2E2HI

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI02
1PFTA 2YU9I 4A3GI 4NBBA 4A3BI 3M3YI 1ZB9A 3EERA 3RZDI 3HOZI 2E2HI 2VUMI 3S15I 2B63I 1NUIA 2K5RA 2R92I 3S1RI 3PO3I 2RBLA 5CM2M 3S16I 1VLAA 5C4XI 3GTPI 2JS4A 4A3II 2F4OA 3HOUI 1YUAA 5IP7I 3I4NI 3Q87A 1I50I 1LQLA 2JNYA 3H0GI 3VB9A 3GTLI 3GTOI 2E2JI 3GKQA 1TWGI 3ESWA 3H3VJ 2R7ZI 4NOZA 3S1MI 2F4MA 5C4JI 2E2II 3HOWI 4NB9A 2DE7A 4NBHA 4NBDA 3GTMS 1USPB 4A93I 2JA7I 4A3KI 1X3WA 4A3CI 1R9TI 3I4MI 1DL6A 3HOYI 1Y1VS 3D6WA 4A3DI 2DE6A 1RLYA 4NBGA 1WW9A 3FKII 4A3EI 1TWCI 4BY7I 3VMGA 3HOXI 2HF1A 4Y7NI 3LUSA 4NBCA 1L1OC 4BBRI 3HOVI 2JA8I 2BJOA 3S1NI 5C44I 5C3EI 1X3ZA 3S17I 1QYPA 3VMIA 4QTTA 2NVYI 1TFIA 2KPIA 3U50C 4QTUA 2JA6I 3S14I 3PO3S 2R93I 3VMHA 4BY1I 1N2FA 3S1QI 2DE5A 1Y1WI 4A3MI 4BBSI 5FLMI 1USPA 2NVXI 3RZOI 3CQZI 4A3LI 4MH4A 3K7AI 1SFOI 4NBAA 2AKLA 3I07A 4NBEA 4A3FI 3GTGI 2JR6A 1K83I 1WCMI 1RO4A 4NBFA 3GTMI 2JA5I 3GTQI 1I3QI 3S2DI 1TWHI 4BXXI 4Y52I 1Y1VI 3GTJI 2NVTI 2NVQI 1I6HI 3GTKI 2J6AA 2PK7A 1ML8A 1TWFI 2P3YA 3GCFA 4NB8A 3S2HI 1ZB8A 5IP9I 4X6AI 3M4OI 4XX2A 3PO2I 4A3JI 1TWAI
chains in the Genus database with same CATH superfamily
4MD8A 3CCR1 4A3BI 1ZB9A 3BG0B 2IZ3A 3EERA 3RZDI 2P28A 1Q7Y2 2B63I 1NUIA 2K5RA 1YITZ 3S1RI 3I561 3CCEZ 3HOUI 3CXCZ 3CCRZ 1I50I 5A2Qf 2O53A 3CCJ1 3GTLI 3GKQA 4S1TA 1TWGI 3NH5A 3NH4A 1WJ2A 3H3VJ 3I56Z 3S1MI 3JAMf 4TNUA 3CCS1 4E2WA 3NDIA 2E7ZA 4DGLA 4A3KI 2OTJ1 1KQSZ 1Y1VS 1VQ51 1WW9A 5FLXf 4BY7I 1TWCI 3HOXI 2HF1A 2WAQA 1VQ61 2VPWA 2YADA 4BBRI 3HOVI 5C3EI 1M901 4RS4A 3CCM1 1S72Z 2OTJZ 3CCVZ 4QTTA 1VQO1 1VQ5Z 3CXCY 2IZ4A 4MXUA 2KPIA 1X0TA 3NH8A 5T64A 3CD61 3CCMZ 1VQK1 3G6E1 3D9XA 2HU9A 1JJ2Z 2Y0SA 4DQYB 2NVXI 1VQ81 4A3LI 4NFRA 1KC81 4NBAA 1KQSY 2AKLA 3HKZA 2OTLZ 4NBEA 4A3FI 5D1PA 4EWCA 1VQKZ 2V8JA 3EEDA 1Y1VI 1Q812 4E2ZA 2NVTI 1VQ8Z 2IV2X 1RNIA 2QA41 1ZB8A 3M4OI 5T67A 1NJI2 2V8KA 2VPYA 3CC4Z 2YU9I 4MONA 3M3YI 2E2HI 4E33A 3MONA 3T4NB 2GTHA 1KD11 1JJ2Y 4HH4A 5D1OA 2QA4Z 1FDOA 2NAPA 3GTPI 2GTIA 2VUGA 2JS4A 2F4OA 2JIPA 1YIT1 1N8R2 2JUBA 5IP7I 3H0GI 3VB9A 1KC82 4CL1A 4RV9A 3HOWI 1K8A1 4NBDA 1JWHC 4A3CI 2O4HA 3CPWZ 3I551 4NBGA 4RVFA 2GU2A 1AA6A 3VMGA 2OZKA 2WB1A 1QVFZ 