5C44I

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 9
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c44I02
4NBGA 1PFTA 2JR6A 3I07A 1Y1VI 3FKII 3S17I 3S1QI 3HOXI 3HOYI 3PO2I 3S1NI 3GCFA 2E2JI 1RO4A 1TWCI 4NBFA 1USPA 4A3DI 3GTPI 5C4XI 1WW9A 1K83I 2J6AA 3VMIA 2JA5I 3PO3I 5C4JI 1I50I 4A3CI 4A3MI 2R7ZI 3H3VJ 3M3YI 2F4OA 1RLYA 4NBCA 1TFIA 1WCMI 2VUMI 2DE5A 2R93I 3U50C 3HOUI 2NVQI 3GKQA 3RZDI 2P3YA 2DE6A 2JA8I 4MH4A 4A93I 4BY7I 1TWHI 5C44I 1N2FA 1ZB8A 3ESWA 3VMHA 4NB9A 3GTOI 4BY1I 2AKLA 5CM2M 3GTMS 4NBEA 4A3GI 4BXXI 4A3II 2K5RA 3GTLI 2DE7A 4A3FI 1DL6A 4A3EI 2JNYA 4NBAA 3GTKI 4NBBA 2E2HI 3Q87A 4A3KI 4Y7NI 2KPIA 3K7AI 2JA7I 1Y1VS 3M4OI 3EERA 3GTGI 2JA6I 3I4NI 2E2II 3S1RI 3VMGA 1R9TI 3RZOI 4XX2A 1LQLA 1ML8A 3HOVI 4NOZA 3LUSA 3S15I 1TWAI 4NB8A 3PO3S 2JS4A 2R92I 2HF1A 3S14I 3S16I 4QTTA 1NUIA 1SFOI 2RBLA 1X3ZA 1TWGI 1Y1WI 1TWFI 5IP9I 4X6AI 4BBSI 2B63I 3S2HI 4NBDA 1ZB9A 3HOWI 3S1MI 2PK7A 3S2DI 3I4MI 3H0GI 5IP7I 3GTJI 4A3JI 4A3BI 1VLAA 3HOZI 3VB9A 1L1OC 1X3WA 5C3EI 1I3QI 4A3LI 1YUAA 3GTMI 4Y52I 5FLMI 2BJOA 2YU9I 2NVYI 3D6WA 2NVXI 4QTUA 1USPB 3CQZI 4BBRI 3GTQI 1QYPA 2NVTI 4NBHA 2F4MA 1I6HI
chains in the Genus database with same CATH superfamily
3I56Z 2VPWA 2OTJ1 4CL1A 3CCR1 3FKII 3S17I 2QA41 1KC81 4MXUA 3GCFA 3CC71 2E2JI 1W2BY 5C4XI 2JA5I 4E30A 2M48A 1M902 4A3MI 2R7ZI 3CCV1 4E2YA 3H3VJ 3M3YI 3CC2Z 1TFIA 5A2Qb 1K8A2 3IF8A 2PM9A 4E2WA 2YADA 1RO0A 2O4HA 2NVQI 1Q861 1Z03A 1QVGZ 1VQPZ 1N2FA 1ZB8A 3OW2Y 1KD12 4BY1I 5CM2M 3GTMS 4NBEA 2OTL1 2OTJZ 1VQ5Z 2QRDB 1YJ91 3CC7Z 4A3FI 3G6EZ 2G2KA 2JNYA 2E2HI 4Y7NI 2KPIA 2GTIA 3K7AI 1QF8A 2QKDA 3EERA 2JA6I 1RNIA 2E2II 3VMGA 4DQYB 1Q812 1NJI1 3CCVZ 4NOZA 1YJW1 5AN9F 1VQM1 3S16I 3S14I 1Q7Y2 3D2LA 1VQOZ 1NUIA 2I3CA 2VPYA 1YIJ1 1YI21 2B63I 3S2HI 1ZB9A 3S1MI 2KI7B 3KIFA 1QVGY 3H0GI 5IP7I 3JAMf 4A3JI 2OTLZ 3VB9A 2R6MA 1YJ9Z 4A3LI 1YUAA 4MD9A 5FLMI 3BG0B 4AYBA 3CQZI 4NBHA 2F4MA 2H85A 5D1OB 1YJWZ 3S1QI 3HOYI 3PO2I 4DGLA 5IT9f 1VQMZ 3NDIA 1TWCI 4RVFA 1USPA 3J7A4 4MD7A 4A3DI 1K9M1 2LEXA 2V3VA 1YIJZ 2J6AA 1AA6A 3I551 5C4JI 1FDOA 3NH5A 1I50I 4A3CI 1JJ2Z 2LIYA 1M1K1 2W04A 1RLYA 1SIWA 1WCMI 3CMEZ 3CCJ1 2R93I 2DE5A 1QXFA 1VQ51 3HOUI 