1VQK1

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqk100
1YJ91 2QEX1 2OTJ1 3CCQ1 3G6E1 1K9M1 3OW2Y 1KQSZ 1VQO1 1YJW1 1W2BY 3CCUZ 1NJI1 3CCL1 1Q811 1K8A2 3G71Z 3CC7Z 1VQ8Z 1K732 1VQ7Z 1VQKZ 2OTLZ 1Q822 1QVGZ 3I56Z 1Q7Y1 3CCU1 1KD11 1QVFZ 1M901 1VQLZ 3G711 3CC71 1VQ81 1VQ9Z 1N8R2 1VQ71 3CCVZ 3CD6Z 1M1K1 1VQK1 1Q861 2OTL1 1JJ2Y 3CCJZ 3I561 3CXCZ 1KC81 1VQPZ 1VQ4Z 1VQL1 3CC4Z 3OW2Z 1VQ6Z 1VQ91 1KD12 3CCSZ 3CCV1 3CD61 3G4SZ 1M902 1YJNZ 1K9M2 1VQNZ 3I55Z 3CCJ1 2QA4Z 1YIJZ 1VQMZ 1VQP1 1Q862 1NJI2 3CPWZ 1VQ41 1Q812 3CC41 1VQ61 1YI2Z 3CCS1 1S72Z 3G4S1 3CCEZ 1QVFY 1YJN1 3CC2Z 1VQN1 1K8A1 3I551 2QA41 1YIJ1 3CCRZ 3CMEZ 1KQSY 1VQM1 1Q7Y2 1YHQZ 1YITZ 1K731 1W2BZ 1YI21 1JJ2Z 3CXCY 1S721 1Q821 3CMAZ 3CCE1 3CCMZ 3CC21 1VQ5Z 1M1K2 3CCR1 3CME1 1YJ9Z 1YHQ1 1YIT1 1N8R1 1QVGY 1KC82 2QEXZ 2OTJZ 3CCQZ 3G6EZ 3CMA1 3CCM1 3CPWY 1VQOZ 1YJWZ 1VQ51 3CCLZ
chains in the Genus database with same CATH superfamily
3GTOI 2RT9A 4A3KI 4A3MI 3HOXI 1ZH1A 5FLMI 1VQO1 2VUGA 2VPZA 3JAMf 4Y52I 2OOXB 3CCUZ 1NJI1 4MD7A 3NDJA 4E32A 1WZNA 1VQKZ 2HF1A 3GTKI 1R9TI 1Q7Y1 4RV9A 2P3YA 2JIRA 3FQMA 2E2II 4MD9A 3K7AI 4Y7NI 3S2DI 1P9NA 3TE5B 3S1NI 1JJ2Y 4A3FI 3MZLB 1RO4A 2PMZA 5D1OB 5C44I 2VUMI 3CC4Z 3J81f 1VQ6Z 4RS4A 2V8JA 5D1OA 1KD12 3CD61 3S14I 2NAPA 1RLYA 4A93I 3EERA 1YJNZ 3HOZI 4A3II 1YIJZ 2QLVB 5FLXb 1VQMZ 1Q862 3Q87A 3CPWZ 3NH5A 1Q812 4NBGA 3NH4A 1S72Z 3G4S1 3CCEZ 3FQQA 3VMIA 2LIYA 3S2HI 2QA41 1KQSY 4E2YA 1YITZ 5AN9F 4A3GI 1YI21 5C4JI 4RVFA 3QWUA 2W04A 5C4XI 1PFTA 2LFUA 3D6WA 1USPB 3RZOI 1KC82 1RNIA 3U50C 2JA5I 3CCQZ 1WIIA 3G6EZ 3P5JB 3IF8A 1ZB8A 1ZB9A 3D9XA 3CPWY 2IZ4A 3J7A4 1Z01A 4HH4A 3VMHA 1YJWZ 2B63I 2JIQA 2VPWA 1YJ91 5IP7I 2E9HA 1TFIA 1JWHC 1QXFA 3GTMI 4A3DI 2OOYB 3OW2Y 2E2HI 2RPRA 2Y0SA 3CCL1 1Q811 1TWFI 2K3RA 2O4HA 1Y8CA 1L1OC 3G71Z 3CC7Z 1VQ8Z 1K732 1TWAI 1VQ7Z 2PM9A 2QKDA 3VMGA 3NDIA 2W03A 3BG1B 2NVQI 1RO0A 2OTLZ 3GTMS 3I56Z 2PK7A 3CCU1 1QVFZ 1VQLZ 4S1TA 3EEDA 1VQ9Z 4E2XA 2H85A 4BBRI 2VPXA 5A2Qb 2NVYI 1VQK1 4XX2A 4NBBA 2NVTI 3CCJZ 3S1MI 4TNUA 3S17I 1KC81 1VQPZ 1VQ4Z 1Y1WI 3VB9A 1I3QI 2JA7I 5CM2M 1M902 1I6HI 1I50I 