1VQK1

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqk100
1VQ6Z 1YIJZ 3CCJZ 1K732 1VQPZ 1KQSZ 2OTL1 1YJ9Z 2OTJZ 1M1K2 3CC41 1VQO1 1VQ7Z 3CCRZ 1Q862 1Q7Y1 1W2BY 1YIT1 3G4SZ 3CMA1 3CCUZ 3CCSZ 3CCLZ 1YJN1 1VQKZ 1K8A1 1W2BZ 1Q811 3CCVZ 1KD11 1VQM1 1KC81 3G6E1 1NJI1 1VQ41 2QA41 3OW2Y 1VQOZ 1YHQZ 3CME1 1Q822 3CMAZ 1VQ51 3G711 1VQL1 1VQ9Z 3CCQZ 1VQ81 3OW2Z 1S721 1YJNZ 3CCE1 3CD61 1Q812 1N8R2 2QEX1 1YJWZ 1YIJ1 3I551 1JJ2Y 1K731 1Q861 1VQ4Z 1K9M1 2QA4Z 2OTLZ 3G4S1 1M901 3CC4Z 1JJ2Z 3CC21 1QVGY 3CC71 1Q7Y2 1YITZ 3CCL1 3CCS1 1VQ5Z 1VQN1 3G71Z 1VQLZ 1VQK1 1QVFY 3I561 3CCV1 1YI21 3CXCY 1QVGZ 1K8A2 3CCM1 1VQ61 2QEXZ 1QVFZ 1KD12 3I55Z 1VQMZ 3CCJ1 1KC82 1VQP1 3G6EZ 1YJ91 1M1K1 3CXCZ 3CPWY 2OTJ1 1NJI2 1VQ71 1YHQ1 1Q821 3CCR1 1K9M2 1M902 3CC2Z 3CMEZ 1VQ91 3CCQ1 3CC7Z 3CPWZ 3CCU1 1VQNZ 3I56Z 1VQ8Z 1N8R1 1S72Z 1KQSY 1YJW1 3CCEZ 1YI2Z 3CCMZ 3CD6Z
chains in the Genus database with same CATH superfamily
4BBRI 2KI7B 3S1QI 5C4JI 2HF1A 1YUAA 4RVDA 1K732 1LQLA 4MONA 4NBAA 2P28A 2H85A 1Q862 2R93I 1W2BY 3NH5A 1YIT1 3IF8A 3G4SZ 2W03A 1L1OC 4RV9A 4DK1A 3JAMb 1YJN1 1W2BZ 3CCVZ 1WIIA 2QRDB 2V8IA 1KD11 1N2FA 2JIQA 4A3JI 1Z02A 2BJOA 1NJI1 1TWHI 1K83I 4MD8A 2V45A 3VB9A 1RO4A 1Y1WI 2K3RA 3EEDA 3VMHA 2J6AA 3S15I 3GTLI 3PO3I 1ZB9A 3HKZA 2EGTA 3JAMf 1VQ81 1YJNZ 2PM9A 4A3KI 3CCE1 1DL6A 3CD61 2NVTI 3D9XA 1YUKA 1X3WA 1JJ2Y 3VMGA 1K731 3S17I 1Q861 2JIRA 2OTLZ 2JA6I 4CL1A 4NBEA 4EWCA 1JJ2Z 3I4NI 4Y52I 2M6NA 1QVGY 1Y1VS 3S1MI 3GTPI 4NB8A 2O53A 4E30A 3RZDI 4MXUA 2LEXA 3HOVI 1QVGZ 3H0GI 1VQ61 2O4HA 2JIPA 3GTOI 1SFOI 2QRCB 3CCJ1 2W04A 4NBGA 5IP7I 1YJ91 3EERA 1WJ2A 3MZLB 3KIFA 2HU9A 3CMEZ 4RS4A 4XX2A 2RPRA 1SIWA 1ZB8A 4A3MI 1Y8CA 1YJW1 1VQ6Z 2JMOA 2KPIA 3KIHA 2VPXA 2JUBA 2VUMI 1Z01A 1YIJZ 3CCJZ 4Y7NI 2NAPA 3S2DI 5FLMI 1YJ9Z 1M1K2 3CC41 1VQO1 2OOYB 3CMA1 3RZOI 4MD7A 2V8JA 5D1PA 3GTKI 3M3YI 3CCSZ 3CCLZ 3H3VJ 3PO2I 4NOZA 3FQMA 4HGYA 3HOUI 3J80b 1Q811 2V8KA 2IV2X 2JS4A 1VQM1 4NBBA 2AYDA 3HOZI 1FDOA 1VQOZ 5T64A 4TNUA 4E2XA 3GTGI 3CMAZ 3F3FC 2B63I 4BY7I 4A3GI 2IZ4A 3G711 1VQL1 4MD9A 3U50C 3J80f 2YU9I 1N8R2 5CM2M 2QEX1 2VF1A 