1Q821 2P3YA 1Y8CA 3G6E1 4A93I 3HKZA 2P28A 3VMHA 2RIQA 3EEDA 2RT9A 3BG1B 3NDJA 4E32A 1N8R2 4TNUA 1RO2A 4A3II 4A3EI 3CC41 4NBAA 4NBBA 1ZH1A 1VQO1 2JA7I 1YIT1 3I55Z 3CD61 3JAMb 4DK1A 1ML8A 1JJ2Y 4RVHA 2QREB 4RV9A 3CCJZ 2JS4A 2W03A 2HF1A 1VQLZ 1Z01A 2GU2A 2JIPA 1X3ZA 4X6AI 3HOWI 3IX0A 3CMA1 3S2DI 1WZNA 2VPXA 3GTJI 3IFUA 3KIHA 1K8A1 5IT9b 1WIIA 1I3QI 1VQ6Z 3CC4Z 1VQ81 3F3FC 3D6WA 3CCL1 1K731 5D1OA 4BBRI 1QYPA 2EGTA 2PMZA 1YUKA 2Q51A 1YITZ 1S721 1KD11 3CD6Z 4NBGA 1PFTA 2WB1A 4MRIA 3CCQ1 1FDIA 2E9HA 1VQ41 1RO4A 2V8KA 3CME1 2RPRA 2JUBA 3CCM1 3G711 1WW9A 1K83I 3NH4A 3VMIA 3PO3I 2O53A 2E7ZA 3CMAZ 1Q811 2LFUA 2F4OA 1QVFZ 2IZ4A 2VUMI 3U50C 1Q7Y1 3RZDI 5FLXf 1VQ8Z 3CCLZ 2DE6A 2JA8I 4MH4A 4BY7I 1TWHI 2V8IA 5C44I 3ESWA 1Q16A 3GTOI 1S72Z 1Z02A 3MZLB 3J81f 1Q822 1KC82 3J80f 3CCQZ 2OZKA 2K5RA 1VQ4Z 1VQK1 3T4NB 2NAPA 4NH1C 3CCS1 1VQL1 3CCMZ 3TE5B 2QEX1 1RQFA 3G71Z 3M4OI 3GTGI 3S1RI 1P9NA 4XX2A 3HOVI 3LUSA 4NB8A 3PO3S 3NFZA 1QVFY 2K3RA 1Q862 1TWGI 1Y1WI 1VQ61 5IP9I 3G4SZ 4BBSI 3FQQA 2PK7A 3IR7A 4S1TA 3I4MI 4EWCA 2OOYB 2HU9A 1L1OC 2V45A 1X3WA 4HGZA 1VQKZ 1YHQ1 2BJOA 4E2ZA 2NVYI 3CCSZ 2QEXZ 2QLVB 2NVXI 2JIQA 1USPB 4QTUA 1X0TA 2JIMA 1VQN1 3CPWZ 2JR6A 1I6HI 2OOXB 3CXCZ 1NJI2 3NH8A 3I07A 1Y1VI 2VUGA 3HOXI 1KRLA 2WAQA 1N8R1 1K732 1VQ9Z 1M901 3CCUZ 1KQSZ 1VQ71 3S1NI 2VPZA 5FLXb 4NBFA 3P5JB 3GTPI 1YJN1 3CCRZ 2Q4ZA 4E33A 2QA4Z 3J81b 3J80b 4NBCA 1WJ2A 2IZ3A 4MD8A 3MZKB 2QRCB 3GKQA 1YHQZ 2ZAEB 4NFRA 4RS4A 4HGYA 3VTNA 1VQNZ 4NB9A 2V8JA 4E31A 2AKLA 3QWUA 1S7MA 3CPWY 4MONA 4A3GI 3CXCY 4BXXI 5A2Qf 1JWHC 3TDHB 1VQ7Z 3GTLI 2DE7A 1DL6A 5T64A 3GTKI 1KQSY 3CCE1 2RHBA 1K9M2 3Q87A 4A3KI 5D1PA 1YJNZ 1Y1VS 2QR1B 3I4NI 3MONA 1R9TI 3I561 3RZOI 3G4S1 1M1K2 1LQLA 3D9XA 5T67A 3S15I 1TWAI 5LL6f 2R92I 2JMOA 4QTTA 2IV2X 1W2BZ 4E2XA 4RVDA 1SFOI 2RBLA 2VF1A 1TWFI 3FQMA 4HH4A 4NBDA 2M6NA 2Y0SA 2JIOA 4A3BI 3CC21 1VLAA 3HOZI 2JIRA 4RVGA 2GTHA 5C3EI 1NP6A 4Y52I 3GTMI 2AYDA 5T6BA 1VQ91 1YI2Z 3CCU1 2YU9I 3CCEZ 3OW2Z 1VQP1 3F3PC 3GTQI 2NVTI
chains in the Genus database with same CATH topology