5IP9I 1K9M2 4BBSI 1X0TA 4NBCA 5IT9f 4RVDA 2QRDB 4DQYB 3CC41 1Z02A 1VQ61 3MONA 2G2KA 2J6AA 3J80b 3IR7A 1Y1VI 1QVFY 1YJN1 3CC2Z 1YIJ1 3CCRZ 3CMEZ 4NB8A 3I07A 1VQM1 1TWGI 1YHQZ 1K731 4MXUA 2HU9A 1K83I 3HOWI 5C3EI 1S721 4NBEA 1RQFA 3CCE1 4A3JI 3CCMZ 3GCFA 2R93I 4AYBA 3KIFA 1Y1VS 3VTNA 2K5RA 3GTLI 2R7ZI 4E33A 1YIT1 2WB1A 3GTPI 2QEXZ 4DK1A 2V45A 2OTJZ 2JIMA 4NFRA 2O53A 3S15I 1SFOI 4QTTA 4E2ZA 3M3YI 3PO2I 1DL6A 2AYDA 2DE7A 2M48A 3IX0A 4BY7I 4NB9A 2VF1A 3CCQ1 3G6E1 1K9M1 2E2JI 3HOVI 2R92I 1X3WA 3GKQA 1YJW1 2YADA 3BG0B 3JAMb 2M6NA 5T6BA 4A3CI 2E7ZA 4MRIA 4MD8A 2GTIA 2JIOA 2P28A 5T64A 2QR1B 3KIHA 1Q822 1QVGZ 3LUSA 1KD11 4RVHA 3G711 3CC71 1VQ81 1VQ71 3D2LA 4NBHA 3CCVZ 1Q861 2OTL1 4NOZA 2GTHA 3I561 3MZKB 3CXCZ 2JNYA 4EWCA 1VQL1 1VQ91 2VPYA 2JMOA 2V3VA 3J81b 3CCSZ 2KI7B 4MH4A 1VQNZ 5FLXf 3I55Z 3CCJ1 1VQP1 2RHBA 1VQ41 4A3BI 3S16I 2V8KA 1YUAA 4E2WA 2WAQA 2EGTA 3ESWA 4NBFA 2ZAEB 1W2BZ 1JJ2Z 3CXCY 1Q821 3CMAZ 3H3VJ 4DGLA 3CC21 1Z03A 1M1K2 2LEXA 1VQ5Z 3PO3I 3CCR1 3CME1 2I3CA 3NH8A 1YHQ1 3TDHB 1LQLA 1S7MA 2JA6I 1NUIA 3RZDI 3T4NB 3CCM1 3F3FC 1VQOZ 5D1PA 1AA6A 3F3PC 2R6MA 3PO3S 3I4MI 4NH1C 1ML8A 2QEX1 2OTJ1 1KRLA 3CQZI 1FDIA 3I4NI 4CL1A 1KQSZ 2QRCB 1W2BY 2RIQA 1TWCI 1QF8A 1K8A2 3NFZA 4A3EI 4RVGA 1Q16A 2IZ3A 1NP6A 3FKII 2NVXI 2JR6A 3H0GI 2Q51A 2JIPA 1M901 4BY1I 2RBLA 1N8R2 2JS4A 5A2Qf 3CD6Z 3S1QI 1M1K1 2QREB 1YUKA 4HGYA 3HOUI 4X6AI 3HOYI 1WCMI 2F4MA 2KPIA 5LL6f 4BXXI 4HGZA 3OW2Z 3CCV1 3G4SZ 4A3LI 3GTJI 2DE5A 2GU2A 1SIWA 2QA4Z 2AKLA 3GTQI 2V8IA 2JA8I 2IV2X 3GTGI 5IT9b 1NJI2 2Q4ZA 3J80f 3HKZA 1TWHI 2JUBA 1YI2Z 1VLAA 2BJOA 3CCS1 1QYPA 5T67A 1USPA 1FDOA 2OZKA 1X3ZA 1VQN1 1K8A1 1RO2A 3I551 3IFUA 1Q7Y2 4E30A 4QTUA 4NBAA 4E31A 1YJ9Z 1N8R1 1QVGY 4MONA 2F4OA 1N2FA 2DE6A 1WJ2A 3CMA1 2YU9I 1VQ51 1WW9A 4NBDA 3CCLZ 3S1RI 3M4OI
chains in the Genus database with same CATH topology
