1JJ2Y

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Y00
1YJNZ 1YI21 1VQMZ 3I561 3CC21 2QEX1 3I55Z 1JJ2Y 2OTJ1 3CCE1 3G6E1 3CCV1 2QA4Z 1YJ91 3CMAZ 3CC71 1VQOZ 3CCM1 1YIT1 3CCU1 1YI2Z 3I56Z 3CC2Z 1S721 1K8A1 2QEXZ 1VQ61 3CXCY 1YIJ1 1W2BY 1N8R1 1K8A2 1M1K1 2OTJZ 3G6EZ 3CCVZ 1QVFZ 3CPWZ 1Q821 1N8R2 1YJ9Z 1M1K2 3CC7Z 1Q822 1VQ71 3CCMZ 3CCUZ 1VQL1 1VQ81 1QVGZ 3CME1 1S72Z 1VQ6Z 1VQ51 2OTL1 1VQNZ 1M901 1KD11 1VQP1 1M902 3G711 1VQ7Z 1KD12 1VQLZ 1VQ8Z 1Q811 3CD61 1QVFY 3CPWY 3CMEZ 1Q812 1VQK1 3G4S1 3CCEZ 1VQ5Z 3CC41 1VQ91 2OTLZ 1VQPZ 1YITZ 1QVGY 1JJ2Z 3G71Z 3CCS1 1NJI1 1VQM1 1Q7Y1 3CD6Z 1YIJZ 3OW2Z 1NJI2 1Q861 3G4SZ 3CCJ1 1Q7Y2 1VQ9Z 3CC4Z 1Q862 1YHQ1 3CCR1 3CCL1 1YJW1 1KQSZ 3CCSZ 1KC81 1VQ41 1KC82 3CCQ1 3CCJZ 1YHQZ 3CCRZ 3CCLZ 1YJWZ 1K731 1K9M1 3OW2Y 1YJN1 1K732 1K9M2 1VQKZ 1VQ4Z 3I551 3CCQZ 1KQSY 2QA41 3CMA1 1VQN1 3CXCZ 1W2BZ 1VQO1
chains in the Genus database with same CATH superfamily
1RLYA 2IZ4A 2G2KA 2M48A 3Q87A 3BG1B 1JJ2Y 3CC71 1LQLA 4A3DI 2JS4A 3CCM1 3CCU1 4A3GI 5T67A 2QRDB 1Z02A 1VQ61 1YUKA 1YIJ1 3FQMA 2JIQA 3T4NB 3CC7Z 1VQ71 2PMZA 3CCMZ 3CCUZ 4E31A 4Y7NI 5C3EI 3CME1 2JA6I 1VQ6Z 3HKZA 2NAPA 1USPA 3VMIA 3TDHB 1VQ7Z 1KD12 5LL6f 4XX2A 4RS4A 2OOXB 3GTJI 3K7AI 2VPXA 1Q811 1USPB 3CQZI 3GTQI 2F4OA 3CPWY 3CMEZ 3VB9A 1VQ91 4CL1A 2OOYB 3VTNA 4RVHA 1NUIA 3I4MI 1QVGY 3NH4A 2JA5I 4A3JI 1X0TA 2WAQA 3S15I 3BG0B 1VQ9Z 3S1NI 1Q16A 1TFIA 1YHQ1 3S2HI 3CCL1 3RZDI 2NVYI 4A3LI 4RV9A 3S14I 1KC81 1VQ41 3VMHA 1ZB8A 2NVXI 1P9NA 1YHQZ 3CCLZ 3OW2Y 1YJN1 1X3ZA 4E2YA 3GTKI 4HGZA 1K732 2VPYA 2QR1B 2JUBA 1VQKZ 1VQ4Z 5IP7I 4NBAA 2KI7B 4MONA 1YJNZ 1YI21 1VQMZ 4NOZA 2ZAEB 3HOWI 1FDIA 4NFRA 1L1OC 2OTJ1 3KIFA 3PO2I 1YJ91 3LUSA 4AYBA 5FLMI 3U50C 4MXUA 2RIQA 5AN9F 1YI2Z 5CM2M 1WIIA 4MD8A 4NBCA 1K8A1 1Z01A 2P28A 1N8R1 1M1K1 4S1TA 2OTJZ 3CPWZ 1YJ9Z 1S7MA 1Q822 2E9HA 1QVGZ 4NBDA 4MD7A 4DK1A 4X6AI 4DQYB 3FQQA 1SFOI 1VQNZ 4RVGA 2PK7A 2RBLA 1M902 4A3EI 2OZKA 4NB9A 4NH1C 3G4S1 4HGYA 3CC41 3I4NI 2JMOA 1ZB9A 4Y52I 2AKLA 3GCFA 2K3RA 3H0GI 3CCS1 4E30A 4NBGA 3NFZA 1NJI1 2DE6A 3HOUI 1YIJZ 3OW2Z 3IR7A 2Q4ZA 3G4SZ 3CCJ1 2IV2X 