3I56Z 2OTJ1 4CL1A 3CCR1 3FKII 3S17I 2QA41 1KC81 4MXUA 3GCFA 3CC71 2E2JI 1W2BY 5C4XI 2JA5I 4E30A 2M48A 1M902 4A3MI 2R7ZI 3CCV1 4E2YA 3H3VJ 3M3YI 3CC2Z 1TFIA 5A2Qb 1K8A2 3IF8A 2PM9A 4E2WA 2YADA 1RO0A 2O4HA 2NVQI 1Q861 1Z03A 1QVGZ 1VQPZ 1N2FA 1ZB8A 3OW2Y 1KD12 4BY1I 5CM2M 3GTMS 4NBEA 2OTL1 2OTJZ 1VQ5Z 2QRDB 1YJ91 3CC7Z 4A3FI 3G6EZ 2G2KA 2JNYA 2E2HI 4Y7NI 2KPIA 2GTIA 3K7AI 1QF8A 2QKDA 3EERA 2JA6I 1RNIA 2E2II 3VMGA 4DQYB 1Q812 1NJI1 3CCVZ 4NOZA 1YJW1 5AN9F 1VQM1 3S16I 3S14I 1Q7Y2 1VQOZ 1NUIA 2I3CA 1YIJ1 1YI21 2B63I 3S2HI 1ZB9A 3S1MI 2KI7B 3KIFA 1QVGY 3H0GI 5IP7I 3JAMf 4A3JI 2OTLZ 3VB9A 2R6MA 1YJ9Z 4A3LI 1YUAA 4MD9A 5FLMI 3BG0B 4AYBA 3CQZI 4NBHA 2F4MA 2H85A 5D1OB 1YJWZ 3S1QI 3HOYI 3PO2I 4DGLA 5IT9f 1VQMZ 3NDIA 1TWCI 4RVFA 1USPA 3J7A4 4MD7A 4A3DI 1K9M1 1YIJZ 2J6AA 3I551 5C4JI 3NH5A 1I50I 4A3CI 1JJ2Z 2LIYA 1M1K1 2W04A 1RLYA 1WCMI 3CMEZ 3CCJ1 2R93I 2DE5A 1VQ51 3HOUI 1Q821 2P3YA 3G6E1 4A93I 3HKZA 2P28A 3VMHA 2RIQA 3EEDA 2RT9A 3BG1B 3NDJA 4E32A 1N8R2 4TNUA 1RO2A 4A3II 4A3EI 3CC41 4NBAA 4NBBA 1ZH1A 1VQO1 2JA7I 1YIT1 3I55Z 3CD61 3JAMb 4DK1A 1ML8A 1JJ2Y 4RVHA 2QREB 4RV9A 3CCJZ 2JS4A 2W03A 2HF1A 1VQLZ 1Z01A 2GU2A 1X3ZA 4X6AI 3HOWI 3IX0A 3CMA1 3S2DI 3GTJI 3IFUA 3KIHA 1K8A1 5IT9b 1WIIA 1I3QI 1VQ6Z 3CC4Z 1VQ81 3F3FC 3D6WA 3CCL1 1K731 5D1OA 4BBRI 1QYPA 2EGTA 2PMZA 1YUKA 2Q51A 1YITZ 1S721 1KD11 3CD6Z 4NBGA 1PFTA 2WB1A 4MRIA 3CCQ1 2E9HA 1VQ41 1RO4A 2V8KA 3CME1 2RPRA 2JUBA 3CCM1 3G711 1WW9A 1K83I 3NH4A 3VMIA 3PO3I 2O53A 3CMAZ 1Q811 2LFUA 2F4OA 1QVFZ 2IZ4A 2VUMI 3U50C 1Q7Y1 3RZDI 5FLXf 1VQ8Z 3CCLZ 2DE6A 2JA8I 4MH4A 4BY7I 1TWHI 2V8IA 5C44I 3ESWA 3GTOI 1S72Z 1Z02A 3MZLB 3J81f 1Q822 1KC82 3J80f 3CCQZ 2OZKA 2K5RA 1VQ4Z 1VQK1 3T4NB 4NH1C 3CCS1 1VQL1 3CCMZ 3TE5B 2QEX1 1RQFA 3G71Z 3M4OI 3GTGI 3S1RI 1P9NA 4XX2A 3HOVI 3LUSA 4NB8A 3PO3S 3NFZA 1QVFY 2K3RA 1Q862 1TWGI 1Y1WI 1VQ61 5IP9I 3G4SZ 4BBSI 3FQQA 2PK7A 4S1TA 3I4MI 4EWCA 2OOYB 2HU9A 1L1OC 1X3WA 4HGZA 1VQKZ 1YHQ1 2BJOA 4E2ZA 2NVYI 3CCSZ 2QEXZ 2QLVB 2NVXI 4QTUA 1USPB 1X0TA 1VQN1 3CPWZ 2JR6A 1I6HI 2OOXB 3CXCZ 1NJI2 3NH8A 3I07A 1Y1VI 2VUGA 3HOXI 1KRLA 2WAQA 1N8R1 1K732 1VQ9Z 1M901 3CCUZ 1KQSZ 1VQ71 3S1NI 5FLXb 4NBFA 3P5JB 3GTPI 1YJN1 3CCRZ 2Q4ZA 4E33A 2QA4Z 3J81b 3J80b 4NBCA 2IZ3A 4MD8A 3MZKB 2QRCB 3GKQA 1YHQZ 2ZAEB 4NFRA 4RS4A 4HGYA 3VTNA 1VQNZ 