3GTOI 2RT9A 4A3KI 4A3MI 3HOXI 1ZH1A 5FLMI 1VQO1 2VUGA 3JAMf 4Y52I 2OOXB 3CCUZ 1NJI1 4MD7A 3NDJA 4E32A 1VQKZ 2HF1A 3GTKI 1R9TI 1Q7Y1 4RV9A 2P3YA 3FQMA 2E2II 4MD9A 3K7AI 4Y7NI 3S2DI 1P9NA 3TE5B 3S1NI 1JJ2Y 4A3FI 3MZLB 1RO4A 2PMZA 5D1OB 5C44I 2VUMI 3CC4Z 3J81f 1VQ6Z 4RS4A 2V8JA 5D1OA 1KD12 3CD61 3S14I 1RLYA 4A93I 3EERA 1YJNZ 3HOZI 4A3II 1YIJZ 2QLVB 5FLXb 1VQMZ 1Q862 3Q87A 3CPWZ 3NH5A 1Q812 4NBGA 3NH4A 1S72Z 3G4S1 3CCEZ 3FQQA 3VMIA 2LIYA 3S2HI 2QA41 1KQSY 4E2YA 1YITZ 5AN9F 4A3GI 1YI21 5C4JI 4RVFA 3QWUA 2W04A 5C4XI 1PFTA 2LFUA 3D6WA 1USPB 3RZOI 1KC82 1RNIA 3U50C 2JA5I 3CCQZ 1WIIA 3G6EZ 3P5JB 3IF8A 1ZB8A 1ZB9A 3D9XA 3CPWY 2IZ4A 3J7A4 1Z01A 4HH4A 3VMHA 1YJWZ 2B63I 1YJ91 5IP7I 2E9HA 1TFIA 1JWHC 3GTMI 4A3DI 2OOYB 3OW2Y 2E2HI 2RPRA 2Y0SA 3CCL1 1Q811 1TWFI 2K3RA 2O4HA 1L1OC 3G71Z 3CC7Z 1VQ8Z 1K732 1TWAI 1VQ7Z 2PM9A 2QKDA 3VMGA 3NDIA 2W03A 3BG1B 2NVQI 1RO0A 2OTLZ 3GTMS 3I56Z 2PK7A 3CCU1 1QVFZ 1VQLZ 4S1TA 3EEDA 1VQ9Z 4E2XA 2H85A 4BBRI 5A2Qb 2NVYI 1VQK1 4XX2A 4NBBA 2NVTI 3CCJZ 3S1MI 4TNUA 3S17I 1KC81 1VQPZ 1VQ4Z 1Y1WI 3VB9A 1I3QI 2JA7I 5CM2M 1M902 1I6HI 1I50I 5IP9I 1K9M2 4BBSI 1X0TA 4NBCA 5IT9f 4RVDA 2QRDB 4DQYB 3CC41 1Z02A 1VQ61 3MONA 2G2KA 2J6AA 3J80b 1Y1VI 1QVFY 1YJN1 3CC2Z 1YIJ1 3CCRZ 3CMEZ 4NB8A 3I07A 1VQM1 1TWGI 1YHQZ 1K731 4MXUA 2HU9A 1K83I 3HOWI 5C3EI 1S721 4NBEA 1RQFA 3CCE1 4A3JI 3CCMZ 3GCFA 2R93I 4AYBA 3KIFA 1Y1VS 3VTNA 2K5RA 3GTLI 2R7ZI 4E33A 1YIT1 2WB1A 3GTPI 2QEXZ 4DK1A 2OTJZ 4NFRA 2O53A 3S15I 1SFOI 4QTTA 4E2ZA 3M3YI 3PO2I 1DL6A 2DE7A 2M48A 3IX0A 4BY7I 4NB9A 2VF1A 3CCQ1 3G6E1 1K9M1 2E2JI 3HOVI 2R92I 1X3WA 3GKQA 1YJW1 2YADA 3BG0B 3JAMb 2M6NA 5T6BA 4A3CI 4MRIA 4MD8A 2GTIA 2P28A 5T64A 2QR1B 3KIHA 1Q822 1QVGZ 3LUSA 1KD11 4RVHA 3G711 3CC71 1VQ81 1VQ71 4NBHA 3CCVZ 1Q861 2OTL1 4NOZA 2GTHA 3I561 3MZKB 3CXCZ 2JNYA 4EWCA 1VQL1 1VQ91 2JMOA 3J81b 3CCSZ 2KI7B 4MH4A 1VQNZ 5FLXf 3I55Z 3CCJ1 1VQP1 2RHBA 1VQ41 4A3BI 3S16I 2V8KA 1YUAA 4E2WA 2WAQA 2EGTA 3ESWA 4NBFA 2ZAEB 1W2BZ 1JJ2Z 3CXCY 1Q821 3CMAZ 3H3VJ 4DGLA 3CC21 1Z03A 1M1K2 1VQ5Z 3PO3I 3CCR1 3CME1 2I3CA 3NH8A 1YHQ1 3TDHB 1LQLA 1S7MA 2JA6I 1NUIA 3RZDI 3T4NB 3CCM1 3F3FC 1VQOZ 5D1PA 3F3PC 2R6MA 3PO3S 3I4MI 4NH1C 1ML8A 2QEX1 2OTJ1 1KRLA 3CQZI 3I4NI 4CL1A 1KQSZ 2QRCB 1W2BY 2RIQA 1TWCI 1QF8A 1K8A2 3NFZA 4A3EI 4RVGA 2IZ3A 1NP6A 3FKII 2NVXI 2JR6A 3H0GI 2Q51A 1M901 4BY1I 2RBLA 1N8R2 