1JJ2Y

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Y00
1VQL1 2QA4Z 3CD6Z 1M1K1 1Q811 1W2BY 3CCQZ 3CCUZ 1Q822 3CC71 1VQOZ 1YJ9Z 3OW2Z 3I56Z 1YHQZ 1VQ61 1W2BZ 3I551 1VQP1 1VQ81 3CC21 1Q7Y2 1Q861 1VQ4Z 3CCR1 3G4SZ 3CCVZ 3CMAZ 1K732 1YI21 3CCM1 1VQMZ 1VQN1 3CCJ1 1Q821 1YIJZ 1YJNZ 2QEX1 3G6E1 1VQ7Z 1KQSY 1YIT1 1VQ91 1VQKZ 1Q7Y1 1VQLZ 3G71Z 1K8A2 3CXCY 1KQSZ 3CD61 1K731 3CC41 1K9M1 1N8R1 3CC7Z 3CCQ1 2OTL1 3CXCZ 1VQO1 1YJW1 3I55Z 1VQPZ 1VQ8Z 3CC2Z 3CME1 1S721 1VQ51 1K8A1 1M1K2 1VQ41 3CCE1 3CCS1 1QVFY 1YI2Z 1QVGY 3CCMZ 2OTJ1 1VQNZ 3CPWY 3CCL1 1M902 1KD12 2QEXZ 1YJN1 2QA41 1QVFZ 1YITZ 1VQ9Z 1QVGZ 3CPWZ 1KC82 3CCU1 1VQ6Z 1YJ91 3I561 1YHQ1 3OW2Y 3G711 3CC4Z 1NJI2 1M901 2OTLZ 1KD11 3CCRZ 1YJWZ 1Q812 3CMEZ 3G4S1 3CCV1 3CMA1 3CCJZ 1KC81 1VQM1 1JJ2Y 1S72Z 3G6EZ 1YIJ1 1VQ5Z 3CCEZ 3CCSZ 2OTJZ 1VQ71 3CCLZ 1Q862 1K9M2 1N8R2 1NJI1 1JJ2Z 1VQK1
chains in the Genus database with same CATH superfamily
2QR1B 2JA5I 2R92I 2R6MA 1W2BY 4NB8A 2M48A 1ML8A 1VQOZ 3GTPI 2OZKA 3NH4A 1W2BZ 2QKDA 1Q861 1ZB9A 3GCFA 4NBAA 1ZB8A 3CQZI 1VQ4Z 3CCR1 3HKZA 3NFZA 4NBEA 2QREB 3J7A4 2DE7A 2H85A 4E32A 1VQMZ 2NVXI 2JA6I 3MZKB 2RIQA 1VQ7Z 1KQSY 3RZOI 1VQKZ 3J81b 3M3YI 1K83I 3IR7A 5IT9f 2K5RA 1KQSZ 1K9M1 3HOZI 2Q4ZA 2LIYA 2OTL1 1VQO1 3HOYI 3GTGI 1I3QI 1VQ8Z 4X6AI 1WIIA 3J80f 3IX0A 5D1OB 5A2Qf 4BBRI 4CL1A 2LFUA 1M1K2 1VQ41 3S1QI 1YI2Z 2G2KA 1QVGY 3CCMZ 3FQQA 3CPWY 1P9NA 3CCL1 3NH8A 2IV2X 2V8JA 2R7ZI 2QA41 1YITZ 1QVGZ 2JNYA 3CPWZ 4TNUA 3S15I 1KC82 2B63I 2IZ4A 2RPRA 4DK1A 1VQ6Z 2JIQA 2V8KA 3IFUA 2WB1A 2BJOA 1YHQ1 3VMIA 1QXFA 4HH4A 1WW9A 2QRCB 1Y8CA 4BBSI 1USPB 3LUSA 3U50C 1KRLA 2F4MA 3CMA1 3CCJZ 1X3WA 2RT9A 3H3VJ 3HOVI 1KC81 3S2DI 2KPIA 3HOXI 1S72Z 1VQ5Z 4E2WA 4MXUA 3CCSZ 3EERA 3T4NB 1N8R2 4NBGA 3GTQI 1VQL1 3CD6Z 4NBBA 3F3PC 4A3KI 2R93I 3VMHA 3CCUZ 3I4MI 3CC71 3TDHB 2NVTI 1YJ9Z 1VQ61 1Y1VI 4NH1C 4QTUA 5IP7I 3PO3S 2OOYB 4RVGA 3CC21 1Q7Y2 3BG0B 2JS4A 3HOWI 1YUAA 1TWAI 3GTLI 2VUMI 3CCVZ 1K732 4A3II 2DE6A 4A3EI 3CCJ1 1YIJZ 3J81f 2V8IA 1Q7Y1 3TE5B 3I07A 1S7MA 3G71Z 3JAMb 1Y1VS 1K8A2 3KIHA 4A3LI 3CXCY 3BG1B 2IZ3A 3CD61 1PFTA 1K731 