3GCFA 4NFRA 2OOXB 3MONA 1M901 4E2YA 3CC21 3ESWA 1NP6A 1YITZ 3GKQA 2JA5I 2LIYA 4A3EI 3G71Z 1VQLZ 1VQN1 1VQK1 4NB9A 1QVFY 4NBFA 1USPB 5A2Qb 2AKLA 2NVXI 1TWAI 2QEXZ 1WW9A 1QVFZ 1KC82 1VQP1 3CPWY 1VQ71 1YHQ1 2G2KA 4MH4A 3CCR1 1K9M2 2JNYA 2VPWA 3J81b 3CC2Z 2V3VA 5D1OB 1I6HI 2K5RA 1VQ91 3CCQ1 1RQFA 4RVGA 2NVQI 3CPWZ 3CCU1 4QTUA 1VQNZ 3TE5B 5A2Qf 5C3EI 4DQYB 1VQ8Z 1QXFA 1N8R1 1S7MA 1KQSY 3CCEZ 2WB1A 3CD6Z 3M4OI 1X3ZA 2RIQA 2WAQA 3S2HI 1VQPZ 1KQSZ 3NH8A 3J7A4 4NBHA 1VQ7Z 1RNIA 3CCRZ 3J81f 2VUGA 3IR7A 3D6WA 5LL6f 5C44I 4RVHA 2E2HI 4E2WA 3CCUZ 1TWGI 1KRLA 1NUIA 4HGZA 2JR6A 4A3II 4BBSI 3D2LA 2JIMA 1KC81 2LFUA 3G6E1 4NBCA 3CQZI 2DE5A 2JA8I 1Q822 1PFTA 1VQ51 3P5JB 4X6AI 2E2JI 2OZKA 1S721 2I3CA 3VMIA 4A93I 3NDJA 5FLXb 1YJWZ 4A3CI 2P3YA 2NVYI 1ZH1A 3I551 3BG1B 2E7ZA 2RT9A 2DE7A 2Y0SA 2JA7I 2GTIA 3T4NB 3G4S1 3CC4Z 2R92I 3HOYI 3CC71 1Q7Y2 3IFUA 4A3DI 1VQ5Z 1I50I 3NH4A 4A3FI 3CCV1 3GTQI 5FLXf 2F4MA 3CXCY 2F4OA 1K8A2 3CCM1 1AA6A 4NBDA 1TWFI 3I55Z 1VQMZ 2QR1B 1M1K1 3CXCZ 4HH4A 2OTJ1 2VPZA 1QYPA 2Q4ZA 1Q821 1FDIA 4NH1C 4S1TA 4DGLA 3CC7Z 2IZ3A 2RBLA 3GTMI 1Q16A 4RVFA 2ZAEB 3CCMZ 3HOWI 3S16I 4MRIA 2OTL1 2OTJZ 1WZNA 4AYBA 3IX0A 1Q7Y1 2Q51A 1I3QI 4QTTA 4E33A 2R7ZI 3S1NI 1VQKZ 1K8A1 2GTHA 1P9NA 1JWHC 1Z03A 1R9TI 2RHBA 3LUSA 2E9HA 3HOXI 2QLVB 3NDIA 4E31A 4E2ZA 1X0TA 1VQ41 2QA41 1ML8A 1RO2A 3OW2Y 1YHQZ 3CME1 1TFIA 5C4XI 2VPYA 1VQ9Z 3CCQZ 3OW2Z 5IT9b 4A3BI 3F3PC 1RO0A 1Q812 1RLYA 4BY1I 1YIJ1 1USPA 3S14I 3FKII 1WCMI 5T67A 2PK7A 2R6MA 1VQ4Z 1K9M1 2QA4Z 5T6BA 3QWUA 4A3LI 2JIOA 3GTMS 3CCL1 3CCS1 3S1RI 5IT9f 3I07A 3I561 2E2II 2M48A 5D1OA 1YI21 3BG0B 3I4MI 3VTNA 2DE6A 1KD12 1TWCI 4BXXI 3Q87A 3G6EZ 5AN9F 1VLAA 1NJI2 3PO3S 2YADA 2QREB 3K7AI 1M902 3GTJI 3FQQA 2QKDA 5IP9I 3MZKB 2PMZA 2GU2A 1QF8A 1Y1VI 3I56Z 1S72Z 3TDHB 3NFZA 1YI2Z 4E32A
chains in the Genus database with same CATH topology
