NI 4NB9A 4BBSI 3HOVI 2OZKA 1VQMZ 1RO2A 3CCR1 3M3YI 4DGLA 1VQ6Z 1Q811 1QVFZ 3S16I 3VMHA 3TE5B 2E2JI 4NB8A 1N8R1 1KQSY 1YIJ1 1VQK1 4HH4A 2JIMA 2IZ4A 3J80f 2NVQI 2NVTI 5T64A 2DE7A 1YI2Z 2Q4ZA 3PO3I 1W2BY 4X6AI 1S7MA 1YUKA 2O4HA 4MH4A 1RNIA 3HOUI 3GTQI 3I4NI 2R6MA 3CCQ1 3JAMf 1YJ9Z 3IR7A 1VQOZ 3GTJI 3NH4A 4NH1C 3GTOI 5T6BA 4NBFA 3JAMb 3CC21 2J6AA 1RO4A 3G6EZ 2JR6A 2OOYB 3MZKB 1WJ2A 2JNYA 3CME1 1YUAA 2JUBA 2LIYA 5C44I 4BY7I 2BJOA 1RQFA 3MZLB 3VB9A 3CCL1 3KIHA 3FQQA 2R92I 1YIJZ 2OTJZ 4MRIA 2NVXI 2AYDA 1QYPA 4EWCA 3CQZI 2P3YA 3G4SZ 2JA7I 3GTKI 3PO3S 2JA8I 1S72Z 4A3EI 3GTPI
chains in the Genus database with same CATH topology
4MD8A 4E2YA 4CL1A 2QREB 1WW9A 4NBBA 3EEDA 2AKLA 1JJ2Z 1K9M2 3OW2Y 1ML8A 1YHQ1 2RIQA 2QKDA 3NH5A 2QRDB 4NOZA 2F4MA 1M1K1 3RZDI 2OTJ1 3CCM1 1LQLA 1K9M1 4RVFA 1VQ61 2QA4Z 1TWFI 1YJWZ 4RVGA 5FLXf 3CCSZ 3S1RI 1VQKZ 1K8A1 1KRLA 3IX0A 3ESWA 5FLXb 1Q822 1NJI1 1NUIA 1WCMI 2M48A 3LUSA 2M6NA 3CCVZ 3S1NI 4E2XA 4A3FI 5IP7I 1WIIA 5IT9f 1NJI2 3I56Z 2DE5A 5T67A 4MONA 4Y52I 4MXUA 1VQ71 5LL6f 4NBGA 1ZB9A 3GTGI 1TWGI 4NBAA 3CMAZ 2PK7A 3J80b 3QWUA 3CCUZ 3CCMZ 3CD61 2VF1A 2JA6I 1USPA 2OOXB 3CXCY 3BG0B 1QVFY 4RS4A 4RVHA 4S1TA 1S721 3GKQA 1K83I 1VQ4Z 2JMOA 4BBRI 1YJNZ 3G711 3H0GI 4E32A 2E2HI 1Q861 2H85A 4MD7A 3CCV1 1KD11 3S2DI 3U50C 5AN9F 5IP9I 2W04A 2NVYI 1VQ9Z 2P28A 3P5JB 3I551 2F4OA 2GTIA 1KD12 3VMGA 2QA41 2YADA 3F3PC 4A93I 3CCJ1 2QEX1 3CCU1 3EERA 2YU9I 3CD6Z 3FQMA 2PMZA 3J81b 4A3CI 3H3VJ 2RT9A 3VMIA 1R9TI 3HOZI 3CCE1 5D1OB 2ZAEB 2V8IA 1VQ41 1VQL1 1VQO1 1VQ5Z 5A2Qb 3NDJA 4NBEA 3T4NB 2DE6A 1VQ81 1VQ7Z 2V8JA 1YJW1 1X3WA 1P9NA 1JWHC 1ZB8A 2PM9A 3CCS1 2E2II 2Q51A 4XX2A 1I6HI 5C3EI 2GU2A 2LFUA 2K5RA 1KC81 2QLVB 2E9HA 1KC82 2HF1A 1DL6A 3HOYI 3S2HI 5FLMI 3NDIA 3GTLI 4DQYB 2WAQA 3GTMI 1JJ2Y 3I561 1RLYA 1L1OC 3D6WA 2QEXZ 1TFIA 3CPWY 2I3CA 3CC71 3HOXI 2EGTA 3HOWI 2KPIA 4E33A 3OW2Z 1Z02A 2QRCB 1USPB 4AYBA 1VQLZ 1SFOI 1VQ91 3NH8A 3D9XA 1Q812 3J7A4 1Q821 1M901 3I55Z 1M902 4NFRA 