3CC41 2M6NA 3Q87A 3ESWA 3CXCZ 3I55Z 2JIPA 1VQPZ 3NH5A 3D9XA 4MD7A 1K8A1 2E9HA 2JA7I 1YUKA 1QVFY 2OTJ1 3D2LA 1VQNZ 3H0GI 4E31A 1M902 5T64A 2QRDB 2QEXZ 1QYPA 4DQYB 4NBFA 3GTOI 4NBCA 1QVFZ 5FLMI 1VQ9Z 3P5JB 4E30A 2JA8I 4RS4A 3OW2Y 3G711 1SFOI 1M901 4Y7NI 2RHBA 1Z02A 1YJWZ 4BXXI 1Q812 3CMEZ 2O53A 5AN9F 3FQMA 3QWUA 1VQM1 1X3ZA 3CCEZ 1VQ71 4BY1I 2E2II 1VQK1 3S2HI 5C3EI 1RO0A 3F3FC 1M1K1 1Q811 2JMOA 1JWHC 5T67A 1RO4A 3CCQZ 1RQFA 4A3CI 2PMZA 1TWCI 2HU9A 1I50I 2F4OA 1LQLA 2AYDA 3I56Z 1I6HI 5FLXb 2VPYA 1TWHI 4E33A 3PO3I 1VQ81 2NVYI 4A3JI 3FKII 2E2HI 4AYBA 4A3MI 5C4JI 3G4SZ 3GKQA 4NFRA 3VMGA 1YI21 3CCM1 1YJNZ 4NBDA 1SIWA 1FDOA 2YU9I 3JAMf 1YIT1 5T6BA 2YADA 3S1MI 1L1OC 4RV9A 2E2JI 3MZLB 5LL6f 3S16I 4HGZA 1N8R1 3CCQ1 1Q16A 2Q51A 4NB9A 3IF8A 3HOUI 2P3YA 1S721 1VQ51 1VLAA 2O4HA 2AKLA 3CCS1 1FDIA 2E7ZA 2GTIA 3VTNA 1R9TI 2EGTA 1ZH1A 2OOXB 4XX2A 3RZDI 1YJN1 2RBLA 1TWGI 3CCU1 3PO2I 2V3VA 2GU2A 1YJ91 4S1TA 2JIRA 2VPZA 4QTTA 4A3DI 2OTLZ 2P28A 3KIFA 2VPXA 4A3BI 3CCV1 4Y52I 4MD8A 3S14I 3G6EZ 1YIJ1 4DGLA 4NBHA 4A3GI 2JIMA 3NDIA 1WJ2A 3CCLZ 4A93I 2I3CA 1K9M2 4RVFA 1WZNA 4E2ZA 2KI7B 2QA4Z 2PM9A 2W04A 2VF1A 3S1NI 1Q822 5FLXf 4E2XA 1TWFI 3OW2Z 1YHQZ 2QLVB 2JUBA 1TFIA 3I551 1QF8A 1VQP1 3MONA 4RVHA 1Z03A 3S17I 3CMAZ 3I4NI 1VQN1 1Q821 2QEX1 3D6WA 3S1RI 3G6E1 1RLYA 4BY7I 5IP9I 2ZAEB 1VQ91 3GTKI 2WAQA 1VQLZ 2JR6A 4RVDA 4MD9A 3VB9A 1Y1WI 1X0TA 4A3FI 2HF1A 2VPWA 3CC7Z 5IT9b 1YJW1 5D1OA 3CC2Z 3CME1 1NUIA 4HGYA 1N2FA 3CCE1 2VUGA 5C4XI 3J80b 5A2Qb 2W03A 2K3RA 1KD12 2LEXA 2J6AA 2PK7A 2NAPA 2NVQI 2GTHA 5C44I 3NDJA 5CM2M 3GTMI 3GTJI 3I561 1RNIA 4NOZA 3CC4Z 1USPA 1NJI2 4E2YA 1KD11 1RO2A 3K7AI 3CCRZ 2JIOA 1AA6A 5D1PA 2V45A 4MH4A 3G4S1 3M4OI 1Z01A 1JJ2Y 3EEDA 4MONA 1NP6A 4EWCA 2Y0SA 1DL6A 2DE5A 2OTJZ 3GTMS 4MRIA 1WCMI 1Q862 1NJI1 1JJ2Z
chains in the Genus database with same CATH topology