1Q7Y2 3HOXI 4A93I 3CC4Z 2VPWA 4MH4A 1Q862 3NH8A 1TWCI 3CCSZ 2E2HI 2VPZA 2W03A 2V8KA 1I6HI 2JIPA 3CCJZ 5D1OA 3H3VJ 4A3MI 1WCMI 2YU9I 1PFTA 2O4HA 1K9M1 1Y1VI 3GTGI 4MD9A 5D1OB 2NVQI 3I551 3S2DI 1KQSY 2QA41 3PO3I 2E7ZA 2GU2A 4TNUA 3HOYI 3M4OI 3J81f 1VQO1 1WJ2A 3I561 3CC21 1YUAA 1NP6A 1QXFA 2QLVB 2QEX1 3S1QI 4E2XA 3I55Z 3IX0A 4BBSI 2P3YA 3CCE1 2R6MA 2IZ3A 3CCV1 2QA4Z 1TWHI 4A3CI 2NVTI 1VQOZ 1YIT1 4BY1I 3S1MI 3I56Z 1RO2A 3CC2Z 1I50I 1TWGI 2WB1A 4MRIA 2RT9A 2KPIA 2QEXZ 4A3II 2QRCB 3CXCY 4NBBA 5C44I 2HF1A 3CCVZ 3HOZI 3P5JB 3F3FC 1VQ81 1VQL1 1DL6A 2EGTA 2JR6A 2I3CA 2W04A 1SIWA 2GTHA 3PO3S 3GTLI 2Q51A 1KD11 3EERA 3GTMI 4E33A 3G711 2GTIA 1VQLZ 1VQ8Z 4DGLA 3J80f 3KIHA 1RNIA 1W2BZ 3CD61 1QVFY 1Q812 2LFUA 1QF8A 3HOVI 4QTTA 3MZKB 3F3PC 1TWAI 1WZNA 2VUMI 3G71Z 3S16I 1QYPA 5IT9f 3CD6Z 2O53A 2JA7I 2JNYA 4NBEA 1JWHC 5T6BA 3J81b 5D1PA 4NBHA 2AYDA 3GKQA 1YJW1 1KQSZ 1X3WA 2DE5A 4HH4A 1KC82 3CCQ1 3S17I 4E2ZA 5C4JI 1Z03A 3GTMS 3M3YI 2M6NA 3GTOI 2VF1A 2V8IA 1YJWZ 1K731 1Y8CA 2E2II 3NH5A 2B63I 4NB8A 3CCQZ 1K83I 2LIYA 3CMA1 2H85A 4BBRI 3CXCZ 2R93I 2JIRA 4RVDA 2HU9A 2V45A 3JAMf 1Y1WI 5A2Qf 3MONA 1TWFI 4A3FI 3G6E1 3D9XA 2F4MA 3CMAZ 3NDJA 2RPRA 3IFUA 3J80b 3GTPI 3TE5B 2J6AA 1RO4A 1S721 1R9TI 2LEXA 2E2JI 3VMGA 1W2BY 1K8A2 2DE7A 3G6EZ 1QVFZ 1Q821 1N8R2 1M1K2 5IT9b 1RQFA 1WW9A 4EWCA 3S1RI 4A3KI 5IP9I 5FLXb 1S72Z 4BY7I 1VLAA 3QWUA 1VQ51 2OTL1 1ZH1A 2RHBA 4BXXI 4NBFA 3NDIA 1M901 1VQP1 3ESWA 1I3QI 1N2FA 1FDOA 2QKDA 2BJOA 3D6WA 2K5RA 5T64A 1VQK1 3CCEZ 1VQ5Z 2OTLZ 2R92I 4A3BI 2YADA 4E2WA 2JIMA 1Y1VS 1VQPZ 1YITZ 2Y0SA 1ML8A 1JJ2Z 3EEDA 2JIOA 2PM9A 1VQM1 1AA6A 1Q7Y1 1NJI2 1Q861 5C4XI 3MZLB 3FKII 3CCR1 3RZOI 2JA8I 3JAMb 5A2Qb 2R7ZI 4E32A 1KRLA 1RO0A 3CCRZ 2V3VA 3I07A 1K9M2 3J7A4 5FLXf 2V8JA 4QTUA 3IF8A 3D2LA 1VQN1 2QREB 2VUGA 4RVFA
chains in the Genus database with same CATH topology
