5C44I

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 9
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I02
3ESWA 4A3GI 3S14I 2F4OA 5FLMI 2RBLA 2E2II 2DE7A 1VLAA 4NBDA 3HOZI 3H0GI 4A3MI 3FKII 2NVTI 3GTOI 3GTQI 3PO3I 3S17I 1TWHI 1Y1VS 4BY1I 1RLYA 2JA5I 2R92I 3I4MI 3RZDI 3S1RI 4NBBA 3S2HI 3GTPI 2NVXI 2JA7I 4NBFA 1TWFI 4QTUA 4Y52I 2DE5A 5C44I 2YU9I 1RO4A 2E2HI 3CQZI 2F4MA 3S15I 4A3CI 3GTMS 1TWGI 3GCFA 4A3BI 1I6HI 3GTKI 1K83I 3HOXI 3S1NI 3Q87A 3VMHA 3I07A 2E2JI 2JA6I 1ML8A 4A3EI 3I4NI 1USPB 4NBCA 1YUAA 4BBSI 1ZB9A 3EERA 1WW9A 1Y1VI 3K7AI 4A93I 5C4XI 2K5RA 3PO2I 1TWAI 4NBAA 4NB8A 4XX2A 1TFIA 4BY7I 4NBHA 1R9TI 4Y7NI 2KPIA 1X3WA 3HOUI 4BXXI 5C4JI 1DL6A 1LQLA 4BBRI 3GTLI 5IP7I 3GTMI 4NBGA 3S2DI 3M3YI 2NVYI 2JA8I 1I3QI 2BJOA 3HOYI 5CM2M 1ZB8A 2R7ZI 2VUMI 4X6AI 2JR6A 2AKLA 3GTGI 4A3FI 2R93I 1QYPA 2P3YA 3LUSA 1SFOI 3HOWI 1N2FA 3D6WA 3M4OI 4QTTA 3VB9A 2JS4A 3GTJI 4NBEA 3H3VJ 3VMGA 2JNYA 3S1QI 4A3JI 4A3DI 3PO3S 1X3ZA 3RZOI 4MH4A 1TWCI 1WCMI 3S16I 2PK7A 4A3LI 2B63I 4A3KI 3U50C 4NB9A 2J6AA 1Y1WI 5IP9I 2NVQI 3S1MI 2HF1A 3HOVI 1L1OC 4NOZA 3VMIA 4A3II 1PFTA 2DE6A 3GKQA 1I50I 5C3EI 1USPA 1NUIA
chains in the Genus database with same CATH superfamily
3ESWA 3CC4Z 5FLMI 4NH1C 1VQ71 1VLAA 4NBDA 3HOZI 3H0GI 1Y8CA 1Q811 4RS4A 3G6E1 4A3MI 3CC71 2M48A 3PO3I 1TWHI 3CXCY 2NAPA 1VQ4Z 2R92I 1YITZ 2JA7I 4QTUA 5C44I 1Z02A 2RIQA 4MONA 2YU9I 3I55Z 4E30A 3IF8A 1RO4A 5T6BA 1VQOZ 2OTL1 4A3CI 1K731 2GU2A 3CC2Z 1QVGZ 1NP6A 1KRLA 3G4S1 1KD11 2JA6I 1SIWA 3I4NI 2QRCB 4HH4A 2GTHA 3FQQA 3EERA 1WW9A 1YJ9Z 3PO2I 3OW2Z 4E32A 2AYDA 4RV9A 4XX2A 4EWCA 4BY7I 1NJI2 4BXXI 1LQLA 1VQL1 3M3YI 3CCSZ 3D9XA 3TDHB 1Z01A 3HOYI 1Q861 1VQ5Z 2O4HA 1VQP1 3GTGI 2R93I 3BG0B 1QYPA 2LEXA 2E9HA 3M4OI 3NDIA 5D1OB 3GTJI 3H3VJ 3QWUA 3VMGA 1VQ8Z 4TNUA 3PO3S 2VPZA 1YJW1 1W2BZ 2V8IA 3RZOI 3CCL1 3CCV1 2W03A 3F3FC 1YIJ1 4A3KI 3U50C 1VQ9Z 1JJ2Z 5IP9I 5IT9b 3F3PC 5IT9f 2W04A 1PFTA 2DE6A 1I50I 1NUIA 1RO2A 2IZ3A 3S14I 3I561 2RBLA 1Q821 1VQ7Z 2DE7A 1Q7Y2 1N8R1 3G6EZ 2QREB 2G2KA 3FKII 3KIHA 1VQM1 3CC7Z 2NVTI 2QRDB 3CXCZ 3KIFA 2JIQA 3TE5B 3S1RI 3GTPI 1TWFI 1M1K2 3VTNA 3J81b 2DE5A 4Y52I 1YUKA 3P5JB 3J81f 1KC81 3CQZI 2QEX1 