1YJ91 1N8R2 4HGZA 1N2FA 1Q7Y1 1Y1VI 1Z01A 5C4JI 3CCJZ 3CC4Z 1TWAI 5C4XI 3G71Z 1YHQZ 1M1K2 3NFZA 2VUGA 1K8A2 1YITZ 2K3RA 4RVDA 2Y0SA 1QVGY 4E30A 2GTHA 3I4MI 4BY1I 3M4OI 3KIFA 5D1OA 2OTL1 1QF8A 2RBLA 2KI7B 1VQ8Z 5CM2M 4A3LI 1Z03A 4E2ZA 3S15I 2WB1A 1VQM1 1I3QI 1VQPZ 1X3ZA 1W2BZ 3CCEZ 3RZOI 4QTTA 4NBDA 2O53A 3FKII 1Y1WI 1VQ51 4BXXI 4TNUA 3CMA1 3CPWZ 3Q87A 1VQNZ 4A3MI 1YI21 3I07A 1QVGZ 3CC7Z 5D1PA 2R93I 1I50I 4QTUA 4NBCA 3HKZA 2HU9A 4E2WA 3S17I 4HGYA 3S1QI 4A3GI 2RPRA 2W03A 3K7AI 4RV9A 2JA5I 1PFTA 3G6E1 4A3BI 2JS4A 3CMEZ 4A3DI 1Q862 4A3JI 3S14I 3GCFA 3CCLZ 1Q7Y2 3IF8A 4DK1A 5A2Qf 3CCQZ 3CCRZ 1YIT1 3GTMS 1K732 3IFUA 1K731 1Y1VS 3BG1B 3G4S1 1KQSZ 1VQN1 4MD9A 2OTLZ 1TWCI 3CXCZ 1ZH1A 4E31A 1NP6A 2V8KA 2B63I 3CC41 1X0TA 2R7ZI 3J81f 2G2KA 3PO2I 5IT9b 1VQP1 1TWHI 3VTNA 3MONA 2QR1B 4A3KI 3S1MI 4NBHA 2VUMI 3F3FC 3TDHB 2RHBA 1RO0A 1YJN1 4A3II 3CC2Z 1VLAA 2IZ3A 4Y7NI 4NB9A 4BBSI 3HOVI 2OZKA 1VQMZ 1RO2A 3CCR1 3M3YI 4DGLA 1VQ6Z 1Q811 1QVFZ 3S16I 3VMHA 3TE5B 2E2JI 4NB8A 1N8R1 1KQSY 1YIJ1 1VQK1 4HH4A 2IZ4A 3J80f 2NVQI 2NVTI 5T64A 2DE7A 1YI2Z 2Q4ZA 3PO3I 1W2BY 4X6AI 1S7MA 1YUKA 2O4HA 4MH4A 1RNIA 3HOUI 3GTQI 3I4NI 2R6MA 3CCQ1 3JAMf 1YJ9Z 1VQOZ 3GTJI 3NH4A 4NH1C 3GTOI 5T6BA 4NBFA 3JAMb 3CC21 2J6AA 1RO4A 3G6EZ 2JR6A 2OOYB 3MZKB 2JNYA 3CME1 1YUAA 2JUBA 2LIYA 5C44I 4BY7I 2BJOA 1RQFA 3MZLB 3VB9A 3CCL1 3KIHA 3FQQA 2R92I 1YIJZ 2OTJZ 4MRIA 2NVXI 1QYPA 4EWCA 3CQZI 2P3YA 3G4SZ 2JA7I 3GTKI 3PO3S 2JA8I 1S72Z 4A3EI 3GTPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH I;  1WW9 A;  4NBB A;  2F4O A;  3I4M I;  4BY1 I;  3VMG A;  4A3K I;  3S1M I;  3M4O I;  2AKL A;  4NBH A;  2VUM I;  2RBL A;  4A93 I;  5CM2 M;  4A3L I;  4A3I I;  1VLA A;  3EER A;  2YU9 I;  1ML8 A;  4Y7N I;  3S15 I;  4A3C I;  4NB9 A;  1I3Q I;  3H3V J;  4NOZ A;  2F4M A;  4BBS I;  3HOV I;  3RZD I;  3VMI A;  3M3Y I;  1R9T I;  1LQL A;  3HOZ I;  1X3Z A;  3S16 I;  3VMH A;  3RZO I;  2E2J I;  4NB8 A;  4QTT A;  4NBE A;  1TWF I;  4NBD A;  3FKI