1VQK1

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqk100
1VQPZ 1VQN1 3CXCY 1VQ5Z 1Q822 1QVGZ 3G711 3CC7Z 1VQL1 1YI2Z 1VQ8Z 1VQ71 3CCJZ 1VQO1 1NJI1 1KQSY 3CCRZ 2OTLZ 1VQ9Z 3CPWZ 2OTJZ 1JJ2Y 3G6EZ 3OW2Y 1K732 3CC41 3G4SZ 1W2BY 1YIJZ 3CCEZ 3CCLZ 1VQP1 3CCU1 1YITZ 1NJI2 1M902 3CCM1 1Q7Y1 3CCVZ 1YHQZ 1YI21 1VQKZ 2QA4Z 3CC2Z 3CCJ1 1VQ41 1K8A1 3CMAZ 1N8R1 1VQ6Z 3CCR1 1VQMZ 1YJ9Z 3CCS1 1QVGY 2QEXZ 1M1K1 1S72Z 2OTJ1 1QVFZ 3I561 3G6E1 3CMEZ 1Q7Y2 1VQNZ 1KQSZ 1YJNZ 1Q811 1YIJ1 1VQLZ 1KD11 1VQ51 1VQ7Z 3OW2Z 3I55Z 3CC71 1M1K2 3CCV1 1YHQ1 1VQ81 1W2BZ 1YJWZ 1Q821 1K9M1 1VQK1 3CXCZ 1Q812 2OTL1 1VQ91 1YJ91 3CCQZ 3CC4Z 3CD6Z 3CME1 3CCUZ 1YJN1 1KC81 3G4S1 3G71Z 1K9M2 3CCMZ 3CCE1 3CCL1 1K731 3CPWY 1K8A2 1YIT1 1Q861 1N8R2 1JJ2Z 1QVFY 3I551 1VQ4Z 1VQOZ 1M901 1YJW1 3CCSZ 2QA41 3CC21 1KC82 3CMA1 3I56Z 1VQ61 1VQM1 2QEX1 3CCQ1 1S721 3CD61 1Q862 1KD12
chains in the Genus database with same CATH superfamily
3GTJI 1VQPZ 1VQN1 3TE5B 3QWUA 1Q822 3G711 3CC7Z 2I3CA 1VQL1 1YI2Z 4E31A 3KIHA 2AKLA 1TWFI 3S15I 3D6WA 2QRCB 2K5RA 3IFUA 2JIMA 3CCRZ 1NP6A 2V8JA 3H0GI 4MONA 2H85A 3FQMA 1JJ2Y 3S14I 3G6EZ 3OW2Y 2QREB 4S1TA 1K732 4EWCA 3G4SZ 2V3VA 3CQZI 1NJI2 5LL6f 2Q51A 4DQYB 3VTNA 3CCVZ 3VMHA 1TWCI 2M48A 2JIOA 4MD8A 1VQ41 2IZ4A 4NBEA 3CMAZ 5D1PA 1YJ9Z 3PO3S 1I50I 4E32A 1S72Z 2JMOA 1QVFZ 3I561 1USPA 2GU2A 3CMEZ 1YJNZ 1Q811 5IP7I 2OOYB 1Y1VS 4RVGA 2OZKA 1WW9A 2M6NA 3CC71 1X0TA 2G2KA 2JA5I 2VUGA 2RPRA 2OOXB 4MXUA 4E2ZA 3EEDA 3FKII 3HOVI 2VPZA 2WB1A 3I07A 3CCUZ 1Z03A 3G4S1 4QTUA 3G71Z 2VPXA 1RQFA 4MRIA 1K8A2 2BJOA 1JJ2Z 3Q87A 2EGTA 3I551 4CL1A 3HOXI 4A3FI 1M901 4E30A 3CCSZ 3I4MI 5FLMI 3JAMb 1KC82 3CMA1 2R92I 3FQQA 3NFZA 3GTLI 1SIWA 3CCQ1 4A3JI 1S721 4Y52I 1Q862 1Y1WI 1KD12 1S7MA 3VMGA 2VPYA 3CXCY 1X3ZA 2AYDA 4A3CI 1VQ8Z 1TFIA 1FDOA 3D2LA 3RZOI 3HOYI 3I4NI 1WIIA 1VQO1 3GCFA 4RVDA 2OTLZ 3NH4A 3GTOI 3NDIA 3IR7A 1RO4A 2QRDB 1ZB8A 1Z02A 4QTTA 2P3YA 1YUAA 1LQLA 2LIYA 1K83I 4NBGA 4DGLA 3H3VJ 3J81f 3CCU1 2F4OA 2IV2X 1DL6A 3EERA 2QA4Z 3ESWA 2YADA 3CC2Z 3CCJ1 4NFRA 2PK7A 2R93I 1VQ6Z 1VQMZ 4A3DI 1QVGY 3CCS1 2OTJ1 2HU9A 4E2YA 