1RLYA 2IZ4A 2G2KA 2M48A 3Q87A 3BG1B 1JJ2Y 3CC71 1LQLA 4A3DI 2JS4A 3CCM1 3CCU1 4A3GI 5T67A 2QRDB 1Z02A 1VQ61 1YUKA 1YIJ1 3FQMA 3T4NB 3CC7Z 1VQ71 2PMZA 3CCMZ 3CCUZ 4E31A 4Y7NI 5C3EI 3CME1 2JA6I 1VQ6Z 3HKZA 1USPA 3VMIA 3TDHB 1VQ7Z 1KD12 5LL6f 4XX2A 4RS4A 2OOXB 3GTJI 3K7AI 1Q811 1USPB 3CQZI 3GTQI 2F4OA 3CPWY 3CMEZ 3VB9A 1VQ91 4CL1A 2OOYB 3VTNA 4RVHA 1NUIA 3I4MI 1QVGY 3NH4A 2JA5I 4A3JI 1X0TA 2WAQA 3S15I 3BG0B 1VQ9Z 3S1NI 1TFIA 1YHQ1 3S2HI 3CCL1 3RZDI 2NVYI 4A3LI 4RV9A 3S14I 1KC81 1VQ41 3VMHA 1ZB8A 2NVXI 1P9NA 1YHQZ 3CCLZ 3OW2Y 1YJN1 1X3ZA 4E2YA 3GTKI 4HGZA 1K732 2QR1B 2JUBA 1VQKZ 1VQ4Z 5IP7I 4NBAA 2KI7B 4MONA 1YJNZ 1YI21 1VQMZ 4NOZA 2ZAEB 3HOWI 4NFRA 1L1OC 2OTJ1 3KIFA 3PO2I 1YJ91 3LUSA 4AYBA 5FLMI 3U50C 4MXUA 2RIQA 5AN9F 1YI2Z 5CM2M 1WIIA 4MD8A 4NBCA 1K8A1 1Z01A 2P28A 1N8R1 1M1K1 4S1TA 2OTJZ 3CPWZ 1YJ9Z 1S7MA 1Q822 2E9HA 1QVGZ 4NBDA 4MD7A 4DK1A 4X6AI 4DQYB 3FQQA 1SFOI 1VQNZ 4RVGA 2PK7A 2RBLA 1M902 4A3EI 2OZKA 4NB9A 4NH1C 3G4S1 4HGYA 3CC41 3I4NI 2JMOA 1ZB9A 4Y52I 2AKLA 3GCFA 2K3RA 3H0GI 3CCS1 4E30A 4NBGA 3NFZA 1NJI1 2DE6A 3HOUI 1YIJZ 3OW2Z 2Q4ZA 3G4SZ 3CCJ1 1Q7Y2 3HOXI 4A93I 3CC4Z 4MH4A 1Q862 3NH8A 1TWCI 3CCSZ 2E2HI 2W03A 1I6HI 2V8KA 3CCJZ 5D1OA 3H3VJ 4A3MI 1WCMI 2YU9I 1PFTA 2O4HA 1K9M1 1Y1VI 3GTGI 4MD9A 5D1OB 2NVQI 3I551 3S2DI 1KQSY 2QA41 3PO3I 2GU2A 4TNUA 3HOYI 3M4OI 3J81f 1VQO1 3I561 3CC21 1YUAA 1NP6A 2QLVB 2QEX1 3S1QI 4E2XA 3I55Z 3IX0A 4BBSI 2P3YA 3CCE1 2R6MA 2IZ3A 3CCV1 2QA4Z 1TWHI 4A3CI 2NVTI 1VQOZ 1YIT1 4BY1I 3S1MI 3I56Z 1RO2A 3CC2Z 1I50I 1TWGI 2WB1A 4MRIA 2RT9A 2KPIA 2QEXZ 4A3II 2QRCB 3CXCY 4NBBA 5C44I 2HF1A 3CCVZ 3HOZI 3P5JB 3F3FC 1VQ81 1VQL1 1DL6A 2EGTA 2JR6A 2I3CA 2W04A 2GTHA 3PO3S 3GTLI 2Q51A 1KD11 3EERA 3GTMI 4E33A 3G711 2GTIA 1VQLZ 1VQ8Z 4DGLA 3J80f 3KIHA 1RNIA 1W2BZ 3CD61 1QVFY 1Q812 2LFUA 1QF8A 3HOVI 4QTTA 3MZKB 3F3PC 1TWAI 2VUMI 3G71Z 3S16I 1QYPA 5IT9f 3CD6Z 2O53A 2JA7I 2JNYA 4NBEA 1JWHC 5T6BA 3J81b 5D1PA 4NBHA 3GKQA 1YJW1 1KQSZ 1X3WA 2DE5A 4HH4A 1KC82 3CCQ1 3S17I 4E2ZA 5C4JI 1Z03A 3GTMS 3M3YI 2M6NA 3GTOI 2VF1A 2V8IA 1YJWZ 1K731 2E2II 3NH5A 2B63I 4NB8A 3CCQZ 1K83I 2LIYA 3CMA1 2H85A 4BBRI 3CXCZ 2R93I 4RVDA 2HU9A 3JAMf 1Y1WI 5A2Qf 3MONA 1TWFI 4A3FI 3G6E1 3D9XA 2F4MA 3CMAZ 3NDJA 2RPRA 3IFUA 3J80b 3GTPI 3TE5B 2J6AA 1RO4A 1S721 1R9TI 2E2JI 3VMGA 1W2BY 1K8A2 2DE7A 3G6EZ 1QVFZ 1Q821 1N8R2 1M1K2 5IT9b 1RQFA 