I;  2DE6 A;  1Y1W I;  3S1R I;  4BXX I;  1X3W A;  3Q87 A;  3ESW A;  4A3M I;  1ZB8 A;  3I07 A;  2E2I I;  2NVQ I;  1NUI A;  1WCM I;  4XX2 A;  5C3E I;  1I6H I;  3LUS A;  2NVT I;  4X6A I;  2DE7 A;  2K5R A;  3PO3 I;  1I50 I;  2R93 I;  4QTU A;  4MH4 A;  4NBC A;  2HF1 A;  1DL6 A;  3HOY I;  3S1N I;  3HOU I;  3GTQ I;  3I4N I;  4A3F I;  5IP7 I;  3S2H I;  5FLM I;  2DE5 A;  3GTL I;  3S17 I;  4Y52 I;  3S1Q I;  3GTJ I;  3GTM I;  4A3G I;  3GTO I;  1RLY A;  4NBF A;  4NBG A;  1L1O C;  1ZB9 A;  3D6W A;  3K7A I;  3GTG I;  2JA5 I;  1TFI A;  1PFT A;  2J6A A;  1TWG I;  4A3B I;  4NBA A;  2PK7 A;  1RO4 A;  2JS4 A;  3HOX I;  3HOW I;  2JR6 A;  2KPI A;  4A3D I;  4A3J I;  3S14 I;  3GCF A;  1USP B;  1USP A;  2JNY A;  2JA6 I;  1YUA A;  5C44 I;  1SFO I;  4BY7 I;  2BJO A;  3VB9 A;  3GTM S;  2R92 I;  3GKQ A;  2NVX I;  1K83 I;  1QYP A;  1Y1V S;  3CQZ I;  1N2F A;  2P3Y A;  1TWC I;  1Y1V I;  4BBR I;  3H0G I;  5C4J I;  2E2H I;  1TWA I;  5C4X I;  2B63 I;  3S2D I;  3U50 C;  2R7Z I;  5IP9 I;  2JA7 I;  3GTK I;  3PO2 I;  2NVY I;  3PO3 S;  2JA8 I;  4A3E I;  3GTP I; 
#chains in the Genus database with same CATH topology
 4MD8 A;  4E2Y A;  1WZN A;  4CL1 A;  2QRE B;  1WW9 A;  4NBB A;  3EED A;  2AKL A;  1JJ2 Z;  1K9M 2;  3OW2 Y;  1ML8 A;  1YHQ 1;  2RIQ A;  2QKD A;  3NH5 A;  2QRD B;  4NOZ A;  2F4M A;  1M1K 1;  3RZD I;  2OTJ 1;  3CCM 1;  1LQL A;  1K9M 1;  4RVF A;  1VQ6 1;  2QA4 Z;  1TWF I;  1YJW Z;  4RVG A;  5FLX f;  3CCS Z;  3S1R I;  1VQK Z;  1K8A 1;  2JIP A;  1KRL A;  3IX0 A;  3ESW A;  5FLX b;  1Q82 2;  1NJI 1;  1FDO A;  1NUI A;  1WCM I;  2M48 A;  3LUS A;  2M6N A;  3CCV Z;  3S1N I;  2JIR A;  4E2X A;  4A3F I;  5IP7 I;  1WII A;  5IT9 f;  1NJI 2;  3I56 Z;  2DE5 A;  5T67 A;  4MON A;  4Y52 I;  4MXU A;  1VQ7 1;  5LL6 f;  1Q16 A;  4NBG A;  1ZB9 A;  3GTG I;  1TWG I;  4NBA A;  3CMA Z;  2PK7 A;  3J80 b;  3QWU A;  3CCU Z;  3CCM Z;  3CD6 1;  2VF1 A;  2JA6 I;  1USP A;  2OOX B;  3CXC Y;  3BG0 B;  1QVF Y;  4RS4 A;  4RVH A;  