4NB9A 2V8JA 4E31A 2AKLA 3QWUA 1S7MA 3CPWY 4MONA 4A3GI 3CXCY 4BXXI 5A2Qf 1JWHC 3TDHB 1VQ7Z 3GTLI 2DE7A 1DL6A 5T64A 3GTKI 1KQSY 3CCE1 2RHBA 1K9M2 3Q87A 4A3KI 5D1PA 1YJNZ 1Y1VS 2QR1B 3I4NI 3MONA 1R9TI 3I561 3RZOI 3G4S1 1M1K2 1LQLA 3D9XA 5T67A 3S15I 1TWAI 5LL6f 2R92I 2JMOA 4QTTA 1W2BZ 4E2XA 4RVDA 1SFOI 2RBLA 2VF1A 1TWFI 3FQMA 4HH4A 4NBDA 2M6NA 2Y0SA 4A3BI 3CC21 1VLAA 3HOZI 4RVGA 2GTHA 5C3EI 1NP6A 4Y52I 3GTMI 5T6BA 1VQ91 1YI2Z 3CCU1 2YU9I 3CCEZ 3OW2Z 1VQP1 3F3PC 3GTQI 2NVTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBG A;  1PFT A;  2JR6 A;  3I07 A;  1Y1V I;  3FKI I;  3S17 I;  3S1Q I;  3HOX I;  3HOY I;  3PO2 I;  3S1N I;  3GCF A;  2E2J I;  1RO4 A;  1TWC I;  4NBF A;  1USP A;  4A3D I;  3GTP I;  5C4X I;  1WW9 A;  1K83 I;  2J6A A;  3VMI A;  2JA5 I;  3PO3 I;  5C4J I;  1I50 I;  4A3C I;  4A3M I;  2R7Z I;  3H3V J;  3M3Y I;  2F4O A;  1RLY A;  4NBC A;  1TFI A;  1WCM I;  2VUM I;  2DE5 A;  2R93 I;  3U50 C;  3HOU I;  2NVQ I;  3GKQ A;  3RZD I;  2P3Y A;  2DE6 A;  2JA8 I;  4MH4 A;  4A93 I;  4BY7 I;  1TWH I;  5C44 I;  1N2F A;  1ZB8 A;  3ESW A;  3VMH A;  4NB9 A;  3GTO I;  4BY1 I;  2AKL A;  5CM2 M;  3GTM S;  4NBE A;  4A3G I;  4BXX I;  4A3I I;  2K5R A;  3GTL I;  2DE7 A;  4A3F I;  1DL6 A;  4A3E I;  2JNY A;  4NBA A;  3GTK I;  4NBB A;  2E2H I;  3Q87 A;  4A3K I;  4Y7N I;  2KPI A;  3K7A I;  2JA7 I;  1Y1V S;  3M4O I;  3EER A;  3GTG I;  2JA6 I;  3I4N I;  2E2I I;  3S1R I;  3VMG A;  1R9T I;  3RZO I;  4XX2 A;  1LQL A;  1ML8 A;  3HOV I;  4NOZ A;  3LUS A;  3S15 I;  1TWA I;  4NB8 A;  3PO3 S;  2JS4 A;  2R92 I;  2HF1 A;  3S14 I;  3S16 I;  4QTT A;  1NUI A;  1SFO I;  2RBL A;  1X3Z A;  1TWG I;  1Y1W I;  1TWF I;  5IP9 I;  4X6A I;  4BBS I;  2B63 I;  3S2H I;  4NBD A;  1ZB9 A;  3HOW I;  3S1M I;  2PK7 A;  3S2D I;  3I4M I;  3H0G I;  5IP7 I;  3GTJ I;  4A3J I;  4A3B I;  1VLA A;  3HOZ I;  3VB9 A;  1L1O C;  1X3W A;  5C3E I;  1I3Q I;  4A3L I;  1YUA A;  3GTM I;  4Y52 I;  5FLM I;  2BJO A;  2YU9 I;  2NVY I;  3D6W A;  2NVX I;  4QTU A;  1USP B;  3CQZ I;  4BBR I;  3GTQ I;  1QYP A;  2NVT I;  4NBH A;  2F4M A;  1I6H I; 
#chains in the Genus database with same CATH topology
