2E2HI

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI02
5IP7I 3H0GI 5C4JI 4A3DI 2DE5A 3GTMI 2E2II 1RO4A 4A3LI 4A3FI 2YU9I 2KPIA 3I4MI 2B63I 1I50I 4QTTA 2R7ZI 1TWHI 1Y1WI 2DE7A 1I6HI 3GTOI 3HOWI 1YUAA 4NBGA 2F4OA 1USPA 4A3JI 4A3EI 3I07A 1RLYA 4A3KI 2JNYA 1ZB9A 2R92I 4BY1I 3PO3S 4A3II 2NVXI 4A93I 3S15I 3S17I 3GTPI 2HF1A 3GTLI 3GTQI 3HOXI 3S1NI 4XX2A 3S2DI 1WW9A 2PK7A 3EERA 2P3YA 2F4MA 3FKII 5FLMI 1I3QI 2BJOA 1QYPA 3S16I 1USPB 3Q87A 3VMIA 1K83I 4A3GI 4NBDA 3M3YI 3CQZI 3S1RI 2NVTI 3GTMS 4BY7I 3S2HI 2NVQI 3LUSA 3VB9A 1Y1VI 2E2HI 5C4XI 1LQLA 1TWGI 4MH4A 3HOZI 1N2FA 3HOVI 2JS4A 4NBHA 2JA8I 3ESWA 1R9TI 3M4OI 3GKQA 2JA5I 3PO2I 3HOUI 3GCFA 1NUIA 4Y7NI 3D6WA 4NB8A 5C44I 1VLAA 1X3WA 4X6AI 1WCMI 2R93I 2K5RA 2RBLA 3S14I 4BBSI 4BXXI 1ML8A 1X3ZA 3I4NI 5C3EI 4BBRI 1TWFI 2NVYI 2JA7I 2AKLA 4NBAA 3GTJI 4Y52I 1TWCI 1TFIA 4NBEA 3RZDI 3GTKI 3HOYI 3S1MI 2J6AA 4NBCA 5IP9I 1DL6A 4NB9A 1TWAI 3H3VJ 4A3CI 3U50C 3PO3I 3VMHA 1SFOI 3K7AI 1Y1VS 3GTGI 3S1QI 3RZOI 2VUMI 2DE6A 4A3MI 1ZB8A 2JR6A 2E2JI 4A3BI 3VMGA 4QTUA 1L1OC 1PFTA 5CM2M 4NBFA 4NBBA 4NOZA 2JA6I
chains in the Genus database with same CATH superfamily
2JIOA 4A3DI 1FDIA 2DE5A 3TE5B 4A3FI 1VQNZ 1VQ51 3CCUZ 2QEXZ 3G4S1 1YUAA 4NBGA 1VQLZ 3NH5A 3J7A4 3CCV1 1M902 3I07A 1VQ91 1RLYA 2R92I 1Q7Y1 2PM9A 3CCR1 1Q861 3S17I 3CCQ1 2KI7B 4HGYA 4NFRA 2PMZA 3FQQA 3S2DI 3CME1 3FQMA 2OZKA 3FKII 5T6BA 1RQFA 1QYPA 3S16I 4E2YA 5IT9f 3VMIA 2OOXB 4A3GI 1K731 1KC81 3CCE1 3M3YI 3CQZI 2E9HA 3CPWY 1VQ5Z 1QVFY 2E7ZA 3VB9A 2IV2X 1N8R2 3G4SZ 4DK1A 2E2HI 3CCVZ 1VQ9Z 2JA8I 3NH4A 3M4OI 3CCRZ 1M1K2 3CCQZ 3D6WA 5C44I 1WCMI 3J80f 2YADA 3CMEZ 1QF8A 4MD9A 4BXXI 1RO0A 5C3EI 2AKLA 3CCEZ 3I561 1K9M1 2V8IA 1YHQ1 4E2XA 1TFIA 4NBEA 1VQK1 3S1MI 2J6AA 5IP9I 1DL6A 1VQM1 2O4HA 2V8JA 3MONA 4EWCA 3CC41 1PFTA 2M6NA 3H0GI 5C4JI 2P28A 5A2Qf 1Q812 2YU9I 3CPWZ 1QVFZ 4QTTA 3J81b 1Y1WI 2VPYA 3I56Z 3HOWI 2V45A 1YHQZ 1KD12 4RS4A 3T4NB 1VQKZ 2F4OA 1YJ91 1YI21 3F3FC 1VQMZ 4E31A 2JNYA 3PO3S 4A93I 3CC4Z 3GTQI 3HOXI 3BG0B 4RVGA 2K3RA 1P9NA 5FLMI 2Q4ZA 2ZAEB 3I551 1W2BY 1VQ41 2NVTI 3D2LA 1VQ61 4HH4A 1Z01A 3G711 2OTJ1 5T64A 2QA41 3KIFA 2RIQA 2IZ4A 2H85A 1Y8CA 4MH4A 1YJ9Z 