2QR1B 2JA5I 2R92I 2R6MA 1W2BY 4NB8A 2M48A 1ML8A 1VQOZ 3GTPI 2OZKA 3NH4A 1W2BZ 2QKDA 1Q861 1ZB9A 3GCFA 4NBAA 1ZB8A 3CQZI 1VQ4Z 3CCR1 3HKZA 3NFZA 4NBEA 2QREB 3J7A4 2DE7A 2H85A 4E32A 1VQMZ 2NVXI 2JA6I 3MZKB 2RIQA 1VQ7Z 1KQSY 3RZOI 1VQKZ 3J81b 3M3YI 1K83I 5IT9f 2K5RA 1KQSZ 1K9M1 3HOZI 2Q4ZA 2LIYA 2OTL1 1VQO1 3HOYI 3GTGI 1I3QI 1VQ8Z 4X6AI 1WIIA 3J80f 3IX0A 5D1OB 5A2Qf 4BBRI 4CL1A 2LFUA 1M1K2 1VQ41 3S1QI 1YI2Z 2G2KA 1QVGY 3CCMZ 3FQQA 3CPWY 1P9NA 3CCL1 3NH8A 2V8JA 2R7ZI 2QA41 1YITZ 1QVGZ 2JNYA 3CPWZ 4TNUA 3S15I 1KC82 2B63I 2IZ4A 2RPRA 4DK1A 1VQ6Z 2V8KA 3IFUA 2WB1A 2BJOA 1YHQ1 3VMIA 4HH4A 1WW9A 2QRCB 4BBSI 1USPB 3LUSA 3U50C 1KRLA 2F4MA 3CMA1 3CCJZ 1X3WA 2RT9A 3H3VJ 3HOVI 1KC81 3S2DI 2KPIA 3HOXI 1S72Z 1VQ5Z 4E2WA 4MXUA 3CCSZ 3EERA 3T4NB 1N8R2 4NBGA 3GTQI 1VQL1 3CD6Z 4NBBA 3F3PC 4A3KI 2R93I 3VMHA 3CCUZ 3I4MI 3CC71 3TDHB 2NVTI 1YJ9Z 1VQ61 1Y1VI 4NH1C 4QTUA 5IP7I 3PO3S 2OOYB 4RVGA 3CC21 1Q7Y2 3BG0B 2JS4A 3HOWI 1YUAA 1TWAI 3GTLI 2VUMI 3CCVZ 1K732 4A3II 2DE6A 4A3EI 3CCJ1 1YIJZ 3J81f 2V8IA 1Q7Y1 3TE5B 3I07A 1S7MA 3G71Z 3JAMb 1Y1VS 1K8A2 3KIHA 4A3LI 3CXCY 3BG1B 2IZ3A 3CD61 1PFTA 1K731 3CC41 2M6NA 3Q87A 3ESWA 3CXCZ 3I55Z 1VQPZ 3NH5A 3D9XA 4MD7A 1K8A1 2E9HA 2JA7I 1YUKA 1QVFY 2OTJ1 1VQNZ 3H0GI 4E31A 1M902 5T64A 2QRDB 2QEXZ 1QYPA 4DQYB 4NBFA 3GTOI 4NBCA 1QVFZ 5FLMI 1VQ9Z 3P5JB 4E30A 2JA8I 4RS4A 3OW2Y 3G711 1SFOI 1M901 4Y7NI 2RHBA 1Z02A 1YJWZ 4BXXI 1Q812 3CMEZ 2O53A 5AN9F 3FQMA 3QWUA 1VQM1 1X3ZA 3CCEZ 1VQ71 4BY1I 2E2II 1VQK1 3S2HI 5C3EI 1RO0A 3F3FC 1M1K1 1Q811 2JMOA 1JWHC 5T67A 1RO4A 3CCQZ 1RQFA 4A3CI 2PMZA 1TWCI 2HU9A 1I50I 2F4OA 1LQLA 3I56Z 1I6HI 5FLXb 1TWHI 4E33A 3PO3I 1VQ81 2NVYI 4A3JI 3FKII 2E2HI 4AYBA 4A3MI 5C4JI 3G4SZ 3GKQA 4NFRA 3VMGA 1YI21 3CCM1 1YJNZ 4NBDA 2YU9I 3JAMf 1YIT1 5T6BA 2YADA 3S1MI 1L1OC 4RV9A 2E2JI 3MZLB 5LL6f 3S16I 4HGZA 1N8R1 3CCQ1 2Q51A 4NB9A 3IF8A 3HOUI 2P3YA 1S721 1VQ51 1VLAA 2O4HA 2AKLA 3CCS1 2GTIA 3VTNA 1R9TI 2EGTA 1ZH1A 2OOXB 4XX2A 3RZDI 1YJN1 2RBLA 1TWGI 3CCU1 3PO2I 2GU2A 1YJ91 4S1TA 4QTTA 4A3DI 2OTLZ 2P28A 3KIFA 4A3BI 3CCV1 4Y52I 4MD8A 3S14I 3G6EZ 1YIJ1 4DGLA 4NBHA 4A3GI 3NDIA 3CCLZ 4A93I 2I3CA 1K9M2 4RVFA 4E2ZA 2KI7B 2QA4Z 2PM9A 2W04A 2VF1A 3S1NI 1Q822 5FLXf 4E2XA 1TWFI 3OW2Z 1YHQZ 2QLVB 2JUBA 1TFIA 3I551 1QF8A 1VQP1 3MONA 4RVHA 1Z03A 3S17I 3CMAZ 3I4NI 1VQN1 1Q821 2QEX1 3D6WA 3S1RI 3G6E1 1RLYA 4BY7I 