1JJ2Y

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jj2Y00
2QA4Z 1KD11 1VQ4Z 3CMA1 1YJN1 3CPWZ 2OTJ1 1VQ7Z 1K9M1 3CCJZ 1S721 1K9M2 1W2BY 1M1K1 1KQSY 3CCQ1 1M1K2 3CC2Z 1VQMZ 1VQ8Z 1NJI2 1VQNZ 1M901 1YITZ 1YJWZ 3CXCZ 2QEX1 1VQL1 1Q811 3CCS1 1K732 1KC82 1VQ41 1Q812 1YJW1 1QVFY 1K8A1 1S72Z 1Q7Y1 3CCJ1 3OW2Y 3CCQZ 1YIJZ 3CC21 1N8R1 1VQ81 1VQOZ 1N8R2 1VQM1 1YIT1 3CCUZ 1YI2Z 1QVGY 1VQLZ 1Q7Y2 2OTLZ 2QEXZ 3CCEZ 3CC41 1VQP1 3G6E1 1VQ51 3CCRZ 1Q862 3CC71 3CCVZ 3CCM1 3CPWY 1JJ2Z 1VQ71 3G711 3CXCY 1VQO1 3CCU1 1KD12 3I561 3I55Z 3G4SZ 3G71Z 1YHQZ 2OTL1 3CCE1 3G6EZ 1VQ5Z 3CC4Z 1YHQ1 1VQPZ 3CCV1 1K8A2 2OTJZ 3CC7Z 1M902 1W2BZ 3CCMZ 1NJI1 1KQSZ 3CD61 3CCLZ 3G4S1 3CD6Z 1Q821 3CCL1 3CCSZ 1YI21 1VQ61 1VQ9Z 1QVFZ 1VQKZ 1K731 1KC81 1YJNZ 1VQ6Z 3CME1 3CMAZ 2QA41 1Q822 1YIJ1 3CMEZ 1YJ9Z 1JJ2Y 1QVGZ 3OW2Z 1YJ91 1Q861 1VQN1 3I551 3I56Z 1VQK1 1VQ91 3CCR1
chains in the Genus database with same CATH superfamily
5AN9F 1VQ7Z 1N2FA 3CCJZ 2B63I 3S1QI 1W2BY 1M1K2 3CC2Z 1VQMZ 2E2II 2PM9A 1NJI2 2R92I 1M901 5D1PA 3CXCZ 4E32A 3FQMA 3CCS1 2RHBA 1QVFY 1K8A1 3VB9A 3KIFA 1Q7Y1 1L1OC 2P28A 3VMIA 1YIJZ 1VQ81 5FLXf 1YIT1 3CCUZ 1VQLZ 2DE5A 1Y1VI 2R6MA 4Y52I 3CC41 3QWUA 1Q862 4MD8A 4NBDA 3S1MI 1X3WA 1JJ2Z 1VQ71 1DL6A 1TWCI 1NUIA 3U50C 3G711 5CM2M 4HGYA 3JAMf 4E31A 1KD12 3G71Z 3F3FC 4RV9A 1YHQZ 4NH1C 3CCE1 1JWHC 2QRDB 3IF8A 2JUBA 2OZKA 1YHQ1 1TWHI 4MH4A 2JA5I 3CC7Z 2V8KA 3CCMZ 1I50I 2AYDA 2VPXA 2QR1B 3CCLZ 3GTMI 1Q16A 3IX0A 2P3YA 3G4S1 2KI7B 1Q821 3CCL1 3H3VJ 2YADA 1VLAA 2RBLA 2F4MA 5C44I 3NDJA 4NBGA 2QA41 4A3JI 2JA8I 2BJOA 3S2HI 3RZDI 1YJ9Z 2KPIA 3PO3I 2V45A 3TDHB 4RVGA 1SIWA 4NB8A 2RT9A 1YJ91 3GTJI 2NVQI 2YU9I 2M48A 1I3QI 3CMA1 1VQ4Z 1YJN1 3T4NB 2PMZA 1K9M2 3GKQA 3GCFA 1M1K1 2H85A 3LUSA 3NH4A 3VTNA 4BY7I 1VQNZ 4RVFA 2NVTI 2F4OA 4RVDA 2OOXB 4RS4A 2JMOA 2VUGA 1LQLA 1X0TA 2JR6A 3P5JB 5C4XI 3OW2Y 4EWCA 3HOVI 5IP7I 1FDOA 1RO0A 4A3KI 3CC21 2EGTA 4NFRA 2LEXA 3RZOI 1YI2Z 2IZ3A 3S16I 1SFOI 3HOWI 4MXUA 3HOUI 3G6E1 1VQ51 1USPB 3CC71 2E9HA 3MZLB 3CCM1 1KRLA 2JIOA 2HF1A 4MD7A 4Y7NI 3S17I 1VQO1 3CCU1 2O53A 1S7MA 2M6NA 2OTL1 