1N2FA 3BG1B 3CCS1 1YI2Z 1WJ2A 5LL6f 3GCFA 1KRLA 3MZLB 1NJI2 2V3VA 1M901 1ML8A 3I4NI 2LFUA 3CC21 1TWFI 5D1PA 3I55Z 2JA7I 1VQP1 4E32A 2JMOA 3EEDA 4NBAA 1VQ4Z 4MD7A 2QREB 1VQ6Z 4Y52I 1TWCI 3G71Z 2OTJZ 3GTKI 2VPXA 3CCL1 2QA4Z 3H3VJ 3PO3I 3VMHA 2VPZA 1Y1VS 3IR7A 3GTGI 2VPWA 3CCSZ 4HGZA 2E2JI 3OW2Y 4QTUA 2RT9A 2EGTA 4RVHA 1N8R1 2QRCB 2Q51A 2QR1B 3JAMf 1QVGY 1JJ2Y 1W2BZ 2E2II 4A3LI 3CC2Z 1K8A2 1M1K1 1VQPZ 3CXCY 2B63I 3I4MI 1I50I 2R7ZI 2M48A 2I3CA 2WAQA 2DE7A 3GTOI 5IT9b 3CCLZ 1QXFA 3VTNA 4A3EI 1Q822 4DGLA 4BY1I 4A3II 3QWUA 2IZ3A 2HF1A 3S1NI 4XX2A 2W03A 2PK7A 4E2ZA 2P3YA 1VQ71 2QLVB 3IFUA 1USPB 1K83I 1X0TA 1RNIA 2JIPA 3S1RI 3GTMS 2O53A 3J80b 2GU2A 3LUSA 1AA6A 1Y1VI 4RV9A 5C4XI 3F3PC 1TWGI 1VQO1 3HOZI 3JAMb 3HKZA 2JS4A 2RPRA 4NBHA 1Q811 3IF8A 2RHBA 3MZKB 1R9TI 3CD61 1RO2A 3GKQA 3PO2I 4MXUA 3NDJA 1NUIA 4Y7NI 1YIT1 5FLXf 4NB8A 1VLAA 2GTHA 1FDOA 2V8KA 1KD11 3G6E1 1VQ81 1QVGZ 2RBLA 1VQ7Z 1YJN1 4BBSI 1JJ2Z 2JIRA 5D1OB 3CCM1 1Z02A 4E30A 2NVYI 1Q7Y2 4AYBA 1Z03A 3KIHA 1Q862 3CXCZ 3RZDI 3TDHB 5A2Qb 4A3CI 3U50C 2QKDA 3RZOI 1VQOZ 1K732 1KC82 3D9XA 5AN9F 3CD6Z 4CL1A 3VMGA 1L1OC 1YITZ 3NFZA 2JIQA 1ZH1A 5CM2M 1YJW1 4NBFA 1KQSY 4NBBA 2JA6I 3G6EZ 5IP7I 1VQ8Z 1SIWA 1YJNZ 2JIMA 3GTMI 1RO4A 3CCMZ 4RVDA 2KPIA 3CC71 1JWHC 1YUKA 1TWHI 2R6MA 3IX0A 4TNUA 1I6HI 2VF1A 2OOYB 5T67A 5FLXb 4RVFA 1S721 1NJI1 1USPA 4A3JI 4A3KI 1ZB9A 2LIYA 2NVXI 3S15I 3GTPI 3CMA1 3GTLI 1K9M2 1NP6A 1WW9A 3EERA 3J81f 4E33A 2F4MA 1WIIA 4MONA 4MD8A 1I3QI 1YJWZ 2BJOA 1WZNA 3Q87A 4S1TA 2LEXA 4NBDA 1YIJ1 2G2KA 4BY7I 3CC7Z 3S2HI 2NVQI 2VUGA 1S72Z 2OTL1 1LQLA 5D1OA 3CCJ1 3HOVI 2JUBA 3ESWA 1K8A1 2JA5I 2NAPA 3HOUI 3CMAZ 4DQYB 1KQSZ 2AYDA 1X3WA 4X6AI 4MRIA 2R93I 2HU9A 2K5RA 3S14I 1Q821 1X3ZA 4BBRI 2GTIA 1VQN1 3NH8A 2W04A 1YIJZ 3CCU1 2QEX1 3P5JB 3GTJI 2WB1A 1VQL1 3HOYI 4NBCA 3OW2Z 4NB9A 1TWAI 4NH1C 1SFOI 3K7AI 2OTLZ 3S1QI 3CCJZ 4E2WA 2VUMI 2DE6A 2Y0SA 4A3MI 1ZB8A 2JR6A 3NDIA 1S7MA 4A3BI 1Q16A 4NOZA 2QRDB
chains in the Genus database with same CATH topology
