1JJ2Y

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Y00
3G4SZ 1VQ5Z 1S721 1VQK1 3CD61 3G4S1 1KD11 3CCR1 1VQO1 3CCEZ 3CXCZ 1VQ81 2QEXZ 3CCJZ 3CXCY 3CPWZ 1Q812 3CPWY 3CCV1 1VQNZ 1VQ71 1YI21 3CCLZ 3CC21 1Q862 1VQ9Z 1VQN1 1YJ9Z 1VQ4Z 1YIJZ 1W2BY 1Q811 1YIJ1 1VQL1 1S72Z 3I551 3CD6Z 1Q7Y2 1Q861 1Q822 1JJ2Z 3CCRZ 1JJ2Y 1VQOZ 3CMEZ 1VQ8Z 3CCS1 3CC71 3CCM1 3CME1 1Q7Y1 1N8R1 1Q821 1YJN1 3CCVZ 1YJW1 1VQ7Z 1YI2Z 3CC2Z 2OTL1 1M902 1VQP1 1K732 1VQLZ 3CMA1 3I55Z 1M901 2QA41 1N8R2 1M1K2 3OW2Z 3G6E1 1KC82 1K8A2 3CCSZ 3OW2Y 3CC7Z 1K731 3CCMZ 3CC41 1K9M2 2OTJ1 1YJNZ 1YJWZ 1M1K1 1KC81 1K8A1 2OTLZ 3CCQZ 1YITZ 3CCQ1 1VQM1 1VQPZ 1K9M1 3G711 1YIT1 3CMAZ 1QVGZ 3CCU1 1YHQ1 1QVGY 1NJI2 3I561 2QA4Z 1QVFZ 3G6EZ 1QVFY 1VQ51 3CC4Z 2OTJZ 1NJI1 3CCE1 2QEX1 3CCJ1 1KQSZ 1KQSY 1VQMZ 1VQ6Z 3G71Z 1W2BZ 3CCL1 1VQ61 1VQ91 1KD12 3CCUZ 1YJ91 1YHQZ 1VQ41 3I56Z 1VQKZ
chains in the Genus database with same CATH superfamily
3G4SZ 2G2KA 3FQQA 3CD61 4NH1C 2Y0SA 4NB8A 4NBHA 3CCEZ 3KIHA 3P5JB 3CPWZ 3BG0B 1QF8A 2DE5A 1VQ71 1YI21 1VQ9Z 1VQN1 1YJ9Z 2LFUA 5D1OB 3S15I 4A3JI 5LL6f 4RV9A 2GU2A 2VUMI 1USPA 1AA6A 3J81b 1VQ8Z 2J6AA 3CME1 4E2WA 1Q7Y1 3T4NB 2M48A 3GKQA 2RIQA 4AYBA 1M902 1WCMI 4A3CI 1K732 5IP7I 1VQLZ 1K83I 3D9XA 3I4NI 3VB9A 2JIPA 1N8R2 3K7AI 3G6E1 4EWCA 3CC41 3IFUA 4HH4A 3S1RI 3GTQI 2NVTI 4A3MI 2E9HA 1KC81 4MRIA 1K8A1 3CCQZ 2R7ZI 4E2ZA 3GTMI 1YITZ 2DE7A 2VPWA 1K9M1 2E2II 3G711 3BG1B 2JNYA 3CMAZ 5C4XI 2JIOA 2V3VA 4RVFA 4MH4A 2OOYB 3TDHB 1WW9A 1N2FA 3Q87A 1S7MA 3D2LA 3CCE1 5C3EI 1KQSY 5D1PA 1RLYA 5C44I 1YUKA 1JWHC 1VQ91 2QRCB 3CCUZ 1YJ91 1YHQZ 2I3CA 2K3RA 5C4JI 4A3LI 1Q16A 4DK1A 2V8JA 4BXXI 2QLVB 2W03A 1VQK1 3HOYI 2NVXI 3CXCZ 1VQ81 2QEXZ 2WB1A 2JIMA 4MD9A 3PO2I 1PFTA 4E31A 1I3QI 2NVYI 3CCLZ 1NP6A 1Y1WI 1YIJZ 1W2BY 4A3KI 1Q811 3MZKB 1VQL1 1S72Z 1Q7Y2 1Q861 2H85A 3M4OI 2R6MA 3CCRZ 1JJ2Y 3IX0A 1Y1VI 4A3GI 2VUGA 5T64A 1VQOZ 3S2DI 4A93I 1LQLA 4NBFA 3J80f 3GTPI 3S1NI 4DQYB 2Q4ZA 4NBBA 4CL1A 5FLXb 2AYDA 1WJ2A 3FQMA 5T6BA 4MD8A 3CMA1 2V8IA 3I55Z 2V45A 1R9TI 2JS4A 3VMGA 4NBAA 3VMIA 4A3FI 3OW2Z 1KC82 1K8A2 3CCSZ 3CC7Z 3ESWA 1Y8CA 