1VQK1

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqk100
1N8R2 3CCVZ 1W2BZ 1K8A1 1YHQ1 3CME1 3CCLZ 1M902 3CPWY 3I551 1KC82 3CCSZ 2OTL1 1K8A2 1QVFY 1YJN1 1S72Z 1VQMZ 1VQ41 1YITZ 1QVGZ 3CMEZ 1KD11 1JJ2Z 3CCV1 1YJ91 3G4SZ 3G6E1 2QA4Z 1VQ91 1N8R1 3CD6Z 1VQ61 3CCS1 2OTLZ 1Q862 1VQ7Z 1Q7Y1 3I561 3CCUZ 1Q812 3CCM1 1VQL1 3CCJ1 1K732 1VQ81 2QA41 3CPWZ 3CD61 3G71Z 1VQK1 1VQ71 1KC81 1VQ51 1Q822 3CCEZ 3CCQZ 1VQNZ 1VQOZ 1VQPZ 1JJ2Y 1K9M1 1YJW1 1YI21 1Q811 1VQ8Z 1KQSZ 1M901 1VQ9Z 1VQM1 3CXCY 1Q7Y2 1YIJ1 1M1K2 3G4S1 3CCMZ 1VQLZ 3CC2Z 3I55Z 3G6EZ 3CCJZ 3CCL1 1YHQZ 2OTJ1 2QEXZ 1NJI2 1S721 1KD12 1YIJZ 1VQN1 3OW2Z 1YIT1 1VQ4Z 3CC71 3CMA1 3CC21 1Q861 1VQP1 1YJ9Z 3G711 1VQKZ 3CCR1 1M1K1 2QEX1 2OTJZ 1KQSY 3CC41 1YJNZ 3CCU1 3I56Z 1W2BY 1K9M2 1K731 1VQ5Z 1QVFZ 1QVGY 3CCE1 3CCQ1 3CXCZ 1VQO1 3CMAZ 3CC7Z 1YI2Z 1YJWZ 1NJI1 3OW2Y 1VQ6Z 3CCRZ 1Q821 3CC4Z
chains in the Genus database with same CATH superfamily
3P5JB 1N8R2 3S17I 3F3FC 1KC82 2YU9I 1P9NA 2PK7A 2JA8I 1K8A2 1QVFY 1ML8A 2VPYA 1VQMZ 3M3YI 1Z02A 4RVGA 1RO4A 2GU2A 2PMZA 2YADA 2VUMI 3G6E1 1WW9A 5C4JI 5IP9I 4BXXI 4E2YA 4A3LI 1USPB 2HF1A 1Q812 1VQL1 4NBBA 1K732 3CPWZ 2Q51A 3G71Z 1JWHC 1KC81 1VQ51 2JR6A 3CCQZ 4NH1C 4HGYA 1KQSZ 1VLAA 5C3EI 3GTGI 2QRCB 3S2DI 3PO2I 1TWGI 1VQM1 2VPWA 3U50C 3CCMZ 2I3CA 4RVDA 3G6EZ 3NH4A 3CCL1 2M48A 2DE7A 2OTJ1 2QEXZ 5FLXb 1KD12 2R6MA 3NDJA 4A3KI 2Q4ZA 4Y7NI 3BG1B 3CMA1 4MH4A 2PM9A 1VQP1 4BBSI 2JIQA 3G711 1M1K1 2RT9A 3MZKB 2QEX1 4NB8A 1KQSY 5IT9f 1X3WA 2HU9A 3CCU1 1QYPA 3I56Z 4NFRA 1W2BY 3VMHA 1DL6A 2QKDA 1WCMI 4Y52I 1VQ5Z 5FLMI 1QVGY 1KRLA 3CCE1 3S15I 3CMAZ 2IV2X 1NJI1 2JS4A 2E2HI 2OOXB 1Y8CA 2O53A 3M4OI 1YUKA 3RZOI 1FDIA 1YHQ1 3CME1 3GTMS 3CCLZ 1M902 2QREB 3I551 3H0GI 4NBDA 3F3PC 2GTHA 3J81f 4A3EI 3HOVI 3S14I 1QVGZ 1ZH1A 2VPZA 1JJ2Z 3MONA 4E30A 1N2FA 4QTUA 3CCS1 2OTLZ 3K7AI 1Q862 3CCUZ 5T64A 3CCM1 2EGTA 1LQLA 2E2II 5A2Qb 4RVFA 2G2KA 2F4OA 2QR1B 3VMGA 2JUBA 3LUSA 2RPRA 3CCEZ 2JNYA 2E9HA 1VQPZ 1JJ2Y 2KPIA 1YI21 1Q811 2JIMA 3EEDA 4MONA 3J7A4 2O4HA 3GTOI 1YIJ1 1M1K2 4BBRI 1WZNA 1ZB8A 4MXUA 1WJ2A 5D1PA 3S1NI 4DQYB 5T67A 