4MRIA 2LFUA 5IT9f 1L1OC 5D1OB 2JA8I 3S1NI 5C44I 5FLXb 4E32A 3S17I 3FQQA 2V45A 4DK1A 2JMOA 4HGYA 1KD12 2G2KA 4NH1C 1YIJ1 3I55Z 1SIWA 2PMZA 2K3RA 2JIQA 3PO3S 2R93I 3VMHA 4BY1I 4E30A 1S721 1N2FA 3CCV1 3J81f 1Y1WI 2QLVB 3J7A4 2E9HA 5FLMI 1USPA 3CCQZ 3FQMA 3IR7A 2R6MA 1YIJZ 3CC21 2AYDA 3F3PC 2KI7B 3P5JB 1VQ41 1RO4A 2JA5I 1QVFY 2EGTA 3GTJI 2OTL1 1I6HI 3CC2Z 3IF8A 2ZAEB 3S2HI 1YI21 3CCLZ 4MD9A 1VQ4Z 4XX2A 3PO2I 2QKDA 2JIOA 2OOXB 1VQMZ 4HGZA 4NBBA 1Z02A 1VQ7Z 2VUMI 3PO3I 5CM2M 1VQLZ 3CC41 1Q861 1YI2Z 4A3II 2V3VA 2RIQA 1YUAA 1YJ9Z 1LQLA 1KRLA 2JNYA 1K731 1YUKA 2LIYA 2E2JI 1M902 2OOYB 2Q51A 3OW2Z 4NOZA 2JIMA 4NBHA 1VQP1 1Q7Y1 1RO0A 1WZNA 2JA7I 1R9TI 3I4MI 3G71Z 2VPXA 2QRCB 3D6WA 1YJW1 4Y7NI 2V8IA 3LUSA 3CMAZ 1WIIA 3CCUZ 2BJOA 1VQPZ 1ZH1A 3CC71 3TE5B 1X3ZA 1Z01A 5IT9b 5A2Qb 1P9NA 1TFIA 3J80f 1YJWZ 3U50C 2JA6I 3IFUA 3JAMb 2RPRA 3S1QI 2DE5A 3CC7Z 4BBSI 3OW2Y 1K732 2QREB 3F3FC 2Q4ZA 2W04A 3K7AI 4RVHA 1W2BZ 1FDIA 3I07A 3G4S1 3GTGI 2JR6A 1WCMI 3CCQ1 4NBFA 1YJN1 3GTQI 3S2DI 1S7MA 1TWHI 1VQ91 4Y52I 3MZLB 2RHBA 5AN9F 1QF8A 2PK7A 1TWFI 2P3YA 2QRDB 1M1K1 1RO2A 4E2XA 3VTNA 4X6AI 3G4SZ 3MZKB 1YJNZ 1TWAI 1Q821 1PFTA 2I3CA 3CPWY 4A3GI 1VQ9Z 3HOZI 4MD7A 3CCL1 1K8A2 3S15I 2R92I 1YHQ1 2RBLA 3S16I 1VLAA 2H85A 1VQM1 4RVGA 5C4XI 3CCJZ 1Q811 1VQ71 1W2BY 2PM9A 1QXFA 3I4NI 1Y8CA 2M6NA 1VQL1 3Q87A 1Q16A 1RQFA 3CCSZ 2LEXA 3GTOI 3ESWA 1NJI1 2M48A 1K9M1 1YHQZ 2R7ZI 1YJ91 2F4MA 5C4JI 2E2II 2QR1B 2DE7A 4NB9A 5LL6f 3NFZA 3NDJA 1QVGZ 3GTMS 1USPB 4A93I 1X3WA 1VQ6Z 4AYBA 1DL6A 3HOYI 1M1K2 4A3DI 2DE6A 1RLYA 1Z03A 3FKII 4A3EI 1N8R1 4RVDA 2JIRA 1VQOZ 4NBCA 3G711 1Q822 3BG1B 2QEX1 3D2LA 1QYPA 3VMIA 3CMA1 2NVYI 3CD6Z 1VQN1 3CCU1 3KIFA 3G6EZ 3IX0A 4QTUA 3S14I 1NP6A 3J80b 4A3MI 2QEXZ 3QWUA 1K9M2 1VQNZ 3RZOI 1QVGY 3CQZI 4MH4A 1SFOI 2VPZA 3CME1 4E31A 1K83I 1Q862 3GTMI 4E2YA 1I3QI 2W03A 2RT9A 5T6BA 4BXXI 2VF1A 2NVQI 3GTKI 2J6AA 3TDHB 1ML8A 4NB8A 3GCFA 3CMEZ 3KIHA 5IP9I 3J81b 3CCE1 4A3JI
chains in the Genus database with same CATH topology