5IP9I 2ZAEB 1VQ91 3GTKI 2WAQA 1VQLZ 2JR6A 4RVDA 4MD9A 3VB9A 1Y1WI 1X0TA 4A3FI 2HF1A 3CC7Z 5IT9b 1YJW1 5D1OA 3CC2Z 3CME1 1NUIA 4HGYA 1N2FA 3CCE1 2VUGA 5C4XI 3J80b 5A2Qb 2W03A 2K3RA 1KD12 2J6AA 2PK7A 2NVQI 2GTHA 5C44I 3NDJA 5CM2M 3GTMI 3GTJI 3I561 1RNIA 4NOZA 3CC4Z 1USPA 1NJI2 4E2YA 1KD11 1RO2A 3K7AI 3CCRZ 5D1PA 4MH4A 3G4S1 3M4OI 1Z01A 1JJ2Y 3EEDA 4MONA 1NP6A 4EWCA 2Y0SA 1DL6A 2DE5A 2OTJZ 3GTMS 4MRIA 1WCMI 1Q862 1NJI1 1JJ2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL 1;  2QA4 Z;  3CD6 Z;  1M1K 1;  1Q81 1;  1W2B Y;  3CCQ Z;  3CCU Z;  1Q82 2;  3CC7 1;  1VQO Z;  1YJ9 Z;  3OW2 Z;  3I56 Z;  1YHQ Z;  1VQ6 1;  1W2B Z;  3I55 1;  1VQP 1;  1VQ8 1;  3CC2 1;  1Q7Y 2;  1Q86 1;  1VQ4 Z;  3CCR 1;  3G4S Z;  3CCV Z;  3CMA Z;  1K73 2;  1YI2 1;  3CCM 1;  1VQM Z;  1VQN 1;  3CCJ 1;  1Q82 1;  1YIJ Z;  1YJN Z;  2QEX 1;  3G6E 1;  1VQ7 Z;  1KQS Y;  1YIT 1;  1VQ9 1;  1VQK Z;  1Q7Y 1;  1VQL Z;  3G71 Z;  1K8A 2;  3CXC Y;  1KQS Z;  3CD6 1;  1K73 1;  3CC4 1;  1K9M 1;  1N8R 1;  3CC7 Z;  3CCQ 1;  2OTL 1;  3CXC Z;  1VQO 1;  1YJW 1;  3I55 Z;  1VQP Z;  1VQ8 Z;  3CC2 Z;  3CME 1;  1S72 1;  1VQ5 1;  1K8A 1;  1M1K 2;  1VQ4 1;  3CCE 1;  3CCS 1;  1QVF Y;  1YI2 Z;  1QVG Y;  3CCM Z;  2OTJ 1;  1VQN Z;  3CPW Y;  3CCL 1;  1M90 2;  1KD1 2;  2QEX Z;  1YJN 1;  2QA4 1;  1QVF Z;  1YIT Z;  1VQ9 Z;  1QVG Z;  3CPW Z;  1KC8 2;  3CCU 1;  1VQ6 Z;  1YJ9 1;  3I56 1;  1YHQ 1;  3OW2 Y;  3G71 1;  3CC4 Z;  1NJI 2;  1M90 1;  2OTL Z;  1KD1 1;  3CCR Z;  1YJW Z;  1Q81 2;  3CME Z;  3G4S 1;  3CCV 1;  3CMA 1;  3CCJ Z;  1KC8 1;  1VQM 1;  1JJ2 Y;  1S72 Z;  3G6E Z;  1YIJ 1;  1VQ5 Z;  3CCE Z;  3CCS Z;  2OTJ Z;  1VQ7 1;  3CCL Z;  1Q86 2;  1K9M 2;  1N8R 2;  1NJI 1;  1JJ2 Z;  1VQK 1; 
#chains in the Genus database with same CATH topology
 2QR1 B;  2JA5 I;  2R92 I;  2R6M A;  1W2B Y;  4NB8 A;  2M48 A;  1ML8 A;  1VQO Z;  3GTP I;  2OZK A;  3NH4 A;  1W2B Z;  2QKD A;  1Q86 1;  1ZB9 A;  3GCF A;  4NBA A;  1ZB8 A;  3CQZ I;  1VQ4 Z;  3CCR 1;  3HKZ A;  3NFZ A;  4NBE A;  2QRE B;  3J7A 4;  2DE7 A;  2H85 A;  4E32 A;  1VQM Z;  2NVX I;  2JA6 I;  3MZK B;  2RIQ A;  1VQ7 