1K9M2 4RVHA 2GTHA 2RHBA 1X3WA 2JR6A 5IT9f 3MZLB 2OTLZ 3GTOI 3HOUI 3NFZA 1I50I 1VQPZ 4E33A 1TWGI 2VPXA 4S1TA 3VMHA 3CCU1 1YHQ1 1QVGY 3QWUA 2E2HI 2O53A 2VPZA 1QVFY 3NH5A 3HOXI 4NBDA 5A2Qf 3J7A4 2IV2X 1I6HI 3NDIA 1SIWA 4E32A 1YUAA 4Y7NI 2QEX1 3JAMf 1ML8A 2OOXB 1KRLA 1VQ6Z 3NH8A 2HU9A 2PMZA 1W2BZ 4A3DI 3CCL1 4QTTA 2W04A 4BY7I 4MXUA 1ZB8A 3I4MI 1S721 2JIQA 3G4S1 5IP9I 3CCR1 3HOWI 1VQO1 3PO3I 1TFIA 5CM2M 1Q812 3CPWY 1VQNZ 1Z03A 4BBRI 3F3FC 1Q862 3U50C 4RVGA 3GTKI 2V8KA 4X6AI 3GTJI 3KIFA 2F4MA 2F4OA 1TWCI 3I551 3GCFA 1QYPA 4MD7A 3S1MI 4NBEA 2JA8I 2YADA 2VF1A 3CMEZ 3CCS1 3CC71 3HOVI 2R93I 1RQFA 1N8R1 1Q821 2IZ4A 3CCVZ 1FDIA 3CC2Z 2OTL1 3GTMS 3RZOI 4HGYA 1VQP1 1P9NA 1TWAI 3S1QI 4Y52I 2JUBA 4DGLA 4TNUA 3TE5B 2GTIA 1RO0A 3CCMZ 3S2HI 1YJNZ 3J81f 3IF8A 1YJWZ 2NVQI 1M1K1 3F3PC 3CCQ1 2O4HA 4NFRA 1Z02A 1L1OC 2QRDB 1YIT1 2HF1A 2R92I 3I07A 3S14I 2BJOA 2QA4Z 2KPIA 1VLAA 4NOZA 4E30A 4E2YA 2OTJZ 1NJI1 3H3VJ 1ZB9A 3GTGI 1KQSZ 2Q51A 1VQMZ 2WAQA 3D6WA 1TWFI 1RO2A 4XX2A 2B63I 3I56Z 1VQKZ 2QREB 2P3YA 3VTNA 3NH4A 1VQ5Z 5FLMI 3J80b 4A3II 4NBCA 2E7ZA 2JIRA 1KD11 2VPYA 2JA6I 5T67A 1Y1VS 4E2XA 3NDJA 3CCJZ 2E2JI 3CXCY 2IZ3A 2KI7B 3M3YI 2EGTA 3CCV1 1TWHI 3HOZI 2RBLA 3CC21 1RO4A 2OZKA 2M6NA 1VQ4Z 1SFOI 1YIJ1 2K5RA 3CD6Z 3S17I 2JMOA 1Q822 1JJ2Z 3H0GI 1X3ZA 5IT9b 2PM9A 3CCM1 2LIYA 1YJN1 1YJW1 1VQ7Z 1YI2Z 4RVDA 2DE6A 3CQZI 1NUIA 2RT9A 1USPB 2RPRA 1DL6A 3S16I 4MONA 1M901 2YU9I 2NAPA 4NBGA 4BY1I 3HKZA 5A2Qb 2QA41 1WIIA 3MONA 1M1K2 2PK7A 3OW2Y 1K731 3JAMb 1X0TA 2OTJ1 1QXFA 3GTLI 2P28A 2QKDA 2ZAEB 1Z01A 2QR1B 4A3EI 1VQM1 4RS4A 4QTUA 3RZDI 1QVGZ 3LUSA 5D1OA 5FLXf 3EERA 1NJI2 3I561 1QVFZ 1RNIA 4BBSI 3G6EZ 1VQ51 2JA5I 3CC4Z 3FKII 3EEDA 2LEXA 3PO3S 1ZH1A 3CCJ1 2JA7I 1WZNA 3IR7A 4NB9A 5AN9F 3G71Z 2AKLA 1VQ61 1FDOA 1KD12 4A3BI 4HGZA 1VQ41
chains in the Genus database with same CATH topology