4HH4A 3GTQI 2OOYB 1W2BZ 1NJI1 3M3YI 3TE5B 3GTGI 2LIYA 4DK1A 2NAPA 2VUMI 2WAQA 1QF8A 1YI21 4A3FI 2JIQA 1P9NA 1VQKZ 1RLYA 2JIRA 4RVHA 1RNIA 1YJNZ 2GU2A 1I6HI 4E2ZA 1JJ2Y 5C3EI 4NOZA 3BG1B 2JA7I 1ZB8A 3D9XA 4A3DI 4BBSI 1Q861 1VQN1 4E2XA 2NVXI 1VQ91 1Y1WI 3K7AI 4DQYB 2QA4Z 3S2DI 1TWGI 4NBAA 3D2LA 1K9M1 1TWFI 1S721 3CCQ1 2DE7A 3MONA 3FKII 1ZB9A 1Z01A 3NDIA 1TFIA 1YJWZ 1X3ZA 4DGLA 1KC82 4BBRI 1VQ41 1Q812 1QXFA 5LL6f 1YJW1 4MD9A 4E33A 4NBFA 2W04A 1FDIA 2JIMA 1WW9A 5IT9f 4X6AI 1WIIA 4MRIA 3I4NI 2E7ZA 1VQOZ 1N8R2 2DE6A 1QVGY 1Q7Y2 2OTLZ 2VPZA 1ZH1A 4E30A 3IR7A 2QEXZ 2IV2X 4A3II 3CCVZ 1AA6A 3CPWY 3M4OI 1TWAI 2V8JA 4A3MI 3I4MI 1Y1VS 3GTPI 3HOZI 4HGZA 4A3GI 2W03A 3G6EZ 1VQ5Z 4S1TA 4TNUA 1VQPZ 2OTJZ 1M902 5T6BA 3GTLI 1YUKA 1KQSZ 3EEDA 3BG0B 1WCMI 3MZKB 2E2JI 3PO3S 1VQ9Z 1QVFZ 1QYPA 3S15I 3J7A4 1KC81 3IFUA 4NB9A 3ESWA 1Q822 1RO2A 5A2Qf 2JS4A 3J80f 3OW2Z 4CL1A 2JIPA 1VQK1 4NBBA 2V8IA 3CCR1 4QTTA 2I3CA 3NH8A 1KD11 1YUAA 3CPWZ 4NBHA 2OTJ1 5IT9b 2WB1A 2PK7A 3KIHA 2K3RA 4BY1I 1KQSY 2RPRA 2GTIA 2K5RA 2ZAEB 2IZ4A 3J80b 3HOXI 4XX2A 2RIQA 1VQ8Z 1NP6A 5A2Qb 2JNYA 3Q87A 5T67A 1YITZ 5C4JI 2QEX1 1VQL1 1Q811 1K732 2R93I 4A3LI 4A93I 3NFZA 2E2HI 1S72Z 1K83I 3J81b 1PFTA 3CCJ1 2R7ZI 3S1NI 3CCQZ 4E2WA 3H0GI 4QTUA 1N8R1 3J81f 1USPA 1VQM1 2Q4ZA 3S14I 3GTKI 3VMHA 4A3CI 3CCEZ 1WZNA 1VQP1 1ML8A 5T64A 3CCRZ 2JA6I 2QKDA 4E2YA 4BXXI 3D6WA 2QRCB 1WJ2A 3CXCY 4NBCA 3I55Z 3I561 3EERA 3G4SZ 2VF1A 2O4HA 3CC4Z 1K8A2 3CCV1 3FQQA 1Z02A 1RO4A 4NBEA 3I07A 2GTHA 2VPWA 3CD61 2HU9A 2Q51A 2QLVB 4MONA 4A3EI 5FLXb 3VMGA 1Y8CA 2LFUA 3GTMS 3CD6Z 3NH5A 4A3BI 3CQZI 3F3PC 3CCSZ 1VQ61 3PO2I 3HKZA 1K731 2NVYI 1VQ6Z 3CME1 3CMAZ 5D1OA 5IP9I 5D1OB 1YIJ1 3CMEZ 2J6AA 1RQFA 1QVGZ 5FLMI 3JAMb 2Y0SA 4AYBA 3GTOI 3HOYI 2AKLA 3S1RI 2QREB 3I551 3I56Z 2V3VA 1R9TI 1Z03A 2VPYA 2G2KA
chains in the Genus database with same CATH topology