4BBRI 2KI7B 3S1QI 5C4JI 2HF1A 1YUAA 4RVDA 1K732 1LQLA 4MONA 4NBAA 2P28A 2H85A 1Q862 2R93I 1W2BY 3NH5A 1YIT1 3IF8A 3G4SZ 2W03A 1L1OC 4RV9A 4DK1A 3JAMb 1YJN1 1W2BZ 3CCVZ 1WIIA 2QRDB 2V8IA 1KD11 1N2FA 4A3JI 1Z02A 2BJOA 1NJI1 1TWHI 1K83I 4MD8A 3VB9A 1RO4A 1Y1WI 2K3RA 3EEDA 3VMHA 2J6AA 3S15I 3GTLI 3PO3I 1ZB9A 3HKZA 2EGTA 3JAMf 1VQ81 1YJNZ 2PM9A 4A3KI 3CCE1 1DL6A 3CD61 2NVTI 3D9XA 1YUKA 1X3WA 1JJ2Y 3VMGA 1K731 3S17I 1Q861 2OTLZ 2JA6I 4CL1A 4NBEA 4EWCA 1JJ2Z 3I4NI 4Y52I 2M6NA 1QVGY 1Y1VS 3S1MI 3GTPI 4NB8A 2O53A 4E30A 3RZDI 4MXUA 3HOVI 1QVGZ 3H0GI 1VQ61 2O4HA 3GTOI 1SFOI 2QRCB 3CCJ1 2W04A 4NBGA 5IP7I 1YJ91 3EERA 3MZLB 3KIFA 2HU9A 3CMEZ 4RS4A 4XX2A 2RPRA 1ZB8A 4A3MI 1YJW1 1VQ6Z 2JMOA 2KPIA 3KIHA 2JUBA 2VUMI 1Z01A 1YIJZ 3CCJZ 4Y7NI 3S2DI 5FLMI 1YJ9Z 1M1K2 3CC41 1VQO1 2OOYB 3CMA1 3RZOI 4MD7A 2V8JA 5D1PA 3GTKI 3M3YI 3CCSZ 3CCLZ 3H3VJ 3PO2I 4NOZA 3FQMA 4HGYA 3HOUI 3J80b 1Q811 2V8KA 2JS4A 1VQM1 4NBBA 3HOZI 1VQOZ 5T64A 4TNUA 4E2XA 3GTGI 3CMAZ 3F3FC 2B63I 4BY7I 4A3GI 2IZ4A 3G711 1VQL1 4MD9A 3U50C 3J80f 2YU9I 1N8R2 5CM2M 2QEX1 2VF1A 3GCFA 4NFRA 2OOXB 3MONA 1M901 4E2YA 3CC21 3ESWA 1NP6A 1YITZ 3GKQA 2JA5I 2LIYA 4A3EI 3G71Z 1VQLZ 1VQN1 1VQK1 4NB9A 1QVFY 4NBFA 1USPB 5A2Qb 2AKLA 2NVXI 1TWAI 2QEXZ 1WW9A 1QVFZ 1KC82 1VQP1 3CPWY 1VQ71 1YHQ1 2G2KA 4MH4A 3CCR1 1K9M2 2JNYA 3J81b 3CC2Z 5D1OB 1I6HI 2K5RA 1VQ91 3CCQ1 1RQFA 4RVGA 2NVQI 3CPWZ 3CCU1 4QTUA 1VQNZ 3TE5B 5A2Qf 5C3EI 4DQYB 1VQ8Z 1N8R1 1S7MA 1KQSY 3CCEZ 2WB1A 3CD6Z 3M4OI 1X3ZA 2RIQA 2WAQA 3S2HI 1VQPZ 1KQSZ 3NH8A 3J7A4 4NBHA 1VQ7Z 1RNIA 3CCRZ 3J81f 2VUGA 3D6WA 5LL6f 5C44I 4RVHA 2E2HI 4E2WA 3CCUZ 1TWGI 1KRLA 1NUIA 4HGZA 2JR6A 4A3II 4BBSI 1KC81 2LFUA 3G6E1 4NBCA 3CQZI 2DE5A 2JA8I 1Q822 1PFTA 1VQ51 3P5JB 4X6AI 2E2JI 2OZKA 1S721 2I3CA 3VMIA 4A93I 3NDJA 5FLXb 1YJWZ 4A3CI 2P3YA 2NVYI 1ZH1A 3I551 3BG1B 2RT9A 2DE7A 2Y0SA 2JA7I 2GTIA 3T4NB 3G4S1 3CC4Z 2R92I 3HOYI 3CC71 1Q7Y2 3IFUA 4A3DI 1VQ5Z 1I50I 3NH4A 4A3FI 3CCV1 3GTQI 5FLXf 2F4MA 3CXCY 2F4OA 1K8A2 3CCM1 4NBDA 1TWFI 3I55Z 1VQMZ 2QR1B 1M1K1 3CXCZ 4HH4A 2OTJ1 1QYPA 2Q4ZA 1Q821 4NH1C 4S1TA 4DGLA 3CC7Z 2IZ3A 2RBLA 3GTMI 4RVFA 2ZAEB 3CCMZ 3HOWI 3S16I 4MRIA 2OTL1 2OTJZ 4AYBA 3IX0A 1Q7Y1 2Q51A 1I3QI 4QTTA 4E33A 2R7ZI 3S1NI 1VQKZ 1K8A1 2GTHA 1P9NA 1JWHC 1Z03A 1R9TI 2RHBA 3LUSA 2E9HA 3HOXI 2QLVB 3NDIA 4E31A 4E2ZA 1X0TA 1VQ41 2QA41 1ML8A 1RO2A 3OW2Y 