4A3DI 2DE5A 3TE5B 4A3FI 1VQNZ 1VQ51 3CCUZ 2QEXZ 3G4S1 1YUAA 4NBGA 1VQLZ 3NH5A 3J7A4 3CCV1 1M902 3I07A 1VQ91 1RLYA 2R92I 1Q7Y1 2PM9A 3CCR1 1Q861 3S17I 3CCQ1 2KI7B 4HGYA 4NFRA 2PMZA 3FQQA 3S2DI 3CME1 3FQMA 2OZKA 3FKII 5T6BA 1RQFA 1QYPA 3S16I 4E2YA 5IT9f 3VMIA 2OOXB 4A3GI 1K731 1KC81 3CCE1 3M3YI 3CQZI 2E9HA 3CPWY 1VQ5Z 1QVFY 3VB9A 1N8R2 3G4SZ 4DK1A 2E2HI 3CCVZ 1VQ9Z 2JA8I 3NH4A 3M4OI 3CCRZ 1M1K2 3CCQZ 3D6WA 5C44I 1WCMI 3J80f 2YADA 3CMEZ 1QF8A 4MD9A 4BXXI 1RO0A 5C3EI 2AKLA 3CCEZ 3I561 1K9M1 2V8IA 1YHQ1 4E2XA 1TFIA 4NBEA 1VQK1 3S1MI 2J6AA 5IP9I 1DL6A 1VQM1 2O4HA 2V8JA 3MONA 4EWCA 3CC41 1PFTA 2M6NA 3H0GI 5C4JI 2P28A 5A2Qf 1Q812 2YU9I 3CPWZ 1QVFZ 4QTTA 3J81b 1Y1WI 3I56Z 3HOWI 1YHQZ 1KD12 4RS4A 3T4NB 1VQKZ 2F4OA 1YJ91 1YI21 3F3FC 1VQMZ 4E31A 2JNYA 3PO3S 4A93I 3CC4Z 3GTQI 3HOXI 3BG0B 4RVGA 2K3RA 1P9NA 5FLMI 2Q4ZA 2ZAEB 3I551 1W2BY 1VQ41 2NVTI 1VQ61 4HH4A 1Z01A 3G711 2OTJ1 5T64A 2QA41 3KIFA 2RIQA 2IZ4A 2H85A 4MH4A 1YJ9Z 1N2FA 3BG1B 3CCS1 1YI2Z 5LL6f 3GCFA 1KRLA 3MZLB 1NJI2 1M901 1ML8A 3I4NI 2LFUA 3CC21 1TWFI 5D1PA 3I55Z 2JA7I 1VQP1 4E32A 2JMOA 3EEDA 4NBAA 1VQ4Z 4MD7A 2QREB 1VQ6Z 4Y52I 1TWCI 3G71Z 2OTJZ 3GTKI 3CCL1 2QA4Z 3H3VJ 3PO3I 3VMHA 1Y1VS 3GTGI 3CCSZ 4HGZA 2E2JI 3OW2Y 4QTUA 2RT9A 2EGTA 4RVHA 1N8R1 2QRCB 2Q51A 2QR1B 3JAMf 1QVGY 1JJ2Y 1W2BZ 2E2II 4A3LI 3CC2Z 1K8A2 1M1K1 1VQPZ 3CXCY 2B63I 3I4MI 1I50I 2R7ZI 2M48A 2I3CA 2WAQA 2DE7A 3GTOI 5IT9b 3CCLZ 3VTNA 4A3EI 1Q822 4DGLA 4BY1I 4A3II 3QWUA 2IZ3A 2HF1A 3S1NI 4XX2A 2W03A 2PK7A 4E2ZA 2P3YA 1VQ71 2QLVB 3IFUA 1USPB 1K83I 1X0TA 1RNIA 3S1RI 3GTMS 2O53A 3J80b 2GU2A 3LUSA 1Y1VI 4RV9A 5C4XI 3F3PC 1TWGI 1VQO1 3HOZI 3JAMb 3HKZA 2JS4A 2RPRA 4NBHA 1Q811 3IF8A 2RHBA 3MZKB 1R9TI 3CD61 1RO2A 3GKQA 3PO2I 4MXUA 3NDJA 1NUIA 4Y7NI 1YIT1 5FLXf 4NB8A 1VLAA 2GTHA 2V8KA 1KD11 3G6E1 1VQ81 1QVGZ 2RBLA 1VQ7Z 1YJN1 4BBSI 1JJ2Z 5D1OB 3CCM1 1Z02A 4E30A 2NVYI 1Q7Y2 4AYBA 1Z03A 3KIHA 1Q862 3CXCZ 3RZDI 3TDHB 5A2Qb 4A3CI 3U50C 2QKDA 3RZOI 1VQOZ 1K732 1KC82 3D9XA 5AN9F 3CD6Z 4CL1A 3VMGA 1L1OC 1YITZ 3NFZA 5CM2M 1ZH1A 1KQSY 1YJW1 4NBFA 4NBBA 2JA6I 3G6EZ 5IP7I 1VQ8Z 1YJNZ 3GTMI 1RO4A 3CCMZ 4RVDA 2KPIA 3CC71 1JWHC 1YUKA 1TWHI 2R6MA 3IX0A 4TNUA 1I6HI 2VF1A 2OOYB 5T67A 5FLXb 4RVFA 1S721 1NJI1 1USPA 4A3JI 4A3KI 1ZB9A 2LIYA 2NVXI 3S15I 3GTPI 3CMA1 3GTLI 1K9M2 1NP6A 1WW9A 3EERA 3J81f 4E33A 2F4MA 1WIIA 