3U50C 1KQSZ 1P9NA 2LFUA 2QR1B 4NB9A 1YIJ1 2IZ3A 1VQ7Z 3I55Z 1Y8CA 1VQ81 1W2BZ 1Q821 1VQK1 3S1RI 1RO0A 3CXCZ 3VMIA 4HGZA 2GTHA 3M3YI 1Q812 4NBHA 2OTL1 3CCQZ 3PO2I 3NH5A 3MONA 4A3EI 2RHBA 3CCMZ 3J7A4 3P5JB 1K731 1X3WA 2NVTI 3S16I 1N8R2 3J80b 2JS4A 2YU9I 3VB9A 1VQOZ 3S2HI 2E2JI 1TWGI 2ZAEB 2F4MA 3NDJA 2QA41 2B63I 3CC21 1VQ61 1VQM1 5C3EI 3D9XA 3CD61 3KIFA 4HGYA 1Q16A 3J80f 2HF1A 2WAQA 1VQ5Z 1QVGZ 4RS4A 5FLXb 5C4JI 1QYPA 4MD7A 1VQ71 3CCJZ 3HOWI 1WJ2A 3IX0A 2QKDA 4TNUA 1KQSY 1VQ9Z 4NBBA 2GTIA 3CPWZ 2OTJZ 3S17I 3S1QI 4NOZA 3LUSA 5T67A 1VLAA 5T6BA 2QLVB 2Y0SA 4BBSI 1TWHI 2RBLA 3GTMI 1W2BY 1YIJZ 5AN9F 2E9HA 3CCEZ 3CCLZ 3GKQA 5FLXf 2R6MA 1YITZ 2NVXI 1Z01A 3CCM1 1Q7Y1 1VQKZ 3RZDI 3JAMf 1L1OC 1K8A1 2O53A 2JNYA 1M1K1 2QEXZ 5A2Qb 4NBDA 3GTQI 2K3RA 5T64A 4NB8A 1R9TI 2PM9A 2E7ZA 1N2FA 2DE5A 1KD11 1VQ51 2DE6A 2E2HI 2JIPA 2V8KA 2LEXA 4A3II 3T4NB 1YHQ1 3HOUI 4NBFA 4RVFA 5CM2M 2Q4ZA 1K9M1 5A2Qf 2NVQI 4A3MI 4BY7I 4AYBA 2RIQA 1VQ91 3CC4Z 3CD6Z 5IP9I 1WZNA 5IT9b 4BY1I 3CCE1 3CCL1 3CPWY 3PO3I 2JA8I 1YIT1 4HH4A 2JR6A 3F3PC 5C4XI 1YJW1 1RLYA 4BXXI 1Y1VI 5D1OB 5IT9f 2KI7B 2W04A 2QEX1 2VPWA 5C44I 4A3BI 1NUIA 4A3GI 4MD9A 2NAPA 5D1OA 1TWAI 1KRLA 3K7AI 2KPIA 2DE7A 1QXFA 2P28A 4A3LI 1USPB 1ZB9A 2VUMI 3GTGI 1RO2A 1NJI1 4E2WA 1ZH1A 3S1NI 3BG0B 4A93I 2JUBA 3S2DI 2V45A 1AA6A 3HOZI 2O4HA 3CC41 4BBRI 1VQP1 2JIQA 3NH8A 1M902 3GTPI 4DK1A 2E2II 4NBCA 1YHQZ 1YI21 2W03A 1QF8A 1ML8A 4E33A 4MH4A 1N8R1 3CCR1 4NH1C 1WCMI 3G6E1 1Q7Y2 4E2XA 1VQNZ 2JIRA 1RNIA 3GTKI 1VQLZ 1YUKA 4XX2A 3MZKB 3S1MI 2PMZA 3HKZA 3OW2Z 3IF8A 1M1K2 3CCV1 1YJWZ 2RT9A 2VF1A 2NVYI 3M4OI 1YJ91 3F3FC 4NBAA 3BG1B 3MZLB 1SFOI 1PFTA 4X6AI 3CME1 1YJN1 1KC81 1K9M2 1I6HI 4Y7NI 3J81b 2R7ZI 2J6AA 1Q861 1QVFY 2V8IA 3GTMS 1VQ4Z 1JWHC 1FDIA 2JA6I 2JA7I 3I56Z 3TDHB 4RV9A 4RVHA 1I3QI 4A3KI
chains in the Genus database with same CATH topology