Z;  1KQS Y;  3RZO I;  1VQK Z;  3J81 b;  3M3Y I;  1K83 I;  3IR7 A;  5IT9 f;  2K5R A;  1KQS Z;  1K9M 1;  3HOZ I;  2Q4Z A;  2LIY A;  2OTL 1;  1VQO 1;  3HOY I;  3GTG I;  1I3Q I;  1VQ8 Z;  4X6A I;  1WII A;  3J80 f;  3IX0 A;  5D1O B;  5A2Q f;  4BBR I;  4CL1 A;  2LFU A;  1M1K 2;  1VQ4 1;  3S1Q I;  1YI2 Z;  2G2K A;  1QVG Y;  3CCM Z;  3FQQ A;  3CPW Y;  1P9N A;  3CCL 1;  3NH8 A;  2IV2 X;  2V8J A;  2R7Z I;  2QA4 1;  1YIT Z;  1QVG Z;  2JNY A;  3CPW Z;  4TNU A;  3S15 I;  1KC8 2;  2B63 I;  2IZ4 A;  2RPR A;  4DK1 A;  1VQ6 Z;  2JIQ A;  2V8K A;  3IFU A;  2WB1 A;  2BJO A;  1YHQ 1;  3VMI A;  1QXF A;  4HH4 A;  1WW9 A;  2QRC B;  1Y8C A;  4BBS I;  1USP B;  3LUS A;  3U50 C;  1KRL A;  2F4M A;  3CMA 1;  3CCJ Z;  1X3W A;  2RT9 A;  3H3V J;  3HOV I;  1KC8 1;  3S2D I;  2KPI A;  3HOX I;  1S72 Z;  1VQ5 Z;  4E2W A;  4MXU A;  3CCS Z;  3EER A;  3T4N B;  1N8R 2;  4NBG A;  3GTQ I;  1VQL 1;  3CD6 Z;  4NBB A;  3F3P C;  4A3K I;  2R93 I;  3VMH A;  3CCU Z;  3I4M I;  3CC7 1;  3TDH B;  2NVT I;  1YJ9 Z;  1VQ6 1;  1Y1V I;  4NH1 C;  4QTU A;  5IP7 I;  3PO3 S;  2OOY B;  4RVG A;  3CC2 1;  1Q7Y 2;  3BG0 B;  2JS4 A;  3HOW I;  1YUA A;  1TWA I;  3GTL I;  2VUM I;  3CCV Z;  1K73 2;  4A3I I;  2DE6 A;  4A3E I;  3CCJ 1;  1YIJ Z;  3J81 f;  2V8I A;  1Q7Y 1;  3TE5 B;  3I07 A;  1S7M A;  3G71 Z;  3JAM b;  1Y1V S;  1K8A 2;  3KIH A;  4A3L I;  3CXC Y;  3BG1 B;  2IZ3 A;  3CD6 1;  1PFT A;  1K73 1;  3CC4 1;  2M6N A;  3Q87 A;  3ESW A;  3CXC Z;  3I55 Z;  2JIP A;  1VQP Z;  3NH5 A;  3D9X A;  4MD7 A;  1K8A 1;  2E9H A;  2JA7 I;  1YUK A;  1QVF Y;  2OTJ 1;  3D2L A;  1VQN Z;  3H0G I;  4E31 A;  1M90 2;  5T64 A;  2QRD B;  2QEX Z;  1QYP A;  4DQY B;  4NBF A;  3GTO I;  4NBC A;  1QVF Z;  5FLM I;  1VQ9 Z;  3P5J B;  4E30 A;  2JA8 I;  4RS4 A;  3OW2 Y;  3G71 1;  1SFO I;  1M90 1;  4Y7N I;  2RHB A;  1Z02 A;  1YJW Z;  4BXX I;  1Q81 2;  3CME Z;  2O53 A;  5AN9 F;  3FQM A;  3QWU A;  1VQM 1;  1X3Z A;  3CCE Z;  1VQ7 1;  4BY1 I;  2E2I I;  1VQK 1;  3S2H I;  5C3E I;  1RO0 A;  3F3F C;  1M1K 1;  1Q81 1;  2JMO A;  1JWH C;  5T67 A;  1RO4 A;  3CCQ Z;  1RQF A;  4A3C I;  2PMZ A;  