2OTLZ 1TWGI 3CCU1 3GCFA 1I6HI 1K8A1 3IX0A 5T64A 3G4SZ 3VMHA 1VQN1 2VPWA 4A3EI 5AN9F 1USPB 1YUAA 4RVFA 1K9M2 1QF8A 2EGTA 1M901 3K7AI 5C4XI 2K5RA 2JIMA 4NBAA 1TFIA 4NBHA 1R9TI 2RT9A 4Y7NI 2KPIA 1RNIA 2M6NA 4MXUA 1VQLZ 3GTMI 3S2DI 2QA41 2IV2X 1S721 2NVYI 2BJOA 5CM2M 2R7ZI 3NFZA 1VQ61 3CME1 2JIPA 1VQPZ 3IR7A 1VQK1 4X6AI 2AKLA 2V8JA 2QKDA 2VUGA 1WZNA 2WB1A 3VB9A 4NBEA 1YJWZ 2RHBA 1YJN1 4MD8A 3CCLZ 3JAMb 2V45A 3JAMf 2LFUA 3T4NB 3CCVZ 1YIJZ 2PK7A 2HF1A 3HOVI 5D1PA 1L1OC 4MD7A 3CMA1 3GKQA 5A2Qb 5A2Qf 5FLXb 1RQFA 5FLXf 2GTIA 2F4OA 1X0TA 3I56Z 4HGZA 2E2II 1YI21 2KI7B 3CPWZ 5D1OA 1VQMZ 4DK1A 3GTOI 3GTQI 1Q812 4S1TA 1YHQ1 1RLYA 2O53A 3I4MI 3RZDI 3NH5A 4NBBA 2QEXZ 2E2HI 3CCUZ 3GTMS 4AYBA 4E2ZA 4A3BI 3GTKI 1K83I 3J80b 1K732 3Q87A 3S1NI 3J80f 3CCR1 1VQNZ 3I07A 2E2JI 2H85A 1KD12 4BBSI 1ZB9A 1Y1VI 3CCJ1 2OTJ1 4E2WA 3MONA 1ZH1A 3NH4A 2JUBA 2OOYB 2JIOA 2VPYA 3HOUI 3HKZA 5C4JI 1DL6A 3CCQ1 1P9NA 3GTLI 5IP7I 2QA4Z 1S72Z 4E2YA 2JA8I 1I3QI 3D2LA 4E31A 4RVHA 1VQ6Z 3CMEZ 2VUMI 1Q862 1VQKZ 2Y0SA 2VF1A 2OZKA 5T67A 2RPRA 3MZLB 2QLVB 1SFOI 4DQYB 3HOWI 1N2FA 3D6WA 4QTTA 3CCE1 1JWHC 2JS4A 3CD61 2JNYA 3S1QI 4A3JI 1YJNZ 4RVGA 2V8KA 3BG1B 1QVFY 2JMOA 1WCMI 3G711 3CCM1 4E33A 2VPXA 2B63I 2HU9A 1Y1WI 2OOXB 1Q16A 3S1MI 3J7A4 3CMAZ 4A3II 1S7MA 5C3EI 1KQSY 4BBRI 1Q7Y1 4A3GI 3CC41 1FDOA 1YI2Z 2PMZA 2IZ4A 4MRIA 1Q822 5LL6f 2JIRA 1N8R2 2QR1B 1YHQZ 3S17I 1Y1VS 4BY1I 2JA5I 1VQ41 1YIT1 1M1K1 3S2HI 2NVXI 4NBFA 2YADA 2WAQA 1RO0A 3I551 2F4MA 2I3CA 3S15I 1VQO1 1KC82 2K3RA 3CC21 1QVGY 3HOXI 2R6MA 3CCRZ 2LIYA 1WJ2A 3MZKB 1K8A2 1ML8A 1K9M1 1AA6A 4NBCA 4MD9A 3CCJZ 2OTJZ 1YJ91 4A93I 2V3VA 1TWAI 1M902 4HGYA 3OW2Y 4NB8A 3NH8A 2Q51A 4DGLA 1X3WA 3CCQZ 4NFRA 4NBGA 3CCS1 2P28A 1ZB8A 1VQ51 2Q4ZA 2ZAEB 2JR6A 4A3FI 3EEDA 2P3YA 3LUSA 3IFUA 3NDJA 3CCEZ 1NJI1 3FQMA 3CD6Z 2E7ZA 4E2XA 1VQ81 4A3DI 1QVFZ 4RVDA 3CPWY 1W2BY 1X3ZA 1QXFA 1WIIA 4MH4A 3G71Z 3CCMZ 1TWCI 3S16I 4A3LI 4NB9A 2J6AA 1VQ91 2NVQI 1JJ2Y 2PM9A 4NOZA 4CL1A 3VMIA 1FDIA 1Z03A 1KQSZ 1USPA
chains in the Genus database with same CATH topology