1YHQZ 3CME1 1TFIA 5C4XI 1VQ9Z 3CCQZ 3OW2Z 5IT9b 4A3BI 3F3PC 1RO0A 1Q812 1RLYA 4BY1I 1YIJ1 1USPA 3S14I 3FKII 1WCMI 5T67A 2PK7A 2R6MA 1VQ4Z 1K9M1 2QA4Z 5T6BA 3QWUA 4A3LI 3GTMS 3CCL1 3CCS1 3S1RI 5IT9f 3I07A 3I561 2E2II 2M48A 5D1OA 1YI21 3BG0B 3I4MI 3VTNA 2DE6A 1KD12 1TWCI 4BXXI 3Q87A 3G6EZ 5AN9F 1VLAA 1NJI2 3PO3S 2YADA 2QREB 3K7AI 1M902 3GTJI 3FQQA 2QKDA 5IP9I 3MZKB 2PMZA 2GU2A 1QF8A 1Y1VI 3I56Z 1S72Z 3TDHB 3NFZA 1YI2Z 4E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Z;  1YIJ Z;  3CCJ Z;  1K73 2;  1VQP Z;  1KQS Z;  2OTL 1;  1YJ9 Z;  2OTJ Z;  1M1K 2;  3CC4 1;  1VQO 1;  1VQ7 Z;  3CCR Z;  1Q86 2;  1Q7Y 1;  1W2B Y;  1YIT 1;  3G4S Z;  3CMA 1;  3CCU Z;  3CCS Z;  3CCL Z;  1YJN 1;  1VQK Z;  1K8A 1;  1W2B Z;  1Q81 1;  3CCV Z;  1KD1 1;  1VQM 1;  1KC8 1;  3G6E 1;  1NJI 1;  1VQ4 1;  2QA4 1;  3OW2 Y;  1VQO Z;  1YHQ Z;  3CME 1;  1Q82 2;  3CMA Z;  1VQ5 1;  3G71 1;  1VQL 1;  1VQ9 Z;  3CCQ Z;  1VQ8 1;  3OW2 Z;  1S72 1;  1YJN Z;  3CCE 1;  3CD6 1;  1Q81 2;  1N8R 2;  2QEX 1;  1YJW Z;  1YIJ 1;  3I55 1;  1JJ2 Y;  1K73 1;  1Q86 1;  1VQ4 Z;  1K9M 1;  2QA4 Z;  2OTL Z;  3G4S 1;  1M90 1;  3CC4 Z;  1JJ2 Z;  3CC2 1;  1QVG Y;  3CC7 1;  1Q7Y 2;  1YIT Z;  3CCL 1;  3CCS 1;  1VQ5 Z;  1VQN 1;  3G71 Z;  1VQL Z;  1VQK 1;  1QVF Y;  3I56 1;  3CCV 1;  1YI2 1;  3CXC Y;  1QVG Z;  1K8A 2;  3CCM 1;  1VQ6 1;  2QEX Z;  1QVF Z;  1KD1 2;  3I55 Z;  1VQM Z;  3CCJ 1;  1KC8 2;  1VQP 1;  3G6E Z;  1YJ9 1;  1M1K 1;  3CXC Z;  3CPW Y;  2OTJ 1;  1NJI 2;  1VQ7 1;  1YHQ 1;  1Q82 1;  3CCR 1;  1K9M 2;  1M90 2;  3CC2 Z;  3CME Z;  1VQ9 1;  3CCQ 1;  3CC7 Z;  3CPW Z;  3CCU 1;  1VQN Z;  3I56 Z;  1VQ8 Z;  1N8R 1;  1S72 Z;  1KQS Y;  1YJW 1;  3CCE Z;  1YI2 Z;  3CCM Z;  3CD6 Z; 
#chains in the Genus database with same CATH topology
 4BBR I;  2KI7 B;  3S1Q I;  5C4J I;  2HF1 A;  1YUA A;  4RVD A;  1K73 2;  1LQL A;  4MON A;  4NBA A;  2P28 A;  2H85 A;  1Q86 2;  2R93 I;  1W2B Y;  3NH5 A;  1YIT 1;  3IF8 A;  3G4S Z;  2W03 A;  1L1O C;  4RV9 A;  4DK1 A;  3JAM b;  1YJN 1;  1W2B Z;  3CCV Z;  1WII A;  2QRD B;  2V8I A;  1KD1 1;  1N2F A;  2JIQ A;  4A3J I;  1Z02 