1TWC I;  2HU9 A;  1I50 I;  2F4O A;  1LQL A;  2AYD A;  3I56 Z;  1I6H I;  5FLX b;  2VPY A;  1TWH I;  4E33 A;  3PO3 I;  1VQ8 1;  2NVY I;  4A3J I;  3FKI I;  2E2H I;  4AYB A;  4A3M I;  5C4J I;  3G4S Z;  3GKQ A;  4NFR A;  3VMG A;  1YI2 1;  3CCM 1;  1YJN Z;  4NBD A;  1SIW A;  1FDO A;  2YU9 I;  3JAM f;  1YIT 1;  5T6B A;  2YAD A;  3S1M I;  1L1O C;  4RV9 A;  2E2J I;  3MZL B;  5LL6 f;  3S16 I;  4HGZ A;  1N8R 1;  3CCQ 1;  1Q16 A;  2Q51 A;  4NB9 A;  3IF8 A;  3HOU I;  2P3Y A;  1S72 1;  1VQ5 1;  1VLA A;  2O4H A;  2AKL A;  3CCS 1;  1FDI A;  2E7Z A;  2GTI A;  3VTN A;  1R9T I;  2EGT A;  1ZH1 A;  2OOX B;  4XX2 A;  3RZD I;  1YJN 1;  2RBL A;  1TWG I;  3CCU 1;  3PO2 I;  2V3V A;  2GU2 A;  1YJ9 1;  4S1T A;  2JIR A;  2VPZ A;  4QTT A;  4A3D I;  2OTL Z;  2P28 A;  3KIF A;  2VPX A;  4A3B I;  3CCV 1;  4Y52 I;  4MD8 A;  3S14 I;  3G6E Z;  1YIJ 1;  4DGL A;  4NBH A;  4A3G I;  2JIM A;  3NDI A;  1WJ2 A;  3CCL Z;  4A93 I;  2I3C A;  1K9M 2;  4RVF A;  1WZN A;  4E2Z A;  2KI7 B;  2QA4 Z;  2PM9 A;  2W04 A;  2VF1 A;  3S1N I;  1Q82 2;  5FLX f;  4E2X A;  1TWF I;  3OW2 Z;  1YHQ Z;  2QLV B;  2JUB A;  1TFI A;  3I55 1;  1QF8 A;  1VQP 1;  3MON A;  4RVH A;  1Z03 A;  3S17 I;  3CMA Z;  3I4N I;  1VQN 1;  1Q82 1;  2QEX 1;  3D6W A;  3S1R I;  3G6E 1;  1RLY A;  4BY7 I;  5IP9 I;  2ZAE B;  1VQ9 1;  3GTK I;  2WAQ A;  1VQL Z;  2JR6 A;  4RVD A;  4MD9 A;  3VB9 A;  1Y1W I;  1X0T A;  4A3F I;  2HF1 A;  2VPW A;  3CC7 Z;  5IT9 b;  1YJW 1;  5D1O A;  3CC2 Z;  3CME 1;  1NUI A;  4HGY A;  1N2F A;  3CCE 1;  2VUG A;  5C4X I;  3J80 b;  5A2Q b;  2W03 A;  2K3R A;  1KD1 2;  2LEX A;  2J6A A;  2PK7 A;  2NAP A;  2NVQ I;  2GTH A;  5C44 I;  3NDJ A;  5CM2 M;  3GTM I;  3GTJ I;  3I56 1;  1RNI A;  4NOZ A;  3CC4 Z;  1USP A;  1NJI 2;  4E2Y A;  1KD1 1;  1RO2 A;  3K7A I;  3CCR Z;  2JIO A;  1AA6 A;  5D1P A;  2V45 A;  4MH4 A;  3G4S 1;  3M4O I;  1Z01 A;  1JJ2 Y;  3EED A;  4MON A;  1NP6 A;  4EWC A;  2Y0S A;  1DL6 A;  2DE5 A;  2OTJ Z;  3GTM S;  4MRI A;  1WCM I;  1Q86 2;  1NJI 1;  1JJ2 Z; 
#chains in the Genus database with same CATH homology
