2E2HI

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI02
1DL6A 3RZDI 4NBEA 3GTLI 3HOWI 3S1RI 3M3YI 1TWHI 4A3KI 3GTGI 1YUAA 3HOVI 5CM2M 3S2DI 4BY7I 5IP9I 2E2HI 2JA7I 2BJOA 2DE7A 1I3QI 2RBLA 3U50C 4A3BI 3D6WA 1QYPA 3LUSA 3HOXI 3S15I 2P3YA 1Y1WI 3GTKI 4A3LI 4NBFA 2DE6A 2JA6I 1TWAI 1N2FA 4QTUA 3HOYI 4NBGA 3S1MI 2VUMI 3M4OI 4XX2A 3FKII 3PO2I 4BBSI 3GTPI 1TWCI 4BBRI 1USPA 1R9TI 3S17I 1Y1VI 2F4MA 2PK7A 4NB8A 2JA5I 3S16I 4Y52I 4X6AI 4A3MI 3GTMS 2R93I 2E2II 1I50I 2KPIA 5C44I 5IP7I 1Y1VS 3VMGA 1WCMI 4A3FI 3S1QI 2NVYI 4A93I 4BXXI 4A3CI 1NUIA 3VB9A 1X3ZA 4NBBA 3EERA 2DE5A 5C4XI 3H0GI 1TFIA 3H3VJ 4NBDA 1ML8A 3HOUI 3GTJI 3I07A 5C3EI 2J6AA 3GCFA 5FLMI 2NVQI 1USPB 3GTOI 3PO3I 3K7AI 4A3II 4NBCA 3I4NI 1K83I 4NOZA 2NVXI 3S14I 1RO4A 2F4OA 1LQLA 4QTTA 1RLYA 4A3DI 2YU9I 3I4MI 2JS4A 1SFOI 4A3EI 3ESWA 4NB9A 3PO3S 1VLAA 2E2JI 1TWFI 2NVTI 3VMHA 2AKLA 3CQZI 3GKQA 1ZB9A 3VMIA 1ZB8A 2JA8I 4MH4A 4BY1I 3S1NI 2JNYA 4A3GI 2JR6A 1X3WA 2R92I 2R7ZI 3RZOI 1L1OC 3GTQI 3HOZI 4A3JI 3Q87A 1PFTA 1TWGI 4NBHA 3S2HI 2K5RA 2B63I 5C4JI 4Y7NI 1I6HI 1WW9A 2HF1A 4NBAA 3GTMI
chains in the Genus database with same CATH superfamily
1Z02A 3RZDI 1Y8CA 3GTLI 3HOWI 1TWHI 1YUAA 2VPYA 3HOVI 1Q811 2HU9A 3CC2Z 1RO2A 2E2HI 2V3VA 4E30A 2OTLZ 4DGLA 3U50C 1YJWZ 3LUSA 2LFUA 4A3LI 3CCMZ 3F3FC 2JA6I 4NBGA 1QVFZ 2VUMI 3FKII 3GTPI 2OTJ1 2OOYB 4MD8A 4MONA 1Q861 3CXCY 1Y1VI 2JA5I 1Q812 1VQL1 4Y52I 4X6AI 4A3MI 5A2Qb 1YHQ1 3FQQA 2R93I 2NVYI 3OW2Y 2M6NA 3CD61 2OZKA 3EERA 1WJ2A 4NBDA 3J80f 3J81b 3CC21 3J80b 3NH5A 1KRLA 1YIT1 1JJ2Y 1SIWA 1W2BZ 3K7AI 2RIQA 4NBCA 1VQPZ 1K83I 4NOZA 2GTHA 1K732 3CC41 1KQSY 1RO4A 2F4OA 2RT9A 1RLYA 2YU9I 1RO0A 2JS4A 2RHBA 2M48A 4NB9A 1VLAA 2PMZA 5T67A 3CQZI 2QLVB 2EGTA 1S7MA 3GKQA 3CPWY 4MH4A 3GTQI 3S2HI 5LL6f 1M902 3BG0B 1I6HI 4CL1A 4NBAA 4E31A 1FDIA 1Q862 4NBEA 3M3YI 3S1RI 4A3KI 5D1PA 2IV2X 3J7A4 2IZ4A 3CCR1 3VTNA 1VQOZ 2OOXB 5AN9F 3F3PC 2VPZA 2IZ3A 3GTKI 3NFZA 3CC71 2DE6A 1TWAI 1N2FA 4QTUA 1QF8A 2LEXA 3CXCZ 3IF8A 1NJI2 2NAPA 4BBRI 4RVFA 3CCU1 3HKZA 1VQ91 3GTMS 1YJ9Z 1KC81 2G2KA 2E2II 1I50I 5C44I 3CCEZ 3T4NB 4BXXI 4A3CI 3KIHA 1KD12 1NUIA 1X3ZA 1RQFA 4E33A 2DE5A 4S1TA 1KC82 2K3RA 