2JA5I 3HOWI 2M6NA 4NBEA 1AA6A 3NFZA 4MD9A 4HH4A 3JAMb 2Y0SA 4NBGA 2LFUA 2V3VA 1RO2A 3IR7A 2JA7I 3TE5B 4BY1I 3Q87A 4NOZA 2H85A 3H3VJ 3CXCZ 3IFUA 3J81b 3I4NI 3GTPI 3ESWA 1RO0A 2NVTI 3CCRZ 3MZLB 4E2XA 3HOYI 1TWAI 3VTNA 4AYBA 4E2ZA 1W2BZ 2E7ZA 3JAMf 3CCSZ 2OTL1 3GTKI 3I07A 5CM2M 1S72Z 4RS4A 3IX0A 2JIPA 2P28A 3CMEZ 1KD11 4NB9A 3CCV1 3J80f 1NP6A 1N8R1 1Q16A 1VQ61 3S2HI 2RIQA 1VQ7Z 3S16I 4BY7I 3I561 2B63I 4CL1A 3RZDI 1QXFA 3HOZI 1VQ81 2V45A 4NBFA 1VQ71 2OZKA 4EWCA 1Q822 1Z03A 4A3II 3S1QI 4NBHA 4MRIA 2W04A 1VQ8Z 1M901 5D1OB 2RBLA 3CXCY 2WAQA 5FLXf 3I55Z 4A93I 3CCJZ 2V8KA 2QLVB 1NJI2 1ZB9A 1S721 2R93I 2V8JA 1SFOI 1YIJZ 3OW2Z 1I3QI 3NH5A 4E32A 1VQ4Z 3CC71 3FQQA 1Q861 2JA6I 1YJ9Z 4A3DI 3CCR1 3GKQA 1RLYA 1YJNZ 2BJOA 2DE6A 5IT9b 3GTMI 3D2LA 1TWHI 1YUAA 4E33A 4X6AI 5T6BA 1K9M2 2RHBA 4RVHA 2WB1A 1K731 1S7MA 3VB9A 3CQZI 2F4MA 1I6HI 2AYDA 2R92I 3PO3S 3KIFA 1VQO1 2E2JI 3CC7Z 1RNIA 1YI2Z 4NBCA 2W03A 1TWCI 3OW2Y 1VQ6Z 3J80b 1Q821 2V8IA 2LEXA 3CCVZ 1K8A1 1X3ZA 3CPWY 1TFIA 1NUIA 1YJN1 4XX2A 5LL6f 4A3BI 4DGLA 4E31A 1VQ41 1YITZ 3KIHA 3GTLI 1TWFI 3FQMA 1L1OC 3D9XA 1YJ91 3G4SZ 3HOXI 2QA4Z 2P3YA 3TDHB 1VQ91 3CD6Z 3GTQI 4S1TA 4E2WA 2VF1A 1Q7Y1 2VUGA 3BG0B 2KI7B 2K3RA 2LIYA 2IZ3A 3CCJ1 4DK1A 1Y1WI 2QA41 3CD61 3GTJI 2QRDB 3FKII 1VQK1 2JIOA 5A2Qf 1QF8A 1VQNZ 3I4MI 3VMIA 4HGZA 1VQOZ 2R7ZI 1K9M1 1PFTA 1YJW1 3D6WA 3HKZA 5C44I 1VQ9Z 5D1OA 2NVQI 1USPA 1Q7Y2 3NDIA 2J6AA 3G4S1 1VQLZ 3CC2Z 1K83I 1YHQZ 1R9TI 3S1MI 3GCFA 2AKLA 2JMOA 4MD7A 2GTIA 1VQN1 4RV9A 1YIT1 3CC21 1FDOA 3EERA 2OOYB 4TNUA 1VQKZ 4NBAA 2OTJZ 2NVXI 3CC41 2NAPA 4A3FI 2VPXA 1I50I 3T4NB 5IP7I 4QTTA 2JIRA 5AN9F 3IF8A 4A3GI 2ZAEB 1QVFZ 3PO3I 1Y1VI 3CCQ1 4A3MI 1WIIA 1Z01A 3NH8A 1X0TA 1YJWZ 5C4XI 2K5RA 1Y1VS 2DE5A 3QWUA 3HOUI 1SIWA 2NVYI 2IZ4A 1RQFA 3CC4Z 4A3JI 4A3CI 4MD8A 3S1RI
chains in the Genus database with same CATH topology