 2QR1 B;  2JA5 I;  2R92 I;  2R6M A;  1W2B Y;  4NB8 A;  2M48 A;  1ML8 A;  1VQO Z;  3GTP I;  2OZK A;  3NH4 A;  1W2B Z;  2QKD A;  1Q86 1;  1ZB9 A;  3GCF A;  4NBA A;  1ZB8 A;  3CQZ I;  1VQ4 Z;  3CCR 1;  3HKZ A;  3NFZ A;  4NBE A;  2QRE B;  3J7A 4;  2DE7 A;  2H85 A;  4E32 A;  1VQM Z;  2NVX I;  2JA6 I;  3MZK B;  2RIQ A;  1VQ7 Z;  1KQS Y;  3RZO I;  1VQK Z;  3J81 b;  3M3Y I;  1K83 I;  5IT9 f;  2K5R A;  1KQS Z;  1K9M 1;  3HOZ I;  2Q4Z A;  2LIY A;  2OTL 1;  1VQO 1;  3HOY I;  3GTG I;  1I3Q I;  1VQ8 Z;  4X6A I;  1WII A;  3J80 f;  3IX0 A;  5D1O B;  5A2Q f;  4BBR I;  4CL1 A;  2LFU A;  1M1K 2;  1VQ4 1;  3S1Q I;  1YI2 Z;  2G2K A;  1QVG Y;  3CCM Z;  3FQQ A;  3CPW Y;  1P9N A;  3CCL 1;  3NH8 A;  2V8J A;  2R7Z I;  2QA4 1;  1YIT Z;  1QVG Z;  2JNY A;  3CPW Z;  4TNU A;  3S15 I;  1KC8 2;  2B63 I;  2IZ4 A;  2RPR A;  4DK1 A;  1VQ6 Z;  2V8K A;  3IFU A;  2WB1 A;  2BJO A;  1YHQ 1;  3VMI A;  4HH4 A;  1WW9 A;  2QRC B;  4BBS I;  1USP B;  3LUS A;  3U50 C;  1KRL A;  2F4M A;  3CMA 1;  3CCJ Z;  1X3W A;  2RT9 A;  3H3V J;  3HOV I;  1KC8 1;  3S2D I;  2KPI A;  3HOX I;  1S72 Z;  1VQ5 Z;  4E2W A;  4MXU A;  3CCS Z;  3EER A;  3T4N B;  1N8R 2;  4NBG A;  3GTQ I;  1VQL 1;  3CD6 Z;  4NBB A;  3F3P C;  4A3K I;  2R93 I;  3VMH A;  3CCU Z;  3I4M I;  3CC7 1;  3TDH B;  2NVT I;  1YJ9 Z;  1VQ6 1;  1Y1V I;  4NH1 C;  4QTU A;  5IP7 I;  3PO3 S;  2OOY B;  4RVG A;  3CC2 1;  1Q7Y 2;  3BG0 B;  2JS4 A;  3HOW I;  1YUA A;  1TWA I;  3GTL I;  2VUM I;  3CCV Z;  1K73 2;  4A3I I;  2DE6 A;  4A3E I;  3CCJ 1;  1YIJ Z;  3J81 f;  2V8I A;  1Q7Y 1;  3TE5 B;  3I07 A;  1S7M A;  3G71 Z;  3JAM b;  1Y1V S;  1K8A 2;  3KIH A;  4A3L I;  3CXC Y;  3BG1 B;  2IZ3 A;  3CD6 1;  1PFT A;  1K73 1;  3CC4 1;  2M6N A;  3Q87 A;  3ESW A;  3CXC Z;  3I55 Z;  1VQP Z;  3NH5 A;  3D9X A;  4MD7 A;  1K8A 1;  2E9H A;  2JA7 I;  1YUK A;  1QVF Y;  2OTJ 1;  1VQN Z;  3H0G I;  4E31 A;  1M90 2;  5T64 A;  2QRD B;  2QEX Z;  1QYP A;  4DQY B;  4NBF A;  3GTO I;  4NBC A;  1QVF Z;  5FLM I;  1VQ9 Z;  3P5J B;  4E30 A;  2JA8 I;  4RS4 A;  3OW2 Y;  3G71 1;  1SFO I;  1M90 1;  4Y7N I;  2RHB A;  1Z02 A;  1YJW Z;  4BXX I;  1Q81 2;  3CME Z;  2O53 A;  