1WW9A 4EWCA 3S1RI 4A3KI 5IP9I 5FLXb 1S72Z 4BY7I 1VLAA 3QWUA 1VQ51 2OTL1 1ZH1A 2RHBA 4BXXI 4NBFA 3NDIA 1M901 1VQP1 3ESWA 1I3QI 1N2FA 2QKDA 2BJOA 3D6WA 2K5RA 5T64A 1VQK1 3CCEZ 1VQ5Z 2OTLZ 2R92I 4A3BI 2YADA 4E2WA 1Y1VS 1VQPZ 1YITZ 2Y0SA 1ML8A 1JJ2Z 3EEDA 2PM9A 1VQM1 1Q7Y1 1NJI2 1Q861 5C4XI 3MZLB 3FKII 3CCR1 3RZOI 2JA8I 3JAMb 5A2Qb 2R7ZI 4E32A 1KRLA 1RO0A 3CCRZ 3I07A 1K9M2 3J7A4 5FLXf 2V8JA 4QTUA 3IF8A 1VQN1 2QREB 2VUGA 4RVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  1YI2 1;  1VQM Z;  3I56 1;  3CC2 1;  2QEX 1;  3I55 Z;  1JJ2 Y;  2OTJ 1;  3CCE 1;  3G6E 1;  3CCV 1;  2QA4 Z;  1YJ9 1;  3CMA Z;  3CC7 1;  1VQO Z;  3CCM 1;  1YIT 1;  3CCU 1;  1YI2 Z;  3I56 Z;  3CC2 Z;  1S72 1;  1K8A 1;  2QEX Z;  1VQ6 1;  3CXC Y;  1YIJ 1;  1W2B Y;  1N8R 1;  1K8A 2;  1M1K 1;  2OTJ Z;  3G6E Z;  3CCV Z;  1QVF Z;  3CPW Z;  1Q82 1;  1N8R 2;  1YJ9 Z;  1M1K 2;  3CC7 Z;  1Q82 2;  1VQ7 1;  3CCM Z;  3CCU Z;  1VQL 1;  1VQ8 1;  1QVG Z;  3CME 1;  1S72 Z;  1VQ6 Z;  1VQ5 1;  2OTL 1;  1VQN Z;  1M90 1;  1KD1 1;  1VQP 1;  1M90 2;  3G71 1;  1VQ7 Z;  1KD1 2;  1VQL Z;  1VQ8 Z;  1Q81 1;  3CD6 1;  1QVF Y;  3CPW Y;  3CME Z;  1Q81 2;  1VQK 1;  3G4S 1;  3CCE Z;  1VQ5 Z;  3CC4 1;  1VQ9 1;  2OTL Z;  1VQP Z;  1YIT Z;  1QVG Y;  1JJ2 Z;  3G71 Z;  3CCS 1;  1NJI 1;  1VQM 1;  1Q7Y 1;  3CD6 Z;  1YIJ Z;  3OW2 Z;  1NJI 2;  1Q86 1;  3G4S Z;  3CCJ 1;  1Q7Y 2;  1VQ9 Z;  3CC4 Z;  1Q86 2;  1YHQ 1;  3CCR 1;  3CCL 1;  1YJW 1;  1KQS Z;  3CCS Z;  1KC8 1;  1VQ4 1;  1KC8 2;  3CCQ 1;  3CCJ Z;  1YHQ Z;  3CCR Z;  3CCL Z;  1YJW Z;  1K73 1;  1K9M 1;  3OW2 Y;  1YJN 1;  1K73 2;  1K9M 2;  1VQK Z;  1VQ4 Z;  3I55 1;  3CCQ Z;  1KQS Y;  2QA4 1;  3CMA 1;  1VQN 1;  3CXC Z;  1W2B Z;  1VQO 1; 
#chains in the Genus database with same CATH topology
 1RLY A;  2IZ4 A;  2G2K A;  2M48 A;  3Q87 A;  3BG1 B;  1JJ2 Y;  3CC7 1;  1LQL A;  4A3D I;  2JS4 A;  3CCM 1;  3CCU 1;  4A3G I;  5T67 A;  2QRD B;  1Z02 A;  1VQ6 1;  1YUK A;  1YIJ 1;  3FQM A;  2JIQ A;  3T4N B;  3CC7 Z;  1VQ7 1;  2PMZ A;  3CCM Z;  3CCU Z;  4E31 A;  4Y7N I;  5C3E I;  3CME 1;  2JA6 I;  1VQ6 Z;  3HKZ A;  2NAP