A;  2BJO A;  1NJI 1;  1TWH I;  1K83 I;  4MD8 A;  2V45 A;  3VB9 A;  1RO4 A;  1Y1W I;  2K3R A;  3EED A;  3VMH A;  2J6A A;  3S15 I;  3GTL I;  3PO3 I;  1ZB9 A;  3HKZ A;  2EGT A;  3JAM f;  1VQ8 1;  1YJN Z;  2PM9 A;  4A3K I;  3CCE 1;  1DL6 A;  3CD6 1;  2NVT I;  3D9X A;  1YUK A;  1X3W A;  1JJ2 Y;  3VMG A;  1K73 1;  3S17 I;  1Q86 1;  2JIR A;  2OTL Z;  2JA6 I;  4CL1 A;  4NBE A;  4EWC A;  1JJ2 Z;  3I4N I;  4Y52 I;  2M6N A;  1QVG Y;  1Y1V S;  3S1M I;  3GTP I;  4NB8 A;  2O53 A;  4E30 A;  3RZD I;  4MXU A;  2LEX A;  3HOV I;  1QVG Z;  3H0G I;  1VQ6 1;  2O4H A;  2JIP A;  3GTO I;  1SFO I;  2QRC B;  3CCJ 1;  2W04 A;  4NBG A;  5IP7 I;  1YJ9 1;  3EER A;  1WJ2 A;  3MZL B;  3KIF A;  2HU9 A;  3CME Z;  4RS4 A;  4XX2 A;  2RPR A;  1SIW A;  1ZB8 A;  4A3M I;  1Y8C A;  1YJW 1;  1VQ6 Z;  2JMO A;  2KPI A;  3KIH A;  2VPX A;  2JUB A;  2VUM I;  1Z01 A;  1YIJ Z;  3CCJ Z;  4Y7N I;  2NAP A;  3S2D I;  5FLM I;  1YJ9 Z;  1M1K 2;  3CC4 1;  1VQO 1;  2OOY B;  3CMA 1;  3RZO I;  4MD7 A;  2V8J A;  5D1P A;  3GTK I;  3M3Y I;  3CCS Z;  3CCL Z;  3H3V J;  3PO2 I;  4NOZ A;  3FQM A;  4HGY A;  3HOU I;  3J80 b;  1Q81 1;  2V8K A;  2IV2 X;  2JS4 A;  1VQM 1;  4NBB A;  2AYD A;  3HOZ I;  1FDO A;  1VQO Z;  5T64 A;  4TNU A;  4E2X A;  3GTG I;  3CMA Z;  3F3F C;  2B63 I;  4BY7 I;  4A3G I;  2IZ4 A;  3G71 1;  1VQL 1;  4MD9 A;  3U50 C;  3J80 f;  2YU9 I;  1N8R 2;  5CM2 M;  2QEX 1;  2VF1 A;  3GCF A;  4NFR A;  2OOX B;  3MON A;  1M90 1;  4E2Y A;  3CC2 1;  3ESW A;  1NP6 A;  1YIT Z;  3GKQ A;  2JA5 I;  2LIY A;  4A3E I;  3G71 Z;  1VQL Z;  1VQN 1;  1VQK 1;  4NB9 A;  1QVF Y;  4NBF A;  1USP B;  5A2Q b;  2AKL A;  2NVX I;  1TWA I;  2QEX Z;  1WW9 A;  1QVF Z;  1KC8 2;  1VQP 1;  3CPW Y;  1VQ7 1;  1YHQ 1;  2G2K A;  4MH4 A;  3CCR 1;  1K9M 2;  2JNY A;  2VPW A;  3J81 b;  3CC2 Z;  2V3V A;  5D1O B;  1I6H I;  2K5R A;  1VQ9 1;  3CCQ 1;  1RQF A;  4RVG A;  2NVQ I;  3CPW Z;  3CCU 1;  4QTU A;  1VQN Z;  3TE5 B;  5A2Q f;  5C3E I;  4DQY B;  1VQ8 Z;  1QXF A;  1N8R 1;  1S7M A;  1KQS Y;  3CCE Z;  2WB1 A;  3CD6 Z;  3M4O I;  1X3Z A;  2RIQ A;  2WAQ A;  3S2H I;  1VQP Z;  1KQS Z;  