 3I56 Z;  2VPW A;  2OTJ 1;  4CL1 A;  3CCR 1;  3FKI I;  3S17 I;  2QA4 1;  1KC8 1;  4MXU A;  3GCF A;  3CC7 1;  2E2J I;  1W2B Y;  5C4X I;  2JA5 I;  4E30 A;  2M48 A;  1M90 2;  4A3M I;  2R7Z I;  3CCV 1;  4E2Y A;  3H3V J;  3M3Y I;  3CC2 Z;  1TFI A;  5A2Q b;  1K8A 2;  3IF8 A;  2PM9 A;  4E2W A;  2YAD A;  1RO0 A;  2O4H A;  2NVQ I;  1Q86 1;  1Z03 A;  1QVG Z;  1VQP Z;  1N2F A;  1ZB8 A;  3OW2 Y;  1KD1 2;  4BY1 I;  5CM2 M;  3GTM S;  4NBE A;  2OTL 1;  2OTJ Z;  1VQ5 Z;  2QRD B;  1YJ9 1;  3CC7 Z;  4A3F I;  3G6E Z;  2G2K A;  2JNY A;  2E2H I;  4Y7N I;  2KPI A;  2GTI A;  3K7A I;  1QF8 A;  2QKD A;  3EER A;  2JA6 I;  1RNI A;  2E2I I;  3VMG A;  4DQY B;  1Q81 2;  1NJI 1;  3CCV Z;  4NOZ A;  1YJW 1;  5AN9 F;  1VQM 1;  3S16 I;  3S14 I;  1Q7Y 2;  3D2L A;  1VQO Z;  1NUI A;  2I3C A;  2VPY A;  1YIJ 1;  1YI2 1;  2B63 I;  3S2H I;  1ZB9 A;  3S1M I;  2KI7 B;  3KIF A;  1QVG Y;  3H0G I;  5IP7 I;  3JAM f;  4A3J I;  2OTL Z;  3VB9 A;  2R6M A;  1YJ9 Z;  4A3L I;  1YUA A;  4MD9 A;  5FLM I;  3BG0 B;  4AYB A;  3CQZ I;  4NBH A;  2F4M A;  2H85 A;  5D1O B;  1YJW Z;  3S1Q I;  3HOY I;  3PO2 I;  4DGL A;  5IT9 f;  1VQM Z;  3NDI A;  1TWC I;  4RVF A;  1USP A;  3J7A 4;  4MD7 A;  4A3D I;  1K9M 1;  2LEX A;  2V3V A;  1YIJ Z;  2J6A A;  1AA6 A;  3I55 1;  5C4J I;  1FDO A;  3NH5 A;  1I50 I;  4A3C I;  1JJ2 Z;  2LIY A;  1M1K 1;  2W04 A;  1RLY A;  1SIW A;  1WCM I;  3CME Z;  3CCJ 1;  2R93 I;  2DE5 A;  1QXF A;  1VQ5 1;  3HOU I;  1Q82 1;  2P3Y A;  1Y8C A;  3G6E 1;  4A93 I;  3HKZ A;  2P28 A;  3VMH A;  2RIQ A;  3EED A;  2RT9 A;  3BG1 B;  3NDJ A;  4E32 A;  1N8R 2;  4TNU A;  1RO2 A;  4A3I I;  4A3E I;  3CC4 1;  4NBA A;  4NBB A;  1ZH1 A;  1VQO 1;  2JA7 I;  1YIT 1;  3I55 Z;  3CD6 1;  3JAM b;  4DK1 A;  1ML8 A;  1JJ2 Y;  4RVH A;  2QRE B;  4RV9 A;  3CCJ Z;  2JS4 A;  2W03 A;  2HF1 A;  1VQL Z;  1Z01 A;  2GU2 A;  2JIP A;  1X3Z A;  4X6A I;  3HOW I;  3IX0 A;  3CMA 1;  3S2D I;  1WZN A;  2VPX A;  3GTJ I;  3IFU A;  3KIH A;  1K8A 1;  5IT9 b;  1WII A;  1I3Q I;  1VQ6 Z;  3CC4 Z;  1VQ8 1;  3F3F C;  3D6W A;  3CCL 1;  1K73 1;  5D1O A;  4BBR I;  1QYP A;  2EGT A;  2PMZ A;  1YUK A;  2Q51 A;  1YIT Z;  1S72 1;  1KD1 1;  3CD6 Z;  4NBG A;  1PFT A;  2WB1 A;  4MRI A;  3CCQ 1;  1FDI