3GTJI 1VQPZ 1VQN1 3TE5B 3QWUA 1Q822 3G711 3CC7Z 2I3CA 1VQL1 1YI2Z 4E31A 3KIHA 2AKLA 1TWFI 3S15I 3D6WA 2QRCB 2K5RA 3IFUA 3CCRZ 1NP6A 2V8JA 3H0GI 4MONA 2H85A 3FQMA 1JJ2Y 3S14I 3G6EZ 3OW2Y 2QREB 4S1TA 1K732 4EWCA 3G4SZ 3CQZI 1NJI2 5LL6f 2Q51A 4DQYB 3VTNA 3CCVZ 3VMHA 1TWCI 2M48A 4MD8A 1VQ41 2IZ4A 4NBEA 3CMAZ 5D1PA 1YJ9Z 3PO3S 1I50I 4E32A 1S72Z 2JMOA 1QVFZ 3I561 1USPA 2GU2A 3CMEZ 1YJNZ 1Q811 5IP7I 2OOYB 1Y1VS 4RVGA 2OZKA 1WW9A 2M6NA 3CC71 1X0TA 2G2KA 2JA5I 2VUGA 2RPRA 2OOXB 4MXUA 4E2ZA 3EEDA 3FKII 3HOVI 2WB1A 3I07A 3CCUZ 1Z03A 3G4S1 4QTUA 3G71Z 1RQFA 4MRIA 1K8A2 2BJOA 1JJ2Z 3Q87A 2EGTA 3I551 4CL1A 3HOXI 4A3FI 1M901 4E30A 3CCSZ 3I4MI 5FLMI 3JAMb 1KC82 3CMA1 2R92I 3FQQA 3NFZA 3GTLI 3CCQ1 4A3JI 1S721 4Y52I 1Q862 1Y1WI 1KD12 1S7MA 3VMGA 3CXCY 1X3ZA 4A3CI 1VQ8Z 1TFIA 3RZOI 3HOYI 3I4NI 1WIIA 1VQO1 3GCFA 4RVDA 2OTLZ 3NH4A 3GTOI 3NDIA 1RO4A 2QRDB 1ZB8A 1Z02A 4QTTA 2P3YA 1YUAA 1LQLA 2LIYA 1K83I 4NBGA 4DGLA 3H3VJ 3J81f 3CCU1 2F4OA 1DL6A 3EERA 2QA4Z 3ESWA 2YADA 3CC2Z 3CCJ1 4NFRA 2PK7A 2R93I 1VQ6Z 1VQMZ 4A3DI 1QVGY 3CCS1 2OTJ1 2HU9A 4E2YA 3U50C 1KQSZ 1P9NA 2LFUA 2QR1B 4NB9A 1YIJ1 2IZ3A 1VQ7Z 3I55Z 1VQ81 1W2BZ 1Q821 1VQK1 3S1RI 1RO0A 3CXCZ 3VMIA 4HGZA 2GTHA 3M3YI 1Q812 4NBHA 2OTL1 3CCQZ 3PO2I 3NH5A 3MONA 4A3EI 2RHBA 3CCMZ 3J7A4 3P5JB 1K731 1X3WA 2NVTI 3S16I 1N8R2 3J80b 2JS4A 2YU9I 3VB9A 1VQOZ 3S2HI 2E2JI 1TWGI 2ZAEB 2F4MA 3NDJA 2QA41 2B63I 3CC21 1VQ61 1VQM1 5C3EI 3D9XA 3CD61 3KIFA 4HGYA 3J80f 2HF1A 2WAQA 1VQ5Z 1QVGZ 4RS4A 5FLXb 5C4JI 1QYPA 4MD7A 1VQ71 3CCJZ 3HOWI 3IX0A 4TNUA 2QKDA 1KQSY 1VQ9Z 4NBBA 2GTIA 3CPWZ 2OTJZ 3S17I 3S1QI 4NOZA 3LUSA 5T67A 1VLAA 5T6BA 2QLVB 2Y0SA 4BBSI 1TWHI 2RBLA 3GTMI 1W2BY 1YIJZ 5AN9F 2E9HA 3CCEZ 3CCLZ 3GKQA 5FLXf 2R6MA 1YITZ 2NVXI 1Z01A 3CCM1 1Q7Y1 1VQKZ 3RZDI 3JAMf 1L1OC 1K8A1 2O53A 2JNYA 1M1K1 2QEXZ 5A2Qb 4NBDA 3GTQI 2K3RA 5T64A 4NB8A 1R9TI 2PM9A 1N2FA 2DE5A 1KD11 1VQ51 2DE6A 2E2HI 2V8KA 4A3II 3T4NB 1YHQ1 3HOUI 4NBFA 4RVFA 5CM2M 2Q4ZA 1K9M1 5A2Qf 2NVQI 4A3MI 4BY7I 4AYBA 2RIQA 1VQ91 3CC4Z 3CD6Z 5IP9I 5IT9b 4BY1I 3CCE1 3CCL1 3CPWY 3PO3I 2JA8I 1YIT1 4HH4A 2JR6A 3F3PC 5C4XI 1YJW1 1RLYA 4BXXI 1Y1VI 5D1OB 5IT9f 2KI7B 2W04A 2QEX1 5C44I 4A3BI 1NUIA 4A3GI 4MD9A 5D1OA 1TWAI 1KRLA 3K7AI 2KPIA 2DE7A 2P28A 4A3LI 1USPB 1ZB9A 2VUMI 3GTGI 1RO2A 1NJI1 4E2WA 1ZH1A 3S1NI 3BG0B 4A93I 2JUBA 3S2DI 3HOZI 2O4HA 3CC41 4BBRI 