2JS4A 5A2Qf 3CD6Z 3S1QI 1M1K1 2QREB 1YUKA 4HGYA 3HOUI 4X6AI 3HOYI 1WCMI 2KPIA 2F4MA 5LL6f 4BXXI 4HGZA 3OW2Z 3CCV1 3G4SZ 4A3LI 3GTJI 2DE5A 2GU2A 2QA4Z 2AKLA 3GTQI 2V8IA 2JA8I 3GTGI 5IT9b 1NJI2 2Q4ZA 3J80f 3HKZA 1TWHI 2JUBA 1YI2Z 1VLAA 2BJOA 3CCS1 1QYPA 5T67A 1USPA 2OZKA 1X3ZA 1VQN1 1K8A1 1RO2A 3I551 3IFUA 1Q7Y2 4E30A 4QTUA 4NBAA 4E31A 1YJ9Z 1N8R1 1QVGY 4MONA 2F4OA 1N2FA 2DE6A 3CMA1 2YU9I 1VQ51 1WW9A 4NBDA 3CCLZ 3S1RI 3M4OI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 1;  2QEX 1;  2OTJ 1;  3CCQ 1;  3G6E 1;  1K9M 1;  3OW2 Y;  1KQS Z;  1VQO 1;  1YJW 1;  1W2B Y;  3CCU Z;  1NJI 1;  3CCL 1;  1Q81 1;  1K8A 2;  3G71 Z;  3CC7 Z;  1VQ8 Z;  1K73 2;  1VQ7 Z;  1VQK Z;  2OTL Z;  1Q82 2;  1QVG Z;  3I56 Z;  1Q7Y 1;  3CCU 1;  1KD1 1;  1QVF Z;  1M90 1;  1VQL Z;  3G71 1;  3CC7 1;  1VQ8 1;  1VQ9 Z;  1N8R 2;  1VQ7 1;  3CCV Z;  3CD6 Z;  1M1K 1;  1VQK 1;  1Q86 1;  2OTL 1;  1JJ2 Y;  3CCJ Z;  3I56 1;  3CXC Z;  1KC8 1;  1VQP Z;  1VQ4 Z;  1VQL 1;  3CC4 Z;  3OW2 Z;  1VQ6 Z;  1VQ9 1;  1KD1 2;  3CCS Z;  3CCV 1;  3CD6 1;  3G4S Z;  1M90 2;  1YJN Z;  1K9M 2;  1VQN Z;  3I55 Z;  3CCJ 1;  2QA4 Z;  1YIJ Z;  1VQM Z;  1VQP 1;  1Q86 2;  1NJI 2;  3CPW Z;  1VQ4 1;  1Q81 2;  3CC4 1;  1VQ6 1;  1YI2 Z;  3CCS 1;  1S72 Z;  3G4S 1;  3CCE Z;  1QVF Y;  1YJN 1;  3CC2 Z;  1VQN 1;  1K8A 1;  3I55 1;  2QA4 1;  1YIJ 1;  3CCR Z;  3CME Z;  1KQS Y;  1VQM 1;  1Q7Y 2;  1YHQ Z;  1YIT Z;  1K73 1;  1W2B Z;  1YI2 1;  1JJ2 Z;  3CXC Y;  1S72 1;  1Q82 1;  3CMA Z;  3CCE 1;  3CCM Z;  3CC2 1;  1VQ5 Z;  1M1K 2;  3CCR 1;  3CME 1;  1YJ9 Z;  1YHQ 1;  1YIT 1;  1N8R 1;  1QVG Y;  1KC8 2;  2QEX Z;  2OTJ Z;  3CCQ Z;  3G6E Z;  3CMA 1;  3CCM 1;  3CPW Y;  1VQO Z;  1YJW Z;  1VQ5 1;  3CCL Z; 
#chains in the Genus database with same CATH topology
 3GTO I;  2RT9 A;  4A3K I;  4A3M I;  3HOX I;  1ZH1 A;  5FLM I;  1VQO 1;  2VUG A;  2VPZ A;  3JAM f;  4Y52 I;  2OOX B;  3CCU Z;  1NJI 1;  4MD7 A;  3NDJ A;  4E32 A;  1WZN A;  1VQK Z;  2HF1 A;  3GTK I;  1R9T I;  1Q7Y 1;  4RV9 A;  2P3Y A;  2JIR A;  3FQM A;  2E2I I;  4MD9 A;  3K7A I;  4Y7N I;  3S2D I;  1P9N A;  3TE5 B;  3S1N