2QRCB 1VQM1 2VF1A 3CC4Z 1RNIA 4MD7A 1S721 1ML8A 3GTJI 4RS4A 4TNUA 1VQ6Z 1W2BY 5D1OA 2QRDB 3I561 5FLMI 3G71Z 4A3II 2VUGA 2NVXI 2QR1B 5FLXb 3S14I 1LQLA 4QTTA 1VQ5Z 2JIQA 4E2XA 4A3DI 1K9M1 3NH8A 3ESWA 1YIJZ 2QEXZ 1M1K1 4HGZA 2JUBA 2NVTI 3VMHA 3CCRZ 3KIFA 1ZB9A 3VMIA 2Q51A 3CCJZ 3CCSZ 2JA8I 2JNYA 5IT9b 2JIRA 2JR6A 2R7ZI 3RZOI 2YADA 3HOZI 4A3JI 1PFTA 1AA6A 1QVGY 1QVGZ 1VQKZ 2JIPA 3CC7Z 4AYBA 5C4JI 4Y7NI 1VQ61 2WAQA 3GTMI 4RVDA 2QA4Z 1DL6A 3MZKB 1QVFY 2V8KA 2E9HA 3G711 1JJ2Z 3GTGI 2GU2A 5CM2M 2PM9A 2JA7I 5T6BA 1I3QI 3CCQ1 4A3BI 1QYPA 3TDHB 3S15I 2P3YA 4NBFA 2AYDA 1WIIA 1Z01A 3MONA 2ZAEB 3HOYI 1VQO1 1S72Z 4XX2A 4RVHA 1NJI1 1TWCI 3IR7A 3I55Z 2E7ZA 1YJNZ 3D2LA 5D1OB 4NFRA 3JAMb 2P28A 2WB1A 3CD6Z 4A3FI 2KPIA 5IP7I 3S1QI 1WCMI 3CCUZ 3CCVZ 3G6EZ 1JWHC 4NBBA 2W03A 1YJ91 4NH1C 3H0GI 1YJW1 1KQSZ 3CCE1 3H3VJ 3HOUI 1VQ41 3I07A 3J81f 3CCQZ 5C3EI 2J6AA 2QKDA 3GCFA 1YIJ1 1VQMZ 1USPB 3CMA1 3PO3I 4E32A 3CCJ1 1VQ81 1K8A1 3I551 3I56Z 1VQK1 1VQ7Z 1VQP1 1K9M2 1X0TA 4MD9A 5A2Qf 3I4MI 1P9NA 4A3EI 3PO3S 1N8R1 1Q821 3FQMA 2QA41 3P5JB 1YI21 1K731 2LIYA 3OW2Z 4E2ZA 3NDIA 1YITZ 4BY1I 3S1NI 4A3GI 3Q87A 3CCLZ 2RPRA 3CCS1 4MRIA 1Q7Y2 2R6MA 1KD11 3QWUA 3CMAZ 1VQ8Z 1VQN1 3S2DI 4BY7I 5IP9I 2BJOA 2DE7A 2QREB 3CCV1 3CMEZ 2Y0SA 2RBLA 1N8R2 3D6WA 3HOXI 1ZH1A 1QXFA 1Y1WI 3G6E1 2JIMA 3S1MI 3M4OI 2VPXA 4RVGA 3PO2I 4BBSI 2W04A 4E2WA 1K8A2 2Q4ZA 1USPA 1R9TI 3S17I 1VQ9Z 2F4MA 3EEDA 2PK7A 4DK1A 4NB8A 3TE5B 3S16I 2JIOA 1VQ4Z 1YJN1 5IT9f 3G4S1 1Y1VS 3VMGA 4A93I 1Z03A 3VB9A 1M901 2JMOA 4E2YA 2KI7B 5C4XI 1VQ71 1TFIA 2I3CA 2V8JA 2O4HA 1M1K2 1VQNZ 2V45A 1VQLZ 1YHQZ 2NVQI 4HH4A 5FLXf 3GTOI 1WZNA 3NDJA 1Q7Y1 3NH4A 4HGYA 2VPWA 3CPWZ 3I4NI 1VQ51 3BG1B 2OTL1 1NP6A 2QEX1 1SFOI 2H85A 1FDOA 3IX0A 4RV9A 2E2JI 3CCL1 5T64A 1TWFI 3G4SZ 3CCM1 1YUKA 1Q822 2OTJZ 2AKLA 3JAMf 1Q16A 4MXUA 3CME1 1ZB8A 2R92I 1X3WA 1L1OC 4DQYB 1YI2Z 2O53A 4EWCA 2GTIA 1TWGI 4NBHA 2K5RA 2B63I 2V8IA 3D9XA 3MZLB 1WW9A 2HF1A 3IFUA
chains in the Genus database with same CATH topology