A;  1USP A;  3VMI A;  3TDH B;  1VQ7 Z;  1KD1 2;  5LL6 f;  4XX2 A;  4RS4 A;  2OOX B;  3GTJ I;  3K7A I;  2VPX A;  1Q81 1;  1USP B;  3CQZ I;  3GTQ I;  2F4O A;  3CPW Y;  3CME Z;  3VB9 A;  1VQ9 1;  4CL1 A;  2OOY B;  3VTN A;  4RVH A;  1NUI A;  3I4M I;  1QVG Y;  3NH4 A;  2JA5 I;  4A3J I;  1X0T A;  2WAQ A;  3S15 I;  3BG0 B;  1VQ9 Z;  3S1N I;  1Q16 A;  1TFI A;  1YHQ 1;  3S2H I;  3CCL 1;  3RZD I;  2NVY I;  4A3L I;  4RV9 A;  3S14 I;  1KC8 1;  1VQ4 1;  3VMH A;  1ZB8 A;  2NVX I;  1P9N A;  1YHQ Z;  3CCL Z;  3OW2 Y;  1YJN 1;  1X3Z A;  4E2Y A;  3GTK I;  4HGZ A;  1K73 2;  2VPY A;  2QR1 B;  2JUB A;  1VQK Z;  1VQ4 Z;  5IP7 I;  4NBA A;  2KI7 B;  4MON A;  1YJN Z;  1YI2 1;  1VQM Z;  4NOZ A;  2ZAE B;  3HOW I;  1FDI A;  4NFR A;  1L1O C;  2OTJ 1;  3KIF A;  3PO2 I;  1YJ9 1;  3LUS A;  4AYB A;  5FLM I;  3U50 C;  4MXU A;  2RIQ A;  5AN9 F;  1YI2 Z;  5CM2 M;  1WII A;  4MD8 A;  4NBC A;  1K8A 1;  1Z01 A;  2P28 A;  1N8R 1;  1M1K 1;  4S1T A;  2OTJ Z;  3CPW Z;  1YJ9 Z;  1S7M A;  1Q82 2;  2E9H A;  1QVG Z;  4NBD A;  4MD7 A;  4DK1 A;  4X6A I;  4DQY B;  3FQQ A;  1SFO I;  1VQN Z;  4RVG A;  2PK7 A;  2RBL A;  1M90 2;  4A3E I;  2OZK A;  4NB9 A;  4NH1 C;  3G4S 1;  4HGY A;  3CC4 1;  3I4N I;  2JMO A;  1ZB9 A;  4Y52 I;  2AKL A;  3GCF A;  2K3R A;  3H0G I;  3CCS 1;  4E30 A;  4NBG A;  3NFZ A;  1NJI 1;  2DE6 A;  3HOU I;  1YIJ Z;  3OW2 Z;  3IR7 A;  2Q4Z A;  3G4S Z;  3CCJ 1;  2IV2 X;  1Q7Y 2;  3HOX I;  4A93 I;  3CC4 Z;  2VPW A;  4MH4 A;  1Q86 2;  3NH8 A;  1TWC I;  3CCS Z;  2E2H I;  2VPZ A;  2W03 A;  2V8K A;  1I6H I;  2JIP A;  3CCJ Z;  5D1O A;  3H3V J;  4A3M I;  1WCM I;  2YU9 I;  1PFT A;  2O4H A;  1K9M 1;  1Y1V I;  3GTG I;  4MD9 A;  5D1O B;  2NVQ I;  3I55 1;  3S2D I;  1KQS Y;  2QA4 1;  3PO3 I;  2E7Z A;  2GU2 A;  4TNU A;  3HOY I;  3M4O I;  3J81 f;  1VQO 1;  1WJ2 A;  3I56 1;  3CC2 1;  1YUA A;  1NP6 A;  1QXF A;  2QLV B;  2QEX 1;  3S1Q I;  4E2X A;  3I55 Z;  3IX0 A;  4BBS I;  2P3Y A;  3CCE 1;  2R6M A;  2IZ3 A;  3CCV 1;  2QA4 Z;  1TWH I;  4A3C I;  2NVT I;  1VQO Z;  1YIT 1;  4BY1 I;  3S1M I;  3I56 Z;  1RO2 A;  3CC2 Z;  1I50 I;  1TWG I;  2WB1 