I;  1JJ2 Y;  4A3F I;  3MZL B;  1RO4 A;  2PMZ A;  5D1O B;  5C44 I;  2VUM I;  3CC4 Z;  3J81 f;  1VQ6 Z;  4RS4 A;  2V8J A;  5D1O A;  1KD1 2;  3CD6 1;  3S14 I;  2NAP A;  1RLY A;  4A93 I;  3EER A;  1YJN Z;  3HOZ I;  4A3I I;  1YIJ Z;  2QLV B;  5FLX b;  1VQM Z;  1Q86 2;  3Q87 A;  3CPW Z;  3NH5 A;  1Q81 2;  4NBG A;  3NH4 A;  1S72 Z;  3G4S 1;  3CCE Z;  3FQQ A;  3VMI A;  2LIY A;  3S2H I;  2QA4 1;  1KQS Y;  4E2Y A;  1YIT Z;  5AN9 F;  4A3G I;  1YI2 1;  5C4J I;  4RVF A;  3QWU A;  2W04 A;  5C4X I;  1PFT A;  2LFU A;  3D6W A;  1USP B;  3RZO I;  1KC8 2;  1RNI A;  3U50 C;  2JA5 I;  3CCQ Z;  1WII A;  3G6E Z;  3P5J B;  3IF8 A;  1ZB8 A;  1ZB9 A;  3D9X A;  3CPW Y;  2IZ4 A;  3J7A 4;  1Z01 A;  4HH4 A;  3VMH A;  1YJW Z;  2B63 I;  2JIQ A;  2VPW A;  1YJ9 1;  5IP7 I;  2E9H A;  1TFI A;  1JWH C;  1QXF A;  3GTM I;  4A3D I;  2OOY B;  3OW2 Y;  2E2H I;  2RPR A;  2Y0S A;  3CCL 1;  1Q81 1;  1TWF I;  2K3R A;  2O4H A;  1Y8C A;  1L1O C;  3G71 Z;  3CC7 Z;  1VQ8 Z;  1K73 2;  1TWA I;  1VQ7 Z;  2PM9 A;  2QKD A;  3VMG A;  3NDI A;  2W03 A;  3BG1 B;  2NVQ I;  1RO0 A;  2OTL Z;  3GTM S;  3I56 Z;  2PK7 A;  3CCU 1;  1QVF Z;  1VQL Z;  4S1T A;  3EED A;  1VQ9 Z;  4E2X A;  2H85 A;  4BBR I;  2VPX A;  5A2Q b;  2NVY I;  1VQK 1;  4XX2 A;  4NBB A;  2NVT I;  3CCJ Z;  3S1M I;  4TNU A;  3S17 I;  1KC8 1;  1VQP Z;  1VQ4 Z;  1Y1W I;  3VB9 A;  1I3Q I;  2JA7 I;  5CM2 M;  1M90 2;  1I6H I;  1I50 I;  5IP9 I;  1K9M 2;  4BBS I;  1X0T A;  4NBC A;  5IT9 f;  4RVD A;  2QRD B;  4DQY B;  3CC4 1;  1Z02 A;  1VQ6 1;  3MON A;  2G2K A;  2J6A A;  3J80 b;  3IR7 A;  1Y1V I;  1QVF Y;  1YJN 1;  3CC2 Z;  1YIJ 1;  3CCR Z;  3CME Z;  4NB8 A;  3I07 A;  1VQM 1;  1TWG I;  1YHQ Z;  1K73 1;  4MXU A;  2HU9 A;  1K83 I;  3HOW I;  5C3E I;  1S72 1;  4NBE A;  1RQF A;  3CCE 1;  4A3J I;  3CCM Z;  3GCF A;  2R93 I;  4AYB A;  3KIF A;  1Y1V S;  3VTN A;  2K5R A;  3GTL I;  2R7Z I;  4E33 A;  1YIT 1;  2WB1 A;  3GTP I;  2QEX Z;  4DK1 A;  2V45 A;  2OTJ Z;  2JIM A;  4NFR A;  2O53 A;  3S15 I;  1SFO I;  4QTT A;  4E2Z A;  3M3Y I;  3PO2 I;  1DL6 A;  2AYD A;  2DE7 A;  2M48 A;  3IX0 A;  4BY7 I;  4NB9 