3G4SZ 2G2KA 3FQQA 3CD61 4NH1C 2Y0SA 4NB8A 4NBHA 3CCEZ 3KIHA 3P5JB 3CPWZ 3BG0B 1QF8A 2DE5A 1VQ71 1YI21 1VQ9Z 1VQN1 1YJ9Z 2LFUA 5D1OB 3S15I 4A3JI 5LL6f 4RV9A 2GU2A 2VUMI 1USPA 3J81b 1VQ8Z 2J6AA 3CME1 4E2WA 1Q7Y1 3T4NB 2M48A 3GKQA 2RIQA 4AYBA 1M902 1WCMI 4A3CI 1K732 5IP7I 1VQLZ 1K83I 3D9XA 3I4NI 3VB9A 1N8R2 3K7AI 3G6E1 4EWCA 3CC41 3IFUA 4HH4A 3S1RI 3GTQI 2NVTI 4A3MI 2E9HA 1KC81 4MRIA 1K8A1 3CCQZ 2R7ZI 4E2ZA 3GTMI 1YITZ 2DE7A 1K9M1 2E2II 3G711 3BG1B 2JNYA 3CMAZ 5C4XI 4RVFA 4MH4A 2OOYB 3TDHB 1WW9A 1N2FA 3Q87A 1S7MA 3CCE1 5C3EI 1KQSY 5D1PA 1RLYA 5C44I 1YUKA 1JWHC 1VQ91 2QRCB 3CCUZ 1YJ91 1YHQZ 2I3CA 2K3RA 5C4JI 4A3LI 4DK1A 2V8JA 4BXXI 2QLVB 2W03A 1VQK1 3HOYI 2NVXI 3CXCZ 1VQ81 2QEXZ 2WB1A 4MD9A 3PO2I 1PFTA 4E31A 1I3QI 2NVYI 3CCLZ 1NP6A 1Y1WI 1YIJZ 1W2BY 4A3KI 1Q811 3MZKB 1VQL1 1S72Z 1Q7Y2 1Q861 2H85A 3M4OI 2R6MA 3CCRZ 1JJ2Y 3IX0A 1Y1VI 4A3GI 2VUGA 5T64A 1VQOZ 3S2DI 4A93I 1LQLA 4NBFA 3J80f 3GTPI 3S1NI 4DQYB 2Q4ZA 4NBBA 4CL1A 5FLXb 3FQMA 5T6BA 4MD8A 3CMA1 2V8IA 3I55Z 1R9TI 2JS4A 3VMGA 4NBAA 3VMIA 4A3FI 3OW2Z 1KC82 1K8A2 3CCSZ 3CC7Z 3ESWA 1K9M2 4RVHA 2GTHA 2RHBA 1X3WA 2JR6A 5IT9f 3MZLB 2OTLZ 3GTOI 3HOUI 3NFZA 1I50I 1VQPZ 4E33A 1TWGI 4S1TA 3VMHA 3CCU1 1YHQ1 1QVGY 3QWUA 2E2HI 2O53A 1QVFY 3NH5A 3HOXI 4NBDA 5A2Qf 3J7A4 1I6HI 3NDIA 4E32A 1YUAA 4Y7NI 2QEX1 3JAMf 1ML8A 2OOXB 1KRLA 1VQ6Z 3NH8A 2HU9A 2PMZA 1W2BZ 4A3DI 3CCL1 4QTTA 2W04A 4BY7I 4MXUA 1ZB8A 3I4MI 1S721 3G4S1 5IP9I 3CCR1 3HOWI 1VQO1 3PO3I 1TFIA 5CM2M 1Q812 3CPWY 1VQNZ 1Z03A 4BBRI 3F3FC 1Q862 3U50C 4RVGA 3GTKI 2V8KA 4X6AI 3GTJI 3KIFA 2F4MA 2F4OA 1TWCI 3I551 3GCFA 1QYPA 4MD7A 3S1MI 4NBEA 2JA8I 2YADA 2VF1A 3CMEZ 3CCS1 3CC71 3HOVI 2R93I 1RQFA 1N8R1 1Q821 2IZ4A 3CCVZ 3CC2Z 2OTL1 3GTMS 3RZOI 4HGYA 1VQP1 1P9NA 1TWAI 3S1QI 4Y52I 2JUBA 4DGLA 4TNUA 3TE5B 2GTIA 1RO0A 3CCMZ 3S2HI 1YJNZ 3J81f 3IF8A 1YJWZ 2NVQI 1M1K1 3F3PC 3CCQ1 2O4HA 4NFRA 1Z02A 1L1OC 2QRDB 1YIT1 2HF1A 2R92I 3I07A 3S14I 2BJOA 2QA4Z 2KPIA 1VLAA 4NOZA 4E30A 4E2YA 2OTJZ 1NJI1 3H3VJ 1ZB9A 3GTGI 1KQSZ 2Q51A 1VQMZ 2WAQA 3D6WA 1TWFI 1RO2A 4XX2A 2B63I 3I56Z 1VQKZ 2QREB 2P3YA 3VTNA 3NH4A 1VQ5Z 5FLMI 3J80b 4A3II 4NBCA 1KD11 2JA6I 5T67A 1Y1VS 4E2XA 3NDJA 3CCJZ 2E2JI 3CXCY 2IZ3A 2KI7B 3M3YI 2EGTA 3CCV1 1TWHI 3HOZI 2RBLA 3CC21 1RO4A 2OZKA 2M6NA 1VQ4Z 1SFOI 1YIJ1 2K5RA 3CD6Z 3S17I 2JMOA 1Q822 1JJ2Z 3H0GI 1X3ZA 5IT9b 2PM9A 3CCM1 2LIYA 