3ESWA 3CC4Z 5FLMI 4NH1C 1VQ71 1VLAA 4NBDA 3HOZI 3H0GI 1Q811 4RS4A 3G6E1 4A3MI 3CC71 2M48A 3PO3I 1TWHI 3CXCY 1VQ4Z 2R92I 1YITZ 2JA7I 4QTUA 5C44I 1Z02A 2RIQA 4MONA 2YU9I 3I55Z 4E30A 3IF8A 1RO4A 5T6BA 1VQOZ 2OTL1 4A3CI 1K731 2GU2A 3CC2Z 1QVGZ 1NP6A 1KRLA 3G4S1 1KD11 2JA6I 3I4NI 2QRCB 4HH4A 2GTHA 3FQQA 3EERA 1WW9A 1YJ9Z 3PO2I 3OW2Z 4E32A 4RV9A 4XX2A 4EWCA 4BY7I 1NJI2 4BXXI 1LQLA 1VQL1 3M3YI 3CCSZ 3D9XA 3TDHB 1Z01A 3HOYI 1Q861 1VQ5Z 2O4HA 1VQP1 3GTGI 2R93I 3BG0B 1QYPA 2E9HA 3M4OI 3NDIA 5D1OB 3GTJI 3H3VJ 3QWUA 3VMGA 1VQ8Z 4TNUA 3PO3S 1YJW1 1W2BZ 2V8IA 3RZOI 3CCL1 3CCV1 2W03A 3F3FC 1YIJ1 4A3KI 3U50C 1VQ9Z 1JJ2Z 5IP9I 5IT9b 3F3PC 5IT9f 2W04A 1PFTA 2DE6A 1I50I 1NUIA 1RO2A 2IZ3A 3S14I 3I561 2RBLA 1Q821 1VQ7Z 2DE7A 1Q7Y2 1N8R1 3G6EZ 2QREB 2G2KA 3FKII 3KIHA 1VQM1 3CC7Z 2NVTI 2QRDB 3CXCZ 3KIFA 3TE5B 3S1RI 3GTPI 1TWFI 1M1K2 3VTNA 3J81b 2DE5A 4Y52I 1YUKA 3P5JB 3J81f 1KC81 3CQZI 2QEX1 2OTLZ 1TWGI 3CCU1 3GCFA 1I6HI 1K8A1 3IX0A 5T64A 3G4SZ 3VMHA 1VQN1 4A3EI 5AN9F 1USPB 1YUAA 4RVFA 1K9M2 1QF8A 2EGTA 1M901 3K7AI 5C4XI 2K5RA 4NBAA 1TFIA 4NBHA 1R9TI 2RT9A 4Y7NI 2KPIA 1RNIA 2M6NA 4MXUA 1VQLZ 3GTMI 3S2DI 2QA41 1S721 2NVYI 2BJOA 5CM2M 2R7ZI 3NFZA 1VQ61 3CME1 1VQPZ 4X6AI 1VQK1 2AKLA 2V8JA 2QKDA 2VUGA 2WB1A 3VB9A 4NBEA 1YJWZ 2RHBA 1YJN1 4MD8A 3CCLZ 3JAMb 3JAMf 2LFUA 3T4NB 3CCVZ 1YIJZ 2PK7A 2HF1A 3HOVI 5D1PA 1L1OC 4MD7A 3CMA1 3GKQA 5A2Qb 5A2Qf 5FLXb 1RQFA 5FLXf 2GTIA 2F4OA 1X0TA 3I56Z 4HGZA 2E2II 1YI21 2KI7B 3CPWZ 5D1OA 1VQMZ 4DK1A 3GTOI 3GTQI 1Q812 4S1TA 1YHQ1 1RLYA 2O53A 3I4MI 3RZDI 3NH5A 4NBBA 2QEXZ 2E2HI 3CCUZ 3GTMS 4AYBA 4E2ZA 4A3BI 3GTKI 1K83I 3J80b 1K732 3Q87A 3S1NI 3J80f 3CCR1 1VQNZ 3I07A 2E2JI 2H85A 1KD12 4BBSI 1ZB9A 1Y1VI 3CCJ1 2OTJ1 4E2WA 3MONA 1ZH1A 3NH4A 2JUBA 2OOYB 3HOUI 3HKZA 5C4JI 1DL6A 3CCQ1 1P9NA 3GTLI 5IP7I 2QA4Z 1S72Z 4E2YA 2JA8I 1I3QI 4E31A 4RVHA 1VQ6Z 3CMEZ 2VUMI 1Q862 1VQKZ 2Y0SA 2VF1A 2OZKA 5T67A 2RPRA 3MZLB 2QLVB 1SFOI 4DQYB 3HOWI 1N2FA 3D6WA 4QTTA 3CCE1 1JWHC 2JS4A 3CD61 2JNYA 3S1QI 4A3JI 1YJNZ 4RVGA 2V8KA 3BG1B 1QVFY 2JMOA 1WCMI 3G711 3CCM1 4E33A 2B63I 2HU9A 1Y1WI 2OOXB 3S1MI 3J7A4 3CMAZ 4A3II 1S7MA 5C3EI 1KQSY 4BBRI 1Q7Y1 4A3GI 3CC41 1YI2Z 2PMZA 2IZ4A 4MRIA 1Q822 5LL6f 1N8R2 2QR1B 1YHQZ 3S17I 1Y1VS 4BY1I 2JA5I 1VQ41 1YIT1 1M1K1 3S2HI 2NVXI 4NBFA 2YADA 2WAQA 1RO0A 3I551 