2VPW A;  4S1T A;  1S72 1;  3GKQ A;  1K83 I;  2JIO A;  2JIQ A;  1VQ4 Z;  1FDI A;  2JMO A;  4BBR I;  1YJN Z;  3G71 1;  3H0G I;  4E32 A;  2E2H I;  1Q86 1;  1Y8C A;  2H85 A;  4MD7 A;  3CCV 1;  1KD1 1;  3S2D I;  3U50 C;  5AN9 F;  5IP9 I;  2W04 A;  2NVY I;  1VQ9 Z;  2P28 A;  3P5J B;  3I55 1;  2F4O A;  2GTI A;  1KD1 2;  3VMG A;  2QA4 1;  1AA6 A;  2YAD A;  2LEX A;  3F3P C;  4A93 I;  3CCJ 1;  2QEX 1;  3CCU 1;  3EER A;  2YU9 I;  3CD6 Z;  3FQM A;  2PMZ A;  3J81 b;  4A3C I;  3H3V J;  2RT9 A;  3VMI A;  1R9T I;  3HOZ I;  3CCE 1;  5D1O B;  2ZAE B;  1QXF A;  2V8I A;  1VQ4 1;  1VQL 1;  1VQO 1;  1VQ5 Z;  5A2Q b;  3NDJ A;  4NBE A;  3T4N B;  2DE6 A;  1VQ8 1;  1VQ7 Z;  2V8J A;  1YJW 1;  1X3W A;  1P9N A;  1JWH C;  1ZB8 A;  2PM9 A;  3CCS 1;  2E2I I;  2Q51 A;  4XX2 A;  1I6H I;  5C3E I;  2GU2 A;  2VPY A;  2LFU A;  2K5R A;  1KC8 1;  2QLV B;  2E9H A;  1KC8 2;  2HF1 A;  1DL6 A;  3HOY I;  3S2H I;  5FLM I;  3NDI A;  2IV2 X;  3GTL I;  4DQY B;  2WAQ A;  3GTM I;  1JJ2 Y;  3I56 1;  1RLY A;  1L1O C;  3D6W A;  2QEX Z;  1TFI A;  2V3V A;  3CPW Y;  2I3C A;  3CC7 1;  3HOX I;  2EGT A;  3HOW I;  2KPI A;  4E33 A;  3OW2 Z;  1Z02 A;  2QRC B;  1USP B;  4AYB A;  1VQL Z;  1SFO I;  1VQ9 1;  3NH8 A;  3D9X A;  1Q81 2;  3J7A 4;  1Q82 1;  1M90 1;  3I55 Z;  1M90 2;  4NFR A;  1YJ9 1;  1N8R 2;  4HGZ A;  1N2F A;  1Q7Y 1;  1Y1V I;  1Z01 A;  5C4J I;  3CCJ Z;  3CC4 Z;  1TWA I;  5C4X I;  3G71 Z;  1YHQ Z;  1M1K 2;  3NFZ A;  2VUG A;  1K8A 2;  1YIT Z;  2K3R A;  4RVD A;  2Y0S A;  1QVG Y;  4E30 A;  2GTH A;  3I4M I;  4BY1 I;  3M4O I;  3KIF A;  5D1O A;  2OTL 1;  1QF8 A;  2RBL A;  2KI7 B;  1VQ8 Z;  5CM2 M;  4A3L I;  1Z03 A;  4E2Z A;  3S15 I;  2WB1 A;  1VQM 1;  1I3Q I;  1VQP Z;  1X3Z A;  1SIW A;  1W2B Z;  3CCE Z;  3RZO I;  4QTT A;  4NBD A;  2O53 A;  3FKI I;  1Y1W I;  1VQ5 1;  4BXX I;  4TNU A;  3CMA 1;  3CPW Z;  2NAP A;  3Q87 A;  1VQN Z;  4A3M I;  1YI2 1;  3I07 A;  1QVG Z;  3CC7 Z;  5D1P A;  3D2L A;  2R93 I;  1I50 I;  4QTU A;  4NBC