1Z02A 3RZDI 3GTLI 3HOWI 1TWHI 1YUAA 3HOVI 1Q811 2HU9A 3CC2Z 1RO2A 2E2HI 4E30A 2OTLZ 4DGLA 3U50C 1YJWZ 3LUSA 2LFUA 4A3LI 3CCMZ 3F3FC 2JA6I 4NBGA 1QVFZ 2VUMI 3FKII 3GTPI 2OTJ1 2OOYB 4MD8A 4MONA 1Q861 3CXCY 1Y1VI 2JA5I 1Q812 1VQL1 4Y52I 4X6AI 4A3MI 5A2Qb 1YHQ1 3FQQA 2R93I 2NVYI 3OW2Y 2M6NA 3CD61 2OZKA 3EERA 4NBDA 3J80f 3J81b 3CC21 3J80b 3NH5A 1KRLA 1YIT1 1JJ2Y 1W2BZ 3K7AI 2RIQA 4NBCA 1VQPZ 1K83I 4NOZA 2GTHA 1K732 3CC41 1KQSY 1RO4A 2F4OA 2RT9A 1RLYA 2YU9I 1RO0A 2JS4A 2RHBA 2M48A 4NB9A 1VLAA 2PMZA 5T67A 3CQZI 2QLVB 2EGTA 1S7MA 3GKQA 3CPWY 4MH4A 3GTQI 3S2HI 5LL6f 1M902 3BG0B 1I6HI 4CL1A 4NBAA 4E31A 1Q862 4NBEA 3M3YI 3S1RI 4A3KI 5D1PA 3J7A4 2IZ4A 3CCR1 3VTNA 1VQOZ 2OOXB 5AN9F 3F3PC 2IZ3A 3GTKI 3NFZA 3CC71 2DE6A 1TWAI 1N2FA 4QTUA 1QF8A 3CXCZ 3IF8A 1NJI2 4BBRI 4RVFA 3CCU1 3HKZA 1VQ91 3GTMS 1YJ9Z 1KC81 2G2KA 2E2II 1I50I 5C44I 3CCEZ 3T4NB 4BXXI 4A3CI 3KIHA 1KD12 1NUIA 1X3ZA 1RQFA 4E33A 2DE5A 4S1TA 1KC82 2K3RA 2QRCB 1VQM1 2VF1A 3CC4Z 1RNIA 4MD7A 1S721 1ML8A 3GTJI 4RS4A 4TNUA 1VQ6Z 1W2BY 5D1OA 2QRDB 3I561 5FLMI 3G71Z 4A3II 2VUGA 2NVXI 2QR1B 5FLXb 3S14I 1LQLA 4QTTA 1VQ5Z 4E2XA 4A3DI 1K9M1 3NH8A 3ESWA 1YIJZ 2QEXZ 1M1K1 4HGZA 2JUBA 2NVTI 3VMHA 3CCRZ 3KIFA 1ZB9A 3VMIA 2Q51A 3CCJZ 3CCSZ 2JA8I 2JNYA 5IT9b 2JR6A 2R7ZI 3RZOI 2YADA 3HOZI 4A3JI 1PFTA 1QVGY 1VQKZ 1QVGZ 3CC7Z 4AYBA 5C4JI 4Y7NI 1VQ61 2WAQA 3GTMI 4RVDA 2QA4Z 1DL6A 3MZKB 1QVFY 2V8KA 2E9HA 3G711 1JJ2Z 3GTGI 2GU2A 5CM2M 2PM9A 2JA7I 5T6BA 1I3QI 3CCQ1 4A3BI 1QYPA 3TDHB 3S15I 2P3YA 4NBFA 1WIIA 1Z01A 3MONA 2ZAEB 3HOYI 1VQO1 1S72Z 4XX2A 4RVHA 1NJI1 1TWCI 3I55Z 1YJNZ 5D1OB 4NFRA 3JAMb 2P28A 2WB1A 3CD6Z 4A3FI 2KPIA 5IP7I 3S1QI 1WCMI 3CCUZ 3CCVZ 3G6EZ 1JWHC 4NBBA 2W03A 1YJ91 4NH1C 3H0GI 1YJW1 1KQSZ 3CCE1 3H3VJ 3HOUI 1VQ41 3I07A 3J81f 3CCQZ 5C3EI 2J6AA 2QKDA 3GCFA 1YIJ1 1VQMZ 1USPB 3CMA1 3PO3I 4E32A 3CCJ1 1VQ81 1K8A1 3I551 3I56Z 1VQK1 1VQ7Z 1VQP1 1K9M2 1X0TA 4MD9A 5A2Qf 3I4MI 1P9NA 4A3EI 3PO3S 1N8R1 1Q821 3FQMA 2QA41 3P5JB 1YI21 1K731 2LIYA 3OW2Z 4E2ZA 3NDIA 1YITZ 4BY1I 3S1NI 4A3GI 3Q87A 3CCLZ 2RPRA 3CCS1 4MRIA 1Q7Y2 2R6MA 1KD11 3QWUA 3CMAZ 1VQ8Z 1VQN1 3S2DI 4BY7I 5IP9I 2BJOA 2DE7A 2QREB 3CCV1 3CMEZ 2Y0SA 2RBLA 1N8R2 3D6WA 3HOXI 1ZH1A 1Y1WI 3G6E1 3S1MI 3M4OI 4RVGA 3PO2I 4BBSI 2W04A 4E2WA 1K8A2 2Q4ZA 1USPA 1R9TI 3S17I 1VQ9Z 2F4MA 3EEDA 2PK7A 4DK1A 4NB8A 3TE5B 3S16I 1VQ4Z 