3NH8 A;  3J7A 4;  4NBH A;  1VQ7 Z;  1RNI A;  3CCR Z;  3J81 f;  2VUG A;  3IR7 A;  3D6W A;  5LL6 f;  5C44 I;  4RVH A;  2E2H I;  4E2W A;  3CCU Z;  1TWG I;  1KRL A;  1NUI A;  4HGZ A;  2JR6 A;  4A3I I;  4BBS I;  3D2L A;  2JIM A;  1KC8 1;  2LFU A;  3G6E 1;  4NBC A;  3CQZ I;  2DE5 A;  2JA8 I;  1Q82 2;  1PFT A;  1VQ5 1;  3P5J B;  4X6A I;  2E2J I;  2OZK A;  1S72 1;  2I3C A;  3VMI A;  4A93 I;  3NDJ A;  5FLX b;  1YJW Z;  4A3C I;  2P3Y A;  2NVY I;  1ZH1 A;  3I55 1;  3BG1 B;  2E7Z A;  2RT9 A;  2DE7 A;  2Y0S A;  2JA7 I;  2GTI A;  3T4N B;  3G4S 1;  3CC4 Z;  2R92 I;  3HOY I;  3CC7 1;  1Q7Y 2;  3IFU A;  4A3D I;  1VQ5 Z;  1I50 I;  3NH4 A;  4A3F I;  3CCV 1;  3GTQ I;  5FLX f;  2F4M A;  3CXC Y;  2F4O A;  1K8A 2;  3CCM 1;  1AA6 A;  4NBD A;  1TWF I;  3I55 Z;  1VQM Z;  2QR1 B;  1M1K 1;  3CXC Z;  4HH4 A;  2OTJ 1;  2VPZ A;  1QYP A;  2Q4Z A;  1Q82 1;  1FDI A;  4NH1 C;  4S1T A;  4DGL A;  3CC7 Z;  2IZ3 A;  2RBL A;  3GTM I;  1Q16 A;  4RVF A;  2ZAE B;  3CCM Z;  3HOW I;  3S16 I;  4MRI A;  2OTL 1;  2OTJ Z;  1WZN A;  4AYB A;  3IX0 A;  1Q7Y 1;  2Q51 A;  1I3Q I;  4QTT A;  4E33 A;  2R7Z I;  3S1N I;  1VQK Z;  1K8A 1;  2GTH A;  1P9N A;  1JWH C;  1Z03 A;  1R9T I;  2RHB A;  3LUS A;  2E9H A;  3HOX I;  2QLV B;  3NDI A;  4E31 A;  4E2Z A;  1X0T A;  1VQ4 1;  2QA4 1;  1ML8 A;  1RO2 A;  3OW2 Y;  1YHQ Z;  3CME 1;  1TFI A;  5C4X I;  2VPY A;  1VQ9 Z;  3CCQ Z;  3OW2 Z;  5IT9 b;  4A3B I;  3F3P C;  1RO0 A;  1Q81 2;  1RLY A;  4BY1 I;  1YIJ 1;  1USP A;  3S14 I;  3FKI I;  1WCM I;  5T67 A;  2PK7 A;  2R6M A;  1VQ4 Z;  1K9M 1;  2QA4 Z;  5T6B A;  3QWU A;  4A3L I;  2JIO A;  3GTM S;  3CCL 1;  3CCS 1;  3S1R I;  5IT9 f;  3I07 A;  3I56 1;  2E2I I;  2M48 A;  5D1O A;  1YI2 1;  3BG0 B;  3I4M I;  3VTN A;  2DE6 A;  1KD1 2;  1TWC I;  4BXX I;  3Q87 A;  3G6E Z;  5AN9 F;  1VLA A;  1NJI 2;  3PO3 S;  2YAD A;  2QRE B;  3K7A I;  1M90 2;  3GTJ I;  3FQQ A;  2QKD A;  5IP9 I;  3MZK B;  2PMZ A;  2GU2 A;  1QF8 A;  1Y1V I;  3I56 Z;  1S72 Z;  3TDH B;  3NFZ A;  1YI2 Z;  4E32 A; 
#chains in the Genus database with same CATH homology