1VQP1 3NH8A 1M902 3GTPI 4DK1A 2E2II 4NBCA 1YHQZ 1YI21 2W03A 1QF8A 1ML8A 4E33A 4MH4A 1N8R1 3CCR1 4NH1C 1WCMI 3G6E1 1Q7Y2 4E2XA 1VQNZ 1RNIA 3GTKI 1VQLZ 1YUKA 4XX2A 3MZKB 3S1MI 2PMZA 3HKZA 3OW2Z 3IF8A 1M1K2 3CCV1 1YJWZ 2RT9A 2VF1A 2NVYI 3M4OI 1YJ91 3F3FC 4NBAA 3BG1B 3MZLB 1SFOI 1PFTA 4X6AI 3CME1 1YJN1 1KC81 1K9M2 1I6HI 4Y7NI 3J81b 2R7ZI 2J6AA 1Q861 1QVFY 2V8IA 3GTMS 1VQ4Z 1JWHC 2JA6I 2JA7I 3I56Z 3TDHB 4RV9A 4RVHA 1I3QI 4A3KI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Z;  1VQN 1;  3CXC Y;  1VQ5 Z;  1Q82 2;  1QVG Z;  3G71 1;  3CC7 Z;  1VQL 1;  1YI2 Z;  1VQ8 Z;  1VQ7 1;  3CCJ Z;  1VQO 1;  1NJI 1;  1KQS Y;  3CCR Z;  2OTL Z;  1VQ9 Z;  3CPW Z;  2OTJ Z;  1JJ2 Y;  3G6E Z;  3OW2 Y;  1K73 2;  3CC4 1;  3G4S Z;  1W2B Y;  1YIJ Z;  3CCE Z;  3CCL Z;  1VQP 1;  3CCU 1;  1YIT Z;  1NJI 2;  1M90 2;  3CCM 1;  1Q7Y 1;  3CCV Z;  1YHQ Z;  1YI2 1;  1VQK Z;  2QA4 Z;  3CC2 Z;  3CCJ 1;  1VQ4 1;  1K8A 1;  3CMA Z;  1N8R 1;  1VQ6 Z;  3CCR 1;  1VQM Z;  1YJ9 Z;  3CCS 1;  1QVG Y;  2QEX Z;  1M1K 1;  1S72 Z;  2OTJ 1;  1QVF Z;  3I56 1;  3G6E 1;  3CME Z;  1Q7Y 2;  1VQN Z;  1KQS Z;  1YJN Z;  1Q81 1;  1YIJ 1;  1VQL Z;  1KD1 1;  1VQ5 1;  1VQ7 Z;  3OW2 Z;  3I55 Z;  3CC7 1;  1M1K 2;  3CCV 1;  1YHQ 1;  1VQ8 1;  1W2B Z;  1YJW Z;  1Q82 1;  1K9M 1;  1VQK 1;  3CXC Z;  1Q81 2;  2OTL 1;  1VQ9 1;  1YJ9 1;  3CCQ Z;  3CC4 Z;  3CD6 Z;  3CME 1;  3CCU Z;  1YJN 1;  1KC8 1;  3G4S 1;  3G71 Z;  1K9M 2;  3CCM Z;  3CCE 1;  3CCL 1;  1K73 1;  3CPW Y;  1K8A 2;  1YIT 1;  1Q86 1;  1N8R 2;  1JJ2 Z;  1QVF Y;  3I55 1;  1VQ4 Z;  1VQO Z;  1M90 1;  1YJW 1;  3CCS Z;  2QA4 1;  3CC2 1;  1KC8 2;  3CMA 1;  3I56 Z;  1VQ6 1;  1VQM 1;  2QEX 1;  3CCQ 1;  1S72 1;  3CD6 1;  1Q86 2;  1KD1 2; 
#chains in the Genus database with same CATH topology
 3GTJ I;  1VQP Z;  1VQN 1;  3TE5 B;  3QWU A;  1Q82 2;  3G71 1;  3CC7 Z;  2I3C A;  1VQL 1;  1YI2 Z;  4E31 A;  3KIH A;  2AKL A;  1TWF I;  3S15 I;  3D6W A;  2QRC B;  2K5R A;  3IFU A;  2JIM A;  3CCR Z;  1NP6 A;  2V8J A;  3H0G I;  4MON A;  2H85 A;  3FQM A;  1JJ2 Y;  3S14 I;  3G6E Z;  3OW2 Y;  2QRE B;  4S1T A;  1K73 2;  4EWC