2E2HI

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2hI02
2KPIA 4BY7I 4NBBA 4NBCA 2JA5I 3S2HI 5C4JI 3LUSA 4NOZA 1X3WA 2DE6A 2NVQI 3HOUI 1ZB8A 2F4OA 2JS4A 1X3ZA 4BBRI 1RO4A 1Y1WI 1TWFI 3HOVI 4NBAA 4A3FI 1N2FA 1TWGI 1Y1VS 2E2II 3M3YI 1VLAA 2JR6A 3VMHA 2JNYA 2DE5A 2P3YA 1TWCI 3RZDI 3VMGA 5C4XI 2E2JI 4A3EI 5FLMI 4A3CI 3S1MI 2F4MA 4NBHA 4A3II 2VUMI 3HOWI 1TWAI 3PO3S 3D6WA 2JA7I 3CQZI 3GTPI 3U50C 2HF1A 5IP7I 2BJOA 3H0GI 4NBDA 1RLYA 2YU9I 3GTGI 3GCFA 4A3GI 3EERA 1ML8A 1WW9A 1I3QI 1R9TI 4NBFA 1K83I 3VB9A 2PK7A 3VMIA 3GTQI 3GTMI 4A3LI 3GTOI 4X6AI 1YUAA 4NB8A 4QTUA 1DL6A 3GKQA 4XX2A 2J6AA 1WCMI 2RBLA 3FKII 1SFOI 1L1OC 4NBEA 2JA8I 4NBGA 4MH4A 1TWHI 4BY1I 2R92I 1I50I 2E2HI 3S1QI 2R7ZI 2NVYI 4BBSI 4BXXI 4Y7NI 3M4OI 3K7AI 1Y1VI 3HOXI 3HOYI 1NUIA 1I6HI 4A3MI 5IP9I 3S15I 3I4MI 3GTJI 3S16I 1TFIA 4NB9A 1QYPA 3PO2I 3PO3I 3GTKI 3S17I 5CM2M 2NVTI 3RZOI 4A3KI 3S1RI 5C44I 3GTLI 2AKLA 3S14I 2R93I 3HOZI 4A3DI 3ESWA 1LQLA 2DE7A 3S1NI 4Y52I 3I4NI 3GTMS 4A3BI 2JA6I 2NVXI 2B63I 2K5RA 4A3JI 4A93I 1PFTA 3S2DI 5C3EI 4QTTA 3I07A 1USPB 1ZB9A 3Q87A 3H3VJ 1USPA
chains in the Genus database with same CATH superfamily
1NJI2 3S2HI 4NOZA 2M6NA 4MD7A 2DE6A 3HOUI 2QA41 1QVGZ 4HH4A 3J7A4 1X3ZA 1RO4A 1YIJZ 1N8R1 1N2FA 1Y1VS 3VMHA 1K731 4E33A 4A3CI 4E2WA 3F3FC 4A3II 3QWUA 4DK1A 3CCMZ 1VQLZ 1TWAI 1FDIA 3KIHA 3CQZI 2QEX1 3GTPI 3G4S1 2BJOA 3CD61 4NBDA 2YU9I 3GTGI 3GCFA 4A3GI 1YI2Z 1WW9A 1I3QI 3IF8A 2JIMA 1VQ7Z 3T4NB 2PK7A 2JMOA 2QKDA 4TNUA 4X6AI 4NB8A 2HU9A 3GKQA 2J6AA 2RBLA 5IT9f 3FKII 1K9M2 2QR1B 1YJ91 1L1OC 2JA8I 1TWHI 2R92I 1VQ8Z 1S7MA 1Q862 5A2Qb 3M4OI 3CCV1 2I3CA 3TDHB 3CMA1 5T64A 5IP9I 3S15I 2K3RA 1TFIA 2OTJ1 2VUGA 3MONA 4RVHA 3BG0B 4RVDA 2PMZA 1RO2A 3S1RI 1JJ2Y 3S14I 2R93I 5D1PA 3IR7A 1RNIA 3J80f 1YJ9Z 2Q51A 3CPWZ 2OTJZ 1VQP1 1YJW1 3CME1 2NVXI 2B63I 3I56Z 4A3JI 1YITZ 2G2KA 3S2DI 3I07A 1USPB 3G711 3H3VJ 5D1OA 3MZKB 2P28A 2IZ3A 4AYBA 5C4JI 1X3WA 1QXFA 1Z02A 2F4OA 2OZKA 1KQSZ 4BBRI 2VPYA 1Y1WI 1K8A2 4NBAA 3HOVI 3P5JB 4MXUA 2W04A 3CCJZ 3RZDI 2DE5A 2P3YA 1VQ5Z 5C4XI 2M48A 4HGYA 1VQ6Z 2F4MA 3CCUZ 2VUMI 5LL6f 2OOYB 2QREB 3IX0A 3HOWI 2H85A 5D1OB 2V3VA 3J81f 1KQSY 2JA7I 3TE5B 3KIFA 