2F4MA 2I3CA 3S15I 1VQO1 1KC82 2K3RA 3CC21 1QVGY 3HOXI 2R6MA 3CCRZ 2LIYA 3MZKB 1K8A2 1ML8A 1K9M1 4NBCA 4MD9A 3CCJZ 2OTJZ 1YJ91 4A93I 1TWAI 1M902 4HGYA 3OW2Y 4NB8A 3NH8A 2Q51A 4DGLA 1X3WA 3CCQZ 4NFRA 4NBGA 3CCS1 2P28A 1ZB8A 1VQ51 2Q4ZA 2ZAEB 2JR6A 4A3FI 3EEDA 2P3YA 3LUSA 3IFUA 3NDJA 3CCEZ 1NJI1 3FQMA 3CD6Z 4E2XA 1VQ81 4A3DI 1QVFZ 4RVDA 3CPWY 1W2BY 1X3ZA 1WIIA 4MH4A 3G71Z 3CCMZ 1TWCI 3S16I 4A3LI 4NB9A 2J6AA 1VQ91 2NVQI 1JJ2Y 2PM9A 4NOZA 4CL1A 3VMIA 1Z03A 1KQSZ 1USPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW A;  4A3G I;  3S14 I;  2F4O A;  5FLM I;  2RBL A;  2E2I I;  2DE7 A;  1VLA A;  4NBD A;  3HOZ I;  3H0G I;  4A3M I;  3FKI I;  2NVT I;  3GTO I;  3GTQ I;  3PO3 I;  3S17 I;  1TWH I;  1Y1V S;  4BY1 I;  1RLY A;  2JA5 I;  2R92 I;  3I4M I;  3RZD I;  3S1R I;  4NBB A;  3S2H I;  3GTP I;  2NVX I;  2JA7 I;  4NBF A;  1TWF I;  4QTU A;  4Y52 I;  2DE5 A;  5C44 I;  2YU9 I;  1RO4 A;  2E2H I;  3CQZ I;  2F4M A;  3S15 I;  4A3C I;  3GTM S;  1TWG I;  3GCF A;  4A3B I;  1I6H I;  3GTK I;  1K83 I;  3HOX I;  3S1N I;  3Q87 A;  3VMH A;  3I07 A;  2E2J I;  2JA6 I;  1ML8 A;  4A3E I;  3I4N I;  1USP B;  4NBC A;  1YUA A;  4BBS I;  1ZB9 A;  3EER A;  1WW9 A;  1Y1V I;  3K7A I;  4A93 I;  5C4X I;  2K5R A;  3PO2 I;  1TWA I;  4NBA A;  4NB8 A;  4XX2 A;  1TFI A;  4BY7 I;  4NBH A;  1R9T I;  4Y7N I;  2KPI A;  1X3W A;  3HOU I;  4BXX I;  5C4J I;  1DL6 A;  1LQL A;  4BBR I;  3GTL I;  5IP7 I;  3GTM I;  4NBG A;  3S2D I;  3M3Y I;  2NVY I;  2JA8 I;  1I3Q I;  2BJO A;  3HOY I;  5CM2 M;  1ZB8 A;  2R7Z I;  2VUM I;  4X6A I;  2JR6 A;  2AKL A;  3GTG I;  4A3F I;  2R93 I;  1QYP A;  2P3Y A;  3LUS A;  1SFO I;  3HOW I;  1N2F A;  3D6W A;  3M4O I;  4QTT A;  3VB9 A;  2JS4 A;  3GTJ I;  4NBE A;  3H3V J;  3VMG A;  2JNY A;  3S1Q I;  4A3J I;  4A3D I;  3PO3 S;  1X3Z A;  3RZO I;  4MH4 A;  1TWC I;  1WCM I;  3S16 I;  2PK7 A;  4A3L I;  2B63 I;  4A3K I;  3U50 C;  4NB9 A;  2J6A A;  1Y1W I;  5IP9 I;  2NVQ I;  3S1M I;  2HF1 A;  3HOV I;  1L1O C;  4NOZ A;  3VMI A;  4A3I I;  1PFT A;  2DE6 A;  3GKQ A;  1I50 I;  5C3E I;  1USP A;  1NUI A; 
#chains in the Genus database with same CATH topology