A;  3G4S Z;  2V3V A;  3CQZ I;  1NJI 2;  5LL6 f;  2Q51 A;  4DQY B;  3VTN A;  3CCV Z;  3VMH A;  1TWC I;  2M48 A;  2JIO A;  4MD8 A;  1VQ4 1;  2IZ4 A;  4NBE A;  3CMA Z;  5D1P A;  1YJ9 Z;  3PO3 S;  1I50 I;  4E32 A;  1S72 Z;  2JMO A;  1QVF Z;  3I56 1;  1USP A;  2GU2 A;  3CME Z;  1YJN Z;  1Q81 1;  5IP7 I;  2OOY B;  1Y1V S;  4RVG A;  2OZK A;  1WW9 A;  2M6N A;  3CC7 1;  1X0T A;  2G2K A;  2JA5 I;  2VUG A;  2RPR A;  2OOX B;  4MXU A;  4E2Z A;  3EED A;  3FKI I;  3HOV I;  2VPZ A;  2WB1 A;  3I07 A;  3CCU Z;  1Z03 A;  3G4S 1;  4QTU A;  3G71 Z;  2VPX A;  1RQF A;  4MRI A;  1K8A 2;  2BJO A;  1JJ2 Z;  3Q87 A;  2EGT A;  3I55 1;  4CL1 A;  3HOX I;  4A3F I;  1M90 1;  4E30 A;  3CCS Z;  3I4M I;  5FLM I;  3JAM b;  1KC8 2;  3CMA 1;  2R92 I;  3FQQ A;  3NFZ A;  3GTL I;  1SIW A;  3CCQ 1;  4A3J I;  1S72 1;  4Y52 I;  1Q86 2;  1Y1W I;  1KD1 2;  1S7M A;  3VMG A;  2VPY A;  3CXC Y;  1X3Z A;  2AYD A;  4A3C I;  1VQ8 Z;  1TFI A;  1FDO A;  3D2L A;  3RZO I;  3HOY I;  3I4N I;  1WII A;  1VQO 1;  3GCF A;  4RVD A;  2OTL Z;  3NH4 A;  3GTO I;  3NDI A;  3IR7 A;  1RO4 A;  2QRD B;  1ZB8 A;  1Z02 A;  4QTT A;  2P3Y A;  1YUA A;  1LQL A;  2LIY A;  1K83 I;  4NBG A;  4DGL A;  3H3V J;  3J81 f;  3CCU 1;  2F4O A;  2IV2 X;  1DL6 A;  3EER A;  2QA4 Z;  3ESW A;  2YAD A;  3CC2 Z;  3CCJ 1;  4NFR A;  2PK7 A;  2R93 I;  1VQ6 Z;  1VQM Z;  4A3D I;  1QVG Y;  3CCS 1;  2OTJ 1;  2HU9 A;  4E2Y A;  3U50 C;  1KQS Z;  1P9N A;  2LFU A;  2QR1 B;  4NB9 A;  1YIJ 1;  2IZ3 A;  1VQ7 Z;  3I55 Z;  1Y8C A;  1VQ8 1;  1W2B Z;  1Q82 1;  1VQK 1;  3S1R I;  1RO0 A;  3CXC Z;  3VMI A;  4HGZ A;  2GTH A;  3M3Y I;  1Q81 2;  4NBH A;  2OTL 1;  3CCQ Z;  3PO2 I;  3NH5 A;  3MON A;  4A3E I;  2RHB A;  3CCM Z;  3J7A 4;  3P5J B;  1K73 1;  1X3W A;  2NVT I;  3S16 I;  1N8R 2;  3J80 b;  2JS4 A;  2YU9 I;  3VB9 A;  1VQO Z;  3S2H I;  2E2J I;  1TWG I;  2ZAE B;  2F4M A;  3NDJ A;  2QA4 1;  2B63 I;  3CC2 1;  1VQ6 1;  1VQM 1;  5C3E I;  3D9X A;  3CD6 1;  3KIF A;  4HGY A;  1Q16 A;  3J80 f;  2HF1 A;  2WAQ A;  1VQ5 Z;  1QVG Z;  4RS4 A;  5FLX b;  5C4J I;  1QYP A;  4MD7 A;  1VQ7 1;  3CCJ Z;  3HOW I;  1WJ2 