4DQYB 2HF1A 3CCRZ 1VQ4Z 2EGTA 1ZH1A 2IZ4A 3CC4Z 1WJ2A 2W03A 2ZAEB 1RQFA 1K83I 3VMIA 4A3LI 5IT9b 2RIQA 2QRDB 1VQ9Z 1YUAA 4QTUA 1KD12 2QLVB 3CCEZ 3CMAZ 5A2Qf 3VTNA 1VQNZ 1YJWZ 1I50I 3CCU1 3OW2Y 5T67A 3CC21 4RS4A 2RPRA 3I551 1Y1VI 3CCE1 4E32A 3G4SZ 1NUIA 1I6HI 4MONA 2Y0SA 4E2ZA 3CPWY 2GTIA 3GTJI 3I4MI 3S16I 4NB9A 1QVFZ 5AN9F 3CMEZ 2JIRA 5CM2M 1YJNZ 1KD11 2NVTI 4MD8A 4E31A 3I561 4A3KI 1YIT1 3GTLI 2V8JA 1VQKZ 3CCQZ 3ESWA 2JUBA 2WB1A 1VQN1 2OOXB 2JA6I 3NH8A 1M1K1 5C3EI 1WIIA 1USPA 3EEDA 3CCQ1 2KPIA 3NDJA 4BY7I 2VPXA 4NBCA 3G6E1 2NVQI 1Q811 1Z01A 2JS4A 1W2BY 1VQ91 5T6BA 1YJN1 1Z03A 1TWFI 4A3FI 1TWGI 3NFZA 4MD9A 1K9M1 2JR6A 2JNYA 1TWCI 4E2YA 3VMGA 4A3EI 5FLMI 3JAMb 2V8KA 1FDOA 2LIYA 1YHQ1 4S1TA 3PO3S 3D6WA 2GU2A 3OW2Z 1P9NA 3HKZA 3CCL1 5IP7I 3CCJ1 1Y8CA 1VQ51 2RHBA 1Q812 1ML8A 1R9TI 2GTHA 3D2LA 4NBFA 3GTQI 1Q7Y1 4DGLA 2KI7B 3JAMf 1SFOI 4NBEA 3CC41 3IFUA 1JJ2Z 1M901 4MH4A 4BY1I 3J80b 1VQ71 2E2HI 2JIOA 2R7ZI 2NVYI 4BBSI 4HGZA 1KRLA 4Y7NI 3CXCY 2RT9A 1KC82 3K7AI 5FLXf 1VQMZ 3HOYI 1S721 4A3MI 3FQQA 4CL1A 1VQ81 4NH1C 3S17I 4E2XA 3RZOI 2WAQA 3NH5A 5C44I 3G71Z 1M902 1YUKA 2VPZA 1S72Z 3HOZI 2O53A 2AYDA 4A3DI 1LQLA 2JIQA 2DE7A 3S1NI 1Q821 4Y52I 3I4NI 3GTMS 3J81b 1RO0A 2K5RA 1PFTA 2LFUA 4NFRA 1K732 1K8A1 2R6MA 1QVGY 1AA6A 2VF1A 2LEXA 4NBBA 2JA5I 3LUSA 3CC71 2E7ZA 3D9XA 1NJI1 1SIWA 1ZB8A 2QRCB 3CCS1 2NAPA 2QEXZ 2E2II 3M3YI 1VLAA 2E2JI 1VQ41 1Q861 1VQK1 3S1MI 4NBHA 1KC81 2JIPA 1VQPZ 4EWCA 2V8IA 1Q16A 3U50C 1VQM1 3FQMA 3H0GI 1RLYA 3BG1B 3EERA 3G6EZ 2VPWA 3F3PC 1VQOZ 1NP6A 1X0TA 3VB9A 2YADA 2QA4Z 3GTMI 3GTOI 3CXCZ 4RV9A 1YIJ1 1DL6A 4XX2A 1WCMI 1M1K2 3CD6Z 3CCVZ 1YI21 4NBGA 2OTL1 5FLXb 3S1QI 3NH4A 4BXXI 2E9HA 2Q4ZA 4E30A 1QVFY 3HOXI 1QF8A 3CCR1 3NDIA 2IV2X 1QYPA 3CC7Z 2OTLZ 3MZLB 3PO2I 1VQO1 3PO3I 3GTKI 3CC2Z 1JWHC 3I55Z 4RVGA 2AKLA 2V45A 1Q7Y2 1VQ61 1Q822 2PM9A 2O4HA 1YHQZ 3CCM1 1VQL1 4RVFA 4A3BI 4A93I 3CCSZ 1N8R2 4QTTA 3CCLZ 1ZB9A 3Q87A 1W2BZ 4MRIA 1WZNA
chains in the Genus database with same CATH topology