4MONA 4MD8A 1I3QI 1YJWZ 2BJOA 3Q87A 4S1TA 4NBDA 1YIJ1 2G2KA 4BY7I 3CC7Z 3S2HI 2NVQI 2VUGA 1S72Z 2OTL1 1LQLA 5D1OA 3CCJ1 3HOVI 2JUBA 3ESWA 1K8A1 2JA5I 3HOUI 3CMAZ 4DQYB 1KQSZ 1X3WA 4X6AI 4MRIA 2R93I 2HU9A 2K5RA 3S14I 1Q821 1X3ZA 4BBRI 2GTIA 1VQN1 3NH8A 2W04A 1YIJZ 3CCU1 2QEX1 3P5JB 3GTJI 2WB1A 1VQL1 3HOYI 4NBCA 3OW2Z 4NB9A 1TWAI 4NH1C 1SFOI 3K7AI 2OTLZ 3S1QI 3CCJZ 4E2WA 2VUMI 2DE6A 2Y0SA 4A3MI 1ZB8A 2JR6A 3NDIA 1S7MA 4A3BI 4NOZA 2QRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  3H0G I;  5C4J I;  4A3D I;  2DE5 A;  3GTM I;  2E2I I;  1RO4 A;  4A3L I;  4A3F I;  2YU9 I;  2KPI A;  3I4M I;  2B63 I;  1I50 I;  4QTT A;  2R7Z I;  1TWH I;  1Y1W I;  2DE7 A;  1I6H I;  3GTO I;  3HOW I;  1YUA A;  4NBG A;  2F4O A;  1USP A;  4A3J I;  4A3E I;  3I07 A;  1RLY A;  4A3K I;  2JNY A;  1ZB9 A;  2R92 I;  4BY1 I;  3PO3 S;  4A3I I;  2NVX I;  4A93 I;  3S15 I;  3S17 I;  3GTP I;  2HF1 A;  3GTL I;  3GTQ I;  3HOX I;  3S1N I;  4XX2 A;  3S2D I;  1WW9 A;  2PK7 A;  3EER A;  2P3Y A;  2F4M A;  3FKI I;  5FLM I;  1I3Q I;  2BJO A;  1QYP A;  3S16 I;  1USP B;  3Q87 A;  3VMI A;  1K83 I;  4A3G I;  4NBD A;  3M3Y I;  3CQZ I;  3S1R I;  2NVT I;  3GTM S;  4BY7 I;  3S2H I;  2NVQ I;  3LUS A;  3VB9 A;  1Y1V I;  2E2H I;  5C4X I;  1LQL A;  1TWG I;  4MH4 A;  3HOZ I;  1N2F A;  3HOV I;  2JS4 A;  4NBH A;  2JA8 I;  3ESW A;  1R9T I;  3M4O I;  3GKQ A;  2JA5 I;  3PO2 I;  3HOU I;  3GCF A;  1NUI A;  4Y7N I;  3D6W A;  4NB8 A;  5C44 I;  1VLA A;  1X3W A;  4X6A I;  1WCM I;  2R93 I;  2K5R A;  2RBL A;  3S14 I;  4BBS I;  4BXX I;  1ML8 A;  1X3Z A;  3I4N I;  5C3E I;  4BBR I;  1TWF I;  2NVY I;  2JA7 I;  2AKL A;  4NBA A;  3GTJ I;  4Y52 I;  1TWC I;  1TFI A;  4NBE A;  3RZD I;  3GTK I;  3HOY I;  3S1M I;  2J6A A;  4NBC A;  5IP9 I;  1DL6 A;  4NB9 A;  1TWA I;  3H3V J;  4A3C I;  3U50 C;  3PO3 I;  3VMH A;  1SFO I;  3K7A I;  1Y1V S;  3GTG I;  3S1Q I;  3RZO I;  2VUM I;  2DE6 A;  4A3M I;  1ZB8 A;  2JR6 A;  2E2J I;  4A3B I;  3VMG A;  4QTU A;  1L1O C;  1PFT A;  5CM2 M;  4NBF A;  4NBB A;  4NOZ A;  2JA6 I; 
#chains in the Genus database with same CATH topology