1YJN1 5IT9f 3G4S1 1Y1VS 3VMGA 4A93I 1Z03A 3VB9A 1M901 2JMOA 4E2YA 2KI7B 5C4XI 1VQ71 1TFIA 2I3CA 2V8JA 2O4HA 1M1K2 1VQNZ 1VQLZ 1YHQZ 2NVQI 4HH4A 5FLXf 3GTOI 3NDJA 1Q7Y1 3NH4A 4HGYA 3CPWZ 3I4NI 1VQ51 3BG1B 2OTL1 1NP6A 2QEX1 1SFOI 2H85A 3IX0A 4RV9A 2E2JI 3CCL1 5T64A 1TWFI 3G4SZ 3CCM1 1YUKA 1Q822 2OTJZ 2AKLA 3JAMf 4MXUA 3CME1 1ZB8A 2R92I 1X3WA 1L1OC 4DQYB 1YI2Z 2O53A 4EWCA 2GTIA 1TWGI 4NBHA 2K5RA 2B63I 2V8IA 3D9XA 3MZLB 1WW9A 2HF1A 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DL6 A;  3RZD I;  4NBE A;  3GTL I;  3HOW I;  3S1R I;  3M3Y I;  1TWH I;  4A3K I;  3GTG I;  1YUA A;  3HOV I;  5CM2 M;  3S2D I;  4BY7 I;  5IP9 I;  2E2H I;  2JA7 I;  2BJO A;  2DE7 A;  1I3Q I;  2RBL A;  3U50 C;  4A3B I;  3D6W A;  1QYP A;  3LUS A;  3HOX I;  3S15 I;  2P3Y A;  1Y1W I;  3GTK I;  4A3L I;  4NBF A;  2DE6 A;  2JA6 I;  1TWA I;  1N2F A;  4QTU A;  3HOY I;  4NBG A;  3S1M I;  2VUM I;  3M4O I;  4XX2 A;  3FKI I;  3PO2 I;  4BBS I;  3GTP I;  1TWC I;  4BBR I;  1USP A;  1R9T I;  3S17 I;  1Y1V I;  2F4M A;  2PK7 A;  4NB8 A;  2JA5 I;  3S16 I;  4Y52 I;  4X6A I;  4A3M I;  3GTM S;  2R93 I;  2E2I I;  1I50 I;  2KPI A;  5C44 I;  5IP7 I;  1Y1V S;  3VMG A;  1WCM I;  4A3F I;  3S1Q I;  2NVY I;  4A93 I;  4BXX I;  4A3C I;  1NUI A;  3VB9 A;  1X3Z A;  4NBB A;  3EER A;  2DE5 A;  5C4X I;  3H0G I;  1TFI A;  3H3V J;  4NBD A;  1ML8 A;  3HOU I;  3GTJ I;  3I07 A;  5C3E I;  2J6A A;  3GCF A;  5FLM I;  2NVQ I;  1USP B;  3GTO I;  3PO3 I;  3K7A I;  4A3I I;  4NBC A;  3I4N I;  1K83 I;  4NOZ A;  2NVX I;  3S14 I;  1RO4 A;  2F4O A;  1LQL A;  4QTT A;  1RLY A;  4A3D I;  2YU9 I;  3I4M I;  2JS4 A;  1SFO I;  4A3E I;  3ESW A;  4NB9 A;  3PO3 S;  1VLA A;  2E2J I;  1TWF I;  2NVT I;  3VMH A;  2AKL A;  3CQZ I;  3GKQ A;  1ZB9 A;  3VMI A;  1ZB8 A;  2JA8 I;  4MH4 A;  4BY1 I;  3S1N I;  2JNY A;  4A3G I;  2JR6 A;  1X3W A;  2R92 I;  2R7Z I;  3RZO I;  1L1O C;  3GTQ I;  3HOZ I;  4A3J I;  3Q87 A;  1PFT A;  1TWG I;  4NBH A;  3S2H I;  2K5R A;  2B63 I;  5C4J I;  4Y7N I;  1I6H I;  1WW9 A;  2HF1 A;  4NBA A;  3GTM I; 
#chains in the Genus database with same CATH topology