3P5JB 1N8R2 3S17I 3F3FC 1KC82 2YU9I 1P9NA 2PK7A 2JA8I 1K8A2 1QVFY 1ML8A 1VQMZ 3M3YI 1Z02A 4RVGA 1RO4A 2GU2A 2PMZA 2YADA 2VUMI 3G6E1 1WW9A 5C4JI 5IP9I 4BXXI 4E2YA 4A3LI 1USPB 2HF1A 1Q812 1VQL1 4NBBA 1K732 3CPWZ 2Q51A 3G71Z 1JWHC 1KC81 1VQ51 2JR6A 3CCQZ 4NH1C 4HGYA 1KQSZ 1VLAA 5C3EI 3GTGI 2QRCB 3S2DI 3PO2I 1TWGI 1VQM1 3U50C 3CCMZ 2I3CA 4RVDA 3G6EZ 3NH4A 3CCL1 2M48A 2DE7A 2OTJ1 2QEXZ 5FLXb 1KD12 2R6MA 3NDJA 4A3KI 2Q4ZA 4Y7NI 3BG1B 3CMA1 4MH4A 2PM9A 1VQP1 4BBSI 3G711 1M1K1 2RT9A 3MZKB 2QEX1 4NB8A 1KQSY 5IT9f 1X3WA 2HU9A 3CCU1 1QYPA 3I56Z 4NFRA 1W2BY 3VMHA 1DL6A 2QKDA 1WCMI 4Y52I 1VQ5Z 5FLMI 1QVGY 1KRLA 3CCE1 3S15I 3CMAZ 1NJI1 2JS4A 2E2HI 2OOXB 2O53A 3M4OI 1YUKA 3RZOI 1YHQ1 3CME1 3GTMS 3CCLZ 1M902 2QREB 3I551 3H0GI 4NBDA 3F3PC 2GTHA 3J81f 4A3EI 3HOVI 3S14I 1QVGZ 1ZH1A 1JJ2Z 3MONA 4E30A 1N2FA 4QTUA 3CCS1 2OTLZ 3K7AI 1Q862 3CCUZ 5T64A 3CCM1 2EGTA 1LQLA 2E2II 5A2Qb 4RVFA 2G2KA 2F4OA 2QR1B 3VMGA 2JUBA 3LUSA 2RPRA 3CCEZ 2JNYA 2E9HA 1VQPZ 1JJ2Y 2KPIA 1YI21 1Q811 3EEDA 4MONA 3J7A4 2O4HA 3GTOI 1YIJ1 1M1K2 4BBRI 1ZB8A 4MXUA 5D1PA 3S1NI 4DQYB 5T67A 2JA5I 3HOWI 2M6NA 4NBEA 3NFZA 4MD9A 4HH4A 3JAMb 2Y0SA 4NBGA 2LFUA 1RO2A 2JA7I 3TE5B 4BY1I 3Q87A 4NOZA 2H85A 3H3VJ 3CXCZ 3IFUA 3J81b 3I4NI 3GTPI 3ESWA 1RO0A 2NVTI 3CCRZ 3MZLB 4E2XA 3HOYI 1TWAI 3VTNA 4AYBA 4E2ZA 1W2BZ 3JAMf 3CCSZ 2OTL1 3GTKI 3I07A 5CM2M 1S72Z 4RS4A 3IX0A 2P28A 3CMEZ 1KD11 4NB9A 3CCV1 3J80f 1NP6A 1N8R1 1VQ61 3S2HI 2RIQA 1VQ7Z 3S16I 4BY7I 3I561 2B63I 4CL1A 3RZDI 3HOZI 1VQ81 4NBFA 1VQ71 2OZKA 4EWCA 1Q822 1Z03A 4A3II 3S1QI 4NBHA 4MRIA 2W04A 1VQ8Z 1M901 5D1OB 2RBLA 3CXCY 2WAQA 5FLXf 3I55Z 4A93I 3CCJZ 2V8KA 2QLVB 1NJI2 1ZB9A 1S721 2R93I 2V8JA 1SFOI 1YIJZ 3OW2Z 1I3QI 3NH5A 4E32A 1VQ4Z 3CC71 3FQQA 1Q861 2JA6I 1YJ9Z 4A3DI 3CCR1 3GKQA 1RLYA 1YJNZ 2BJOA 2DE6A 5IT9b 3GTMI 1TWHI 1YUAA 4E33A 4X6AI 5T6BA 1K9M2 2RHBA 4RVHA 2WB1A 1K731 1S7MA 3VB9A 3CQZI 2F4MA 1I6HI 2R92I 3PO3S 3KIFA 1VQO1 2E2JI 3CC7Z 1RNIA 1YI2Z 4NBCA 2W03A 1TWCI 3OW2Y 1VQ6Z 3J80b 1Q821 2V8IA 3CCVZ 1K8A1 1X3ZA 3CPWY 1TFIA 1NUIA 1YJN1 4XX2A 5LL6f 4A3BI 4DGLA 4E31A 1VQ41 1YITZ 3KIHA 3GTLI 1TWFI 3FQMA 1L1OC 3D9XA 1YJ91 3G4SZ 3HOXI 2QA4Z 2P3YA 3TDHB 1VQ91 3CD6Z 3GTQI 4S1TA 4E2WA 2VF1A 1Q7Y1 2VUGA 3BG0B 2KI7B 2K3RA 2LIYA 2IZ3A 3CCJ1 4DK1A 1Y1WI 2QA41 3CD61 3GTJI 2QRDB 3FKII 1VQK1 5A2Qf 1QF8A 1VQNZ 3I4MI 3VMIA 4HGZA 1VQOZ 