A;  4MRI A;  2RT9 A;  2KPI A;  2QEX Z;  4A3I I;  2QRC B;  3CXC Y;  4NBB A;  5C44 I;  2HF1 A;  3CCV Z;  3HOZ I;  3P5J B;  3F3F C;  1VQ8 1;  1VQL 1;  1DL6 A;  2EGT A;  2JR6 A;  2I3C A;  2W04 A;  1SIW A;  2GTH A;  3PO3 S;  3GTL I;  2Q51 A;  1KD1 1;  3EER A;  3GTM I;  4E33 A;  3G71 1;  2GTI A;  1VQL Z;  1VQ8 Z;  4DGL A;  3J80 f;  3KIH A;  1RNI A;  1W2B Z;  3CD6 1;  1QVF Y;  1Q81 2;  2LFU A;  1QF8 A;  3HOV I;  4QTT A;  3MZK B;  3F3P C;  1TWA I;  1WZN A;  2VUM I;  3G71 Z;  3S16 I;  1QYP A;  5IT9 f;  3CD6 Z;  2O53 A;  2JA7 I;  2JNY A;  4NBE A;  1JWH C;  5T6B A;  3J81 b;  5D1P A;  4NBH A;  2AYD A;  3GKQ A;  1YJW 1;  1KQS Z;  1X3W A;  2DE5 A;  4HH4 A;  1KC8 2;  3CCQ 1;  3S17 I;  4E2Z A;  5C4J I;  1Z03 A;  3GTM S;  3M3Y I;  2M6N A;  3GTO I;  2VF1 A;  2V8I A;  1YJW Z;  1K73 1;  1Y8C A;  2E2I I;  3NH5 A;  2B63 I;  4NB8 A;  3CCQ Z;  1K83 I;  2LIY A;  3CMA 1;  2H85 A;  4BBR I;  3CXC Z;  2R93 I;  2JIR A;  4RVD A;  2HU9 A;  2V45 A;  3JAM f;  1Y1W I;  5A2Q f;  3MON A;  1TWF I;  4A3F I;  3G6E 1;  3D9X A;  2F4M A;  3CMA Z;  3NDJ A;  2RPR A;  3IFU A;  3J80 b;  3GTP I;  3TE5 B;  2J6A A;  1RO4 A;  1S72 1;  1R9T I;  2LEX A;  2E2J I;  3VMG A;  1W2B Y;  1K8A 2;  2DE7 A;  3G6E Z;  1QVF Z;  1Q82 1;  1N8R 2;  1M1K 2;  5IT9 b;  1RQF A;  1WW9 A;  4EWC A;  3S1R I;  4A3K I;  5IP9 I;  5FLX b;  1S72 Z;  4BY7 I;  1VLA A;  3QWU A;  1VQ5 1;  2OTL 1;  1ZH1 A;  2RHB A;  4BXX I;  4NBF A;  3NDI A;  1M90 1;  1VQP 1;  3ESW A;  1I3Q I;  1N2F A;  1FDO A;  2QKD A;  2BJO A;  3D6W A;  2K5R A;  5T64 A;  1VQK 1;  3CCE Z;  1VQ5 Z;  2OTL Z;  2R92 I;  4A3B I;  2YAD A;  4E2W A;  2JIM A;  1Y1V S;  1VQP Z;  1YIT Z;  2Y0S A;  1ML8 A;  1JJ2 Z;  3EED A;  2JIO A;  2PM9 A;  1VQM 1;  1AA6 A;  1Q7Y 1;  1NJI 2;  1Q86 1;  5C4X I;  3MZL B;  3FKI I;  3CCR 1;  3RZO I;  2JA8 I;  3JAM b;  5A2Q b;  2R7Z I;  4E32 A;  1KRL A;  1RO0 A;  3CCR Z;  2V3V A;  3I07 A;  1K9M 2;  3J7A 4;  5FLX f;  2V8J A;  4QTU A;  3IF8 A;  3D2L A;  1VQN 1;  2QRE B;  2VUG A;  4RVF A; 
#chains in the Genus database with same CATH homology