4MD8A 3CCR1 4A3BI 1ZB9A 3BG0B 2IZ3A 3EERA 3RZDI 2P28A 1Q7Y2 2B63I 1NUIA 2K5RA 1YITZ 3S1RI 3I561 3CCEZ 3HOUI 3CXCZ 3CCRZ 1I50I 5A2Qf 2O53A 3CCJ1 3GTLI 3GKQA 4S1TA 1TWGI 3NH5A 3NH4A 3H3VJ 3I56Z 3S1MI 3JAMf 4TNUA 3CCS1 4E2WA 3NDIA 4DGLA 4A3KI 2OTJ1 1KQSZ 1Y1VS 1VQ51 1WW9A 5FLXf 4BY7I 1TWCI 3HOXI 2HF1A 2WAQA 1VQ61 2YADA 4BBRI 3HOVI 5C3EI 1M901 4RS4A 3CCM1 1S72Z 2OTJZ 3CCVZ 4QTTA 1VQO1 1VQ5Z 3CXCY 2IZ4A 4MXUA 2KPIA 1X0TA 3NH8A 5T64A 3CD61 3CCMZ 1VQK1 3G6E1 3D9XA 2HU9A 1JJ2Z 2Y0SA 4DQYB 2NVXI 1VQ81 4A3LI 4NFRA 1KC81 4NBAA 1KQSY 2AKLA 3HKZA 2OTLZ 4NBEA 4A3FI 5D1PA 4EWCA 1VQKZ 2V8JA 3EEDA 1Y1VI 1Q812 4E2ZA 2NVTI 1VQ8Z 1RNIA 2QA41 1ZB8A 3M4OI 5T67A 1NJI2 2V8KA 3CC4Z 2YU9I 4MONA 3M3YI 2E2HI 4E33A 3MONA 3T4NB 2GTHA 1KD11 1JJ2Y 4HH4A 5D1OA 2QA4Z 3GTPI 2GTIA 2VUGA 2JS4A 2F4OA 1YIT1 1N8R2 2JUBA 5IP7I 3H0GI 3VB9A 1KC82 4CL1A 4RV9A 3HOWI 1K8A1 4NBDA 1JWHC 4A3CI 2O4HA 3CPWZ 3I551 4NBGA 4RVFA 2GU2A 3VMGA 2OZKA 2WB1A 1QVFZ 4MRIA 2LFUA 5IT9f 1L1OC 5D1OB 2JA8I 3S1NI 5C44I 5FLXb 4E32A 3S17I 3FQQA 4DK1A 2JMOA 4HGYA 1KD12 2G2KA 4NH1C 1YIJ1 3I55Z 2PMZA 2K3RA 3PO3S 2R93I 3VMHA 4BY1I 4E30A 1S721 1N2FA 3CCV1 3J81f 1Y1WI 2QLVB 3J7A4 2E9HA 5FLMI 1USPA 3CCQZ 3FQMA 1YIJZ 2R6MA 3CC21 3F3PC 2KI7B 3P5JB 1VQ41 1RO4A 2JA5I 1QVFY 2EGTA 3GTJI 2OTL1 1I6HI 3CC2Z 3IF8A 2ZAEB 3S2HI 1YI21 3CCLZ 4MD9A 1VQ4Z 4XX2A 3PO2I 2QKDA 2OOXB 1VQMZ 4HGZA 4NBBA 1Z02A 1VQ7Z 2VUMI 3PO3I 5CM2M 1VQLZ 3CC41 1Q861 1YI2Z 4A3II 2RIQA 1YUAA 1YJ9Z 1LQLA 1KRLA 2JNYA 1K731 1YUKA 2LIYA 2E2JI 1M902 2OOYB 2Q51A 3OW2Z 4NOZA 4NBHA 1VQP1 1Q7Y1 1RO0A 2JA7I 1R9TI 3I4MI 3G71Z 2QRCB 3D6WA 1YJW1 4Y7NI 2V8IA 3LUSA 3CMAZ 1WIIA 3CCUZ 2BJOA 1VQPZ 1ZH1A 3CC71 3TE5B 1X3ZA 1Z01A 5IT9b 5A2Qb 1P9NA 1TFIA 3J80f 1YJWZ 3U50C 2JA6I 3IFUA 3JAMb 2RPRA 3S1QI 2DE5A 3CC7Z 4BBSI 3OW2Y 1K732 2QREB 3F3FC 2Q4ZA 2W04A 3K7AI 4RVHA 1W2BZ 3I07A 3G4S1 3GTGI 2JR6A 1WCMI 3CCQ1 4NBFA 1YJN1 3GTQI 3S2DI 1S7MA 1TWHI 1VQ91 4Y52I 3MZLB 2RHBA 5AN9F 1QF8A 2PK7A 1TWFI 2P3YA 2QRDB 1M1K1 1RO2A 4E2XA 3VTNA 4X6AI 3G4SZ 3MZKB 1YJNZ 1TWAI 1Q821 1PFTA 2I3CA 3CPWY 4A3GI 1VQ9Z 3HOZI 4MD7A 3CCL1 1K8A2 3S15I 2R92I 1YHQ1 2RBLA 3S16I 1VLAA 2H85A 1VQM1 4RVGA 5C4XI 3CCJZ 1Q811 1VQ71 1W2BY 2PM9A 3I4NI 2M6NA 1VQL1 3Q87A 1RQFA 3CCSZ 3GTOI 3ESWA 1NJI1 2M48A 1K9M1 1YHQZ 2R7ZI 1YJ91 2F4MA 5C4JI 2E2II 2QR1B 2DE7A 4NB9A 5LL6f 3NFZA 3NDJA 