1YJN1 1YJW1 1VQ7Z 1YI2Z 4RVDA 2DE6A 3CQZI 1NUIA 2RT9A 1USPB 2RPRA 1DL6A 3S16I 4MONA 1M901 2YU9I 4NBGA 4BY1I 3HKZA 5A2Qb 2QA41 1WIIA 3MONA 1M1K2 2PK7A 3OW2Y 1K731 3JAMb 1X0TA 2OTJ1 3GTLI 2P28A 2QKDA 2ZAEB 1Z01A 2QR1B 4A3EI 1VQM1 4RS4A 4QTUA 3RZDI 1QVGZ 3LUSA 5D1OA 5FLXf 3EERA 1NJI2 3I561 1QVFZ 1RNIA 4BBSI 3G6EZ 1VQ51 2JA5I 3CC4Z 3FKII 3EEDA 3PO3S 1ZH1A 3CCJ1 2JA7I 4NB9A 5AN9F 3G71Z 2AKLA 1VQ61 1KD12 4A3BI 4HGZA 1VQ41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S Z;  1VQ5 Z;  1S72 1;  1VQK 1;  3CD6 1;  3G4S 1;  1KD1 1;  3CCR 1;  1VQO 1;  3CCE Z;  3CXC Z;  1VQ8 1;  2QEX Z;  3CCJ Z;  3CXC Y;  3CPW Z;  1Q81 2;  3CPW Y;  3CCV 1;  1VQN Z;  1VQ7 1;  1YI2 1;  3CCL Z;  3CC2 1;  1Q86 2;  1VQ9 Z;  1VQN 1;  1YJ9 Z;  1VQ4 Z;  1YIJ Z;  1W2B Y;  1Q81 1;  1YIJ 1;  1VQL 1;  1S72 Z;  3I55 1;  3CD6 Z;  1Q7Y 2;  1Q86 1;  1Q82 2;  1JJ2 Z;  3CCR Z;  1JJ2 Y;  1VQO Z;  3CME Z;  1VQ8 Z;  3CCS 1;  3CC7 1;  3CCM 1;  3CME 1;  1Q7Y 1;  1N8R 1;  1Q82 1;  1YJN 1;  3CCV Z;  1YJW 1;  1VQ7 Z;  1YI2 Z;  3CC2 Z;  2OTL 1;  1M90 2;  1VQP 1;  1K73 2;  1VQL Z;  3CMA 1;  3I55 Z;  1M90 1;  2QA4 1;  1N8R 2;  1M1K 2;  3OW2 Z;  3G6E 1;  1KC8 2;  1K8A 2;  3CCS Z;  3OW2 Y;  3CC7 Z;  1K73 1;  3CCM Z;  3CC4 1;  1K9M 2;  2OTJ 1;  1YJN Z;  1YJW Z;  1M1K 1;  1KC8 1;  1K8A 1;  2OTL Z;  3CCQ Z;  1YIT Z;  3CCQ 1;  1VQM 1;  1VQP Z;  1K9M 1;  3G71 1;  1YIT 1;  3CMA Z;  1QVG Z;  3CCU 1;  1YHQ 1;  1QVG Y;  1NJI 2;  3I56 1;  2QA4 Z;  1QVF Z;  3G6E Z;  1QVF Y;  1VQ5 1;  3CC4 Z;  2OTJ Z;  1NJI 1;  3CCE 1;  2QEX 1;  3CCJ 1;  1KQS Z;  1KQS Y;  1VQM Z;  1VQ6 Z;  3G71 Z;  1W2B Z;  3CCL 1;  1VQ6 1;  1VQ9 1;  1KD1 2;  3CCU Z;  1YJ9 1;  1YHQ Z;  1VQ4 1;  3I56 Z;  1VQK Z; 
#chains in the Genus database with same CATH topology
 3G4S Z;  2G2K A;  3FQQ A;  3CD6 1;  4NH1 C;  2Y0S A;  4NB8 A;  4NBH A;  3CCE Z;  3KIH A;  3P5J B;  3CPW Z;  3BG0 B;  1QF8 A;  2DE5 A;  1VQ7 1;  1YI2 1;  1VQ9 Z;  1VQN 1;  1YJ9 Z;  2LFU A;  5D1O B;  3S15 I;  4A3J I;  5LL6 f;  4RV9 A;  2GU2 A;  2VUM I;  1USP A;  1AA6 A;  3J81 b;  1VQ8 Z;  2J6A A;  3CME 1;  4E2W A;  1Q7Y 