1NJI2 3S2HI 4NOZA 2M6NA 4MD7A 2DE6A 3HOUI 2QA41 1QVGZ 4HH4A 3J7A4 1X3ZA 1RO4A 1YIJZ 1N8R1 1N2FA 1Y1VS 3VMHA 1K731 4E33A 4A3CI 4E2WA 3F3FC 4A3II 3QWUA 4DK1A 3CCMZ 1VQLZ 1TWAI 3KIHA 3CQZI 2QEX1 3GTPI 3G4S1 2BJOA 3CD61 4NBDA 2YU9I 3GTGI 3GCFA 4A3GI 1YI2Z 1WW9A 1I3QI 3IF8A 1VQ7Z 3T4NB 2PK7A 2JMOA 2QKDA 4TNUA 4X6AI 4NB8A 2HU9A 3GKQA 2J6AA 2RBLA 5IT9f 3FKII 1K9M2 2QR1B 1YJ91 1L1OC 2JA8I 1TWHI 2R92I 1VQ8Z 1S7MA 1Q862 5A2Qb 3M4OI 3CCV1 2I3CA 3TDHB 3CMA1 5T64A 5IP9I 3S15I 2K3RA 1TFIA 2OTJ1 2VUGA 3MONA 4RVHA 3BG0B 4RVDA 2PMZA 1RO2A 3S1RI 1JJ2Y 3S14I 2R93I 5D1PA 1RNIA 3J80f 1YJ9Z 2Q51A 3CPWZ 2OTJZ 1VQP1 1YJW1 3CME1 2NVXI 2B63I 3I56Z 4A3JI 1YITZ 2G2KA 3S2DI 3I07A 1USPB 3G711 3H3VJ 5D1OA 3MZKB 2P28A 2IZ3A 4AYBA 5C4JI 1X3WA 1Z02A 2F4OA 2OZKA 1KQSZ 4BBRI 1Y1WI 1K8A2 4NBAA 3HOVI 3P5JB 4MXUA 2W04A 3CCJZ 3RZDI 2DE5A 2P3YA 1VQ5Z 5C4XI 2M48A 4HGYA 1VQ6Z 2F4MA 3CCUZ 2VUMI 5LL6f 2OOYB 2QREB 3IX0A 3HOWI 2H85A 5D1OB 3J81f 1KQSY 2JA7I 3TE5B 3KIFA 4DQYB 2HF1A 3CCRZ 1VQ4Z 2EGTA 1ZH1A 2IZ4A 3CC4Z 2W03A 2ZAEB 1RQFA 1K83I 3VMIA 4A3LI 5IT9b 2RIQA 2QRDB 1VQ9Z 1YUAA 4QTUA 1KD12 2QLVB 3CCEZ 3CMAZ 5A2Qf 3VTNA 1VQNZ 1YJWZ 1I50I 3CCU1 3OW2Y 5T67A 3CC21 4RS4A 2RPRA 3I551 1Y1VI 3CCE1 4E32A 3G4SZ 1NUIA 1I6HI 4MONA 2Y0SA 4E2ZA 3CPWY 2GTIA 3GTJI 3I4MI 3S16I 4NB9A 1QVFZ 5AN9F 3CMEZ 5CM2M 1YJNZ 1KD11 2NVTI 4MD8A 4E31A 3I561 4A3KI 1YIT1 3GTLI 2V8JA 1VQKZ 3CCQZ 3ESWA 2JUBA 2WB1A 1VQN1 2OOXB 2JA6I 3NH8A 1M1K1 5C3EI 1WIIA 1USPA 3EEDA 3CCQ1 2KPIA 3NDJA 4BY7I 4NBCA 3G6E1 2NVQI 1Q811 1Z01A 2JS4A 1W2BY 1VQ91 5T6BA 1YJN1 1Z03A 1TWFI 4A3FI 1TWGI 3NFZA 4MD9A 1K9M1 2JR6A 2JNYA 1TWCI 4E2YA 3VMGA 4A3EI 5FLMI 3JAMb 2V8KA 2LIYA 1YHQ1 4S1TA 3PO3S 3D6WA 2GU2A 3OW2Z 1P9NA 3HKZA 3CCL1 5IP7I 3CCJ1 1VQ51 2RHBA 1Q812 1ML8A 1R9TI 2GTHA 4NBFA 3GTQI 1Q7Y1 4DGLA 2KI7B 3JAMf 1SFOI 4NBEA 3CC41 3IFUA 1JJ2Z 1M901 4MH4A 4BY1I 3J80b 1VQ71 2E2HI 2R7ZI 2NVYI 4BBSI 4HGZA 1KRLA 4Y7NI 3CXCY 2RT9A 1KC82 3K7AI 5FLXf 1VQMZ 3HOYI 1S721 4A3MI 3FQQA 4CL1A 1VQ81 4NH1C 3S17I 4E2XA 3RZOI 2WAQA 3NH5A 5C44I 3G71Z 1M902 1YUKA 1S72Z 3HOZI 2O53A 4A3DI 1LQLA 2DE7A 3S1NI 1Q821 4Y52I 3I4NI 3GTMS 3J81b 1RO0A 2K5RA 1PFTA 2LFUA 4NFRA 1K732 1K8A1 2R6MA 1QVGY 2VF1A 4NBBA 2JA5I 3LUSA 3CC71 3D9XA 1NJI1 1ZB8A 2QRCB 3CCS1 2QEXZ 2E2II 3M3YI 1VLAA 2E2JI 1VQ41 1Q861 1VQK1 3S1MI 4NBHA 1KC81 1VQPZ 4EWCA 