1QVGZ 3GTMS 1USPB 4A93I 1X3WA 1VQ6Z 4AYBA 1DL6A 3HOYI 1M1K2 4A3DI 2DE6A 1RLYA 1Z03A 3FKII 4A3EI 1N8R1 4RVDA 1VQOZ 4NBCA 3G711 1Q822 3BG1B 2QEX1 1QYPA 3VMIA 3CMA1 2NVYI 3CD6Z 1VQN1 3CCU1 3KIFA 3G6EZ 3IX0A 4QTUA 3S14I 1NP6A 3J80b 4A3MI 2QEXZ 3QWUA 1K9M2 1VQNZ 3RZOI 1QVGY 3CQZI 4MH4A 1SFOI 3CME1 4E31A 1K83I 1Q862 3GTMI 4E2YA 1I3QI 2W03A 2RT9A 5T6BA 4BXXI 2VF1A 2NVQI 3GTKI 2J6AA 3TDHB 1ML8A 4NB8A 3GCFA 3CMEZ 3KIHA 5IP9I 3J81b 3CCE1 4A3JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFT A;  2YU9 I;  4A3G I;  4NBB A;  4A3B I;  3M3Y I;  1ZB9 A;  3EER A;  3RZD I;  3HOZ I;  2E2H I;  2VUM I;  3S15 I;  2B63 I;  1NUI A;  2K5R A;  2R92 I;  3S1R I;  3PO3 I;  2RBL A;  5CM2 M;  3S16 I;  1VLA A;  5C4X I;  3GTP I;  2JS4 A;  4A3I I;  2F4O A;  3HOU I;  1YUA A;  5IP7 I;  3I4N I;  3Q87 A;  1I50 I;  1LQL A;  2JNY A;  3H0G I;  3VB9 A;  3GTL I;  3GTO I;  2E2J I;  3GKQ A;  1TWG I;  3ESW A;  3H3V J;  2R7Z I;  4NOZ A;  3S1M I;  2F4M A;  5C4J I;  2E2I I;  3HOW I;  4NB9 A;  2DE7 A;  4NBH A;  4NBD A;  3GTM S;  1USP B;  4A93 I;  2JA7 I;  4A3K I;  1X3W A;  4A3C I;  1R9T I;  3I4M I;  1DL6 A;  3HOY I;  1Y1V S;  3D6W A;  4A3D I;  2DE6 A;  1RLY A;  4NBG A;  1WW9 A;  3FKI I;  4A3E I;  1TWC I;  4BY7 I;  3VMG A;  3HOX I;  2HF1 A;  4Y7N I;  3LUS A;  4NBC A;  1L1O C;  4BBR I;  3HOV I;  2JA8 I;  2BJO A;  3S1N I;  5C44 I;  5C3E I;  1X3Z A;  3S17 I;  1QYP A;  3VMI A;  4QTT A;  2NVY I;  1TFI A;  2KPI A;  3U50 C;  4QTU A;  2JA6 I;  3S14 I;  3PO3 S;  2R93 I;  3VMH A;  4BY1 I;  1N2F A;  3S1Q I;  2DE5 A;  1Y1W I;  4A3M I;  4BBS I;  5FLM I;  1USP A;  2NVX I;  3RZO I;  3CQZ I;  4A3L I;  4MH4 A;  3K7A I;  1SFO I;  4NBA A;  2AKL A;  3I07 A;  4NBE A;  4A3F I;  3GTG I;  2JR6 A;  1K83 I;  1WCM I;  1RO4 A;  4NBF A;  3GTM I;  2JA5 I;  3GTQ I;  1I3Q I;  3S2D I;  1TWH I;  4BXX I;  4Y52 I;  1Y1V I;  3GTJ I;  2NVT I;  2NVQ I;  1I6H I;  3GTK I;  2J6A A;  2PK7 A;  1ML8 A;  1TWF I;  2P3Y A;  3GCF A;  4NB8 A;  3S2H I;  1ZB8 A;  5IP9 I;  4X6A I;  3M4O I;  4XX2 A;  3PO2 I;  4A3J I;  1TWA I; 
#chains in the Genus database with same CATH topology