 1Z02 A;  3RZD I;  1Y8C A;  3GTL I;  3HOW I;  1TWH I;  1YUA A;  2VPY A;  3HOV I;  1Q81 1;  2HU9 A;  3CC2 Z;  1RO2 A;  2E2H I;  2V3V A;  4E30 A;  2OTL Z;  4DGL A;  3U50 C;  1YJW Z;  3LUS A;  2LFU A;  4A3L I;  3CCM Z;  3F3F C;  2JA6 I;  4NBG A;  1QVF Z;  2VUM I;  3FKI I;  3GTP I;  2OTJ 1;  2OOY B;  4MD8 A;  4MON A;  1Q86 1;  3CXC Y;  1Y1V I;  2JA5 I;  1Q81 2;  1VQL 1;  4Y52 I;  4X6A I;  4A3M I;  5A2Q b;  1YHQ 1;  3FQQ A;  2R93 I;  2NVY I;  3OW2 Y;  2M6N A;  3CD6 1;  2OZK A;  3EER A;  1WJ2 A;  4NBD A;  3J80 f;  3J81 b;  3CC2 1;  3J80 b;  3NH5 A;  1KRL A;  1YIT 1;  1JJ2 Y;  1SIW A;  1W2B Z;  3K7A I;  2RIQ A;  4NBC A;  1VQP Z;  1K83 I;  4NOZ A;  2GTH A;  1K73 2;  3CC4 1;  1KQS Y;  1RO4 A;  2F4O A;  2RT9 A;  1RLY A;  2YU9 I;  1RO0 A;  2JS4 A;  2RHB A;  2M48 A;  4NB9 A;  1VLA A;  2PMZ A;  5T67 A;  3CQZ I;  2QLV B;  2EGT A;  1S7M A;  3GKQ A;  3CPW Y;  4MH4 A;  3GTQ I;  3S2H I;  5LL6 f;  1M90 2;  3BG0 B;  1I6H I;  4CL1 A;  4NBA A;  4E31 A;  1FDI A;  1Q86 2;  4NBE A;  3M3Y I;  3S1R I;  4A3K I;  5D1P A;  2IV2 X;  3J7A 4;  2IZ4 A;  3CCR 1;  3VTN A;  1VQO Z;  2OOX B;  5AN9 F;  3F3P C;  2VPZ A;  2IZ3 A;  3GTK I;  3NFZ A;  3CC7 1;  2DE6 A;  1TWA I;  1N2F A;  4QTU A;  1QF8 A;  2LEX A;  3CXC Z;  3IF8 A;  1NJI 2;  2NAP A;  4BBR I;  4RVF A;  3CCU 1;  3HKZ A;  1VQ9 1;  3GTM S;  1YJ9 Z;  1KC8 1;  2G2K A;  2E2I I;  1I50 I;  5C44 I;  3CCE Z;  3T4N B;  4BXX I;  4A3C I;  3KIH A;  1KD1 2;  1NUI A;  1X3Z A;  1RQF A;  4E33 A;  2DE5 A;  4S1T A;  1KC8 2;  2K3R A;  2QRC B;  1VQM 1;  2VF1 A;  3CC4 Z;  1RNI A;  4MD7 A;  1S72 1;  1ML8 A;  3GTJ I;  4RS4 A;  4TNU A;  1VQ6 Z;  1W2B Y;  5D1O A;  2QRD B;  3I56 1;  5FLM I;  3G71 Z;  4A3I I;  2VUG A;  2NVX I;  2QR1 B;  5FLX b;  3S14 I;  1LQL A;  4QTT A;  1VQ5 Z;  2JIQ A;  4E2X A;  4A3D I;  1K9M 1;  3NH8 A;  3ESW A;  1YIJ Z;  2QEX Z;  1M1K 1;  4HGZ A;  2JUB A;  2NVT I;  3VMH A;  3CCR Z;  3KIF A;  1ZB9 A;  3VMI A;  2Q51 A;  3CCJ Z;  3CCS Z;  2JA8 I;  2JNY A;  5IT9 b;  2JIR A;  2JR6 A;  2R7Z I;  3RZO I;  2YAD A;  3HOZ I;  4A3J I;  1PFT A;  1AA6 A;  1QVG Y;  1QVG Z;  1VQK Z;  2JIP A;  3CC7 Z;  4AYB A;  5C4J I;  4Y7N I;  1VQ6 1;  2WAQ A;  3GTM I;  4RVD A;  2QA4 Z;  1DL6 A;  3MZK B;  1QVF Y;  2V8K