 2JIO A;  4A3D I;  1FDI A;  2DE5 A;  3TE5 B;  4A3F I;  1VQN Z;  1VQ5 1;  3CCU Z;  2QEX Z;  3G4S 1;  1YUA A;  4NBG A;  1VQL Z;  3NH5 A;  3J7A 4;  3CCV 1;  1M90 2;  3I07 A;  1VQ9 1;  1RLY A;  2R92 I;  1Q7Y 1;  2PM9 A;  3CCR 1;  1Q86 1;  3S17 I;  3CCQ 1;  2KI7 B;  4HGY A;  4NFR A;  2PMZ A;  3FQQ A;  3S2D I;  3CME 1;  3FQM A;  2OZK A;  3FKI I;  5T6B A;  1RQF A;  1QYP A;  3S16 I;  4E2Y A;  5IT9 f;  3VMI A;  2OOX B;  4A3G I;  1K73 1;  1KC8 1;  3CCE 1;  3M3Y I;  3CQZ I;  2E9H A;  3CPW Y;  1VQ5 Z;  1QVF Y;  2E7Z A;  3VB9 A;  2IV2 X;  1N8R 2;  3G4S Z;  4DK1 A;  2E2H I;  3CCV Z;  1VQ9 Z;  2JA8 I;  3NH4 A;  3M4O I;  3CCR Z;  1M1K 2;  3CCQ Z;  3D6W A;  5C44 I;  1WCM I;  3J80 f;  2YAD A;  3CME Z;  1QF8 A;  4MD9 A;  4BXX I;  1RO0 A;  5C3E I;  2AKL A;  3CCE Z;  3I56 1;  1K9M 1;  2V8I A;  1YHQ 1;  4E2X A;  1TFI A;  4NBE A;  1VQK 1;  3S1M I;  2J6A A;  5IP9 I;  1DL6 A;  1VQM 1;  2O4H A;  2V8J A;  3MON A;  4EWC A;  3CC4 1;  1PFT A;  2M6N A;  3H0G I;  5C4J I;  2P28 A;  5A2Q f;  1Q81 2;  2YU9 I;  3CPW Z;  1QVF Z;  4QTT A;  3J81 b;  1Y1W I;  2VPY A;  3I56 Z;  3HOW I;  2V45 A;  1YHQ Z;  1KD1 2;  4RS4 A;  3T4N B;  1VQK Z;  2F4O A;  1YJ9 1;  1YI2 1;  3F3F C;  1VQM Z;  4E31 A;  2JNY A;  3PO3 S;  4A93 I;  3CC4 Z;  3GTQ I;  3HOX I;  3BG0 B;  4RVG A;  2K3R A;  1P9N A;  5FLM I;  2Q4Z A;  2ZAE B;  3I55 1;  1W2B Y;  1VQ4 1;  2NVT I;  3D2L A;  1VQ6 1;  4HH4 A;  1Z01 A;  3G71 1;  2OTJ 1;  5T64 A;  2QA4 1;  3KIF A;  2RIQ A;  2IZ4 A;  2H85 A;  1Y8C A;  4MH4 A;  1YJ9 Z;  1N2F A;  3BG1 B;  3CCS 1;  1YI2 Z;  1WJ2 A;  5LL6 f;  3GCF A;  1KRL A;  3MZL B;  1NJI 2;  2V3V A;  1M90 1;  1ML8 A;  3I4N I;  2LFU A;  3CC2 1;  1TWF I;  5D1P A;  3I55 Z;  2JA7 I;  1VQP 1;  4E32 A;  2JMO A;  3EED A;  4NBA A;  1VQ4 Z;  4MD7 A;  2QRE B;  1VQ6 Z;  4Y52 I;  1TWC I;  3G71 Z;  2OTJ Z;  3GTK I;  2VPX A;  3CCL 1;  2QA4 Z;  3H3V J;  3PO3 I;  3VMH A;  2VPZ A;  1Y1V S;  3IR7 A;  3GTG I;  2VPW A;  3CCS Z;  4HGZ A;  2E2J I;  3OW2 Y;  4QTU A;  2RT9 A;  2EGT A;  4RVH A;  1N8R 1;  2QRC B;  2Q51 A;  2QR1 B;  3JAM f;  1QVG Y;  1JJ2 Y;  1W2B Z;  2E2I I;  4A3L I;  3CC2 Z;  1K8A 2;  1M1K 1;  1VQP Z;  3CXC Y;  2B63 I;  3I4M I;  1I50 I;  2R7Z I;  2M48 A;  2I3C A;  2WAQ A;  2DE7 A;  