 1RLY A;  2IZ4 A;  2G2K A;  2M48 A;  3Q87 A;  3BG1 B;  1JJ2 Y;  3CC7 1;  1LQL A;  4A3D I;  2JS4 A;  3CCM 1;  3CCU 1;  4A3G I;  5T67 A;  2QRD B;  1Z02 A;  1VQ6 1;  1YUK A;  1YIJ 1;  3FQM A;  3T4N B;  3CC7 Z;  1VQ7 1;  2PMZ A;  3CCM Z;  3CCU Z;  4E31 A;  4Y7N I;  5C3E I;  3CME 1;  2JA6 I;  1VQ6 Z;  3HKZ A;  1USP A;  3VMI A;  3TDH B;  1VQ7 Z;  1KD1 2;  5LL6 f;  4XX2 A;  4RS4 A;  2OOX B;  3GTJ I;  3K7A I;  1Q81 1;  1USP B;  3CQZ I;  3GTQ I;  2F4O A;  3CPW Y;  3CME Z;  3VB9 A;  1VQ9 1;  4CL1 A;  2OOY B;  3VTN A;  4RVH A;  1NUI A;  3I4M I;  1QVG Y;  3NH4 A;  2JA5 I;  4A3J I;  1X0T A;  2WAQ A;  3S15 I;  3BG0 B;  1VQ9 Z;  3S1N I;  1TFI A;  1YHQ 1;  3S2H I;  3CCL 1;  3RZD I;  2NVY I;  4A3L I;  4RV9 A;  3S14 I;  1KC8 1;  1VQ4 1;  3VMH A;  1ZB8 A;  2NVX I;  1P9N A;  1YHQ Z;  3CCL Z;  3OW2 Y;  1YJN 1;  1X3Z A;  4E2Y A;  3GTK I;  4HGZ A;  1K73 2;  2QR1 B;  2JUB A;  1VQK Z;  1VQ4 Z;  5IP7 I;  4NBA A;  2KI7 B;  4MON A;  1YJN Z;  1YI2 1;  1VQM Z;  4NOZ A;  2ZAE B;  3HOW I;  4NFR A;  1L1O C;  2OTJ 1;  3KIF A;  3PO2 I;  1YJ9 1;  3LUS A;  4AYB A;  5FLM I;  3U50 C;  4MXU A;  2RIQ A;  5AN9 F;  1YI2 Z;  5CM2 M;  1WII A;  4MD8 A;  4NBC A;  1K8A 1;  1Z01 A;  2P28 A;  1N8R 1;  1M1K 1;  4S1T A;  2OTJ Z;  3CPW Z;  1YJ9 Z;  1S7M A;  1Q82 2;  2E9H A;  1QVG Z;  4NBD A;  4MD7 A;  4DK1 A;  4X6A I;  4DQY B;  3FQQ A;  1SFO I;  1VQN Z;  4RVG A;  2PK7 A;  2RBL A;  1M90 2;  4A3E I;  2OZK A;  4NB9 A;  4NH1 C;  3G4S 1;  4HGY A;  3CC4 1;  3I4N I;  2JMO A;  1ZB9 A;  4Y52 I;  2AKL A;  3GCF A;  2K3R A;  3H0G I;  3CCS 1;  4E30 A;  4NBG A;  3NFZ A;  1NJI 1;  2DE6 A;  3HOU I;  1YIJ Z;  3OW2 Z;  2Q4Z A;  3G4S Z;  3CCJ 1;  1Q7Y 2;  3HOX I;  4A93 I;  3CC4 Z;  4MH4 A;  1Q86 2;  3NH8 A;  1TWC I;  3CCS Z;  2E2H I;  2W03 A;  1I6H I;  2V8K A;  3CCJ Z;  5D1O A;  3H3V J;  4A3M I;  1WCM I;  2YU9 I;  1PFT A;  2O4H A;  1K9M 1;  1Y1V I;  3GTG I;  4MD9 A;  5D1O B;  2NVQ I;  3I55 1;  3S2D I;  1KQS Y;  2QA4 1;  3PO3 I;  2GU2 A;  4TNU A;  3HOY I;  3M4O I;  3J81 f;  1VQO 1;  3I56 1;  3CC2 1;  1YUA A;  1NP6 A;  2QLV B;  2QEX 1;  3S1Q I;  4E2X A;  3I55 Z;  3IX0 A;  4BBS I;  2P3Y A;  