A;  2E9H A;  3G71 1;  1JJ2 Z;  3GTG I;  2GU2 A;  5CM2 M;  2PM9 A;  2JA7 I;  5T6B A;  1I3Q I;  3CCQ 1;  4A3B I;  1QYP A;  3TDH B;  3S15 I;  2P3Y A;  4NBF A;  2AYD A;  1WII A;  1Z01 A;  3MON A;  2ZAE B;  3HOY I;  1VQO 1;  1S72 Z;  4XX2 A;  4RVH A;  1NJI 1;  1TWC I;  3IR7 A;  3I55 Z;  2E7Z A;  1YJN Z;  3D2L A;  5D1O B;  4NFR A;  3JAM b;  2P28 A;  2WB1 A;  3CD6 Z;  4A3F I;  2KPI A;  5IP7 I;  3S1Q I;  1WCM I;  3CCU Z;  3CCV Z;  3G6E Z;  1JWH C;  4NBB A;  2W03 A;  1YJ9 1;  4NH1 C;  3H0G I;  1YJW 1;  1KQS Z;  3CCE 1;  3H3V J;  3HOU I;  1VQ4 1;  3I07 A;  3J81 f;  3CCQ Z;  5C3E I;  2J6A A;  2QKD A;  3GCF A;  1YIJ 1;  1VQM Z;  1USP B;  3CMA 1;  3PO3 I;  4E32 A;  3CCJ 1;  1VQ8 1;  1K8A 1;  3I55 1;  3I56 Z;  1VQK 1;  1VQ7 Z;  1VQP 1;  1K9M 2;  1X0T A;  4MD9 A;  5A2Q f;  3I4M I;  1P9N A;  4A3E I;  3PO3 S;  1N8R 1;  1Q82 1;  3FQM A;  2QA4 1;  3P5J B;  1YI2 1;  1K73 1;  2LIY A;  3OW2 Z;  4E2Z A;  3NDI A;  1YIT Z;  4BY1 I;  3S1N I;  4A3G I;  3Q87 A;  3CCL Z;  2RPR A;  3CCS 1;  4MRI A;  1Q7Y 2;  2R6M A;  1KD1 1;  3QWU A;  3CMA Z;  1VQ8 Z;  1VQN 1;  3S2D I;  4BY7 I;  5IP9 I;  2BJO A;  2DE7 A;  2QRE B;  3CCV 1;  3CME Z;  2Y0S A;  2RBL A;  1N8R 2;  3D6W A;  3HOX I;  1ZH1 A;  1QXF A;  1Y1W I;  3G6E 1;  2JIM A;  3S1M I;  3M4O I;  2VPX A;  4RVG A;  3PO2 I;  4BBS I;  2W04 A;  4E2W A;  1K8A 2;  2Q4Z A;  1USP A;  1R9T I;  3S17 I;  1VQ9 Z;  2F4M A;  3EED A;  2PK7 A;  4DK1 A;  4NB8 A;  3TE5 B;  3S16 I;  2JIO A;  1VQ4 Z;  1YJN 1;  5IT9 f;  3G4S 1;  1Y1V S;  3VMG A;  4A93 I;  1Z03 A;  3VB9 A;  1M90 1;  2JMO A;  4E2Y A;  2KI7 B;  5C4X I;  1VQ7 1;  1TFI A;  2I3C A;  2V8J A;  2O4H A;  1M1K 2;  1VQN Z;  2V45 A;  1VQL Z;  1YHQ Z;  2NVQ I;  4HH4 A;  5FLX f;  3GTO I;  1WZN A;  3NDJ A;  1Q7Y 1;  3NH4 A;  4HGY A;  2VPW A;  3CPW Z;  3I4N I;  1VQ5 1;  3BG1 B;  2OTL 1;  1NP6 A;  2QEX 1;  1SFO I;  2H85 A;  1FDO A;  3IX0 A;  4RV9 A;  2E2J I;  3CCL 1;  5T64 A;  1TWF I;  3G4S Z;  3CCM 1;  1YUK A;  1Q82 2;  2OTJ Z;  2AKL A;  3JAM f;  1Q16 A;  4MXU A;  3CME 1;  1ZB8 A;  2R92 I;  1X3W A;  1L1O C;  4DQY B;  1YI2 Z;  2O53 A;  4EWC A;  2GTI A;  1TWG I;  4NBH A;  2K5R A;  2B63 I;  2V8I A;  3D9X A;  3MZL B;  1WW9 A;  2HF1 A;  3IFU A; 