A;  3IX0 A;  2QKD A;  4TNU A;  1KQS Y;  1VQ9 Z;  4NBB A;  2GTI A;  3CPW Z;  2OTJ Z;  3S17 I;  3S1Q I;  4NOZ A;  3LUS A;  5T67 A;  1VLA A;  5T6B A;  2QLV B;  2Y0S A;  4BBS I;  1TWH I;  2RBL A;  3GTM I;  1W2B Y;  1YIJ Z;  5AN9 F;  2E9H A;  3CCE Z;  3CCL Z;  3GKQ A;  5FLX f;  2R6M A;  1YIT Z;  2NVX I;  1Z01 A;  3CCM 1;  1Q7Y 1;  1VQK Z;  3RZD I;  3JAM f;  1L1O C;  1K8A 1;  2O53 A;  2JNY A;  1M1K 1;  2QEX Z;  5A2Q b;  4NBD A;  3GTQ I;  2K3R A;  5T64 A;  4NB8 A;  1R9T I;  2PM9 A;  2E7Z A;  1N2F A;  2DE5 A;  1KD1 1;  1VQ5 1;  2DE6 A;  2E2H I;  2JIP A;  2V8K A;  2LEX A;  4A3I I;  3T4N B;  1YHQ 1;  3HOU I;  4NBF A;  4RVF A;  5CM2 M;  2Q4Z A;  1K9M 1;  5A2Q f;  2NVQ I;  4A3M I;  4BY7 I;  4AYB A;  2RIQ A;  1VQ9 1;  3CC4 Z;  3CD6 Z;  5IP9 I;  1WZN A;  5IT9 b;  4BY1 I;  3CCE 1;  3CCL 1;  3CPW Y;  3PO3 I;  2JA8 I;  1YIT 1;  4HH4 A;  2JR6 A;  3F3P C;  5C4X I;  1YJW 1;  1RLY A;  4BXX I;  1Y1V I;  5D1O B;  5IT9 f;  2KI7 B;  2W04 A;  2QEX 1;  2VPW A;  5C44 I;  4A3B I;  1NUI A;  4A3G I;  4MD9 A;  2NAP A;  5D1O A;  1TWA I;  1KRL A;  3K7A I;  2KPI A;  2DE7 A;  1QXF A;  2P28 A;  4A3L I;  1USP B;  1ZB9 A;  2VUM I;  3GTG I;  1RO2 A;  1NJI 1;  4E2W A;  1ZH1 A;  3S1N I;  3BG0 B;  4A93 I;  2JUB A;  3S2D I;  2V45 A;  1AA6 A;  3HOZ I;  2O4H A;  3CC4 1;  4BBR I;  1VQP 1;  2JIQ A;  3NH8 A;  1M90 2;  3GTP I;  4DK1 A;  2E2I I;  4NBC A;  1YHQ Z;  1YI2 1;  2W03 A;  1QF8 A;  1ML8 A;  4E33 A;  4MH4 A;  1N8R 1;  3CCR 1;  4NH1 C;  1WCM I;  3G6E 1;  1Q7Y 2;  4E2X A;  1VQN Z;  2JIR A;  1RNI A;  3GTK I;  1VQL Z;  1YUK A;  4XX2 A;  3MZK B;  3S1M I;  2PMZ A;  3HKZ A;  3OW2 Z;  3IF8 A;  1M1K 2;  3CCV 1;  1YJW Z;  2RT9 A;  2VF1 A;  2NVY I;  3M4O I;  1YJ9 1;  3F3F C;  4NBA A;  3BG1 B;  3MZL B;  1SFO I;  1PFT A;  4X6A I;  3CME 1;  1YJN 1;  1KC8 1;  1K9M 2;  1I6H I;  4Y7N I;  3J81 b;  2R7Z I;  2J6A A;  1Q86 1;  1QVF Y;  2V8I A;  3GTM S;  1VQ4 Z;  1JWH C;  1FDI A;  2JA6 I;  2JA7 I;  3I56 Z;  3TDH B;  4RV9 A;  4RVH A;  1I3Q I;  4A3K I; 
#chains in the Genus database with same CATH homology