A;  2E9H A;  1VQ4 1;  1RO4 A;  2V8K A;  3CME 1;  2RPR A;  2JUB A;  3CCM 1;  3G71 1;  1WW9 A;  1K83 I;  3NH4 A;  3VMI A;  3PO3 I;  2O53 A;  2E7Z A;  3CMA Z;  1Q81 1;  2LFU A;  2F4O A;  1QVF Z;  2IZ4 A;  2VUM I;  3U50 C;  1Q7Y 1;  3RZD I;  5FLX f;  1VQ8 Z;  3CCL Z;  2DE6 A;  2JA8 I;  4MH4 A;  4BY7 I;  1TWH I;  2V8I A;  5C44 I;  3ESW A;  1Q16 A;  3GTO I;  1S72 Z;  1Z02 A;  3MZL B;  3J81 f;  1Q82 2;  1KC8 2;  3J80 f;  3CCQ Z;  2OZK A;  2K5R A;  1VQ4 Z;  1VQK 1;  3T4N B;  2NAP A;  4NH1 C;  3CCS 1;  1VQL 1;  3CCM Z;  3TE5 B;  2QEX 1;  1RQF A;  3G71 Z;  3M4O I;  3GTG I;  3S1R I;  1P9N A;  4XX2 A;  3HOV I;  3LUS A;  4NB8 A;  3PO3 S;  3NFZ A;  1QVF Y;  2K3R A;  1Q86 2;  1TWG I;  1Y1W I;  1VQ6 1;  5IP9 I;  3G4S Z;  4BBS I;  3FQQ A;  2PK7 A;  3IR7 A;  4S1T A;  3I4M I;  4EWC A;  2OOY B;  2HU9 A;  1L1O C;  2V45 A;  1X3W A;  4HGZ A;  1VQK Z;  1YHQ 1;  2BJO A;  4E2Z A;  2NVY I;  3CCS Z;  2QEX Z;  2QLV B;  2NVX I;  2JIQ A;  1USP B;  4QTU A;  1X0T A;  2JIM A;  1VQN 1;  3CPW Z;  2JR6 A;  1I6H I;  2OOX B;  3CXC Z;  1NJI 2;  3NH8 A;  3I07 A;  1Y1V I;  2VUG A;  3HOX I;  1KRL A;  2WAQ A;  1N8R 1;  1K73 2;  1VQ9 Z;  1M90 1;  3CCU Z;  1KQS Z;  1VQ7 1;  3S1N I;  2VPZ A;  5FLX b;  4NBF A;  3P5J B;  3GTP I;  1YJN 1;  3CCR Z;  2Q4Z A;  4E33 A;  2QA4 Z;  3J81 b;  3J80 b;  4NBC A;  1WJ2 A;  2IZ3 A;  4MD8 A;  3MZK B;  2QRC B;  3GKQ A;  1YHQ Z;  2ZAE B;  4NFR A;  4RS4 A;  4HGY A;  3VTN A;  1VQN Z;  4NB9 A;  2V8J A;  4E31 A;  2AKL A;  3QWU A;  1S7M A;  3CPW Y;  4MON A;  4A3G I;  3CXC Y;  4BXX I;  5A2Q f;  1JWH C;  3TDH B;  1VQ7 Z;  3GTL I;  2DE7 A;  1DL6 A;  5T64 A;  3GTK I;  1KQS Y;  3CCE 1;  2RHB A;  1K9M 2;  3Q87 A;  4A3K I;  5D1P A;  1YJN Z;  1Y1V S;  2QR1 B;  3I4N I;  3MON A;  1R9T I;  3I56 1;  3RZO I;  3G4S 1;  1M1K 2;  1LQL A;  3D9X A;  5T67 A;  3S15 I;  1TWA I;  5LL6 f;  2R92 I;  2JMO A;  4QTT A;  2IV2 X;  1W2B Z;  4E2X A;  4RVD A;  1SFO I;  2RBL A;  2VF1 A;  1TWF I;  3FQM A;  4HH4 A;  4NBD A;  2M6N A;  2Y0S A;  2JIO A;  4A3B I;  3CC2 1;  1VLA A;  3HOZ I;  2JIR A;  4RVG A;  2GTH A;  5C3E I;  1NP6 A;  4Y52 I;  3GTM I;  2AYD A;  5T6B A;  1VQ9 1;  1YI2 Z;  3CCU 1;  2YU9 I;  3CCE Z;  3OW2 Z;  1VQP 1;  3F3P C;  3GTQ I;  2NVT I; 