#chains in the Genus database with same CATH homology
 1Z02 A;  3RZD I;  3GTL I;  3HOW I;  1TWH I;  1YUA A;  3HOV I;  1Q81 1;  2HU9 A;  3CC2 Z;  1RO2 A;  2E2H I;  4E30 A;  2OTL Z;  4DGL A;  3U50 C;  1YJW Z;  3LUS A;  2LFU A;  4A3L I;  3CCM Z;  3F3F C;  2JA6 I;  4NBG A;  1QVF Z;  2VUM I;  3FKI I;  3GTP I;  2OTJ 1;  2OOY B;  4MD8 A;  4MON A;  1Q86 1;  3CXC Y;  1Y1V I;  2JA5 I;  1Q81 2;  1VQL 1;  4Y52 I;  4X6A I;  4A3M I;  5A2Q b;  1YHQ 1;  3FQQ A;  2R93 I;  2NVY I;  3OW2 Y;  2M6N A;  3CD6 1;  2OZK A;  3EER A;  4NBD A;  3J80 f;  3J81 b;  3CC2 1;  3J80 b;  3NH5 A;  1KRL A;  1YIT 1;  1JJ2 Y;  1W2B Z;  3K7A I;  2RIQ A;  4NBC A;  1VQP Z;  1K83 I;  4NOZ A;  2GTH A;  1K73 2;  3CC4 1;  1KQS Y;  1RO4 A;  2F4O A;  2RT9 A;  1RLY A;  2YU9 I;  1RO0 A;  2JS4 A;  2RHB A;  2M48 A;  4NB9 A;  1VLA A;  2PMZ A;  5T67 A;  3CQZ I;  2QLV B;  2EGT A;  1S7M A;  3GKQ A;  3CPW Y;  4MH4 A;  3GTQ I;  3S2H I;  5LL6 f;  1M90 2;  3BG0 B;  1I6H I;  4CL1 A;  4NBA A;  4E31 A;  1Q86 2;  4NBE A;  3M3Y I;  3S1R I;  4A3K I;  5D1P A;  3J7A 4;  2IZ4 A;  3CCR 1;  3VTN A;  1VQO Z;  2OOX B;  5AN9 F;  3F3P C;  2IZ3 A;  3GTK I;  3NFZ A;  3CC7 1;  2DE6 A;  1TWA I;  1N2F A;  4QTU A;  1QF8 A;  3CXC Z;  3IF8 A;  1NJI 2;  4BBR I;  4RVF A;  3CCU 1;  3HKZ A;  1VQ9 1;  3GTM S;  1YJ9 Z;  1KC8 1;  2G2K A;  2E2I I;  1I50 I;  5C44 I;  3CCE Z;  3T4N B;  4BXX I;  4A3C I;  3KIH A;  1KD1 2;  1NUI A;  1X3Z A;  1RQF A;  4E33 A;  2DE5 A;  4S1T A;  1KC8 2;  2K3R A;  2QRC B;  1VQM 1;  2VF1 A;  3CC4 Z;  1RNI A;  4MD7 A;  1S72 1;  1ML8 A;  3GTJ I;  4RS4 A;  4TNU A;  1VQ6 Z;  1W2B Y;  5D1O A;  2QRD B;  3I56 1;  5FLM I;  3G71 Z;  4A3I I;  2VUG A;  2NVX I;  2QR1 B;  5FLX b;  3S14 I;  1LQL A;  4QTT A;  1VQ5 Z;  4E2X A;  4A3D I;  1K9M 1;  3NH8 A;  3ESW A;  1YIJ Z;  2QEX Z;  1M1K 1;  4HGZ A;  2JUB A;  2NVT I;  3VMH A;  3CCR Z;  3KIF A;  1ZB9 A;  3VMI A;  2Q51 A;  3CCJ Z;  3CCS Z;  2JA8 I;  2JNY A;  5IT9 b;  2JR6 A;  2R7Z I;  3RZO I;  2YAD A;  3HOZ I;  4A3J I;  1PFT A;  1QVG Y;  1VQK Z;  1QVG Z;  3CC7 Z;  4AYB A;  5C4J I;  4Y7N I;  1VQ6 1;  2WAQ A;  3GTM I;  4RVD A;  2QA4 Z;  