 4BBR I;  2KI7 B;  3S1Q I;  5C4J I;  2HF1 A;  1YUA A;  4RVD A;  1K73 2;  1LQL A;  4MON A;  4NBA A;  2P28 A;  2H85 A;  1Q86 2;  2R93 I;  1W2B Y;  3NH5 A;  1YIT 1;  3IF8 A;  3G4S Z;  2W03 A;  1L1O C;  4RV9 A;  4DK1 A;  3JAM b;  1YJN 1;  1W2B Z;  3CCV Z;  1WII A;  2QRD B;  2V8I A;  1KD1 1;  1N2F A;  4A3J I;  1Z02 A;  2BJO A;  1NJI 1;  1TWH I;  1K83 I;  4MD8 A;  3VB9 A;  1RO4 A;  1Y1W I;  2K3R A;  3EED A;  3VMH A;  2J6A A;  3S15 I;  3GTL I;  3PO3 I;  1ZB9 A;  3HKZ A;  2EGT A;  3JAM f;  1VQ8 1;  1YJN Z;  2PM9 A;  4A3K I;  3CCE 1;  1DL6 A;  3CD6 1;  2NVT I;  3D9X A;  1YUK A;  1X3W A;  1JJ2 Y;  3VMG A;  1K73 1;  3S17 I;  1Q86 1;  2OTL Z;  2JA6 I;  4CL1 A;  4NBE A;  4EWC A;  1JJ2 Z;  3I4N I;  4Y52 I;  2M6N A;  1QVG Y;  1Y1V S;  3S1M I;  3GTP I;  4NB8 A;  2O53 A;  4E30 A;  3RZD I;  4MXU A;  3HOV I;  1QVG Z;  3H0G I;  1VQ6 1;  2O4H A;  3GTO I;  1SFO I;  2QRC B;  3CCJ 1;  2W04 A;  4NBG A;  5IP7 I;  1YJ9 1;  3EER A;  3MZL B;  3KIF A;  2HU9 A;  3CME Z;  4RS4 A;  4XX2 A;  2RPR A;  1ZB8 A;  4A3M I;  1YJW 1;  1VQ6 Z;  2JMO A;  2KPI A;  3KIH A;  2JUB A;  2VUM I;  1Z01 A;  1YIJ Z;  3CCJ Z;  4Y7N I;  3S2D I;  5FLM I;  1YJ9 Z;  1M1K 2;  3CC4 1;  1VQO 1;  2OOY B;  3CMA 1;  3RZO I;  4MD7 A;  2V8J A;  5D1P A;  3GTK I;  3M3Y I;  3CCS Z;  3CCL Z;  3H3V J;  3PO2 I;  4NOZ A;  3FQM A;  4HGY A;  3HOU I;  3J80 b;  1Q81 1;  2V8K A;  2JS4 A;  1VQM 1;  4NBB A;  3HOZ I;  1VQO Z;  5T64 A;  4TNU A;  4E2X A;  3GTG I;  3CMA Z;  3F3F C;  2B63 I;  4BY7 I;  4A3G I;  2IZ4 A;  3G71 1;  1VQL 1;  4MD9 A;  3U50 C;  3J80 f;  2YU9 I;  1N8R 2;  5CM2 M;  2QEX 1;  2VF1 A;  3GCF A;  4NFR A;  2OOX B;  3MON A;  1M90 1;  4E2Y A;  3CC2 1;  3ESW A;  1NP6 A;  1YIT Z;  3GKQ A;  2JA5 I;  2LIY A;  4A3E I;  3G71 Z;  1VQL Z;  1VQN 1;  1VQK 1;  4NB9 A;  1QVF Y;  4NBF A;  1USP B;  5A2Q b;  2AKL A;  2NVX I;  1TWA I;  2QEX Z;  1WW9 A;  1QVF Z;  1KC8 2;  1VQP 1;  3CPW Y;  1VQ7 1;  1YHQ 1;  2G2K A;  4MH4 A;  3CCR 1;  1K9M 2;  2JNY A;  3J81 b;  3CC2 Z;  5D1O B;  1I6H I;  2K5R A;  1VQ9 1;  3CCQ 1;  1RQF A;  4RVG A;  2NVQ I;  3CPW Z;  3CCU 1;  4QTU A;  1VQN Z;  3TE5 B;  5A2Q f;  5C3E