A;  3HKZ A;  2HU9 A;  4E2W A;  2VPZ A;  3S17 I;  4HGY A;  3S1Q I;  4A3G I;  2RPR A;  2W03 A;  3K7A I;  4RV9 A;  2JA5 I;  1PFT A;  3G6E 1;  4A3B I;  2JS4 A;  3CME Z;  4A3D I;  1Q86 2;  4A3J I;  3S14 I;  3GCF A;  3CCL Z;  1Q7Y 2;  3IF8 A;  4DK1 A;  5A2Q f;  3CCQ Z;  3CCR Z;  1YIT 1;  3GTM S;  1K73 2;  3IFU A;  1K73 1;  1Y1V S;  3BG1 B;  3G4S 1;  1KQS Z;  1VQN 1;  4MD9 A;  2OTL Z;  2E7Z A;  1TWC I;  3CXC Z;  1ZH1 A;  4E31 A;  1NP6 A;  2V8K A;  2B63 I;  3CC4 1;  1X0T A;  2R7Z I;  3J81 f;  2G2K A;  3PO2 I;  5IT9 b;  1VQP 1;  1TWH I;  3VTN A;  2VPX A;  3MON A;  2V45 A;  2QR1 B;  4A3K I;  3S1M I;  4NBH A;  2VUM I;  3F3F C;  3TDH B;  2RHB A;  1RO0 A;  1YJN 1;  4A3I I;  3CC2 Z;  1VLA A;  2IZ3 A;  4Y7N I;  4NB9 A;  4BBS I;  3HOV I;  2OZK A;  1VQM Z;  1RO2 A;  3CCR 1;  3M3Y I;  4DGL A;  1VQ6 Z;  1Q81 1;  1QVF Z;  3S16 I;  3VMH A;  3TE5 B;  2E2J I;  4NB8 A;  1N8R 1;  1KQS Y;  1YIJ 1;  1VQK 1;  4HH4 A;  2JIM A;  2IZ4 A;  3J80 f;  2NVQ I;  2NVT I;  5T64 A;  2DE7 A;  1YI2 Z;  2Q4Z A;  3PO3 I;  1W2B Y;  4X6A I;  1S7M A;  1YUK A;  2O4H A;  4MH4 A;  1RNI A;  3HOU I;  3GTQ I;  3I4N I;  2R6M A;  3CCQ 1;  3JAM f;  1YJ9 Z;  3IR7 A;  1VQO Z;  3GTJ I;  3NH4 A;  4NH1 C;  3GTO I;  5T6B A;  4NBF A;  3JAM b;  3CC2 1;  2J6A A;  1RO4 A;  3G6E Z;  2JR6 A;  2OOY B;  3MZK B;  1WJ2 A;  2JNY A;  3CME 1;  1YUA A;  2JUB A;  2LIY A;  5C44 I;  4BY7 I;  2BJO A;  1RQF A;  3MZL B;  3VB9 A;  3CCL 1;  3KIH A;  3FQQ A;  2R92 I;  1YIJ Z;  2OTJ Z;  4MRI A;  2NVX I;  2AYD A;  1QYP A;  4EWC A;  3CQZ I;  2P3Y A;  3G4S Z;  2JA7 I;  3GTK I;  3PO3 S;  2JA8 I;  1S72 Z;  4A3E I;  3GTP I; 
#chains in the Genus database with same CATH homology