1DL6 A;  3MZK B;  1QVF Y;  2V8K A;  2E9H A;  3G71 1;  1JJ2 Z;  3GTG I;  2GU2 A;  5CM2 M;  2PM9 A;  2JA7 I;  5T6B A;  1I3Q I;  3CCQ 1;  4A3B I;  1QYP A;  3TDH B;  3S15 I;  2P3Y A;  4NBF A;  1WII A;  1Z01 A;  3MON A;  2ZAE B;  3HOY I;  1VQO 1;  1S72 Z;  4XX2 A;  4RVH A;  1NJI 1;  1TWC I;  3I55 Z;  1YJN Z;  5D1O B;  4NFR A;  3JAM b;  2P28 A;  2WB1 A;  3CD6 Z;  4A3F I;  2KPI A;  5IP7 I;  3S1Q I;  1WCM I;  3CCU Z;  3CCV Z;  3G6E Z;  1JWH C;  4NBB A;  2W03 A;  1YJ9 1;  4NH1 C;  3H0G I;  1YJW 1;  1KQS Z;  3CCE 1;  3H3V J;  3HOU I;  1VQ4 1;  3I07 A;  3J81 f;  3CCQ Z;  5C3E I;  2J6A A;  2QKD A;  3GCF A;  1YIJ 1;  1VQM Z;  1USP B;  3CMA 1;  3PO3 I;  4E32 A;  3CCJ 1;  1VQ8 1;  1K8A 1;  3I55 1;  3I56 Z;  1VQK 1;  1VQ7 Z;  1VQP 1;  1K9M 2;  1X0T A;  4MD9 A;  5A2Q f;  3I4M I;  1P9N A;  4A3E I;  3PO3 S;  1N8R 1;  1Q82 1;  3FQM A;  2QA4 1;  3P5J B;  1YI2 1;  1K73 1;  2LIY A;  3OW2 Z;  4E2Z A;  3NDI A;  1YIT Z;  4BY1 I;  3S1N I;  4A3G I;  3Q87 A;  3CCL Z;  2RPR A;  3CCS 1;  4MRI A;  1Q7Y 2;  2R6M A;  1KD1 1;  3QWU A;  3CMA Z;  1VQ8 Z;  1VQN 1;  3S2D I;  4BY7 I;  5IP9 I;  2BJO A;  2DE7 A;  2QRE B;  3CCV 1;  3CME Z;  2Y0S A;  2RBL A;  1N8R 2;  3D6W A;  3HOX I;  1ZH1 A;  1Y1W I;  3G6E 1;  3S1M I;  3M4O I;  4RVG A;  3PO2 I;  4BBS I;  2W04 A;  4E2W A;  1K8A 2;  2Q4Z A;  1USP A;  1R9T I;  3S17 I;  1VQ9 Z;  2F4M A;  3EED A;  2PK7 A;  4DK1 A;  4NB8 A;  3TE5 B;  3S16 I;  1VQ4 Z;  1YJN 1;  5IT9 f;  3G4S 1;  1Y1V S;  3VMG A;  4A93 I;  1Z03 A;  3VB9 A;  1M90 1;  2JMO A;  4E2Y A;  2KI7 B;  5C4X I;  1VQ7 1;  1TFI A;  2I3C A;  2V8J A;  2O4H A;  1M1K 2;  1VQN Z;  1VQL Z;  1YHQ Z;  2NVQ I;  4HH4 A;  5FLX f;  3GTO I;  3NDJ A;  1Q7Y 1;  3NH4 A;  4HGY A;  3CPW Z;  3I4N I;  1VQ5 1;  3BG1 B;  2OTL 1;  1NP6 A;  2QEX 1;  1SFO I;  2H85 A;  3IX0 A;  4RV9 A;  2E2J I;  3CCL 1;  5T64 A;  1TWF I;  3G4S Z;  3CCM 1;  1YUK A;  1Q82 2;  2OTJ Z;  2AKL A;  3JAM f;  4MXU A;  3CME 1;  1ZB8 A;  2R92 I;  1X3W A;  1L1O C;  4DQY B;  1YI2 Z;  2O53 A;  4EWC A;  2GTI A;  1TWG I;  4NBH A;  2K5R A;  2B63 I;  2V8I A;  3D9X A;  3MZL B;  1WW9 A;  2HF1 A;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...