#chains in the Genus database with same CATH homology
 3I56 Z;  2OTJ 1;  4CL1 A;  3CCR 1;  3FKI I;  3S17 I;  2QA4 1;  1KC8 1;  4MXU A;  3GCF A;  3CC7 1;  2E2J I;  1W2B Y;  5C4X I;  2JA5 I;  4E30 A;  2M48 A;  1M90 2;  4A3M I;  2R7Z I;  3CCV 1;  4E2Y A;  3H3V J;  3M3Y I;  3CC2 Z;  1TFI A;  5A2Q b;  1K8A 2;  3IF8 A;  2PM9 A;  4E2W A;  2YAD A;  1RO0 A;  2O4H A;  2NVQ I;  1Q86 1;  1Z03 A;  1QVG Z;  1VQP Z;  1N2F A;  1ZB8 A;  3OW2 Y;  1KD1 2;  4BY1 I;  5CM2 M;  3GTM S;  4NBE A;  2OTL 1;  2OTJ Z;  1VQ5 Z;  2QRD B;  1YJ9 1;  3CC7 Z;  4A3F I;  3G6E Z;  2G2K A;  2JNY A;  2E2H I;  4Y7N I;  2KPI A;  2GTI A;  3K7A I;  1QF8 A;  2QKD A;  3EER A;  2JA6 I;  1RNI A;  2E2I I;  3VMG A;  4DQY B;  1Q81 2;  1NJI 1;  3CCV Z;  4NOZ A;  1YJW 1;  5AN9 F;  1VQM 1;  3S16 I;  3S14 I;  1Q7Y 2;  1VQO Z;  1NUI A;  2I3C A;  1YIJ 1;  1YI2 1;  2B63 I;  3S2H I;  1ZB9 A;  3S1M I;  2KI7 B;  3KIF A;  1QVG Y;  3H0G I;  5IP7 I;  3JAM f;  4A3J I;  2OTL Z;  3VB9 A;  2R6M A;  1YJ9 Z;  4A3L I;  1YUA A;  4MD9 A;  5FLM I;  3BG0 B;  4AYB A;  3CQZ I;  4NBH A;  2F4M A;  2H85 A;  5D1O B;  1YJW Z;  3S1Q I;  3HOY I;  3PO2 I;  4DGL A;  5IT9 f;  1VQM Z;  3NDI A;  1TWC I;  4RVF A;  1USP A;  3J7A 4;  4MD7 A;  4A3D I;  1K9M 1;  1YIJ Z;  2J6A A;  3I55 1;  5C4J I;  3NH5 A;  1I50 I;  4A3C I;  1JJ2 Z;  2LIY A;  1M1K 1;  2W04 A;  1RLY A;  1WCM I;  3CME Z;  3CCJ 1;  2R93 I;  2DE5 A;  1VQ5 1;  3HOU I;  1Q82 1;  2P3Y A;  3G6E 1;  4A93 I;  3HKZ A;  2P28 A;  3VMH A;  2RIQ A;  3EED A;  2RT9 A;  3BG1 B;  3NDJ A;  4E32 A;  1N8R 2;  4TNU A;  1RO2 A;  4A3I I;  4A3E I;  3CC4 1;  4NBA A;  4NBB A;  1ZH1 A;  1VQO 1;  2JA7 I;  1YIT 1;  3I55 Z;  3CD6 1;  3JAM b;  4DK1 A;  1ML8 A;  1JJ2 Y;  4RVH A;  2QRE B;  4RV9 A;  3CCJ Z;  2JS4 A;  2W03 A;  2HF1 A;  1VQL Z;  1Z01 A;  2GU2 A;  1X3Z A;  4X6A I;  3HOW I;  3IX0 A;  3CMA 1;  3S2D I;  3GTJ I;  3IFU A;  3KIH A;  1K8A 1;  5IT9 b;  1WII A;  1I3Q I;  1VQ6 Z;  3CC4 Z;  1VQ8 1;  3F3F C;  3D6W A;  3CCL 1;  1K73 1;  5D1O A;  4BBR I;  1QYP A;  2EGT A;  2PMZ A;  1YUK A;  2Q51 A;  1YIT Z;  1S72 1;  1KD1 1;  3CD6 Z;  4NBG A;  1PFT A;  2WB1 A;  