 4MD8 A;  4E2Y A;  4CL1 A;  2QRE B;  1WW9 A;  4NBB A;  3EED A;  2AKL A;  1JJ2 Z;  1K9M 2;  3OW2 Y;  1ML8 A;  1YHQ 1;  2RIQ A;  2QKD A;  3NH5 A;  2QRD B;  4NOZ A;  2F4M A;  1M1K 1;  3RZD I;  2OTJ 1;  3CCM 1;  1LQL A;  1K9M 1;  4RVF A;  1VQ6 1;  2QA4 Z;  1TWF I;  1YJW Z;  4RVG A;  5FLX f;  3CCS Z;  3S1R I;  1VQK Z;  1K8A 1;  1KRL A;  3IX0 A;  3ESW A;  5FLX b;  1Q82 2;  1NJI 1;  1NUI A;  1WCM I;  2M48 A;  3LUS A;  2M6N A;  3CCV Z;  3S1N I;  4E2X A;  4A3F I;  5IP7 I;  1WII A;  5IT9 f;  1NJI 2;  3I56 Z;  2DE5 A;  5T67 A;  4MON A;  4Y52 I;  4MXU A;  1VQ7 1;  5LL6 f;  4NBG A;  1ZB9 A;  3GTG I;  1TWG I;  4NBA A;  3CMA Z;  2PK7 A;  3J80 b;  3QWU A;  3CCU Z;  3CCM Z;  3CD6 1;  2VF1 A;  2JA6 I;  1USP A;  2OOX B;  3CXC Y;  3BG0 B;  1QVF Y;  4RS4 A;  4RVH A;  4S1T A;  1S72 1;  3GKQ A;  1K83 I;  1VQ4 Z;  2JMO A;  4BBR I;  1YJN Z;  3G71 1;  3H0G I;  4E32 A;  2E2H I;  1Q86 1;  2H85 A;  4MD7 A;  3CCV 1;  1KD1 1;  3S2D I;  3U50 C;  5AN9 F;  5IP9 I;  2W04 A;  2NVY I;  1VQ9 Z;  2P28 A;  3P5J B;  3I55 1;  2F4O A;  2GTI A;  1KD1 2;  3VMG A;  2QA4 1;  2YAD A;  3F3P C;  4A93 I;  3CCJ 1;  2QEX 1;  3CCU 1;  3EER A;  2YU9 I;  3CD6 Z;  3FQM A;  2PMZ A;  3J81 b;  4A3C I;  3H3V J;  2RT9 A;  3VMI A;  1R9T I;  3HOZ I;  3CCE 1;  5D1O B;  2ZAE B;  2V8I A;  1VQ4 1;  1VQL 1;  1VQO 1;  1VQ5 Z;  5A2Q b;  3NDJ A;  4NBE A;  3T4N B;  2DE6 A;  1VQ8 1;  1VQ7 Z;  2V8J A;  1YJW 1;  1X3W A;  1P9N A;  1JWH C;  1ZB8 A;  2PM9 A;  3CCS 1;  2E2I I;  2Q51 A;  4XX2 A;  1I6H I;  5C3E I;  2GU2 A;  2LFU A;  2K5R A;  1KC8 1;  2QLV B;  2E9H A;  1KC8 2;  2HF1 A;  1DL6 A;  3HOY I;  3S2H I;  5FLM I;  3NDI A;  3GTL I;  4DQY B;  2WAQ A;  3GTM I;  1JJ2 Y;  3I56 1;  1RLY A;  1L1O C;  3D6W A;  2QEX Z;  1TFI A;  3CPW Y;  2I3C A;  3CC7 1;  3HOX I;  2EGT A;  3HOW I;  2KPI A;  4E33 A;  3OW2 Z;  1Z02 A;  2QRC B;  1USP B;  4AYB A;  1VQL Z;  1SFO I;  1VQ9 1;  3NH8 A;  3D9X A;  1Q81 2;  3J7A 4;  1Q82 1;  1M90 1;  3I55 Z;  1M90 2;  4NFR A;  1YJ9 1;  1N8R 2;  4HGZ A;  1N2F A;  1Q7Y 1;  1Y1V I;  1Z01 A;  5C4J I;  3CCJ Z;  3CC4 Z;  1TWA I;  5C4X I;  3G71 Z;  1YHQ Z;  1M1K 2;  3NFZ A;  2VUG A;  1K8A 2;  1YIT Z;  2K3R A;  4RVD A;  2Y0S A;  1QVG Y;  4E30 A;  2GTH A;  3I4M I;  4BY1 I;  3M4O I;  3KIF A;  5D1O A;  