2R7ZI 1K9M1 1PFTA 1YJW1 3D6WA 3HKZA 5C44I 1VQ9Z 5D1OA 2NVQI 1USPA 1Q7Y2 3NDIA 2J6AA 3G4S1 1VQLZ 3CC2Z 1K83I 1YHQZ 1R9TI 3S1MI 3GCFA 2AKLA 2JMOA 4MD7A 2GTIA 1VQN1 4RV9A 1YIT1 3CC21 3EERA 2OOYB 4TNUA 1VQKZ 4NBAA 2OTJZ 2NVXI 3CC41 4A3FI 1I50I 3T4NB 5IP7I 4QTTA 5AN9F 3IF8A 4A3GI 2ZAEB 1QVFZ 3PO3I 1Y1VI 3CCQ1 4A3MI 1WIIA 1Z01A 3NH8A 1X0TA 1YJWZ 5C4XI 2K5RA 1Y1VS 2DE5A 3QWUA 3HOUI 2NVYI 2IZ4A 1RQFA 3CC4Z 4A3JI 4A3CI 4MD8A 3S1RI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  3CCV Z;  1W2B Z;  1K8A 1;  1YHQ 1;  3CME 1;  3CCL Z;  1M90 2;  3CPW Y;  3I55 1;  1KC8 2;  3CCS Z;  2OTL 1;  1K8A 2;  1QVF Y;  1YJN 1;  1S72 Z;  1VQM Z;  1VQ4 1;  1YIT Z;  1QVG Z;  3CME Z;  1KD1 1;  1JJ2 Z;  3CCV 1;  1YJ9 1;  3G4S Z;  3G6E 1;  2QA4 Z;  1VQ9 1;  1N8R 1;  3CD6 Z;  1VQ6 1;  3CCS 1;  2OTL Z;  1Q86 2;  1VQ7 Z;  1Q7Y 1;  3I56 1;  3CCU Z;  1Q81 2;  3CCM 1;  1VQL 1;  3CCJ 1;  1K73 2;  1VQ8 1;  2QA4 1;  3CPW Z;  3CD6 1;  3G71 Z;  1VQK 1;  1VQ7 1;  1KC8 1;  1VQ5 1;  1Q82 2;  3CCE Z;  3CCQ Z;  1VQN Z;  1VQO Z;  1VQP Z;  1JJ2 Y;  1K9M 1;  1YJW 1;  1YI2 1;  1Q81 1;  1VQ8 Z;  1KQS Z;  1M90 1;  1VQ9 Z;  1VQM 1;  3CXC Y;  1Q7Y 2;  1YIJ 1;  1M1K 2;  3G4S 1;  3CCM Z;  1VQL Z;  3CC2 Z;  3I55 Z;  3G6E Z;  3CCJ Z;  3CCL 1;  1YHQ Z;  2OTJ 1;  2QEX Z;  1NJI 2;  1S72 1;  1KD1 2;  1YIJ Z;  1VQN 1;  3OW2 Z;  1YIT 1;  1VQ4 Z;  3CC7 1;  3CMA 1;  3CC2 1;  1Q86 1;  1VQP 1;  1YJ9 Z;  3G71 1;  1VQK Z;  3CCR 1;  1M1K 1;  2QEX 1;  2OTJ Z;  1KQS Y;  3CC4 1;  1YJN Z;  3CCU 1;  3I56 Z;  1W2B Y;  1K9M 2;  1K73 1;  1VQ5 Z;  1QVF Z;  1QVG Y;  3CCE 1;  3CCQ 1;  3CXC Z;  1VQO 1;  3CMA Z;  3CC7 Z;  1YI2 Z;  1YJW Z;  1NJI 1;  3OW2 Y;  1VQ6 Z;  3CCR Z;  1Q82 1;  3CC4 Z; 
#chains in the Genus database with same CATH topology
 3P5J B;  1N8R 2;  3S17 I;  3F3F C;  1KC8 2;  2YU9 I;  1P9N A;  2PK7 A;  2JA8 I;  1K8A 2;  1QVF Y;  1ML8 A;  2VPY A;  1VQM Z;  3M3Y I;  1Z02 A;  4RVG A;  1RO4 A;  2GU2 A;  2PMZ A;  2YAD A;  2VUM I;  3G6E 1;  1WW9 A;  5C4J I;  5IP9 I;  4BXX I;  4E2Y A;  4A3L I;  1USP B;  2HF1 A;  1Q81 2;  1VQL 1;  4NBB A;  1K73 2;  3CPW