4MRI A;  3CCQ 1;  2E9H A;  1VQ4 1;  1RO4 A;  2V8K A;  3CME 1;  2RPR A;  2JUB A;  3CCM 1;  3G71 1;  1WW9 A;  1K83 I;  3NH4 A;  3VMI A;  3PO3 I;  2O53 A;  3CMA Z;  1Q81 1;  2LFU A;  2F4O A;  1QVF Z;  2IZ4 A;  2VUM I;  3U50 C;  1Q7Y 1;  3RZD I;  5FLX f;  1VQ8 Z;  3CCL Z;  2DE6 A;  2JA8 I;  4MH4 A;  4BY7 I;  1TWH I;  2V8I A;  5C44 I;  3ESW A;  3GTO I;  1S72 Z;  1Z02 A;  3MZL B;  3J81 f;  1Q82 2;  1KC8 2;  3J80 f;  3CCQ Z;  2OZK A;  2K5R A;  1VQ4 Z;  1VQK 1;  3T4N B;  4NH1 C;  3CCS 1;  1VQL 1;  3CCM Z;  3TE5 B;  2QEX 1;  1RQF A;  3G71 Z;  3M4O I;  3GTG I;  3S1R I;  1P9N A;  4XX2 A;  3HOV I;  3LUS A;  4NB8 A;  3PO3 S;  3NFZ A;  1QVF Y;  2K3R A;  1Q86 2;  1TWG I;  1Y1W I;  1VQ6 1;  5IP9 I;  3G4S Z;  4BBS I;  3FQQ A;  2PK7 A;  4S1T A;  3I4M I;  4EWC A;  2OOY B;  2HU9 A;  1L1O C;  1X3W A;  4HGZ A;  1VQK Z;  1YHQ 1;  2BJO A;  4E2Z A;  2NVY I;  3CCS Z;  2QEX Z;  2QLV B;  2NVX I;  4QTU A;  1USP B;  1X0T A;  1VQN 1;  3CPW Z;  2JR6 A;  1I6H I;  2OOX B;  3CXC Z;  1NJI 2;  3NH8 A;  3I07 A;  1Y1V I;  2VUG A;  3HOX I;  1KRL A;  2WAQ A;  1N8R 1;  1K73 2;  1VQ9 Z;  1M90 1;  3CCU Z;  1KQS Z;  1VQ7 1;  3S1N I;  5FLX b;  4NBF A;  3P5J B;  3GTP I;  1YJN 1;  3CCR Z;  2Q4Z A;  4E33 A;  2QA4 Z;  3J81 b;  3J80 b;  4NBC A;  2IZ3 A;  4MD8 A;  3MZK B;  2QRC B;  3GKQ A;  1YHQ Z;  2ZAE B;  4NFR A;  4RS4 A;  4HGY A;  3VTN A;  1VQN Z;  4NB9 A;  2V8J A;  4E31 A;  2AKL A;  3QWU A;  1S7M A;  3CPW Y;  4MON A;  4A3G I;  3CXC Y;  4BXX I;  5A2Q f;  1JWH C;  3TDH B;  1VQ7 Z;  3GTL I;  2DE7 A;  1DL6 A;  5T64 A;  3GTK I;  1KQS Y;  3CCE 1;  2RHB A;  1K9M 2;  3Q87 A;  4A3K I;  5D1P A;  1YJN Z;  1Y1V S;  2QR1 B;  3I4N I;  3MON A;  1R9T I;  3I56 1;  3RZO I;  3G4S 1;  1M1K 2;  1LQL A;  3D9X A;  5T67 A;  3S15 I;  1TWA I;  5LL6 f;  2R92 I;  2JMO A;  4QTT A;  1W2B Z;  4E2X A;  4RVD A;  1SFO I;  2RBL A;  2VF1 A;  1TWF I;  3FQM A;  4HH4 A;  4NBD A;  2M6N A;  2Y0S A;  4A3B I;  3CC2 1;  1VLA A;  3HOZ I;  4RVG A;  2GTH A;  5C3E I;  1NP6 A;  4Y52 I;  3GTM I;  5T6B A;  1VQ9 1;  1YI2 Z;  3CCU 1;  2YU9 I;  3CCE Z;  3OW2 Z;  1VQP 1;  3F3P C;  3GTQ I;  2NVT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...