2V8IA 3U50C 1VQM1 3FQMA 3H0GI 1RLYA 3BG1B 3EERA 3G6EZ 3F3PC 1VQOZ 1NP6A 1X0TA 3VB9A 2YADA 2QA4Z 3GTMI 3GTOI 3CXCZ 4RV9A 1YIJ1 1DL6A 4XX2A 1WCMI 1M1K2 3CD6Z 3CCVZ 1YI21 4NBGA 2OTL1 5FLXb 3S1QI 3NH4A 4BXXI 2E9HA 2Q4ZA 4E30A 1QVFY 3HOXI 1QF8A 3CCR1 3NDIA 3CC7Z 1QYPA 2OTLZ 3MZLB 3PO2I 1VQO1 3PO3I 3GTKI 3CC2Z 1JWHC 3I55Z 4RVGA 2AKLA 1Q7Y2 1VQ61 1Q822 2PM9A 2O4HA 1YHQZ 3CCM1 1VQL1 4RVFA 4A3BI 4A93I 3CCSZ 1N8R2 4QTTA 3CCLZ 1ZB9A 3Q87A 1W2BZ 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  4BY7 I;  4NBB A;  4NBC A;  2JA5 I;  3S2H I;  5C4J I;  3LUS A;  4NOZ A;  1X3W A;  2DE6 A;  2NVQ I;  3HOU I;  1ZB8 A;  2F4O A;  2JS4 A;  1X3Z A;  4BBR I;  1RO4 A;  1Y1W I;  1TWF I;  3HOV I;  4NBA A;  4A3F I;  1N2F A;  1TWG I;  1Y1V S;  2E2I I;  3M3Y I;  1VLA A;  2JR6 A;  3VMH A;  2JNY A;  2DE5 A;  2P3Y A;  1TWC I;  3RZD I;  3VMG A;  5C4X I;  2E2J I;  4A3E I;  5FLM I;  4A3C I;  3S1M I;  2F4M A;  4NBH A;  4A3I I;  2VUM I;  3HOW I;  1TWA I;  3PO3 S;  3D6W A;  2JA7 I;  3CQZ I;  3GTP I;  3U50 C;  2HF1 A;  5IP7 I;  2BJO A;  3H0G I;  4NBD A;  1RLY A;  2YU9 I;  3GTG I;  3GCF A;  4A3G I;  3EER A;  1ML8 A;  1WW9 A;  1I3Q I;  1R9T I;  4NBF A;  1K83 I;  3VB9 A;  2PK7 A;  3VMI A;  3GTQ I;  3GTM I;  4A3L I;  3GTO I;  4X6A I;  1YUA A;  4NB8 A;  4QTU A;  1DL6 A;  3GKQ A;  4XX2 A;  2J6A A;  1WCM I;  2RBL A;  3FKI I;  1SFO I;  1L1O C;  4NBE A;  2JA8 I;  4NBG A;  4MH4 A;  1TWH I;  4BY1 I;  2R92 I;  1I50 I;  2E2H I;  3S1Q I;  2R7Z I;  2NVY I;  4BBS I;  4BXX I;  4Y7N I;  3M4O I;  3K7A I;  1Y1V I;  3HOX I;  3HOY I;  1NUI A;  1I6H I;  4A3M I;  5IP9 I;  3S15 I;  3I4M I;  3GTJ I;  3S16 I;  1TFI A;  4NB9 A;  1QYP A;  3PO2 I;  3PO3 I;  3GTK I;  3S17 I;  5CM2 M;  2NVT I;  3RZO I;  4A3K I;  3S1R I;  5C44 I;  3GTL I;  2AKL A;  3S14 I;  2R93 I;  3HOZ I;  4A3D I;  3ESW A;  1LQL A;  2DE7 A;  3S1N I;  4Y52 I;  3I4N I;  3GTM S;  4A3B I;  2JA6 I;  2NVX I;  2B63 I;  2K5R A;  4A3J I;  4A93 I;  1PFT A;  3S2D I;  5C3E I;  4QTT A;  3I07 A;  1USP B;  1ZB9 A;  3Q87 A;  3H3V J;  1USP A; 
#chains in the Genus database with same CATH topology