Z;  2Q51 A;  3G71 Z;  1JWH C;  1KC8 1;  1VQ5 1;  2JR6 A;  3CCQ Z;  4NH1 C;  4HGY A;  1KQS Z;  1VLA A;  5C3E I;  3GTG I;  2QRC B;  3S2D I;  3PO2 I;  1TWG I;  1VQM 1;  2VPW A;  3U50 C;  3CCM Z;  2I3C A;  4RVD A;  3G6E Z;  3NH4 A;  3CCL 1;  2M48 A;  2DE7 A;  2OTJ 1;  2QEX Z;  5FLX b;  1KD1 2;  2R6M A;  3NDJ A;  4A3K I;  2Q4Z A;  4Y7N I;  3BG1 B;  3CMA 1;  4MH4 A;  2PM9 A;  1VQP 1;  4BBS I;  2JIQ A;  3G71 1;  1M1K 1;  2RT9 A;  3MZK B;  2QEX 1;  4NB8 A;  1KQS Y;  5IT9 f;  1X3W A;  2HU9 A;  3CCU 1;  1QYP A;  3I56 Z;  4NFR A;  1W2B Y;  3VMH A;  1DL6 A;  2QKD A;  1WCM I;  4Y52 I;  1VQ5 Z;  5FLM I;  1QVG Y;  1KRL A;  3CCE 1;  3S15 I;  3CMA Z;  2IV2 X;  1NJI 1;  2JS4 A;  2E2H I;  2OOX B;  1Y8C A;  2O53 A;  3M4O I;  1YUK A;  3RZO I;  1FDI A;  1YHQ 1;  3CME 1;  3GTM S;  3CCL Z;  1M90 2;  2QRE B;  3I55 1;  3H0G I;  4NBD A;  3F3P C;  2GTH A;  3J81 f;  4A3E I;  3HOV I;  3S14 I;  1QVG Z;  1ZH1 A;  2VPZ A;  1JJ2 Z;  3MON A;  4E30 A;  1N2F A;  4QTU A;  3CCS 1;  2OTL Z;  3K7A I;  1Q86 2;  3CCU Z;  5T64 A;  3CCM 1;  2EGT A;  1LQL A;  2E2I I;  5A2Q b;  4RVF A;  2G2K A;  2F4O A;  2QR1 B;  3VMG A;  2JUB A;  3LUS A;  2RPR A;  3CCE Z;  2JNY A;  2E9H A;  1VQP Z;  1JJ2 Y;  2KPI A;  1YI2 1;  1Q81 1;  2JIM A;  3EED A;  4MON A;  3J7A 4;  2O4H A;  3GTO I;  1YIJ 1;  1M1K 2;  4BBR I;  1WZN A;  1ZB8 A;  4MXU A;  1WJ2 A;  5D1P A;  3S1N I;  4DQY B;  5T67 A;  2JA5 I;  3HOW I;  2M6N A;  4NBE A;  1AA6 A;  3NFZ A;  4MD9 A;  4HH4 A;  3JAM b;  2Y0S A;  4NBG A;  2LFU A;  2V3V A;  1RO2 A;  3IR7 A;  2JA7 I;  3TE5 B;  4BY1 I;  3Q87 A;  4NOZ A;  2H85 A;  3H3V J;  3CXC Z;  3IFU A;  3J81 b;  3I4N I;  3GTP I;  3ESW A;  1RO0 A;  2NVT I;  3CCR Z;  3MZL B;  4E2X A;  3HOY I;  1TWA I;  3VTN A;  4AYB A;  4E2Z A;  1W2B Z;  2E7Z A;  3JAM f;  3CCS Z;  2OTL 1;  3GTK I;  3I07 A;  5CM2 M;  1S72 Z;  4RS4 A;  3IX0 A;  2JIP A;  2P28 A;  3CME Z;  1KD1 1;  4NB9 A;  3CCV 1;  3J80 f;  1NP6 A;  1N8R 1;  1Q16 A;  1VQ6 1;  3S2H I;  2RIQ A;  1VQ7 Z;  3S16 I;  4BY7 I;  3I56 1;  2B63 I;  4CL1 A;  3RZD I;  1QXF A;  3HOZ I;  1VQ8 1;  2V45 A;  4NBF A;  1VQ7 