1;  3T4N B;  2M48 A;  3GKQ A;  2RIQ A;  4AYB A;  1M90 2;  1WCM I;  4A3C I;  1K73 2;  5IP7 I;  1VQL Z;  1K83 I;  3D9X A;  3I4N I;  3VB9 A;  2JIP A;  1N8R 2;  3K7A I;  3G6E 1;  4EWC A;  3CC4 1;  3IFU A;  4HH4 A;  3S1R I;  3GTQ I;  2NVT I;  4A3M I;  2E9H A;  1KC8 1;  4MRI A;  1K8A 1;  3CCQ Z;  2R7Z I;  4E2Z A;  3GTM I;  1YIT Z;  2DE7 A;  2VPW A;  1K9M 1;  2E2I I;  3G71 1;  3BG1 B;  2JNY A;  3CMA Z;  5C4X I;  2JIO A;  2V3V A;  4RVF A;  4MH4 A;  2OOY B;  3TDH B;  1WW9 A;  1N2F A;  3Q87 A;  1S7M A;  3D2L A;  3CCE 1;  5C3E I;  1KQS Y;  5D1P A;  1RLY A;  5C44 I;  1YUK A;  1JWH C;  1VQ9 1;  2QRC B;  3CCU Z;  1YJ9 1;  1YHQ Z;  2I3C A;  2K3R A;  5C4J I;  4A3L I;  1Q16 A;  4DK1 A;  2V8J A;  4BXX I;  2QLV B;  2W03 A;  1VQK 1;  3HOY I;  2NVX I;  3CXC Z;  1VQ8 1;  2QEX Z;  2WB1 A;  2JIM A;  4MD9 A;  3PO2 I;  1PFT A;  4E31 A;  1I3Q I;  2NVY I;  3CCL Z;  1NP6 A;  1Y1W I;  1YIJ Z;  1W2B Y;  4A3K I;  1Q81 1;  3MZK B;  1VQL 1;  1S72 Z;  1Q7Y 2;  1Q86 1;  2H85 A;  3M4O I;  2R6M A;  3CCR Z;  1JJ2 Y;  3IX0 A;  1Y1V I;  4A3G I;  2VUG A;  5T64 A;  1VQO Z;  3S2D I;  4A93 I;  1LQL A;  4NBF A;  3J80 f;  3GTP I;  3S1N I;  4DQY B;  2Q4Z A;  4NBB A;  4CL1 A;  5FLX b;  2AYD A;  1WJ2 A;  3FQM A;  5T6B A;  4MD8 A;  3CMA 1;  2V8I A;  3I55 Z;  2V45 A;  1R9T I;  2JS4 A;  3VMG A;  4NBA A;  3VMI A;  4A3F I;  3OW2 Z;  1KC8 2;  1K8A 2;  3CCS Z;  3CC7 Z;  3ESW A;  1Y8C A;  1K9M 2;  4RVH A;  2GTH A;  2RHB A;  1X3W A;  2JR6 A;  5IT9 f;  3MZL B;  2OTL Z;  3GTO I;  3HOU I;  3NFZ A;  1I50 I;  1VQP Z;  4E33 A;  1TWG I;  2VPX A;  4S1T A;  3VMH A;  3CCU 1;  1YHQ 1;  1QVG Y;  3QWU A;  2E2H I;  2O53 A;  2VPZ A;  1QVF Y;  3NH5 A;  3HOX I;  4NBD A;  5A2Q f;  3J7A 4;  2IV2 X;  1I6H I;  3NDI A;  1SIW A;  4E32 A;  1YUA A;  4Y7N I;  2QEX 1;  3JAM f;  1ML8 A;  2OOX B;  1KRL A;  1VQ6 Z;  3NH8 A;  2HU9 A;  2PMZ A;  1W2B Z;  4A3D I;  3CCL 1;  4QTT A;  2W04 A;  4BY7 I;  4MXU A;  1ZB8 A;  3I4M I;  1S72 1;  2JIQ A;  3G4S 1;  5IP9 I;  3CCR 1;  3HOW I;  1VQO 1;  3PO3 I;  1TFI A;  5CM2 M;  1Q81 2;  3CPW Y;  1VQN Z;  1Z03 A;  4BBR I;  3F3F C;  