 4MD8 A;  3CCR 1;  4A3B I;  1ZB9 A;  3BG0 B;  2IZ3 A;  3EER A;  3RZD I;  2P28 A;  1Q7Y 2;  2B63 I;  1NUI A;  2K5R A;  1YIT Z;  3S1R I;  3I56 1;  3CCE Z;  3HOU I;  3CXC Z;  3CCR Z;  1I50 I;  5A2Q f;  2O53 A;  3CCJ 1;  3GTL I;  3GKQ A;  4S1T A;  1TWG I;  3NH5 A;  3NH4 A;  1WJ2 A;  3H3V J;  3I56 Z;  3S1M I;  3JAM f;  4TNU A;  3CCS 1;  4E2W A;  3NDI A;  2E7Z A;  4DGL A;  4A3K I;  2OTJ 1;  1KQS Z;  1Y1V S;  1VQ5 1;  1WW9 A;  5FLX f;  4BY7 I;  1TWC I;  3HOX I;  2HF1 A;  2WAQ A;  1VQ6 1;  2VPW A;  2YAD A;  4BBR I;  3HOV I;  5C3E I;  1M90 1;  4RS4 A;  3CCM 1;  1S72 Z;  2OTJ Z;  3CCV Z;  4QTT A;  1VQO 1;  1VQ5 Z;  3CXC Y;  2IZ4 A;  4MXU A;  2KPI A;  1X0T A;  3NH8 A;  5T64 A;  3CD6 1;  3CCM Z;  1VQK 1;  3G6E 1;  3D9X A;  2HU9 A;  1JJ2 Z;  2Y0S A;  4DQY B;  2NVX I;  1VQ8 1;  4A3L I;  4NFR A;  1KC8 1;  4NBA A;  1KQS Y;  2AKL A;  3HKZ A;  2OTL Z;  4NBE A;  4A3F I;  5D1P A;  4EWC A;  1VQK Z;  2V8J A;  3EED A;  1Y1V I;  1Q81 2;  4E2Z A;  2NVT I;  1VQ8 Z;  2IV2 X;  1RNI A;  2QA4 1;  1ZB8 A;  3M4O I;  5T67 A;  1NJI 2;  2V8K A;  2VPY A;  3CC4 Z;  2YU9 I;  4MON A;  3M3Y I;  2E2H I;  4E33 A;  3MON A;  3T4N B;  2GTH A;  1KD1 1;  1JJ2 Y;  4HH4 A;  5D1O A;  2QA4 Z;  1FDO A;  2NAP A;  3GTP I;  2GTI A;  2VUG A;  2JS4 A;  2F4O A;  2JIP A;  1YIT 1;  1N8R 2;  2JUB A;  5IP7 I;  3H0G I;  3VB9 A;  1KC8 2;  4CL1 A;  4RV9 A;  3HOW I;  1K8A 1;  4NBD A;  1JWH C;  4A3C I;  2O4H A;  3CPW Z;  3I55 1;  4NBG A;  4RVF A;  2GU2 A;  1AA6 A;  3VMG A;  2OZK A;  2WB1 A;  1QVF Z;  4MRI A;  2LFU A;  5IT9 f;  1L1O C;  5D1O B;  2JA8 I;  3S1N I;  5C44 I;  5FLX b;  4E32 A;  3S17 I;  3FQQ A;  2V45 A;  4DK1 A;  2JMO A;  4HGY A;  1KD1 2;  2G2K A;  4NH1 C;  1YIJ 1;  3I55 Z;  1SIW A;  2PMZ A;  2K3R A;  2JIQ A;  3PO3 S;  2R93 I;  3VMH A;  4BY1 I;  4E30 A;  1S72 1;  1N2F A;  3CCV 1;  3J81 f;  1Y1W I;  2QLV B;  3J7A 4;  2E9H A;  5FLM I;  1USP A;  3CCQ Z;  3FQM A;  3IR7 A;  2R6M A;  1YIJ Z;  3CC2 1;  2AYD A;  3F3P C;  2KI7 B;  3P5J B;  1VQ4 1;  1RO4 A;  2JA5 I;  1QVF Y;  2EGT A;  3GTJ I;  2OTL 1;  1I6H I;  3CC2 Z;  3IF8 A;  2ZAE B;  3S2H I;  1YI2 1;  3CCL Z;  4MD9 A;  1VQ4 Z;  4XX2 A;  3PO2 I;  2QKD A;  2JIO A;  2OOX B;  1VQM Z;  4HGZ A;  4NBB A;  1Z02 A;  1VQ7 Z;  