3GTO I;  5IT9 b;  3CCL Z;  1QXF A;  3VTN A;  4A3E I;  1Q82 2;  4DGL A;  4BY1 I;  4A3I I;  3QWU A;  2IZ3 A;  2HF1 A;  3S1N I;  4XX2 A;  2W03 A;  2PK7 A;  4E2Z A;  2P3Y A;  1VQ7 1;  2QLV B;  3IFU A;  1USP B;  1K83 I;  1X0T A;  1RNI A;  2JIP A;  3S1R I;  3GTM S;  2O53 A;  3J80 b;  2GU2 A;  3LUS A;  1AA6 A;  1Y1V I;  4RV9 A;  5C4X I;  3F3P C;  1TWG I;  1VQO 1;  3HOZ I;  3JAM b;  3HKZ A;  2JS4 A;  2RPR A;  4NBH A;  1Q81 1;  3IF8 A;  2RHB A;  3MZK B;  1R9T I;  3CD6 1;  1RO2 A;  3GKQ A;  3PO2 I;  4MXU A;  3NDJ A;  1NUI A;  4Y7N I;  1YIT 1;  5FLX f;  4NB8 A;  1VLA A;  2GTH A;  1FDO A;  2V8K A;  1KD1 1;  3G6E 1;  1VQ8 1;  1QVG Z;  2RBL A;  1VQ7 Z;  1YJN 1;  4BBS I;  1JJ2 Z;  2JIR A;  5D1O B;  3CCM 1;  1Z02 A;  4E30 A;  2NVY I;  1Q7Y 2;  4AYB A;  1Z03 A;  3KIH A;  1Q86 2;  3CXC Z;  3RZD I;  3TDH B;  5A2Q b;  4A3C I;  3U50 C;  2QKD A;  3RZO I;  1VQO Z;  1K73 2;  1KC8 2;  3D9X A;  5AN9 F;  3CD6 Z;  4CL1 A;  3VMG A;  1L1O C;  1YIT Z;  3NFZ A;  2JIQ A;  1ZH1 A;  5CM2 M;  1YJW 1;  4NBF A;  1KQS Y;  4NBB A;  2JA6 I;  3G6E Z;  5IP7 I;  1VQ8 Z;  1SIW A;  1YJN Z;  2JIM A;  3GTM I;  1RO4 A;  3CCM Z;  4RVD A;  2KPI A;  3CC7 1;  1JWH C;  1YUK A;  1TWH I;  2R6M A;  3IX0 A;  4TNU A;  1I6H I;  2VF1 A;  2OOY B;  5T67 A;  5FLX b;  4RVF A;  1S72 1;  1NJI 1;  1USP A;  4A3J I;  4A3K I;  1ZB9 A;  2LIY A;  2NVX I;  3S15 I;  3GTP I;  3CMA 1;  3GTL I;  1K9M 2;  1NP6 A;  1WW9 A;  3EER A;  3J81 f;  4E33 A;  2F4M A;  1WII A;  4MON A;  4MD8 A;  1I3Q I;  1YJW Z;  2BJO A;  1WZN A;  3Q87 A;  4S1T A;  2LEX A;  4NBD A;  1YIJ 1;  2G2K A;  4BY7 I;  3CC7 Z;  3S2H I;  2NVQ I;  2VUG A;  1S72 Z;  2OTL 1;  1LQL A;  5D1O A;  3CCJ 1;  3HOV I;  2JUB A;  3ESW A;  1K8A 1;  2JA5 I;  2NAP A;  3HOU I;  3CMA Z;  4DQY B;  1KQS Z;  2AYD A;  1X3W A;  4X6A I;  4MRI A;  2R93 I;  2HU9 A;  2K5R A;  3S14 I;  1Q82 1;  1X3Z A;  4BBR I;  2GTI A;  1VQN 1;  3NH8 A;  2W04 A;  1YIJ Z;  3CCU 1;  2QEX 1;  3P5J B;  3GTJ I;  2WB1 A;  1VQL 1;  3HOY I;  4NBC A;  3OW2 Z;  4NB9 A;  1TWA I;  4NH1 C;  1SFO I;  3K7A I;  2OTL Z;  3S1Q I;  3CCJ Z;  4E2W A;  2VUM I;  2DE6 A;  2Y0S A;  4A3M I;  1ZB8 A;  2JR6 A;  3NDI A;  1S7M A;  4A3B I;  1Q16 A;  4NOZ A;  2QRD B; 