5AN9 F;  3FQM A;  3QWU A;  1VQM 1;  1X3Z A;  3CCE Z;  1VQ7 1;  4BY1 I;  2E2I I;  1VQK 1;  3S2H I;  5C3E I;  1RO0 A;  3F3F C;  1M1K 1;  1Q81 1;  2JMO A;  1JWH C;  5T67 A;  1RO4 A;  3CCQ Z;  1RQF A;  4A3C I;  2PMZ A;  1TWC I;  2HU9 A;  1I50 I;  2F4O A;  1LQL A;  3I56 Z;  1I6H I;  5FLX b;  1TWH I;  4E33 A;  3PO3 I;  1VQ8 1;  2NVY I;  4A3J I;  3FKI I;  2E2H I;  4AYB A;  4A3M I;  5C4J I;  3G4S Z;  3GKQ A;  4NFR A;  3VMG A;  1YI2 1;  3CCM 1;  1YJN Z;  4NBD A;  2YU9 I;  3JAM f;  1YIT 1;  5T6B A;  2YAD A;  3S1M I;  1L1O C;  4RV9 A;  2E2J I;  3MZL B;  5LL6 f;  3S16 I;  4HGZ A;  1N8R 1;  3CCQ 1;  2Q51 A;  4NB9 A;  3IF8 A;  3HOU I;  2P3Y A;  1S72 1;  1VQ5 1;  1VLA A;  2O4H A;  2AKL A;  3CCS 1;  2GTI A;  3VTN A;  1R9T I;  2EGT A;  1ZH1 A;  2OOX B;  4XX2 A;  3RZD I;  1YJN 1;  2RBL A;  1TWG I;  3CCU 1;  3PO2 I;  2GU2 A;  1YJ9 1;  4S1T A;  4QTT A;  4A3D I;  2OTL Z;  2P28 A;  3KIF A;  4A3B I;  3CCV 1;  4Y52 I;  4MD8 A;  3S14 I;  3G6E Z;  1YIJ 1;  4DGL A;  4NBH A;  4A3G I;  3NDI A;  3CCL Z;  4A93 I;  2I3C A;  1K9M 2;  4RVF A;  4E2Z A;  2KI7 B;  2QA4 Z;  2PM9 A;  2W04 A;  2VF1 A;  3S1N I;  1Q82 2;  5FLX f;  4E2X A;  1TWF I;  3OW2 Z;  1YHQ Z;  2QLV B;  2JUB A;  1TFI A;  3I55 1;  1QF8 A;  1VQP 1;  3MON A;  4RVH A;  1Z03 A;  3S17 I;  3CMA Z;  3I4N I;  1VQN 1;  1Q82 1;  2QEX 1;  3D6W A;  3S1R I;  3G6E 1;  1RLY A;  4BY7 I;  5IP9 I;  2ZAE B;  1VQ9 1;  3GTK I;  2WAQ A;  1VQL Z;  2JR6 A;  4RVD A;  4MD9 A;  3VB9 A;  1Y1W I;  1X0T A;  4A3F I;  2HF1 A;  3CC7 Z;  5IT9 b;  1YJW 1;  5D1O A;  3CC2 Z;  3CME 1;  1NUI A;  4HGY A;  1N2F A;  3CCE 1;  2VUG A;  5C4X I;  3J80 b;  5A2Q b;  2W03 A;  2K3R A;  1KD1 2;  2J6A A;  2PK7 A;  2NVQ I;  2GTH A;  5C44 I;  3NDJ A;  5CM2 M;  3GTM I;  3GTJ I;  3I56 1;  1RNI A;  4NOZ A;  3CC4 Z;  1USP A;  1NJI 2;  4E2Y A;  1KD1 1;  1RO2 A;  3K7A I;  3CCR Z;  5D1P A;  4MH4 A;  3G4S 1;  3M4O I;  1Z01 A;  1JJ2 Y;  3EED A;  4MON A;  1NP6 A;  4EWC A;  2Y0S A;  1DL6 A;  2DE5 A;  2OTJ Z;  3GTM S;  4MRI A;  1WCM I;  1Q86 2;  1NJI 1;  1JJ2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...