1;  2OZK A;  4EWC A;  1Q82 2;  1Z03 A;  4A3I I;  3S1Q I;  4NBH A;  4MRI A;  2W04 A;  1VQ8 Z;  1M90 1;  5D1O B;  2RBL A;  3CXC Y;  2WAQ A;  5FLX f;  3I55 Z;  4A93 I;  3CCJ Z;  2V8K A;  2QLV B;  1NJI 2;  1ZB9 A;  1S72 1;  2R93 I;  2V8J A;  1SFO I;  1YIJ Z;  3OW2 Z;  1I3Q I;  3NH5 A;  4E32 A;  1VQ4 Z;  3CC7 1;  3FQQ A;  1Q86 1;  2JA6 I;  1YJ9 Z;  4A3D I;  3CCR 1;  3GKQ A;  1RLY A;  1YJN Z;  2BJO A;  2DE6 A;  5IT9 b;  3GTM I;  3D2L A;  1TWH I;  1YUA A;  4E33 A;  4X6A I;  5T6B A;  1K9M 2;  2RHB A;  4RVH A;  2WB1 A;  1K73 1;  1S7M A;  3VB9 A;  3CQZ I;  2F4M A;  1I6H I;  2AYD A;  2R92 I;  3PO3 S;  3KIF A;  1VQO 1;  2E2J I;  3CC7 Z;  1RNI A;  1YI2 Z;  4NBC A;  2W03 A;  1TWC I;  3OW2 Y;  1VQ6 Z;  3J80 b;  1Q82 1;  2V8I A;  2LEX A;  3CCV Z;  1K8A 1;  1X3Z A;  3CPW Y;  1TFI A;  1NUI A;  1YJN 1;  4XX2 A;  5LL6 f;  4A3B I;  4DGL A;  4E31 A;  1VQ4 1;  1YIT Z;  3KIH A;  3GTL I;  1TWF I;  3FQM A;  1L1O C;  3D9X A;  1YJ9 1;  3G4S Z;  3HOX I;  2QA4 Z;  2P3Y A;  3TDH B;  1VQ9 1;  3CD6 Z;  3GTQ I;  4S1T A;  4E2W A;  2VF1 A;  1Q7Y 1;  2VUG A;  3BG0 B;  2KI7 B;  2K3R A;  2LIY A;  2IZ3 A;  3CCJ 1;  4DK1 A;  1Y1W I;  2QA4 1;  3CD6 1;  3GTJ I;  2QRD B;  3FKI I;  1VQK 1;  2JIO A;  5A2Q f;  1QF8 A;  1VQN Z;  3I4M I;  3VMI A;  4HGZ A;  1VQO Z;  2R7Z I;  1K9M 1;  1PFT A;  1YJW 1;  3D6W A;  3HKZ A;  5C44 I;  1VQ9 Z;  5D1O A;  2NVQ I;  1USP A;  1Q7Y 2;  3NDI A;  2J6A A;  3G4S 1;  1VQL Z;  3CC2 Z;  1K83 I;  1YHQ Z;  1R9T I;  3S1M I;  3GCF A;  2AKL A;  2JMO A;  4MD7 A;  2GTI A;  1VQN 1;  4RV9 A;  1YIT 1;  3CC2 1;  1FDO A;  3EER A;  2OOY B;  4TNU A;  1VQK Z;  4NBA A;  2OTJ Z;  2NVX I;  3CC4 1;  2NAP A;  4A3F I;  2VPX A;  1I50 I;  3T4N B;  5IP7 I;  4QTT A;  2JIR A;  5AN9 F;  3IF8 A;  4A3G I;  2ZAE B;  1QVF Z;  3PO3 I;  1Y1V I;  3CCQ 1;  4A3M I;  1WII A;  1Z01 A;  3NH8 A;  1X0T A;  1YJW Z;  5C4X I;  2K5R A;  1Y1V S;  2DE5 A;  3QWU A;  3HOU I;  1SIW A;  2NVY I;  2IZ4 A;  1RQF A;  3CC4 Z;  4A3J I;  4A3C I;  4MD8 A;  3S1R I; 
#chains in the Genus database with same CATH homology