#chains in the Genus database with same CATH homology
 4A3D I;  2DE5 A;  3TE5 B;  4A3F I;  1VQN Z;  1VQ5 1;  3CCU Z;  2QEX Z;  3G4S 1;  1YUA A;  4NBG A;  1VQL Z;  3NH5 A;  3J7A 4;  3CCV 1;  1M90 2;  3I07 A;  1VQ9 1;  1RLY A;  2R92 I;  1Q7Y 1;  2PM9 A;  3CCR 1;  1Q86 1;  3S17 I;  3CCQ 1;  2KI7 B;  4HGY A;  4NFR A;  2PMZ A;  3FQQ A;  3S2D I;  3CME 1;  3FQM A;  2OZK A;  3FKI I;  5T6B A;  1RQF A;  1QYP A;  3S16 I;  4E2Y A;  5IT9 f;  3VMI A;  2OOX B;  4A3G I;  1K73 1;  1KC8 1;  3CCE 1;  3M3Y I;  3CQZ I;  2E9H A;  3CPW Y;  1VQ5 Z;  1QVF Y;  3VB9 A;  1N8R 2;  3G4S Z;  4DK1 A;  2E2H I;  3CCV Z;  1VQ9 Z;  2JA8 I;  3NH4 A;  3M4O I;  3CCR Z;  1M1K 2;  3CCQ Z;  3D6W A;  5C44 I;  1WCM I;  3J80 f;  2YAD A;  3CME Z;  1QF8 A;  4MD9 A;  4BXX I;  1RO0 A;  5C3E I;  2AKL A;  3CCE Z;  3I56 1;  1K9M 1;  2V8I A;  1YHQ 1;  4E2X A;  1TFI A;  4NBE A;  1VQK 1;  3S1M I;  2J6A A;  5IP9 I;  1DL6 A;  1VQM 1;  2O4H A;  2V8J A;  3MON A;  4EWC A;  3CC4 1;  1PFT A;  2M6N A;  3H0G I;  5C4J I;  2P28 A;  5A2Q f;  1Q81 2;  2YU9 I;  3CPW Z;  1QVF Z;  4QTT A;  3J81 b;  1Y1W I;  3I56 Z;  3HOW I;  1YHQ Z;  1KD1 2;  4RS4 A;  3T4N B;  1VQK Z;  2F4O A;  1YJ9 1;  1YI2 1;  3F3F C;  1VQM Z;  4E31 A;  2JNY A;  3PO3 S;  4A93 I;  3CC4 Z;  3GTQ I;  3HOX I;  3BG0 B;  4RVG A;  2K3R A;  1P9N A;  5FLM I;  2Q4Z A;  2ZAE B;  3I55 1;  1W2B Y;  1VQ4 1;  2NVT I;  1VQ6 1;  4HH4 A;  1Z01 A;  3G71 1;  2OTJ 1;  5T64 A;  2QA4 1;  3KIF A;  2RIQ A;  2IZ4 A;  2H85 A;  4MH4 A;  1YJ9 Z;  1N2F A;  3BG1 B;  3CCS 1;  1YI2 Z;  5LL6 f;  3GCF A;  1KRL A;  3MZL B;  1NJI 2;  1M90 1;  1ML8 A;  3I4N I;  2LFU A;  3CC2 1;  1TWF I;  5D1P A;  3I55 Z;  2JA7 I;  1VQP 1;  4E32 A;  2JMO A;  3EED A;  4NBA A;  1VQ4 Z;  4MD7 A;  2QRE B;  1VQ6 Z;  4Y52 I;  1TWC I;  3G71 Z;  2OTJ Z;  3GTK I;  3CCL 1;  2QA4 Z;  3H3V J;  3PO3 I;  3VMH A;  1Y1V S;  3GTG I;  3CCS Z;  4HGZ A;  2E2J I;  3OW2 Y;  4QTU A;  2RT9 A;  2EGT A;  4RVH A;  1N8R 1;  2QRC B;  2Q51 A;  2QR1 B;  3JAM f;  1QVG Y;  1JJ2 Y;  1W2B Z;  2E2I I;  4A3L I;  3CC2 Z;  1K8A 2;  1M1K 1;  1VQP Z;  3CXC Y;  2B63 I;  3I4M I;  1I50 I;  2R7Z I;  2M48 