 1NJI 2;  3S2H I;  4NOZ A;  2M6N A;  4MD7 A;  2DE6 A;  3HOU I;  2QA4 1;  1QVG Z;  4HH4 A;  3J7A 4;  1X3Z A;  1RO4 A;  1YIJ Z;  1N8R 1;  1N2F A;  1Y1V S;  3VMH A;  1K73 1;  4E33 A;  4A3C I;  4E2W A;  3F3F C;  4A3I I;  3QWU A;  4DK1 A;  3CCM Z;  1VQL Z;  1TWA I;  1FDI A;  3KIH A;  3CQZ I;  2QEX 1;  3GTP I;  3G4S 1;  2BJO A;  3CD6 1;  4NBD A;  2YU9 I;  3GTG I;  3GCF A;  4A3G I;  1YI2 Z;  1WW9 A;  1I3Q I;  3IF8 A;  2JIM A;  1VQ7 Z;  3T4N B;  2PK7 A;  2JMO A;  2QKD A;  4TNU A;  4X6A I;  4NB8 A;  2HU9 A;  3GKQ A;  2J6A A;  2RBL A;  5IT9 f;  3FKI I;  1K9M 2;  2QR1 B;  1YJ9 1;  1L1O C;  2JA8 I;  1TWH I;  2R92 I;  1VQ8 Z;  1S7M A;  1Q86 2;  5A2Q b;  3M4O I;  3CCV 1;  2I3C A;  3TDH B;  3CMA 1;  5T64 A;  5IP9 I;  3S15 I;  2K3R A;  1TFI A;  2OTJ 1;  2VUG A;  3MON A;  4RVH A;  3BG0 B;  4RVD A;  2PMZ A;  1RO2 A;  3S1R I;  1JJ2 Y;  3S14 I;  2R93 I;  5D1P A;  3IR7 A;  1RNI A;  3J80 f;  1YJ9 Z;  2Q51 A;  3CPW Z;  2OTJ Z;  1VQP 1;  1YJW 1;  3CME 1;  2NVX I;  2B63 I;  3I56 Z;  4A3J I;  1YIT Z;  2G2K A;  3S2D I;  3I07 A;  1USP B;  3G71 1;  3H3V J;  5D1O A;  3MZK B;  2P28 A;  2IZ3 A;  4AYB A;  5C4J I;  1X3W A;  1QXF A;  1Z02 A;  2F4O A;  2OZK A;  1KQS Z;  4BBR I;  2VPY A;  1Y1W I;  1K8A 2;  4NBA A;  3HOV I;  3P5J B;  4MXU A;  2W04 A;  3CCJ Z;  3RZD I;  2DE5 A;  2P3Y A;  1VQ5 Z;  5C4X I;  2M48 A;  4HGY A;  1VQ6 Z;  2F4M A;  3CCU Z;  2VUM I;  5LL6 f;  2OOY B;  2QRE B;  3IX0 A;  3HOW I;  2H85 A;  5D1O B;  2V3V A;  3J81 f;  1KQS Y;  2JA7 I;  3TE5 B;  3KIF A;  4DQY B;  2HF1 A;  3CCR Z;  1VQ4 Z;  2EGT A;  1ZH1 A;  2IZ4 A;  3CC4 Z;  1WJ2 A;  2W03 A;  2ZAE B;  1RQF A;  1K83 I;  3VMI A;  4A3L I;  5IT9 b;  2RIQ A;  2QRD B;  1VQ9 Z;  1YUA A;  4QTU A;  1KD1 2;  2QLV B;  3CCE Z;  3CMA Z;  5A2Q f;  3VTN A;  1VQN Z;  1YJW Z;  1I50 I;  3CCU 1;  3OW2 Y;  5T67 A;  3CC2 1;  4RS4 A;  2RPR A;  3I55 1;  1Y1V I;  3CCE 1;  4E32 A;  3G4S Z;  1NUI A;  1I6H I;  4MON A;  2Y0S A;  4E2Z A;  3CPW Y;  2GTI A;  3GTJ I;  3I4M I;  3S16 I;  4NB9 A;  1QVF Z;  5AN9 F;  3CME Z;  2JIR A;  5CM2 M;  1YJN Z;  1KD1 1;  2NVT I;  4MD8 A;  4E31 A;  3I56 1;  4A3K I;  1YIT 1;  3GTL I;  2V8J A;  1VQK Z;  3CCQ Z;  3ESW A;  2JUB A;  2WB1 A;  1VQN 1;  2OOX B;  2JA6 I;  3NH8 A;  