 3GTJ I;  1VQP Z;  1VQN 1;  3TE5 B;  3QWU A;  1Q82 2;  3G71 1;  3CC7 Z;  2I3C A;  1VQL 1;  1YI2 Z;  4E31 A;  3KIH A;  2AKL A;  1TWF I;  3S15 I;  3D6W A;  2QRC B;  2K5R A;  3IFU A;  3CCR Z;  1NP6 A;  2V8J A;  3H0G I;  4MON A;  2H85 A;  3FQM A;  1JJ2 Y;  3S14 I;  3G6E Z;  3OW2 Y;  2QRE B;  4S1T A;  1K73 2;  4EWC A;  3G4S Z;  3CQZ I;  1NJI 2;  5LL6 f;  2Q51 A;  4DQY B;  3VTN A;  3CCV Z;  3VMH A;  1TWC I;  2M48 A;  4MD8 A;  1VQ4 1;  2IZ4 A;  4NBE A;  3CMA Z;  5D1P A;  1YJ9 Z;  3PO3 S;  1I50 I;  4E32 A;  1S72 Z;  2JMO A;  1QVF Z;  3I56 1;  1USP A;  2GU2 A;  3CME Z;  1YJN Z;  1Q81 1;  5IP7 I;  2OOY B;  1Y1V S;  4RVG A;  2OZK A;  1WW9 A;  2M6N A;  3CC7 1;  1X0T A;  2G2K A;  2JA5 I;  2VUG A;  2RPR A;  2OOX B;  4MXU A;  4E2Z A;  3EED A;  3FKI I;  3HOV I;  2WB1 A;  3I07 A;  3CCU Z;  1Z03 A;  3G4S 1;  4QTU A;  3G71 Z;  1RQF A;  4MRI A;  1K8A 2;  2BJO A;  1JJ2 Z;  3Q87 A;  2EGT A;  3I55 1;  4CL1 A;  3HOX I;  4A3F I;  1M90 1;  4E30 A;  3CCS Z;  3I4M I;  5FLM I;  3JAM b;  1KC8 2;  3CMA 1;  2R92 I;  3FQQ A;  3NFZ A;  3GTL I;  3CCQ 1;  4A3J I;  1S72 1;  4Y52 I;  1Q86 2;  1Y1W I;  1KD1 2;  1S7M A;  3VMG A;  3CXC Y;  1X3Z A;  4A3C I;  1VQ8 Z;  1TFI A;  3RZO I;  3HOY I;  3I4N I;  1WII A;  1VQO 1;  3GCF A;  4RVD A;  2OTL Z;  3NH4 A;  3GTO I;  3NDI A;  1RO4 A;  2QRD B;  1ZB8 A;  1Z02 A;  4QTT A;  2P3Y A;  1YUA A;  1LQL A;  2LIY A;  1K83 I;  4NBG A;  4DGL A;  3H3V J;  3J81 f;  3CCU 1;  2F4O A;  1DL6 A;  3EER A;  2QA4 Z;  3ESW A;  2YAD A;  3CC2 Z;  3CCJ 1;  4NFR A;  2PK7 A;  2R93 I;  1VQ6 Z;  1VQM Z;  4A3D I;  1QVG Y;  3CCS 1;  2OTJ 1;  2HU9 A;  4E2Y A;  3U50 C;  1KQS Z;  1P9N A;  2LFU A;  2QR1 B;  4NB9 A;  1YIJ 1;  2IZ3 A;  1VQ7 Z;  3I55 Z;  1VQ8 1;  1W2B Z;  1Q82 1;  1VQK 1;  3S1R I;  1RO0 A;  3CXC Z;  3VMI A;  4HGZ A;  2GTH A;  3M3Y I;  1Q81 2;  4NBH A;  2OTL 1;  3CCQ Z;  3PO2 I;  3NH5 A;  3MON A;  4A3E I;  2RHB A;  3CCM Z;  3J7A 4;  3P5J B;  1K73 1;  1X3W A;  2NVT I;  3S16 I;  1N8R 2;  3J80 b;  2JS4 A;  2YU9 I;  3VB9 A;  1VQO Z;  3S2H I;  2E2J I;  1TWG I;  2ZAE B;  2F4M A;  3NDJ A;  2QA4 1;  2B63 I;  3CC2 1;  1VQ6 1;  1VQM 1;  5C3E I;  