 3ESW A;  3CC4 Z;  5FLM I;  4NH1 C;  1VQ7 1;  1VLA A;  4NBD A;  3HOZ I;  3H0G I;  1Y8C A;  1Q81 1;  4RS4 A;  3G6E 1;  4A3M I;  3CC7 1;  2M48 A;  3PO3 I;  1TWH I;  3CXC Y;  2NAP A;  1VQ4 Z;  2R92 I;  1YIT Z;  2JA7 I;  4QTU A;  5C44 I;  1Z02 A;  2RIQ A;  4MON A;  2YU9 I;  3I55 Z;  4E30 A;  3IF8 A;  1RO4 A;  5T6B A;  1VQO Z;  2OTL 1;  4A3C I;  1K73 1;  2GU2 A;  3CC2 Z;  1QVG Z;  1NP6 A;  1KRL A;  3G4S 1;  1KD1 1;  2JA6 I;  1SIW A;  3I4N I;  2QRC B;  4HH4 A;  2GTH A;  3FQQ A;  3EER A;  1WW9 A;  1YJ9 Z;  3PO2 I;  3OW2 Z;  4E32 A;  2AYD A;  4RV9 A;  4XX2 A;  4EWC A;  4BY7 I;  1NJI 2;  4BXX I;  1LQL A;  1VQL 1;  3M3Y I;  3CCS Z;  3D9X A;  3TDH B;  1Z01 A;  3HOY I;  1Q86 1;  1VQ5 Z;  2O4H A;  1VQP 1;  3GTG I;  2R93 I;  3BG0 B;  1QYP A;  2LEX A;  2E9H A;  3M4O I;  3NDI A;  5D1O B;  3GTJ I;  3H3V J;  3QWU A;  3VMG A;  1VQ8 Z;  4TNU A;  3PO3 S;  2VPZ A;  1YJW 1;  1W2B Z;  2V8I A;  3RZO I;  3CCL 1;  3CCV 1;  2W03 A;  3F3F C;  1YIJ 1;  4A3K I;  3U50 C;  1VQ9 Z;  1JJ2 Z;  5IP9 I;  5IT9 b;  3F3P C;  5IT9 f;  2W04 A;  1PFT A;  2DE6 A;  1I50 I;  1NUI A;  1RO2 A;  2IZ3 A;  3S14 I;  3I56 1;  2RBL A;  1Q82 1;  1VQ7 Z;  2DE7 A;  1Q7Y 2;  1N8R 1;  3G6E Z;  2QRE B;  2G2K A;  3FKI I;  3KIH A;  1VQM 1;  3CC7 Z;  2NVT I;  2QRD B;  3CXC Z;  3KIF A;  2JIQ A;  3TE5 B;  3S1R I;  3GTP I;  1TWF I;  1M1K 2;  3VTN A;  3J81 b;  2DE5 A;  4Y52 I;  1YUK A;  3P5J B;  3J81 f;  1KC8 1;  3CQZ I;  2QEX 1;  2OTL Z;  1TWG I;  3CCU 1;  3GCF A;  1I6H I;  1K8A 1;  3IX0 A;  5T64 A;  3G4S Z;  3VMH A;  1VQN 1;  2VPW A;  4A3E I;  5AN9 F;  1USP B;  1YUA A;  4RVF A;  1K9M 2;  1QF8 A;  2EGT A;  1M90 1;  3K7A I;  5C4X I;  2K5R A;  2JIM A;  4NBA A;  1TFI A;  4NBH A;  1R9T I;  2RT9 A;  4Y7N I;  2KPI A;  1RNI A;  2M6N A;  4MXU A;  1VQL Z;  3GTM I;  3S2D I;  2QA4 1;  2IV2 X;  1S72 1;  2NVY I;  2BJO A;  5CM2 M;  2R7Z I;  3NFZ A;  1VQ6 1;  3CME 1;  2JIP A;  1VQP Z;  3IR7 A;  1VQK 1;  4X6A I;  2AKL A;  2V8J A;  2QKD A;  2VUG A;  1WZN A;  2WB1 A;  3VB9 A;  4NBE A;  1YJW Z;  2RHB A;  1YJN 1;  4MD8 A;  3CCL Z;  3JAM b;  2V45 A;  3JAM f;  2LFU A;  3T4N B;  3CCV Z;  1YIJ Z;  2PK7 A;  2HF1 A;  3HOV I;  5D1P A;  1L1O C;  4MD7 A;  3CMA 1;  3GKQ A;  5A2Q