1M1K 1;  5C3E I;  1WII A;  1USP A;  3EED A;  3CCQ 1;  2KPI A;  3NDJ A;  4BY7 I;  2VPX A;  4NBC A;  3G6E 1;  2NVQ I;  1Q81 1;  1Z01 A;  2JS4 A;  1W2B Y;  1VQ9 1;  5T6B A;  1YJN 1;  1Z03 A;  1TWF I;  4A3F I;  1TWG I;  3NFZ A;  4MD9 A;  1K9M 1;  2JR6 A;  2JNY A;  1TWC I;  4E2Y A;  3VMG A;  4A3E I;  5FLM I;  3JAM b;  2V8K A;  1FDO A;  2LIY A;  1YHQ 1;  4S1T A;  3PO3 S;  3D6W A;  2GU2 A;  3OW2 Z;  1P9N A;  3HKZ A;  3CCL 1;  5IP7 I;  3CCJ 1;  1Y8C A;  1VQ5 1;  2RHB A;  1Q81 2;  1ML8 A;  1R9T I;  2GTH A;  3D2L A;  4NBF A;  3GTQ I;  1Q7Y 1;  4DGL A;  2KI7 B;  3JAM f;  1SFO I;  4NBE A;  3CC4 1;  3IFU A;  1JJ2 Z;  1M90 1;  4MH4 A;  4BY1 I;  3J80 b;  1VQ7 1;  2E2H I;  2JIO A;  2R7Z I;  2NVY I;  4BBS I;  4HGZ A;  1KRL A;  4Y7N I;  3CXC Y;  2RT9 A;  1KC8 2;  3K7A I;  5FLX f;  1VQM Z;  3HOY I;  1S72 1;  4A3M I;  3FQQ A;  4CL1 A;  1VQ8 1;  4NH1 C;  3S17 I;  4E2X A;  3RZO I;  2WAQ A;  3NH5 A;  5C44 I;  3G71 Z;  1M90 2;  1YUK A;  2VPZ A;  1S72 Z;  3HOZ I;  2O53 A;  2AYD A;  4A3D I;  1LQL A;  2JIQ A;  2DE7 A;  3S1N I;  1Q82 1;  4Y52 I;  3I4N I;  3GTM S;  3J81 b;  1RO0 A;  2K5R A;  1PFT A;  2LFU A;  4NFR A;  1K73 2;  1K8A 1;  2R6M A;  1QVG Y;  1AA6 A;  2VF1 A;  2LEX A;  4NBB A;  2JA5 I;  3LUS A;  3CC7 1;  2E7Z A;  3D9X A;  1NJI 1;  1SIW A;  1ZB8 A;  2QRC B;  3CCS 1;  2NAP A;  2QEX Z;  2E2I I;  3M3Y I;  1VLA A;  2E2J I;  1VQ4 1;  1Q86 1;  1VQK 1;  3S1M I;  4NBH A;  1KC8 1;  2JIP A;  1VQP Z;  4EWC A;  2V8I A;  1Q16 A;  3U50 C;  1VQM 1;  3FQM A;  3H0G I;  1RLY A;  3BG1 B;  3EER A;  3G6E Z;  2VPW A;  3F3P C;  1VQO Z;  1NP6 A;  1X0T A;  3VB9 A;  2YAD A;  2QA4 Z;  3GTM I;  3GTO I;  3CXC Z;  4RV9 A;  1YIJ 1;  1DL6 A;  4XX2 A;  1WCM I;  1M1K 2;  3CD6 Z;  3CCV Z;  1YI2 1;  4NBG A;  2OTL 1;  5FLX b;  3S1Q I;  3NH4 A;  4BXX I;  2E9H A;  2Q4Z A;  4E30 A;  1QVF Y;  3HOX I;  1QF8 A;  3CCR 1;  3NDI A;  2IV2 X;  1QYP A;  3CC7 Z;  2OTL Z;  3MZL B;  3PO2 I;  1VQO 1;  3PO3 I;  3GTK I;  3CC2 Z;  1JWH C;  3I55 Z;  4RVG A;  2AKL A;  2V45 A;  1Q7Y 2;  1VQ6 1;  1Q82 2;  2PM9 A;  2O4H A;  1YHQ Z;  3CCM 1;  1VQL 1;  4RVF A;  4A3B I;  4A93 I;  3CCS Z;  1N8R 2;  4QTT A;  3CCL Z;  1ZB9 A;  3Q87 A;  1W2B Z;  4MRI A;  1WZN A; 