A;  2VF1 A;  3CCQ 1;  3G6E 1;  1K9M 1;  2E2J I;  3HOV I;  2R92 I;  1X3W A;  3GKQ A;  1YJW 1;  2YAD A;  3BG0 B;  3JAM b;  2M6N A;  5T6B A;  4A3C I;  2E7Z A;  4MRI A;  4MD8 A;  2GTI A;  2JIO A;  2P28 A;  5T64 A;  2QR1 B;  3KIH A;  1Q82 2;  1QVG Z;  3LUS A;  1KD1 1;  4RVH A;  3G71 1;  3CC7 1;  1VQ8 1;  1VQ7 1;  3D2L A;  4NBH A;  3CCV Z;  1Q86 1;  2OTL 1;  4NOZ A;  2GTH A;  3I56 1;  3MZK B;  3CXC Z;  2JNY A;  4EWC A;  1VQL 1;  1VQ9 1;  2VPY A;  2JMO A;  2V3V A;  3J81 b;  3CCS Z;  2KI7 B;  4MH4 A;  1VQN Z;  5FLX f;  3I55 Z;  3CCJ 1;  1VQP 1;  2RHB A;  1VQ4 1;  4A3B I;  3S16 I;  2V8K A;  1YUA A;  4E2W A;  2WAQ A;  2EGT A;  3ESW A;  4NBF A;  2ZAE B;  1W2B Z;  1JJ2 Z;  3CXC Y;  1Q82 1;  3CMA Z;  3H3V J;  4DGL A;  3CC2 1;  1Z03 A;  1M1K 2;  2LEX A;  1VQ5 Z;  3PO3 I;  3CCR 1;  3CME 1;  2I3C A;  3NH8 A;  1YHQ 1;  3TDH B;  1LQL A;  1S7M A;  2JA6 I;  1NUI A;  3RZD I;  3T4N B;  3CCM 1;  3F3F C;  1VQO Z;  5D1P A;  1AA6 A;  3F3P C;  2R6M A;  3PO3 S;  3I4M I;  4NH1 C;  1ML8 A;  2QEX 1;  2OTJ 1;  1KRL A;  3CQZ I;  1FDI A;  3I4N I;  4CL1 A;  1KQS Z;  2QRC B;  1W2B Y;  2RIQ A;  1TWC I;  1QF8 A;  1K8A 2;  3NFZ A;  4A3E I;  4RVG A;  1Q16 A;  2IZ3 A;  1NP6 A;  3FKI I;  2NVX I;  2JR6 A;  3H0G I;  2Q51 A;  2JIP A;  1M90 1;  4BY1 I;  2RBL A;  1N8R 2;  2JS4 A;  5A2Q f;  3CD6 Z;  3S1Q I;  1M1K 1;  2QRE B;  1YUK A;  4HGY A;  3HOU I;  4X6A I;  3HOY I;  1WCM I;  2F4M A;  2KPI A;  5LL6 f;  4BXX I;  4HGZ A;  3OW2 Z;  3CCV 1;  3G4S Z;  4A3L I;  3GTJ I;  2DE5 A;  2GU2 A;  1SIW A;  2QA4 Z;  2AKL A;  3GTQ I;  2V8I A;  2JA8 I;  2IV2 X;  3GTG I;  5IT9 b;  1NJI 2;  2Q4Z A;  3J80 f;  3HKZ A;  1TWH I;  2JUB A;  1YI2 Z;  1VLA A;  2BJO A;  3CCS 1;  1QYP A;  5T67 A;  1USP A;  1FDO A;  2OZK A;  1X3Z A;  1VQN 1;  1K8A 1;  1RO2 A;  3I55 1;  3IFU A;  1Q7Y 2;  4E30 A;  4QTU A;  4NBA A;  4E31 A;  1YJ9 Z;  1N8R 1;  1QVG Y;  4MON A;  2F4O A;  1N2F A;  2DE6 A;  1WJ2 A;  3CMA 1;  2YU9 I;  1VQ5 1;  1WW9 A;  4NBD A;  3CCL Z;  3S1R I;  3M4O I; 
#chains in the Genus database with same CATH homology