2VUM I;  3PO3 I;  5CM2 M;  1VQL Z;  3CC4 1;  1Q86 1;  1YI2 Z;  4A3I I;  2V3V A;  2RIQ A;  1YUA A;  1YJ9 Z;  1LQL A;  1KRL A;  2JNY A;  1K73 1;  1YUK A;  2LIY A;  2E2J I;  1M90 2;  2OOY B;  2Q51 A;  3OW2 Z;  4NOZ A;  2JIM A;  4NBH A;  1VQP 1;  1Q7Y 1;  1RO0 A;  1WZN A;  2JA7 I;  1R9T I;  3I4M I;  3G71 Z;  2VPX A;  2QRC B;  3D6W A;  1YJW 1;  4Y7N I;  2V8I A;  3LUS A;  3CMA Z;  1WII A;  3CCU Z;  2BJO A;  1VQP Z;  1ZH1 A;  3CC7 1;  3TE5 B;  1X3Z A;  1Z01 A;  5IT9 b;  5A2Q b;  1P9N A;  1TFI A;  3J80 f;  1YJW Z;  3U50 C;  2JA6 I;  3IFU A;  3JAM b;  2RPR A;  3S1Q I;  2DE5 A;  3CC7 Z;  4BBS I;  3OW2 Y;  1K73 2;  2QRE B;  3F3F C;  2Q4Z A;  2W04 A;  3K7A I;  4RVH A;  1W2B Z;  1FDI A;  3I07 A;  3G4S 1;  3GTG I;  2JR6 A;  1WCM I;  3CCQ 1;  4NBF A;  1YJN 1;  3GTQ I;  3S2D I;  1S7M A;  1TWH I;  1VQ9 1;  4Y52 I;  3MZL B;  2RHB A;  5AN9 F;  1QF8 A;  2PK7 A;  1TWF I;  2P3Y A;  2QRD B;  1M1K 1;  1RO2 A;  4E2X A;  3VTN A;  4X6A I;  3G4S Z;  3MZK B;  1YJN Z;  1TWA I;  1Q82 1;  1PFT A;  2I3C A;  3CPW Y;  4A3G I;  1VQ9 Z;  3HOZ I;  4MD7 A;  3CCL 1;  1K8A 2;  3S15 I;  2R92 I;  1YHQ 1;  2RBL A;  3S16 I;  1VLA A;  2H85 A;  1VQM 1;  4RVG A;  5C4X I;  3CCJ Z;  1Q81 1;  1VQ7 1;  1W2B Y;  2PM9 A;  1QXF A;  3I4N I;  1Y8C A;  2M6N A;  1VQL 1;  3Q87 A;  1Q16 A;  1RQF A;  3CCS Z;  2LEX A;  3GTO I;  3ESW A;  1NJI 1;  2M48 A;  1K9M 1;  1YHQ Z;  2R7Z I;  1YJ9 1;  2F4M A;  5C4J I;  2E2I I;  2QR1 B;  2DE7 A;  4NB9 A;  5LL6 f;  3NFZ A;  3NDJ A;  1QVG Z;  3GTM S;  1USP B;  4A93 I;  1X3W A;  1VQ6 Z;  4AYB A;  1DL6 A;  3HOY I;  1M1K 2;  4A3D I;  2DE6 A;  1RLY A;  1Z03 A;  3FKI I;  4A3E I;  1N8R 1;  4RVD A;  2JIR A;  1VQO Z;  4NBC A;  3G71 1;  1Q82 2;  3BG1 B;  2QEX 1;  3D2L A;  1QYP A;  3VMI A;  3CMA 1;  2NVY I;  3CD6 Z;  1VQN 1;  3CCU 1;  3KIF A;  3G6E Z;  3IX0 A;  4QTU A;  3S14 I;  1NP6 A;  3J80 b;  4A3M I;  2QEX Z;  3QWU A;  1K9M 2;  1VQN Z;  3RZO I;  1QVG Y;  3CQZ I;  4MH4 A;  1SFO I;  2VPZ A;  3CME 1;  4E31 A;  1K83 I;  1Q86 2;  3GTM I;  4E2Y A;  1I3Q I;  2W03 A;  2RT9 A;  5T6B A;  4BXX I;  2VF1 A;  2NVQ I;  3GTK I;  2J6A A;  3TDH B;  1ML8 A;  4NB8 A;  3GCF A;  3CME Z;  3KIH A;  5IP9 I;  3J81 b;  3CCE 1;  4A3J I; 