#chains in the Genus database with same CATH homology
 1NJI 2;  3S2H I;  4NOZ A;  2M6N A;  4MD7 A;  2DE6 A;  3HOU I;  2QA4 1;  1QVG Z;  4HH4 A;  3J7A 4;  1X3Z A;  1RO4 A;  1YIJ Z;  1N8R 1;  1N2F A;  1Y1V S;  3VMH A;  1K73 1;  4E33 A;  4A3C I;  4E2W A;  3F3F C;  4A3I I;  3QWU A;  4DK1 A;  3CCM Z;  1VQL Z;  1TWA I;  3KIH A;  3CQZ I;  2QEX 1;  3GTP I;  3G4S 1;  2BJO A;  3CD6 1;  4NBD A;  2YU9 I;  3GTG I;  3GCF A;  4A3G I;  1YI2 Z;  1WW9 A;  1I3Q I;  3IF8 A;  1VQ7 Z;  3T4N B;  2PK7 A;  2JMO A;  2QKD A;  4TNU A;  4X6A I;  4NB8 A;  2HU9 A;  3GKQ A;  2J6A A;  2RBL A;  5IT9 f;  3FKI I;  1K9M 2;  2QR1 B;  1YJ9 1;  1L1O C;  2JA8 I;  1TWH I;  2R92 I;  1VQ8 Z;  1S7M A;  1Q86 2;  5A2Q b;  3M4O I;  3CCV 1;  2I3C A;  3TDH B;  3CMA 1;  5T64 A;  5IP9 I;  3S15 I;  2K3R A;  1TFI A;  2OTJ 1;  2VUG A;  3MON A;  4RVH A;  3BG0 B;  4RVD A;  2PMZ A;  1RO2 A;  3S1R I;  1JJ2 Y;  3S14 I;  2R93 I;  5D1P A;  1RNI A;  3J80 f;  1YJ9 Z;  2Q51 A;  3CPW Z;  2OTJ Z;  1VQP 1;  1YJW 1;  3CME 1;  2NVX I;  2B63 I;  3I56 Z;  4A3J I;  1YIT Z;  2G2K A;  3S2D I;  3I07 A;  1USP B;  3G71 1;  3H3V J;  5D1O A;  3MZK B;  2P28 A;  2IZ3 A;  4AYB A;  5C4J I;  1X3W A;  1Z02 A;  2F4O A;  2OZK A;  1KQS Z;  4BBR I;  1Y1W I;  1K8A 2;  4NBA A;  3HOV I;  3P5J B;  4MXU A;  2W04 A;  3CCJ Z;  3RZD I;  2DE5 A;  2P3Y A;  1VQ5 Z;  5C4X I;  2M48 A;  4HGY A;  1VQ6 Z;  2F4M A;  3CCU Z;  2VUM I;  5LL6 f;  2OOY B;  2QRE B;  3IX0 A;  3HOW I;  2H85 A;  5D1O B;  3J81 f;  1KQS Y;  2JA7 I;  3TE5 B;  3KIF A;  4DQY B;  2HF1 A;  3CCR Z;  1VQ4 Z;  2EGT A;  1ZH1 A;  2IZ4 A;  3CC4 Z;  2W03 A;  2ZAE B;  1RQF A;  1K83 I;  3VMI A;  4A3L I;  5IT9 b;  2RIQ A;  2QRD B;  1VQ9 Z;  1YUA A;  4QTU A;  1KD1 2;  2QLV B;  3CCE Z;  3CMA Z;  5A2Q f;  3VTN A;  1VQN Z;  1YJW Z;  1I50 I;  3CCU 1;  3OW2 Y;  5T67 A;  3CC2 1;  4RS4 A;  2RPR A;  3I55 1;  1Y1V I;  3CCE 1;  4E32 A;  3G4S Z;  1NUI A;  1I6H I;  4MON A;  2Y0S A;  4E2Z A;  3CPW Y;  2GTI A;  3GTJ I;  3I4M I;  3S16 I;  4NB9 A;  1QVF Z;  5AN9 F;  3CME Z;  5CM2 M;  1YJN Z;  1KD1 1;  2NVT I;  4MD8 A;  4E31 A;  3I56 1;  4A3K I;  1YIT 1;  3GTL I;  