1Q86 2;  3U50 C;  4RVG A;  3GTK I;  2V8K A;  4X6A I;  3GTJ I;  3KIF A;  2F4M A;  2F4O A;  1TWC I;  3I55 1;  3GCF A;  1QYP A;  4MD7 A;  3S1M I;  4NBE A;  2JA8 I;  2YAD A;  2VF1 A;  3CME Z;  3CCS 1;  3CC7 1;  3HOV I;  2R93 I;  1RQF A;  1N8R 1;  1Q82 1;  2IZ4 A;  3CCV Z;  1FDI A;  3CC2 Z;  2OTL 1;  3GTM S;  3RZO I;  4HGY A;  1VQP 1;  1P9N A;  1TWA I;  3S1Q I;  4Y52 I;  2JUB A;  4DGL A;  4TNU A;  3TE5 B;  2GTI A;  1RO0 A;  3CCM Z;  3S2H I;  1YJN Z;  3J81 f;  3IF8 A;  1YJW Z;  2NVQ I;  1M1K 1;  3F3P C;  3CCQ 1;  2O4H A;  4NFR A;  1Z02 A;  1L1O C;  2QRD B;  1YIT 1;  2HF1 A;  2R92 I;  3I07 A;  3S14 I;  2BJO A;  2QA4 Z;  2KPI A;  1VLA A;  4NOZ A;  4E30 A;  4E2Y A;  2OTJ Z;  1NJI 1;  3H3V J;  1ZB9 A;  3GTG I;  1KQS Z;  2Q51 A;  1VQM Z;  2WAQ A;  3D6W A;  1TWF I;  1RO2 A;  4XX2 A;  2B63 I;  3I56 Z;  1VQK Z;  2QRE B;  2P3Y A;  3VTN A;  3NH4 A;  1VQ5 Z;  5FLM I;  3J80 b;  4A3I I;  4NBC A;  2E7Z A;  2JIR A;  1KD1 1;  2VPY A;  2JA6 I;  5T67 A;  1Y1V S;  4E2X A;  3NDJ A;  3CCJ Z;  2E2J I;  3CXC Y;  2IZ3 A;  2KI7 B;  3M3Y I;  2EGT A;  3CCV 1;  1TWH I;  3HOZ I;  2RBL A;  3CC2 1;  1RO4 A;  2OZK A;  2M6N A;  1VQ4 Z;  1SFO I;  1YIJ 1;  2K5R A;  3CD6 Z;  3S17 I;  2JMO A;  1Q82 2;  1JJ2 Z;  3H0G I;  1X3Z A;  5IT9 b;  2PM9 A;  3CCM 1;  2LIY A;  1YJN 1;  1YJW 1;  1VQ7 Z;  1YI2 Z;  4RVD A;  2DE6 A;  3CQZ I;  1NUI A;  2RT9 A;  1USP B;  2RPR A;  1DL6 A;  3S16 I;  4MON A;  1M90 1;  2YU9 I;  2NAP A;  4NBG A;  4BY1 I;  3HKZ A;  5A2Q b;  2QA4 1;  1WII A;  3MON A;  1M1K 2;  2PK7 A;  3OW2 Y;  1K73 1;  3JAM b;  1X0T A;  2OTJ 1;  1QXF A;  3GTL I;  2P28 A;  2QKD A;  2ZAE B;  1Z01 A;  2QR1 B;  4A3E I;  1VQM 1;  4RS4 A;  4QTU A;  3RZD I;  1QVG Z;  3LUS A;  5D1O A;  5FLX f;  3EER A;  1NJI 2;  3I56 1;  1QVF Z;  1RNI A;  4BBS I;  3G6E Z;  1VQ5 1;  2JA5 I;  3CC4 Z;  3FKI I;  3EED A;  2LEX A;  3PO3 S;  1ZH1 A;  3CCJ 1;  2JA7 I;  1WZN A;  3IR7 A;  4NB9 A;  5AN9 F;  3G71 Z;  2AKL A;  1VQ6 1;  1FDO A;  1KD1 2;  4A3B I;  4HGZ A;  1VQ4 1; 
#chains in the Genus database with same CATH homology