b;  5A2Q f;  5FLX b;  1RQF A;  5FLX f;  2GTI A;  2F4O A;  1X0T A;  3I56 Z;  4HGZ A;  2E2I I;  1YI2 1;  2KI7 B;  3CPW Z;  5D1O A;  1VQM Z;  4DK1 A;  3GTO I;  3GTQ I;  1Q81 2;  4S1T A;  1YHQ 1;  1RLY A;  2O53 A;  3I4M I;  3RZD I;  3NH5 A;  4NBB A;  2QEX Z;  2E2H I;  3CCU Z;  3GTM S;  4AYB A;  4E2Z A;  4A3B I;  3GTK I;  1K83 I;  3J80 b;  1K73 2;  3Q87 A;  3S1N I;  3J80 f;  3CCR 1;  1VQN Z;  3I07 A;  2E2J I;  2H85 A;  1KD1 2;  4BBS I;  1ZB9 A;  1Y1V I;  3CCJ 1;  2OTJ 1;  4E2W A;  3MON A;  1ZH1 A;  3NH4 A;  2JUB A;  2OOY B;  2JIO A;  2VPY A;  3HOU I;  3HKZ A;  5C4J I;  1DL6 A;  3CCQ 1;  1P9N A;  3GTL I;  5IP7 I;  2QA4 Z;  1S72 Z;  4E2Y A;  2JA8 I;  1I3Q I;  3D2L A;  4E31 A;  4RVH A;  1VQ6 Z;  3CME Z;  2VUM I;  1Q86 2;  1VQK Z;  2Y0S A;  2VF1 A;  2OZK A;  5T67 A;  2RPR A;  3MZL B;  2QLV B;  1SFO I;  4DQY B;  3HOW I;  1N2F A;  3D6W A;  4QTT A;  3CCE 1;  1JWH C;  2JS4 A;  3CD6 1;  2JNY A;  3S1Q I;  4A3J I;  1YJN Z;  4RVG A;  2V8K A;  3BG1 B;  1QVF Y;  2JMO A;  1WCM I;  3G71 1;  3CCM 1;  4E33 A;  2VPX A;  2B63 I;  2HU9 A;  1Y1W I;  2OOX B;  1Q16 A;  3S1M I;  3J7A 4;  3CMA Z;  4A3I I;  1S7M A;  5C3E I;  1KQS Y;  4BBR I;  1Q7Y 1;  4A3G I;  3CC4 1;  1FDO A;  1YI2 Z;  2PMZ A;  2IZ4 A;  4MRI A;  1Q82 2;  5LL6 f;  2JIR A;  1N8R 2;  2QR1 B;  1YHQ Z;  3S17 I;  1Y1V S;  4BY1 I;  2JA5 I;  1VQ4 1;  1YIT 1;  1M1K 1;  3S2H I;  2NVX I;  4NBF A;  2YAD A;  2WAQ A;  1RO0 A;  3I55 1;  2F4M A;  2I3C A;  3S15 I;  1VQO 1;  1KC8 2;  2K3R A;  3CC2 1;  1QVG Y;  3HOX I;  2R6M A;  3CCR Z;  2LIY A;  1WJ2 A;  3MZK B;  1K8A 2;  1ML8 A;  1K9M 1;  1AA6 A;  4NBC A;  4MD9 A;  3CCJ Z;  2OTJ Z;  1YJ9 1;  4A93 I;  2V3V A;  1TWA I;  1M90 2;  4HGY A;  3OW2 Y;  4NB8 A;  3NH8 A;  2Q51 A;  4DGL A;  1X3W A;  3CCQ Z;  4NFR A;  4NBG A;  3CCS 1;  2P28 A;  1ZB8 A;  1VQ5 1;  2Q4Z A;  2ZAE B;  2JR6 A;  4A3F I;  3EED A;  2P3Y A;  3LUS A;  3IFU A;  3NDJ A;  3CCE Z;  1NJI 1;  3FQM A;  3CD6 Z;  2E7Z A;  4E2X A;  1VQ8 1;  4A3D I;  1QVF Z;  4RVD A;  3CPW Y;  1W2B Y;  1X3Z A;  1QXF A;  1WII A;  4MH4 A;  3G71 Z;  3CCM Z;  1TWC I;  3S16 I;  4A3L I;  4NB9 A;  2J6A A;  1VQ9 1;  2NVQ I;  1JJ2 Y;  2PM9 A;  4NOZ A;  4CL1 A;  3VMI A;  1FDI A;  1Z03 A;  1KQS Z;  1USP A; 