#chains in the Genus database with same CATH homology
 4MD8 A;  3CCR 1;  4A3B I;  1ZB9 A;  3BG0 B;  2IZ3 A;  3EER A;  3RZD I;  2P28 A;  1Q7Y 2;  2B63 I;  1NUI A;  2K5R A;  1YIT Z;  3S1R I;  3I56 1;  3CCE Z;  3HOU I;  3CXC Z;  3CCR Z;  1I50 I;  5A2Q f;  2O53 A;  3CCJ 1;  3GTL I;  3GKQ A;  4S1T A;  1TWG I;  3NH5 A;  3NH4 A;  3H3V J;  3I56 Z;  3S1M I;  3JAM f;  4TNU A;  3CCS 1;  4E2W A;  3NDI A;  4DGL A;  4A3K I;  2OTJ 1;  1KQS Z;  1Y1V S;  1VQ5 1;  1WW9 A;  5FLX f;  4BY7 I;  1TWC I;  3HOX I;  2HF1 A;  2WAQ A;  1VQ6 1;  2YAD A;  4BBR I;  3HOV I;  5C3E I;  1M90 1;  4RS4 A;  3CCM 1;  1S72 Z;  2OTJ Z;  3CCV Z;  4QTT A;  1VQO 1;  1VQ5 Z;  3CXC Y;  2IZ4 A;  4MXU A;  2KPI A;  1X0T A;  3NH8 A;  5T64 A;  3CD6 1;  3CCM Z;  1VQK 1;  3G6E 1;  3D9X A;  2HU9 A;  1JJ2 Z;  2Y0S A;  4DQY B;  2NVX I;  1VQ8 1;  4A3L I;  4NFR A;  1KC8 1;  4NBA A;  1KQS Y;  2AKL A;  3HKZ A;  2OTL Z;  4NBE A;  4A3F I;  5D1P A;  4EWC A;  1VQK Z;  2V8J A;  3EED A;  1Y1V I;  1Q81 2;  4E2Z A;  2NVT I;  1VQ8 Z;  1RNI A;  2QA4 1;  1ZB8 A;  3M4O I;  5T67 A;  1NJI 2;  2V8K A;  3CC4 Z;  2YU9 I;  4MON A;  3M3Y I;  2E2H I;  4E33 A;  3MON A;  3T4N B;  2GTH A;  1KD1 1;  1JJ2 Y;  4HH4 A;  5D1O A;  2QA4 Z;  3GTP I;  2GTI A;  2VUG A;  2JS4 A;  2F4O A;  1YIT 1;  1N8R 2;  2JUB A;  5IP7 I;  3H0G I;  3VB9 A;  1KC8 2;  4CL1 A;  4RV9 A;  3HOW I;  1K8A 1;  4NBD A;  1JWH C;  4A3C I;  2O4H A;  3CPW Z;  3I55 1;  4NBG A;  4RVF A;  2GU2 A;  3VMG A;  2OZK A;  2WB1 A;  1QVF Z;  4MRI A;  2LFU A;  5IT9 f;  1L1O C;  5D1O B;  2JA8 I;  3S1N I;  5C44 I;  5FLX b;  4E32 A;  3S17 I;  3FQQ A;  4DK1 A;  2JMO A;  4HGY A;  1KD1 2;  2G2K A;  4NH1 C;  1YIJ 1;  3I55 Z;  2PMZ A;  2K3R A;  3PO3 S;  2R93 I;  3VMH A;  4BY1 I;  4E30 A;  1S72 1;  1N2F A;  3CCV 1;  3J81 f;  1Y1W I;  2QLV B;  3J7A 4;  2E9H A;  5FLM I;  1USP A;  3CCQ Z;  3FQM A;  1YIJ Z;  2R6M A;  3CC2 1;  3F3P C;  2KI7 B;  3P5J B;  1VQ4 1;  1RO4 A;  2JA5 I;  1QVF Y;  2EGT A;  3GTJ I;  2OTL 1;  1I6H I;  3CC2 Z;  3IF8 A;  2ZAE B;  3S2H I;  1YI2 1;  3CCL Z;  4MD9 A;  1VQ4 Z;  4XX2 A;  3PO2 I;  2QKD A;  2OOX B;  1VQM Z;  4HGZ A;  4NBB