 3G4S Z;  2G2K A;  3FQQ A;  3CD6 1;  4NH1 C;  2Y0S A;  4NB8 A;  4NBH A;  3CCE Z;  3KIH A;  3P5J B;  3CPW Z;  3BG0 B;  1QF8 A;  2DE5 A;  1VQ7 1;  1YI2 1;  1VQ9 Z;  1VQN 1;  1YJ9 Z;  2LFU A;  5D1O B;  3S15 I;  4A3J I;  5LL6 f;  4RV9 A;  2GU2 A;  2VUM I;  1USP A;  3J81 b;  1VQ8 Z;  2J6A A;  3CME 1;  4E2W A;  1Q7Y 1;  3T4N B;  2M48 A;  3GKQ A;  2RIQ A;  4AYB A;  1M90 2;  1WCM I;  4A3C I;  1K73 2;  5IP7 I;  1VQL Z;  1K83 I;  3D9X A;  3I4N I;  3VB9 A;  1N8R 2;  3K7A I;  3G6E 1;  4EWC A;  3CC4 1;  3IFU A;  4HH4 A;  3S1R I;  3GTQ I;  2NVT I;  4A3M I;  2E9H A;  1KC8 1;  4MRI A;  1K8A 1;  3CCQ Z;  2R7Z I;  4E2Z A;  3GTM I;  1YIT Z;  2DE7 A;  1K9M 1;  2E2I I;  3G71 1;  3BG1 B;  2JNY A;  3CMA Z;  5C4X I;  4RVF A;  4MH4 A;  2OOY B;  3TDH B;  1WW9 A;  1N2F A;  3Q87 A;  1S7M A;  3CCE 1;  5C3E I;  1KQS Y;  5D1P A;  1RLY A;  5C44 I;  1YUK A;  1JWH C;  1VQ9 1;  2QRC B;  3CCU Z;  1YJ9 1;  1YHQ Z;  2I3C A;  2K3R A;  5C4J I;  4A3L I;  4DK1 A;  2V8J A;  4BXX I;  2QLV B;  2W03 A;  1VQK 1;  3HOY I;  2NVX I;  3CXC Z;  1VQ8 1;  2QEX Z;  2WB1 A;  4MD9 A;  3PO2 I;  1PFT A;  4E31 A;  1I3Q I;  2NVY I;  3CCL Z;  1NP6 A;  1Y1W I;  1YIJ Z;  1W2B Y;  4A3K I;  1Q81 1;  3MZK B;  1VQL 1;  1S72 Z;  1Q7Y 2;  1Q86 1;  2H85 A;  3M4O I;  2R6M A;  3CCR Z;  1JJ2 Y;  3IX0 A;  1Y1V I;  4A3G I;  2VUG A;  5T64 A;  1VQO Z;  3S2D I;  4A93 I;  1LQL A;  4NBF A;  3J80 f;  3GTP I;  3S1N I;  4DQY B;  2Q4Z A;  4NBB A;  4CL1 A;  5FLX b;  3FQM A;  5T6B A;  4MD8 A;  3CMA 1;  2V8I A;  3I55 Z;  1R9T I;  2JS4 A;  3VMG A;  4NBA A;  3VMI A;  4A3F I;  3OW2 Z;  1KC8 2;  1K8A 2;  3CCS Z;  3CC7 Z;  3ESW A;  1K9M 2;  4RVH A;  2GTH A;  2RHB A;  1X3W A;  2JR6 A;  5IT9 f;  3MZL B;  2OTL Z;  3GTO I;  3HOU I;  3NFZ A;  1I50 I;  1VQP Z;  4E33 A;  1TWG I;  4S1T A;  3VMH A;  3CCU 1;  1YHQ 1;  1QVG Y;  3QWU A;  2E2H I;  2O53 A;  1QVF Y;  3NH5 A;  3HOX I;  4NBD A;  5A2Q f;  3J7A 4;  1I6H I;  3NDI A;  4E32 A;  1YUA A;  4Y7N I;  2QEX 1;  3JAM f;  1ML8 A;  2OOX B;  1KRL A;  1VQ6 Z;  3NH8 A;  2HU9 A;  2PMZ A;  1W2B Z;  4A3D I;  3CCL 1;  4QTT A;  2W04 A;  4BY7 I;  4MXU A;  1ZB8 A;  3I4M I;  1S72 1;  