#chains in the Genus database with same CATH homology
 3ESW A;  3CC4 Z;  5FLM I;  4NH1 C;  1VQ7 1;  1VLA A;  4NBD A;  3HOZ I;  3H0G I;  1Q81 1;  4RS4 A;  3G6E 1;  4A3M I;  3CC7 1;  2M48 A;  3PO3 I;  1TWH I;  3CXC Y;  1VQ4 Z;  2R92 I;  1YIT Z;  2JA7 I;  4QTU A;  5C44 I;  1Z02 A;  2RIQ A;  4MON A;  2YU9 I;  3I55 Z;  4E30 A;  3IF8 A;  1RO4 A;  5T6B A;  1VQO Z;  2OTL 1;  4A3C I;  1K73 1;  2GU2 A;  3CC2 Z;  1QVG Z;  1NP6 A;  1KRL A;  3G4S 1;  1KD1 1;  2JA6 I;  3I4N I;  2QRC B;  4HH4 A;  2GTH A;  3FQQ A;  3EER A;  1WW9 A;  1YJ9 Z;  3PO2 I;  3OW2 Z;  4E32 A;  4RV9 A;  4XX2 A;  4EWC A;  4BY7 I;  1NJI 2;  4BXX I;  1LQL A;  1VQL 1;  3M3Y I;  3CCS Z;  3D9X A;  3TDH B;  1Z01 A;  3HOY I;  1Q86 1;  1VQ5 Z;  2O4H A;  1VQP 1;  3GTG I;  2R93 I;  3BG0 B;  1QYP A;  2E9H A;  3M4O I;  3NDI A;  5D1O B;  3GTJ I;  3H3V J;  3QWU A;  3VMG A;  1VQ8 Z;  4TNU A;  3PO3 S;  1YJW 1;  1W2B Z;  2V8I A;  3RZO I;  3CCL 1;  3CCV 1;  2W03 A;  3F3F C;  1YIJ 1;  4A3K I;  3U50 C;  1VQ9 Z;  1JJ2 Z;  5IP9 I;  5IT9 b;  3F3P C;  5IT9 f;  2W04 A;  1PFT A;  2DE6 A;  1I50 I;  1NUI A;  1RO2 A;  2IZ3 A;  3S14 I;  3I56 1;  2RBL A;  1Q82 1;  1VQ7 Z;  2DE7 A;  1Q7Y 2;  1N8R 1;  3G6E Z;  2QRE B;  2G2K A;  3FKI I;  3KIH A;  1VQM 1;  3CC7 Z;  2NVT I;  2QRD B;  3CXC Z;  3KIF A;  3TE5 B;  3S1R I;  3GTP I;  1TWF I;  1M1K 2;  3VTN A;  3J81 b;  2DE5 A;  4Y52 I;  1YUK A;  3P5J B;  3J81 f;  1KC8 1;  3CQZ I;  2QEX 1;  2OTL Z;  1TWG I;  3CCU 1;  3GCF A;  1I6H I;  1K8A 1;  3IX0 A;  5T64 A;  3G4S Z;  3VMH A;  1VQN 1;  4A3E I;  5AN9 F;  1USP B;  1YUA A;  4RVF A;  1K9M 2;  1QF8 A;  2EGT A;  1M90 1;  3K7A I;  5C4X I;  2K5R A;  4NBA A;  1TFI A;  4NBH A;  1R9T I;  2RT9 A;  4Y7N I;  2KPI A;  1RNI A;  2M6N A;  4MXU A;  1VQL Z;  3GTM I;  3S2D I;  2QA4 1;  1S72 1;  2NVY I;  2BJO A;  5CM2 M;  2R7Z I;  3NFZ A;  1VQ6 1;  3CME 1;  1VQP Z;  4X6A I;  1VQK 1;  2AKL A;  2V8J A;  2QKD A;  2VUG A;  2WB1 A;  3VB9 A;  4NBE A;  1YJW Z;  2RHB A;  1YJN 1;  4MD8 A;  3CCL Z;  3JAM b;  3JAM f;  2LFU A;  3T4N B;  3CCV Z;  1YIJ Z;  2PK7 A;  2HF1 A;  3HOV I;  5D1P A;  1L1O C;  4MD7 A;  3CMA 1;  