 3GTO I;  2RT9 A;  4A3K I;  4A3M I;  3HOX I;  1ZH1 A;  5FLM I;  1VQO 1;  2VUG A;  3JAM f;  4Y52 I;  2OOX B;  3CCU Z;  1NJI 1;  4MD7 A;  3NDJ A;  4E32 A;  1VQK Z;  2HF1 A;  3GTK I;  1R9T I;  1Q7Y 1;  4RV9 A;  2P3Y A;  3FQM A;  2E2I I;  4MD9 A;  3K7A I;  4Y7N I;  3S2D I;  1P9N A;  3TE5 B;  3S1N I;  1JJ2 Y;  4A3F I;  3MZL B;  1RO4 A;  2PMZ A;  5D1O B;  5C44 I;  2VUM I;  3CC4 Z;  3J81 f;  1VQ6 Z;  4RS4 A;  2V8J A;  5D1O A;  1KD1 2;  3CD6 1;  3S14 I;  1RLY A;  4A93 I;  3EER A;  1YJN Z;  3HOZ I;  4A3I I;  1YIJ Z;  2QLV B;  5FLX b;  1VQM Z;  1Q86 2;  3Q87 A;  3CPW Z;  3NH5 A;  1Q81 2;  4NBG A;  3NH4 A;  1S72 Z;  3G4S 1;  3CCE Z;  3FQQ A;  3VMI A;  2LIY A;  3S2H I;  2QA4 1;  1KQS Y;  4E2Y A;  1YIT Z;  5AN9 F;  4A3G I;  1YI2 1;  5C4J I;  4RVF A;  3QWU A;  2W04 A;  5C4X I;  1PFT A;  2LFU A;  3D6W A;  1USP B;  3RZO I;  1KC8 2;  1RNI A;  3U50 C;  2JA5 I;  3CCQ Z;  1WII A;  3G6E Z;  3P5J B;  3IF8 A;  1ZB8 A;  1ZB9 A;  3D9X A;  3CPW Y;  2IZ4 A;  3J7A 4;  1Z01 A;  4HH4 A;  3VMH A;  1YJW Z;  2B63 I;  1YJ9 1;  5IP7 I;  2E9H A;  1TFI A;  1JWH C;  3GTM I;  4A3D I;  2OOY B;  3OW2 Y;  2E2H I;  2RPR A;  2Y0S A;  3CCL 1;  1Q81 1;  1TWF I;  2K3R A;  2O4H A;  1L1O C;  3G71 Z;  3CC7 Z;  1VQ8 Z;  1K73 2;  1TWA I;  1VQ7 Z;  2PM9 A;  2QKD A;  3VMG A;  3NDI A;  2W03 A;  3BG1 B;  2NVQ I;  1RO0 A;  2OTL Z;  3GTM S;  3I56 Z;  2PK7 A;  3CCU 1;  1QVF Z;  1VQL Z;  4S1T A;  3EED A;  1VQ9 Z;  4E2X A;  2H85 A;  4BBR I;  5A2Q b;  2NVY I;  1VQK 1;  4XX2 A;  4NBB A;  2NVT I;  3CCJ Z;  3S1M I;  4TNU A;  3S17 I;  1KC8 1;  1VQP Z;  1VQ4 Z;  1Y1W I;  3VB9 A;  1I3Q I;  2JA7 I;  5CM2 M;  1M90 2;  1I6H I;  1I50 I;  5IP9 I;  1K9M 2;  4BBS I;  1X0T A;  4NBC A;  5IT9 f;  4RVD A;  2QRD B;  4DQY B;  3CC4 1;  1Z02 A;  1VQ6 1;  3MON A;  2G2K A;  2J6A A;  3J80 b;  1Y1V I;  1QVF Y;  1YJN 1;  3CC2 Z;  1YIJ 1;  3CCR Z;  3CME Z;  4NB8 A;  3I07 A;  1VQM 1;  1TWG I;  1YHQ Z;  1K73 1;  4MXU A;  2HU9 A;  1K83 I;  3HOW I;  5C3E I;  1S72 1;  4NBE A;  1RQF A;  3CCE 1;  4A3J I;  3CCM Z;  3GCF A;  2R93 I;  4AYB A;  3KIF A;  1Y1V S;  3VTN A;  2K5R A;  3GTL I;  2R7Z I;  4E33 A;  1YIT 1;  