2OTL 1;  1QF8 A;  2RBL A;  2KI7 B;  1VQ8 Z;  5CM2 M;  4A3L I;  1Z03 A;  4E2Z A;  3S15 I;  2WB1 A;  1VQM 1;  1I3Q I;  1VQP Z;  1X3Z A;  1W2B Z;  3CCE Z;  3RZO I;  4QTT A;  4NBD A;  2O53 A;  3FKI I;  1Y1W I;  1VQ5 1;  4BXX I;  4TNU A;  3CMA 1;  3CPW Z;  3Q87 A;  1VQN Z;  4A3M I;  1YI2 1;  3I07 A;  1QVG Z;  3CC7 Z;  5D1P A;  2R93 I;  1I50 I;  4QTU A;  4NBC A;  3HKZ A;  2HU9 A;  4E2W A;  3S17 I;  4HGY A;  3S1Q I;  4A3G I;  2RPR A;  2W03 A;  3K7A I;  4RV9 A;  2JA5 I;  1PFT A;  3G6E 1;  4A3B I;  2JS4 A;  3CME Z;  4A3D I;  1Q86 2;  4A3J I;  3S14 I;  3GCF A;  3CCL Z;  1Q7Y 2;  3IF8 A;  4DK1 A;  5A2Q f;  3CCQ Z;  3CCR Z;  1YIT 1;  3GTM S;  1K73 2;  3IFU A;  1K73 1;  1Y1V S;  3BG1 B;  3G4S 1;  1KQS Z;  1VQN 1;  4MD9 A;  2OTL Z;  1TWC I;  3CXC Z;  1ZH1 A;  4E31 A;  1NP6 A;  2V8K A;  2B63 I;  3CC4 1;  1X0T A;  2R7Z I;  3J81 f;  2G2K A;  3PO2 I;  5IT9 b;  1VQP 1;  1TWH I;  3VTN A;  3MON A;  2QR1 B;  4A3K I;  3S1M I;  4NBH A;  2VUM I;  3F3F C;  3TDH B;  2RHB A;  1RO0 A;  1YJN 1;  4A3I I;  3CC2 Z;  1VLA A;  2IZ3 A;  4Y7N I;  4NB9 A;  4BBS I;  3HOV I;  2OZK A;  1VQM Z;  1RO2 A;  3CCR 1;  3M3Y I;  4DGL A;  1VQ6 Z;  1Q81 1;  1QVF Z;  3S16 I;  3VMH A;  3TE5 B;  2E2J I;  4NB8 A;  1N8R 1;  1KQS Y;  1YIJ 1;  1VQK 1;  4HH4 A;  2IZ4 A;  3J80 f;  2NVQ I;  2NVT I;  5T64 A;  2DE7 A;  1YI2 Z;  2Q4Z A;  3PO3 I;  1W2B Y;  4X6A I;  1S7M A;  1YUK A;  2O4H A;  4MH4 A;  1RNI A;  3HOU I;  3GTQ I;  3I4N I;  2R6M A;  3CCQ 1;  3JAM f;  1YJ9 Z;  1VQO Z;  3GTJ I;  3NH4 A;  4NH1 C;  3GTO I;  5T6B A;  4NBF A;  3JAM b;  3CC2 1;  2J6A A;  1RO4 A;  3G6E Z;  2JR6 A;  2OOY B;  3MZK B;  2JNY A;  3CME 1;  1YUA A;  2JUB A;  2LIY A;  5C44 I;  4BY7 I;  2BJO A;  1RQF A;  3MZL B;  3VB9 A;  3CCL 1;  3KIH A;  3FQQ A;  2R92 I;  1YIJ Z;  2OTJ Z;  4MRI A;  2NVX I;  1QYP A;  4EWC A;  3CQZ I;  2P3Y A;  3G4S Z;  2JA7 I;  3GTK I;  3PO3 S;  2JA8 I;  1S72 Z;  4A3E I;  3GTP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...