3GKQ A;  5A2Q b;  5A2Q f;  5FLX b;  1RQF A;  5FLX f;  2GTI A;  2F4O A;  1X0T A;  3I56 Z;  4HGZ A;  2E2I I;  1YI2 1;  2KI7 B;  3CPW Z;  5D1O A;  1VQM Z;  4DK1 A;  3GTO I;  3GTQ I;  1Q81 2;  4S1T A;  1YHQ 1;  1RLY A;  2O53 A;  3I4M I;  3RZD I;  3NH5 A;  4NBB A;  2QEX Z;  2E2H I;  3CCU Z;  3GTM S;  4AYB A;  4E2Z A;  4A3B I;  3GTK I;  1K83 I;  3J80 b;  1K73 2;  3Q87 A;  3S1N I;  3J80 f;  3CCR 1;  1VQN Z;  3I07 A;  2E2J I;  2H85 A;  1KD1 2;  4BBS I;  1ZB9 A;  1Y1V I;  3CCJ 1;  2OTJ 1;  4E2W A;  3MON A;  1ZH1 A;  3NH4 A;  2JUB A;  2OOY B;  3HOU I;  3HKZ A;  5C4J I;  1DL6 A;  3CCQ 1;  1P9N A;  3GTL I;  5IP7 I;  2QA4 Z;  1S72 Z;  4E2Y A;  2JA8 I;  1I3Q I;  4E31 A;  4RVH A;  1VQ6 Z;  3CME Z;  2VUM I;  1Q86 2;  1VQK Z;  2Y0S A;  2VF1 A;  2OZK A;  5T67 A;  2RPR A;  3MZL B;  2QLV B;  1SFO I;  4DQY B;  3HOW I;  1N2F A;  3D6W A;  4QTT A;  3CCE 1;  1JWH C;  2JS4 A;  3CD6 1;  2JNY A;  3S1Q I;  4A3J I;  1YJN Z;  4RVG A;  2V8K A;  3BG1 B;  1QVF Y;  2JMO A;  1WCM I;  3G71 1;  3CCM 1;  4E33 A;  2B63 I;  2HU9 A;  1Y1W I;  2OOX B;  3S1M I;  3J7A 4;  3CMA Z;  4A3I I;  1S7M A;  5C3E I;  1KQS Y;  4BBR I;  1Q7Y 1;  4A3G I;  3CC4 1;  1YI2 Z;  2PMZ A;  2IZ4 A;  4MRI A;  1Q82 2;  5LL6 f;  1N8R 2;  2QR1 B;  1YHQ Z;  3S17 I;  1Y1V S;  4BY1 I;  2JA5 I;  1VQ4 1;  1YIT 1;  1M1K 1;  3S2H I;  2NVX I;  4NBF A;  2YAD A;  2WAQ A;  1RO0 A;  3I55 1;  2F4M A;  2I3C A;  3S15 I;  1VQO 1;  1KC8 2;  2K3R A;  3CC2 1;  1QVG Y;  3HOX I;  2R6M A;  3CCR Z;  2LIY A;  3MZK B;  1K8A 2;  1ML8 A;  1K9M 1;  4NBC A;  4MD9 A;  3CCJ Z;  2OTJ Z;  1YJ9 1;  4A93 I;  1TWA I;  1M90 2;  4HGY A;  3OW2 Y;  4NB8 A;  3NH8 A;  2Q51 A;  4DGL A;  1X3W A;  3CCQ Z;  4NFR A;  4NBG A;  3CCS 1;  2P28 A;  1ZB8 A;  1VQ5 1;  2Q4Z A;  2ZAE B;  2JR6 A;  4A3F I;  3EED A;  2P3Y A;  3LUS A;  3IFU A;  3NDJ A;  3CCE Z;  1NJI 1;  3FQM A;  3CD6 Z;  4E2X A;  1VQ8 1;  4A3D I;  1QVF Z;  4RVD A;  3CPW Y;  1W2B Y;  1X3Z A;  1WII A;  4MH4 A;  3G71 Z;  3CCM Z;  1TWC I;  3S16 I;  4A3L I;  4NB9 A;  2J6A A;  1VQ9 1;  2NVQ I;  1JJ2 Y;  2PM9 A;  4NOZ A;  4CL1 A;  3VMI A;  1Z03 A;  1KQS Z;  1USP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...