 3P5J B;  1N8R 2;  3S17 I;  3F3F C;  1KC8 2;  2YU9 I;  1P9N A;  2PK7 A;  2JA8 I;  1K8A 2;  1QVF Y;  1ML8 A;  1VQM Z;  3M3Y I;  1Z02 A;  4RVG A;  1RO4 A;  2GU2 A;  2PMZ A;  2YAD A;  2VUM I;  3G6E 1;  1WW9 A;  5C4J I;  5IP9 I;  4BXX I;  4E2Y A;  4A3L I;  1USP B;  2HF1 A;  1Q81 2;  1VQL 1;  4NBB A;  1K73 2;  3CPW Z;  2Q51 A;  3G71 Z;  1JWH C;  1KC8 1;  1VQ5 1;  2JR6 A;  3CCQ Z;  4NH1 C;  4HGY A;  1KQS Z;  1VLA A;  5C3E I;  3GTG I;  2QRC B;  3S2D I;  3PO2 I;  1TWG I;  1VQM 1;  3U50 C;  3CCM Z;  2I3C A;  4RVD A;  3G6E Z;  3NH4 A;  3CCL 1;  2M48 A;  2DE7 A;  2OTJ 1;  2QEX Z;  5FLX b;  1KD1 2;  2R6M A;  3NDJ A;  4A3K I;  2Q4Z A;  4Y7N I;  3BG1 B;  3CMA 1;  4MH4 A;  2PM9 A;  1VQP 1;  4BBS I;  3G71 1;  1M1K 1;  2RT9 A;  3MZK B;  2QEX 1;  4NB8 A;  1KQS Y;  5IT9 f;  1X3W A;  2HU9 A;  3CCU 1;  1QYP A;  3I56 Z;  4NFR A;  1W2B Y;  3VMH A;  1DL6 A;  2QKD A;  1WCM I;  4Y52 I;  1VQ5 Z;  5FLM I;  1QVG Y;  1KRL A;  3CCE 1;  3S15 I;  3CMA Z;  1NJI 1;  2JS4 A;  2E2H I;  2OOX B;  2O53 A;  3M4O I;  1YUK A;  3RZO I;  1YHQ 1;  3CME 1;  3GTM S;  3CCL Z;  1M90 2;  2QRE B;  3I55 1;  3H0G I;  4NBD A;  3F3P C;  2GTH A;  3J81 f;  4A3E I;  3HOV I;  3S14 I;  1QVG Z;  1ZH1 A;  1JJ2 Z;  3MON A;  4E30 A;  1N2F A;  4QTU A;  3CCS 1;  2OTL Z;  3K7A I;  1Q86 2;  3CCU Z;  5T64 A;  3CCM 1;  2EGT A;  1LQL A;  2E2I I;  5A2Q b;  4RVF A;  2G2K A;  2F4O A;  2QR1 B;  3VMG A;  2JUB A;  3LUS A;  2RPR A;  3CCE Z;  2JNY A;  2E9H A;  1VQP Z;  1JJ2 Y;  2KPI A;  1YI2 1;  1Q81 1;  3EED A;  4MON A;  3J7A 4;  2O4H A;  3GTO I;  1YIJ 1;  1M1K 2;  4BBR I;  1ZB8 A;  4MXU A;  5D1P A;  3S1N I;  4DQY B;  5T67 A;  2JA5 I;  3HOW I;  2M6N A;  4NBE A;  3NFZ A;  4MD9 A;  4HH4 A;  3JAM b;  2Y0S A;  4NBG A;  2LFU A;  1RO2 A;  2JA7 I;  3TE5 B;  4BY1 I;  3Q87 A;  4NOZ A;  2H85 A;  3H3V J;  3CXC Z;  3IFU A;  3J81 b;  3I4N I;  3GTP I;  3ESW A;  1RO0 A;  2NVT I;  3CCR Z;  3MZL B;  4E2X A;  3HOY I;  1TWA I;  3VTN A;  4AYB A;  4E2Z A;  1W2B Z;  3JAM f;  3CCS Z;  2OTL 1;  3GTK I;  3I07 A;  5CM2 M;  1S72 Z;  4RS4 A;  3IX0 A;  2P28 A;  3CME Z;  1KD1 1;  4NB9 A;  3CCV 1;  3J80 f;  1NP6 A;  1N8R 1;  