3CCE 1;  2R6M A;  2IZ3 A;  3CCV 1;  2QA4 Z;  1TWH I;  4A3C I;  2NVT I;  1VQO Z;  1YIT 1;  4BY1 I;  3S1M I;  3I56 Z;  1RO2 A;  3CC2 Z;  1I50 I;  1TWG I;  2WB1 A;  4MRI A;  2RT9 A;  2KPI A;  2QEX Z;  4A3I I;  2QRC B;  3CXC Y;  4NBB A;  5C44 I;  2HF1 A;  3CCV Z;  3HOZ I;  3P5J B;  3F3F C;  1VQ8 1;  1VQL 1;  1DL6 A;  2EGT A;  2JR6 A;  2I3C A;  2W04 A;  2GTH A;  3PO3 S;  3GTL I;  2Q51 A;  1KD1 1;  3EER A;  3GTM I;  4E33 A;  3G71 1;  2GTI A;  1VQL Z;  1VQ8 Z;  4DGL A;  3J80 f;  3KIH A;  1RNI A;  1W2B Z;  3CD6 1;  1QVF Y;  1Q81 2;  2LFU A;  1QF8 A;  3HOV I;  4QTT A;  3MZK B;  3F3P C;  1TWA I;  2VUM I;  3G71 Z;  3S16 I;  1QYP A;  5IT9 f;  3CD6 Z;  2O53 A;  2JA7 I;  2JNY A;  4NBE A;  1JWH C;  5T6B A;  3J81 b;  5D1P A;  4NBH A;  3GKQ A;  1YJW 1;  1KQS Z;  1X3W A;  2DE5 A;  4HH4 A;  1KC8 2;  3CCQ 1;  3S17 I;  4E2Z A;  5C4J I;  1Z03 A;  3GTM S;  3M3Y I;  2M6N A;  3GTO I;  2VF1 A;  2V8I A;  1YJW Z;  1K73 1;  2E2I I;  3NH5 A;  2B63 I;  4NB8 A;  3CCQ Z;  1K83 I;  2LIY A;  3CMA 1;  2H85 A;  4BBR I;  3CXC Z;  2R93 I;  4RVD A;  2HU9 A;  3JAM f;  1Y1W I;  5A2Q f;  3MON A;  1TWF I;  4A3F I;  3G6E 1;  3D9X A;  2F4M A;  3CMA Z;  3NDJ A;  2RPR A;  3IFU A;  3J80 b;  3GTP I;  3TE5 B;  2J6A A;  1RO4 A;  1S72 1;  1R9T I;  2E2J I;  3VMG A;  1W2B Y;  1K8A 2;  2DE7 A;  3G6E Z;  1QVF Z;  1Q82 1;  1N8R 2;  1M1K 2;  5IT9 b;  1RQF A;  1WW9 A;  4EWC A;  3S1R I;  4A3K I;  5IP9 I;  5FLX b;  1S72 Z;  4BY7 I;  1VLA A;  3QWU A;  1VQ5 1;  2OTL 1;  1ZH1 A;  2RHB A;  4BXX I;  4NBF A;  3NDI A;  1M90 1;  1VQP 1;  3ESW A;  1I3Q I;  1N2F A;  2QKD A;  2BJO A;  3D6W A;  2K5R A;  5T64 A;  1VQK 1;  3CCE Z;  1VQ5 Z;  2OTL Z;  2R92 I;  4A3B I;  2YAD A;  4E2W A;  1Y1V S;  1VQP Z;  1YIT Z;  2Y0S A;  1ML8 A;  1JJ2 Z;  3EED A;  2PM9 A;  1VQM 1;  1Q7Y 1;  1NJI 2;  1Q86 1;  5C4X I;  3MZL B;  3FKI I;  3CCR 1;  3RZO I;  2JA8 I;  3JAM b;  5A2Q b;  2R7Z I;  4E32 A;  1KRL A;  1RO0 A;  3CCR Z;  3I07 A;  1K9M 2;  3J7A 4;  5FLX f;  2V8J A;  4QTU A;  3IF8 A;  1VQN 1;  2QRE B;  2VUG A;  4RVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...