A;  2I3C A;  2WAQ A;  2DE7 A;  3GTO I;  5IT9 b;  3CCL Z;  3VTN A;  4A3E I;  1Q82 2;  4DGL A;  4BY1 I;  4A3I I;  3QWU A;  2IZ3 A;  2HF1 A;  3S1N I;  4XX2 A;  2W03 A;  2PK7 A;  4E2Z A;  2P3Y A;  1VQ7 1;  2QLV B;  3IFU A;  1USP B;  1K83 I;  1X0T A;  1RNI A;  3S1R I;  3GTM S;  2O53 A;  3J80 b;  2GU2 A;  3LUS A;  1Y1V I;  4RV9 A;  5C4X I;  3F3P C;  1TWG I;  1VQO 1;  3HOZ I;  3JAM b;  3HKZ A;  2JS4 A;  2RPR A;  4NBH A;  1Q81 1;  3IF8 A;  2RHB A;  3MZK B;  1R9T I;  3CD6 1;  1RO2 A;  3GKQ A;  3PO2 I;  4MXU A;  3NDJ A;  1NUI A;  4Y7N I;  1YIT 1;  5FLX f;  4NB8 A;  1VLA A;  2GTH A;  2V8K A;  1KD1 1;  3G6E 1;  1VQ8 1;  1QVG Z;  2RBL A;  1VQ7 Z;  1YJN 1;  4BBS I;  1JJ2 Z;  5D1O B;  3CCM 1;  1Z02 A;  4E30 A;  2NVY I;  1Q7Y 2;  4AYB A;  1Z03 A;  3KIH A;  1Q86 2;  3CXC Z;  3RZD I;  3TDH B;  5A2Q b;  4A3C I;  3U50 C;  2QKD A;  3RZO I;  1VQO Z;  1K73 2;  1KC8 2;  3D9X A;  5AN9 F;  3CD6 Z;  4CL1 A;  3VMG A;  1L1O C;  1YIT Z;  3NFZ A;  5CM2 M;  1ZH1 A;  1KQS Y;  1YJW 1;  4NBF A;  4NBB A;  2JA6 I;  3G6E Z;  5IP7 I;  1VQ8 Z;  1YJN Z;  3GTM I;  1RO4 A;  3CCM Z;  4RVD A;  2KPI A;  3CC7 1;  1JWH C;  1YUK A;  1TWH I;  2R6M A;  3IX0 A;  4TNU A;  1I6H I;  2VF1 A;  2OOY B;  5T67 A;  5FLX b;  4RVF A;  1S72 1;  1NJI 1;  1USP A;  4A3J I;  4A3K I;  1ZB9 A;  2LIY A;  2NVX I;  3S15 I;  3GTP I;  3CMA 1;  3GTL I;  1K9M 2;  1NP6 A;  1WW9 A;  3EER A;  3J81 f;  4E33 A;  2F4M A;  1WII A;  4MON A;  4MD8 A;  1I3Q I;  1YJW Z;  2BJO A;  3Q87 A;  4S1T A;  4NBD A;  1YIJ 1;  2G2K A;  4BY7 I;  3CC7 Z;  3S2H I;  2NVQ I;  2VUG A;  1S72 Z;  2OTL 1;  1LQL A;  5D1O A;  3CCJ 1;  3HOV I;  2JUB A;  3ESW A;  1K8A 1;  2JA5 I;  3HOU I;  3CMA Z;  4DQY B;  1KQS Z;  1X3W A;  4X6A I;  4MRI A;  2R93 I;  2HU9 A;  2K5R A;  3S14 I;  1Q82 1;  1X3Z A;  4BBR I;  2GTI A;  1VQN 1;  3NH8 A;  2W04 A;  1YIJ Z;  3CCU 1;  2QEX 1;  3P5J B;  3GTJ I;  2WB1 A;  1VQL 1;  3HOY I;  4NBC A;  3OW2 Z;  4NB9 A;  1TWA I;  4NH1 C;  1SFO I;  3K7A I;  2OTL Z;  3S1Q I;  3CCJ Z;  4E2W A;  2VUM I;  2DE6 A;  2Y0S A;  4A3M I;  1ZB8 A;  2JR6 A;  3NDI A;  1S7M A;  4A3B I;  4NOZ A;  2QRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...