3D9X A;  3CD6 1;  3KIF A;  4HGY A;  3J80 f;  2HF1 A;  2WAQ A;  1VQ5 Z;  1QVG Z;  4RS4 A;  5FLX b;  5C4J I;  1QYP A;  4MD7 A;  1VQ7 1;  3CCJ Z;  3HOW I;  3IX0 A;  4TNU A;  2QKD A;  1KQS Y;  1VQ9 Z;  4NBB A;  2GTI A;  3CPW Z;  2OTJ Z;  3S17 I;  3S1Q I;  4NOZ A;  3LUS A;  5T67 A;  1VLA A;  5T6B A;  2QLV B;  2Y0S A;  4BBS I;  1TWH I;  2RBL A;  3GTM I;  1W2B Y;  1YIJ Z;  5AN9 F;  2E9H A;  3CCE Z;  3CCL Z;  3GKQ A;  5FLX f;  2R6M A;  1YIT Z;  2NVX I;  1Z01 A;  3CCM 1;  1Q7Y 1;  1VQK Z;  3RZD I;  3JAM f;  1L1O C;  1K8A 1;  2O53 A;  2JNY A;  1M1K 1;  2QEX Z;  5A2Q b;  4NBD A;  3GTQ I;  2K3R A;  5T64 A;  4NB8 A;  1R9T I;  2PM9 A;  1N2F A;  2DE5 A;  1KD1 1;  1VQ5 1;  2DE6 A;  2E2H I;  2V8K A;  4A3I I;  3T4N B;  1YHQ 1;  3HOU I;  4NBF A;  4RVF A;  5CM2 M;  2Q4Z A;  1K9M 1;  5A2Q f;  2NVQ I;  4A3M I;  4BY7 I;  4AYB A;  2RIQ A;  1VQ9 1;  3CC4 Z;  3CD6 Z;  5IP9 I;  5IT9 b;  4BY1 I;  3CCE 1;  3CCL 1;  3CPW Y;  3PO3 I;  2JA8 I;  1YIT 1;  4HH4 A;  2JR6 A;  3F3P C;  5C4X I;  1YJW 1;  1RLY A;  4BXX I;  1Y1V I;  5D1O B;  5IT9 f;  2KI7 B;  2W04 A;  2QEX 1;  5C44 I;  4A3B I;  1NUI A;  4A3G I;  4MD9 A;  5D1O A;  1TWA I;  1KRL A;  3K7A I;  2KPI A;  2DE7 A;  2P28 A;  4A3L I;  1USP B;  1ZB9 A;  2VUM I;  3GTG I;  1RO2 A;  1NJI 1;  4E2W A;  1ZH1 A;  3S1N I;  3BG0 B;  4A93 I;  2JUB A;  3S2D I;  3HOZ I;  2O4H A;  3CC4 1;  4BBR I;  1VQP 1;  3NH8 A;  1M90 2;  3GTP I;  4DK1 A;  2E2I I;  4NBC A;  1YHQ Z;  1YI2 1;  2W03 A;  1QF8 A;  1ML8 A;  4E33 A;  4MH4 A;  1N8R 1;  3CCR 1;  4NH1 C;  1WCM I;  3G6E 1;  1Q7Y 2;  4E2X A;  1VQN Z;  1RNI A;  3GTK I;  1VQL Z;  1YUK A;  4XX2 A;  3MZK B;  3S1M I;  2PMZ A;  3HKZ A;  3OW2 Z;  3IF8 A;  1M1K 2;  3CCV 1;  1YJW Z;  2RT9 A;  2VF1 A;  2NVY I;  3M4O I;  1YJ9 1;  3F3F C;  4NBA A;  3BG1 B;  3MZL B;  1SFO I;  1PFT A;  4X6A I;  3CME 1;  1YJN 1;  1KC8 1;  1K9M 2;  1I6H I;  4Y7N I;  3J81 b;  2R7Z I;  2J6A A;  1Q86 1;  1QVF Y;  2V8I A;  3GTM S;  1VQ4 Z;  1JWH C;  2JA6 I;  2JA7 I;  3I56 Z;  3TDH B;  4RV9 A;  4RVH A;  1I3Q I;  4A3K I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...