A;  1Z02 A;  1VQ7 Z;  2VUM I;  3PO3 I;  5CM2 M;  1VQL Z;  3CC4 1;  1Q86 1;  1YI2 Z;  4A3I I;  2RIQ A;  1YUA A;  1YJ9 Z;  1LQL A;  1KRL A;  2JNY A;  1K73 1;  1YUK A;  2LIY A;  2E2J I;  1M90 2;  2OOY B;  2Q51 A;  3OW2 Z;  4NOZ A;  4NBH A;  1VQP 1;  1Q7Y 1;  1RO0 A;  2JA7 I;  1R9T I;  3I4M I;  3G71 Z;  2QRC B;  3D6W A;  1YJW 1;  4Y7N I;  2V8I A;  3LUS A;  3CMA Z;  1WII A;  3CCU Z;  2BJO A;  1VQP Z;  1ZH1 A;  3CC7 1;  3TE5 B;  1X3Z A;  1Z01 A;  5IT9 b;  5A2Q b;  1P9N A;  1TFI A;  3J80 f;  1YJW Z;  3U50 C;  2JA6 I;  3IFU A;  3JAM b;  2RPR A;  3S1Q I;  2DE5 A;  3CC7 Z;  4BBS I;  3OW2 Y;  1K73 2;  2QRE B;  3F3F C;  2Q4Z A;  2W04 A;  3K7A I;  4RVH A;  1W2B Z;  3I07 A;  3G4S 1;  3GTG I;  2JR6 A;  1WCM I;  3CCQ 1;  4NBF A;  1YJN 1;  3GTQ I;  3S2D I;  1S7M A;  1TWH I;  1VQ9 1;  4Y52 I;  3MZL B;  2RHB A;  5AN9 F;  1QF8 A;  2PK7 A;  1TWF I;  2P3Y A;  2QRD B;  1M1K 1;  1RO2 A;  4E2X A;  3VTN A;  4X6A I;  3G4S Z;  3MZK B;  1YJN Z;  1TWA I;  1Q82 1;  1PFT A;  2I3C A;  3CPW Y;  4A3G I;  1VQ9 Z;  3HOZ I;  4MD7 A;  3CCL 1;  1K8A 2;  3S15 I;  2R92 I;  1YHQ 1;  2RBL A;  3S16 I;  1VLA A;  2H85 A;  1VQM 1;  4RVG A;  5C4X I;  3CCJ Z;  1Q81 1;  1VQ7 1;  1W2B Y;  2PM9 A;  3I4N I;  2M6N A;  1VQL 1;  3Q87 A;  1RQF A;  3CCS Z;  3GTO I;  3ESW A;  1NJI 1;  2M48 A;  1K9M 1;  1YHQ Z;  2R7Z I;  1YJ9 1;  2F4M A;  5C4J I;  2E2I I;  2QR1 B;  2DE7 A;  4NB9 A;  5LL6 f;  3NFZ A;  3NDJ A;  1QVG Z;  3GTM S;  1USP B;  4A93 I;  1X3W A;  1VQ6 Z;  4AYB A;  1DL6 A;  3HOY I;  1M1K 2;  4A3D I;  2DE6 A;  1RLY A;  1Z03 A;  3FKI I;  4A3E I;  1N8R 1;  4RVD A;  1VQO Z;  4NBC A;  3G71 1;  1Q82 2;  3BG1 B;  2QEX 1;  1QYP A;  3VMI A;  3CMA 1;  2NVY I;  3CD6 Z;  1VQN 1;  3CCU 1;  3KIF A;  3G6E Z;  3IX0 A;  4QTU A;  3S14 I;  1NP6 A;  3J80 b;  4A3M I;  2QEX Z;  3QWU A;  1K9M 2;  1VQN Z;  3RZO I;  1QVG Y;  3CQZ I;  4MH4 A;  1SFO I;  3CME 1;  4E31 A;  1K83 I;  1Q86 2;  3GTM I;  4E2Y A;  1I3Q I;  2W03 A;  2RT9 A;  5T6B A;  4BXX I;  2VF1 A;  2NVQ I;  3GTK I;  2J6A A;  3TDH B;  1ML8 A;  4NB8 A;  3GCF A;  3CME Z;  3KIH A;  5IP9 I;  3J81 b;  3CCE 1;  4A3J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...