1VQ6 1;  3S2H I;  2RIQ A;  1VQ7 Z;  3S16 I;  4BY7 I;  3I56 1;  2B63 I;  4CL1 A;  3RZD I;  3HOZ I;  1VQ8 1;  4NBF A;  1VQ7 1;  2OZK A;  4EWC A;  1Q82 2;  1Z03 A;  4A3I I;  3S1Q I;  4NBH A;  4MRI A;  2W04 A;  1VQ8 Z;  1M90 1;  5D1O B;  2RBL A;  3CXC Y;  2WAQ A;  5FLX f;  3I55 Z;  4A93 I;  3CCJ Z;  2V8K A;  2QLV B;  1NJI 2;  1ZB9 A;  1S72 1;  2R93 I;  2V8J A;  1SFO I;  1YIJ Z;  3OW2 Z;  1I3Q I;  3NH5 A;  4E32 A;  1VQ4 Z;  3CC7 1;  3FQQ A;  1Q86 1;  2JA6 I;  1YJ9 Z;  4A3D I;  3CCR 1;  3GKQ A;  1RLY A;  1YJN Z;  2BJO A;  2DE6 A;  5IT9 b;  3GTM I;  1TWH I;  1YUA A;  4E33 A;  4X6A I;  5T6B A;  1K9M 2;  2RHB A;  4RVH A;  2WB1 A;  1K73 1;  1S7M A;  3VB9 A;  3CQZ I;  2F4M A;  1I6H I;  2R92 I;  3PO3 S;  3KIF A;  1VQO 1;  2E2J I;  3CC7 Z;  1RNI A;  1YI2 Z;  4NBC A;  2W03 A;  1TWC I;  3OW2 Y;  1VQ6 Z;  3J80 b;  1Q82 1;  2V8I A;  3CCV Z;  1K8A 1;  1X3Z A;  3CPW Y;  1TFI A;  1NUI A;  1YJN 1;  4XX2 A;  5LL6 f;  4A3B I;  4DGL A;  4E31 A;  1VQ4 1;  1YIT Z;  3KIH A;  3GTL I;  1TWF I;  3FQM A;  1L1O C;  3D9X A;  1YJ9 1;  3G4S Z;  3HOX I;  2QA4 Z;  2P3Y A;  3TDH B;  1VQ9 1;  3CD6 Z;  3GTQ I;  4S1T A;  4E2W A;  2VF1 A;  1Q7Y 1;  2VUG A;  3BG0 B;  2KI7 B;  2K3R A;  2LIY A;  2IZ3 A;  3CCJ 1;  4DK1 A;  1Y1W I;  2QA4 1;  3CD6 1;  3GTJ I;  2QRD B;  3FKI I;  1VQK 1;  5A2Q f;  1QF8 A;  1VQN Z;  3I4M I;  3VMI A;  4HGZ A;  1VQO Z;  2R7Z I;  1K9M 1;  1PFT A;  1YJW 1;  3D6W A;  3HKZ A;  5C44 I;  1VQ9 Z;  5D1O A;  2NVQ I;  1USP A;  1Q7Y 2;  3NDI A;  2J6A A;  3G4S 1;  1VQL Z;  3CC2 Z;  1K83 I;  1YHQ Z;  1R9T I;  3S1M I;  3GCF A;  2AKL A;  2JMO A;  4MD7 A;  2GTI A;  1VQN 1;  4RV9 A;  1YIT 1;  3CC2 1;  3EER A;  2OOY B;  4TNU A;  1VQK Z;  4NBA A;  2OTJ Z;  2NVX I;  3CC4 1;  4A3F I;  1I50 I;  3T4N B;  5IP7 I;  4QTT A;  5AN9 F;  3IF8 A;  4A3G I;  2ZAE B;  1QVF Z;  3PO3 I;  1Y1V I;  3CCQ 1;  4A3M I;  1WII A;  1Z01 A;  3NH8 A;  1X0T A;  1YJW Z;  5C4X I;  2K5R A;  1Y1V S;  2DE5 A;  3QWU A;  3HOU I;  2NVY I;  2IZ4 A;  1RQF A;  3CC4 Z;  4A3J I;  4A3C I;  4MD8 A;  3S1R I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...