2WB1 A;  3GTP I;  2QEX Z;  4DK1 A;  2OTJ Z;  4NFR A;  2O53 A;  3S15 I;  1SFO I;  4QTT A;  4E2Z A;  3M3Y I;  3PO2 I;  1DL6 A;  2DE7 A;  2M48 A;  3IX0 A;  4BY7 I;  4NB9 A;  2VF1 A;  3CCQ 1;  3G6E 1;  1K9M 1;  2E2J I;  3HOV I;  2R92 I;  1X3W A;  3GKQ A;  1YJW 1;  2YAD A;  3BG0 B;  3JAM b;  2M6N A;  5T6B A;  4A3C I;  4MRI A;  4MD8 A;  2GTI A;  2P28 A;  5T64 A;  2QR1 B;  3KIH A;  1Q82 2;  1QVG Z;  3LUS A;  1KD1 1;  4RVH A;  3G71 1;  3CC7 1;  1VQ8 1;  1VQ7 1;  4NBH A;  3CCV Z;  1Q86 1;  2OTL 1;  4NOZ A;  2GTH A;  3I56 1;  3MZK B;  3CXC Z;  2JNY A;  4EWC A;  1VQL 1;  1VQ9 1;  2JMO A;  3J81 b;  3CCS Z;  2KI7 B;  4MH4 A;  1VQN Z;  5FLX f;  3I55 Z;  3CCJ 1;  1VQP 1;  2RHB A;  1VQ4 1;  4A3B I;  3S16 I;  2V8K A;  1YUA A;  4E2W A;  2WAQ A;  2EGT A;  3ESW A;  4NBF A;  2ZAE B;  1W2B Z;  1JJ2 Z;  3CXC Y;  1Q82 1;  3CMA Z;  3H3V J;  4DGL A;  3CC2 1;  1Z03 A;  1M1K 2;  1VQ5 Z;  3PO3 I;  3CCR 1;  3CME 1;  2I3C A;  3NH8 A;  1YHQ 1;  3TDH B;  1LQL A;  1S7M A;  2JA6 I;  1NUI A;  3RZD I;  3T4N B;  3CCM 1;  3F3F C;  1VQO Z;  5D1P A;  3F3P C;  2R6M A;  3PO3 S;  3I4M I;  4NH1 C;  1ML8 A;  2QEX 1;  2OTJ 1;  1KRL A;  3CQZ I;  3I4N I;  4CL1 A;  1KQS Z;  2QRC B;  1W2B Y;  2RIQ A;  1TWC I;  1QF8 A;  1K8A 2;  3NFZ A;  4A3E I;  4RVG A;  2IZ3 A;  1NP6 A;  3FKI I;  2NVX I;  2JR6 A;  3H0G I;  2Q51 A;  1M90 1;  4BY1 I;  2RBL A;  1N8R 2;  2JS4 A;  5A2Q f;  3CD6 Z;  3S1Q I;  1M1K 1;  2QRE B;  1YUK A;  4HGY A;  3HOU I;  4X6A I;  3HOY I;  1WCM I;  2KPI A;  2F4M A;  5LL6 f;  4BXX I;  4HGZ A;  3OW2 Z;  3CCV 1;  3G4S Z;  4A3L I;  3GTJ I;  2DE5 A;  2GU2 A;  2QA4 Z;  2AKL A;  3GTQ I;  2V8I A;  2JA8 I;  3GTG I;  5IT9 b;  1NJI 2;  2Q4Z A;  3J80 f;  3HKZ A;  1TWH I;  2JUB A;  1YI2 Z;  1VLA A;  2BJO A;  3CCS 1;  1QYP A;  5T67 A;  1USP A;  2OZK A;  1X3Z A;  1VQN 1;  1K8A 1;  1RO2 A;  3I55 1;  3IFU A;  1Q7Y 2;  4E30 A;  4QTU A;  4NBA A;  4E31 A;  1YJ9 Z;  1N8R 1;  1QVG Y;  4MON A;  2F4O A;  1N2F A;  2DE6 A;  3CMA 1;  2YU9 I;  1VQ5 1;  1WW9 A;  4NBD A;  3CCL Z;  3S1R I;  3M4O I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...