3G4S 1;  5IP9 I;  3CCR 1;  3HOW I;  1VQO 1;  3PO3 I;  1TFI A;  5CM2 M;  1Q81 2;  3CPW Y;  1VQN Z;  1Z03 A;  4BBR I;  3F3F C;  1Q86 2;  3U50 C;  4RVG A;  3GTK I;  2V8K A;  4X6A I;  3GTJ I;  3KIF A;  2F4M A;  2F4O A;  1TWC I;  3I55 1;  3GCF A;  1QYP A;  4MD7 A;  3S1M I;  4NBE A;  2JA8 I;  2YAD A;  2VF1 A;  3CME Z;  3CCS 1;  3CC7 1;  3HOV I;  2R93 I;  1RQF A;  1N8R 1;  1Q82 1;  2IZ4 A;  3CCV Z;  3CC2 Z;  2OTL 1;  3GTM S;  3RZO I;  4HGY A;  1VQP 1;  1P9N A;  1TWA I;  3S1Q I;  4Y52 I;  2JUB A;  4DGL A;  4TNU A;  3TE5 B;  2GTI A;  1RO0 A;  3CCM Z;  3S2H I;  1YJN Z;  3J81 f;  3IF8 A;  1YJW Z;  2NVQ I;  1M1K 1;  3F3P C;  3CCQ 1;  2O4H A;  4NFR A;  1Z02 A;  1L1O C;  2QRD B;  1YIT 1;  2HF1 A;  2R92 I;  3I07 A;  3S14 I;  2BJO A;  2QA4 Z;  2KPI A;  1VLA A;  4NOZ A;  4E30 A;  4E2Y A;  2OTJ Z;  1NJI 1;  3H3V J;  1ZB9 A;  3GTG I;  1KQS Z;  2Q51 A;  1VQM Z;  2WAQ A;  3D6W A;  1TWF I;  1RO2 A;  4XX2 A;  2B63 I;  3I56 Z;  1VQK Z;  2QRE B;  2P3Y A;  3VTN A;  3NH4 A;  1VQ5 Z;  5FLM I;  3J80 b;  4A3I I;  4NBC A;  1KD1 1;  2JA6 I;  5T67 A;  1Y1V S;  4E2X A;  3NDJ A;  3CCJ Z;  2E2J I;  3CXC Y;  2IZ3 A;  2KI7 B;  3M3Y I;  2EGT A;  3CCV 1;  1TWH I;  3HOZ I;  2RBL A;  3CC2 1;  1RO4 A;  2OZK A;  2M6N A;  1VQ4 Z;  1SFO I;  1YIJ 1;  2K5R A;  3CD6 Z;  3S17 I;  2JMO A;  1Q82 2;  1JJ2 Z;  3H0G I;  1X3Z A;  5IT9 b;  2PM9 A;  3CCM 1;  2LIY A;  1YJN 1;  1YJW 1;  1VQ7 Z;  1YI2 Z;  4RVD A;  2DE6 A;  3CQZ I;  1NUI A;  2RT9 A;  1USP B;  2RPR A;  1DL6 A;  3S16 I;  4MON A;  1M90 1;  2YU9 I;  4NBG A;  4BY1 I;  3HKZ A;  5A2Q b;  2QA4 1;  1WII A;  3MON A;  1M1K 2;  2PK7 A;  3OW2 Y;  1K73 1;  3JAM b;  1X0T A;  2OTJ 1;  3GTL I;  2P28 A;  2QKD A;  2ZAE B;  1Z01 A;  2QR1 B;  4A3E I;  1VQM 1;  4RS4 A;  4QTU A;  3RZD I;  1QVG Z;  3LUS A;  5D1O A;  5FLX f;  3EER A;  1NJI 2;  3I56 1;  1QVF Z;  1RNI A;  4BBS I;  3G6E Z;  1VQ5 1;  2JA5 I;  3CC4 Z;  3FKI I;  3EED A;  3PO3 S;  1ZH1 A;  3CCJ 1;  2JA7 I;  4NB9 A;  5AN9 F;  3G71 Z;  2AKL A;  1VQ6 1;  1KD1 2;  4A3B I;  4HGZ A;  1VQ4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...