I;  4DQY B;  1VQ8 Z;  1N8R 1;  1S7M A;  1KQS Y;  3CCE Z;  2WB1 A;  3CD6 Z;  3M4O I;  1X3Z A;  2RIQ A;  2WAQ A;  3S2H I;  1VQP Z;  1KQS Z;  3NH8 A;  3J7A 4;  4NBH A;  1VQ7 Z;  1RNI A;  3CCR Z;  3J81 f;  2VUG A;  3D6W A;  5LL6 f;  5C44 I;  4RVH A;  2E2H I;  4E2W A;  3CCU Z;  1TWG I;  1KRL A;  1NUI A;  4HGZ A;  2JR6 A;  4A3I I;  4BBS I;  1KC8 1;  2LFU A;  3G6E 1;  4NBC A;  3CQZ I;  2DE5 A;  2JA8 I;  1Q82 2;  1PFT A;  1VQ5 1;  3P5J B;  4X6A I;  2E2J I;  2OZK A;  1S72 1;  2I3C A;  3VMI A;  4A93 I;  3NDJ A;  5FLX b;  1YJW Z;  4A3C I;  2P3Y A;  2NVY I;  1ZH1 A;  3I55 1;  3BG1 B;  2RT9 A;  2DE7 A;  2Y0S A;  2JA7 I;  2GTI A;  3T4N B;  3G4S 1;  3CC4 Z;  2R92 I;  3HOY I;  3CC7 1;  1Q7Y 2;  3IFU A;  4A3D I;  1VQ5 Z;  1I50 I;  3NH4 A;  4A3F I;  3CCV 1;  3GTQ I;  5FLX f;  2F4M A;  3CXC Y;  2F4O A;  1K8A 2;  3CCM 1;  4NBD A;  1TWF I;  3I55 Z;  1VQM Z;  2QR1 B;  1M1K 1;  3CXC Z;  4HH4 A;  2OTJ 1;  1QYP A;  2Q4Z A;  1Q82 1;  4NH1 C;  4S1T A;  4DGL A;  3CC7 Z;  2IZ3 A;  2RBL A;  3GTM I;  4RVF A;  2ZAE B;  3CCM Z;  3HOW I;  3S16 I;  4MRI A;  2OTL 1;  2OTJ Z;  4AYB A;  3IX0 A;  1Q7Y 1;  2Q51 A;  1I3Q I;  4QTT A;  4E33 A;  2R7Z I;  3S1N I;  1VQK Z;  1K8A 1;  2GTH A;  1P9N A;  1JWH C;  1Z03 A;  1R9T I;  2RHB A;  3LUS A;  2E9H A;  3HOX I;  2QLV B;  3NDI A;  4E31 A;  4E2Z A;  1X0T A;  1VQ4 1;  2QA4 1;  1ML8 A;  1RO2 A;  3OW2 Y;  1YHQ Z;  3CME 1;  1TFI A;  5C4X I;  1VQ9 Z;  3CCQ Z;  3OW2 Z;  5IT9 b;  4A3B I;  3F3P C;  1RO0 A;  1Q81 2;  1RLY A;  4BY1 I;  1YIJ 1;  1USP A;  3S14 I;  3FKI I;  1WCM I;  5T67 A;  2PK7 A;  2R6M A;  1VQ4 Z;  1K9M 1;  2QA4 Z;  5T6B A;  3QWU A;  4A3L I;  3GTM S;  3CCL 1;  3CCS 1;  3S1R I;  5IT9 f;  3I07 A;  3I56 1;  2E2I I;  2M48 A;  5D1O A;  1YI2 1;  3BG0 B;  3I4M I;  3VTN A;  2DE6 A;  1KD1 2;  1TWC I;  4BXX I;  3Q87 A;  3G6E Z;  5AN9 F;  1VLA A;  1NJI 2;  3PO3 S;  2YAD A;  2QRE B;  3K7A I;  1M90 2;  3GTJ I;  3FQQ A;  2QKD A;  5IP9 I;  3MZK B;  2PMZ A;  2GU2 A;  1QF8 A;  1Y1V I;  3I56 Z;  1S72 Z;  3TDH B;  3NFZ A;  1YI2 Z;  4E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...