2V8J A;  1VQK Z;  3CCQ Z;  3ESW A;  2JUB A;  2WB1 A;  1VQN 1;  2OOX B;  2JA6 I;  3NH8 A;  1M1K 1;  5C3E I;  1WII A;  1USP A;  3EED A;  3CCQ 1;  2KPI A;  3NDJ A;  4BY7 I;  4NBC A;  3G6E 1;  2NVQ I;  1Q81 1;  1Z01 A;  2JS4 A;  1W2B Y;  1VQ9 1;  5T6B A;  1YJN 1;  1Z03 A;  1TWF I;  4A3F I;  1TWG I;  3NFZ A;  4MD9 A;  1K9M 1;  2JR6 A;  2JNY A;  1TWC I;  4E2Y A;  3VMG A;  4A3E I;  5FLM I;  3JAM b;  2V8K A;  2LIY A;  1YHQ 1;  4S1T A;  3PO3 S;  3D6W A;  2GU2 A;  3OW2 Z;  1P9N A;  3HKZ A;  3CCL 1;  5IP7 I;  3CCJ 1;  1VQ5 1;  2RHB A;  1Q81 2;  1ML8 A;  1R9T I;  2GTH A;  4NBF A;  3GTQ I;  1Q7Y 1;  4DGL A;  2KI7 B;  3JAM f;  1SFO I;  4NBE A;  3CC4 1;  3IFU A;  1JJ2 Z;  1M90 1;  4MH4 A;  4BY1 I;  3J80 b;  1VQ7 1;  2E2H I;  2R7Z I;  2NVY I;  4BBS I;  4HGZ A;  1KRL A;  4Y7N I;  3CXC Y;  2RT9 A;  1KC8 2;  3K7A I;  5FLX f;  1VQM Z;  3HOY I;  1S72 1;  4A3M I;  3FQQ A;  4CL1 A;  1VQ8 1;  4NH1 C;  3S17 I;  4E2X A;  3RZO I;  2WAQ A;  3NH5 A;  5C44 I;  3G71 Z;  1M90 2;  1YUK A;  1S72 Z;  3HOZ I;  2O53 A;  4A3D I;  1LQL A;  2DE7 A;  3S1N I;  1Q82 1;  4Y52 I;  3I4N I;  3GTM S;  3J81 b;  1RO0 A;  2K5R A;  1PFT A;  2LFU A;  4NFR A;  1K73 2;  1K8A 1;  2R6M A;  1QVG Y;  2VF1 A;  4NBB A;  2JA5 I;  3LUS A;  3CC7 1;  3D9X A;  1NJI 1;  1ZB8 A;  2QRC B;  3CCS 1;  2QEX Z;  2E2I I;  3M3Y I;  1VLA A;  2E2J I;  1VQ4 1;  1Q86 1;  1VQK 1;  3S1M I;  4NBH A;  1KC8 1;  1VQP Z;  4EWC A;  2V8I A;  3U50 C;  1VQM 1;  3FQM A;  3H0G I;  1RLY A;  3BG1 B;  3EER A;  3G6E Z;  3F3P C;  1VQO Z;  1NP6 A;  1X0T A;  3VB9 A;  2YAD A;  2QA4 Z;  3GTM I;  3GTO I;  3CXC Z;  4RV9 A;  1YIJ 1;  1DL6 A;  4XX2 A;  1WCM I;  1M1K 2;  3CD6 Z;  3CCV Z;  1YI2 1;  4NBG A;  2OTL 1;  5FLX b;  3S1Q I;  3NH4 A;  4BXX I;  2E9H A;  2Q4Z A;  4E30 A;  1QVF Y;  3HOX I;  1QF8 A;  3CCR 1;  3NDI A;  3CC7 Z;  1QYP A;  2OTL Z;  3MZL B;  3PO2 I;  1VQO 1;  3PO3 I;  3GTK I;  3CC2 Z;  1JWH C;  3I55 Z;  4RVG A;  2AKL A;  1Q7Y 2;  1VQ6 1;  1Q82 2;  2PM9 A;  2O4H A;  1YHQ Z;  3CCM 1;  1VQL 1;  4RVF A;  4A3B I;  4A93 I;  3CCS Z;  1N8R 2;  4QTT A;  3CCL Z;  1ZB9 A;  3Q87 A;  1W2B Z;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...