5AN9F 1VQ7Z 1N2FA 3CCJZ 2B63I 3S1QI 1W2BY 1M1K2 3CC2Z 1VQMZ 2E2II 2PM9A 1NJI2 2R92I 1M901 5D1PA 3CXCZ 4E32A 3FQMA 3CCS1 2RHBA 1QVFY 1K8A1 3VB9A 3KIFA 1Q7Y1 1L1OC 2P28A 3VMIA 1YIJZ 1VQ81 5FLXf 1YIT1 3CCUZ 1VQLZ 2DE5A 1Y1VI 2R6MA 4Y52I 3CC41 3QWUA 1Q862 4MD8A 4NBDA 3S1MI 1X3WA 1JJ2Z 1VQ71 1DL6A 1TWCI 1NUIA 3U50C 3G711 5CM2M 4HGYA 3JAMf 4E31A 1KD12 3G71Z 3F3FC 4RV9A 1YHQZ 4NH1C 3CCE1 1JWHC 2QRDB 3IF8A 2JUBA 2OZKA 1YHQ1 1TWHI 4MH4A 2JA5I 3CC7Z 2V8KA 3CCMZ 1I50I 2QR1B 3CCLZ 3GTMI 3IX0A 2P3YA 3G4S1 2KI7B 1Q821 3CCL1 3H3VJ 2YADA 1VLAA 2RBLA 2F4MA 5C44I 3NDJA 4NBGA 2QA41 4A3JI 2JA8I 2BJOA 3S2HI 3RZDI 1YJ9Z 2KPIA 3PO3I 3TDHB 4RVGA 4NB8A 2RT9A 1YJ91 3GTJI 2NVQI 2YU9I 2M48A 1I3QI 3CMA1 1VQ4Z 1YJN1 3T4NB 2PMZA 1K9M2 3GKQA 3GCFA 1M1K1 2H85A 3LUSA 3NH4A 3VTNA 4BY7I 1VQNZ 4RVFA 2NVTI 2F4OA 4RVDA 2OOXB 4RS4A 2JMOA 2VUGA 1LQLA 1X0TA 2JR6A 3P5JB 5C4XI 3OW2Y 4EWCA 3HOVI 5IP7I 1RO0A 4A3KI 3CC21 2EGTA 4NFRA 3RZOI 1YI2Z 2IZ3A 3S16I 1SFOI 3HOWI 4MXUA 3HOUI 3G6E1 1VQ51 1USPB 3CC71 2E9HA 3MZLB 3CCM1 1KRLA 2HF1A 4MD7A 4Y7NI 3S17I 1VQO1 3CCU1 2O53A 1S7MA 2M6NA 2OTL1 4HH4A 3GTQI 2OOYB 1W2BZ 1NJI1 3M3YI 3TE5B 3GTGI 2LIYA 4DK1A 2VUMI 2WAQA 1QF8A 1YI21 4A3FI 1P9NA 1VQKZ 1RLYA 4RVHA 1RNIA 1YJNZ 2GU2A 1I6HI 4E2ZA 1JJ2Y 5C3EI 4NOZA 3BG1B 2JA7I 1ZB8A 3D9XA 4A3DI 4BBSI 1Q861 1VQN1 4E2XA 2NVXI 1VQ91 1Y1WI 3K7AI 4DQYB 2QA4Z 3S2DI 1TWGI 4NBAA 1K9M1 1TWFI 1S721 3CCQ1 2DE7A 3MONA 3FKII 1ZB9A 1Z01A 3NDIA 1TFIA 1YJWZ 1X3ZA 4DGLA 1KC82 4BBRI 1VQ41 1Q812 5LL6f 1YJW1 4MD9A 4E33A 4NBFA 2W04A 1WW9A 5IT9f 4X6AI 1WIIA 4MRIA 3I4NI 1VQOZ 1N8R2 2DE6A 1QVGY 1Q7Y2 2OTLZ 1ZH1A 4E30A 2QEXZ 4A3II 3CCVZ 3CPWY 3M4OI 1TWAI 2V8JA 4A3MI 3I4MI 1Y1VS 3GTPI 3HOZI 4HGZA 4A3GI 2W03A 3G6EZ 1VQ5Z 4S1TA 4TNUA 1VQPZ 2OTJZ 1M902 5T6BA 3GTLI 1YUKA 1KQSZ 3EEDA 3BG0B 1WCMI 3MZKB 2E2JI 3PO3S 1VQ9Z 1QVFZ 1QYPA 3S15I 3J7A4 1KC81 3IFUA 4NB9A 3ESWA 1Q822 1RO2A 5A2Qf 2JS4A 3J80f 3OW2Z 4CL1A 1VQK1 4NBBA 2V8IA 3CCR1 4QTTA 2I3CA 3NH8A 1KD11 1YUAA 3CPWZ 4NBHA 2OTJ1 5IT9b 2WB1A 2PK7A 3KIHA 2K3RA 4BY1I 1KQSY 2RPRA 2GTIA 2K5RA 2ZAEB 2IZ4A 3J80b 3HOXI 4XX2A 2RIQA 1VQ8Z 1NP6A 5A2Qb 2JNYA 3Q87A 5T67A 1YITZ 5C4JI 2QEX1 1VQL1 1Q811 1K732 2R93I 4A3LI 4A93I 3NFZA 2E2HI 1S72Z 1K83I 3J81b 1PFTA 3CCJ1 2R7ZI 3S1NI 3CCQZ 4E2WA 3H0GI 4QTUA 1N8R1 3J81f 1USPA 1VQM1 2Q4ZA 3S14I 3GTKI 3VMHA 4A3CI 3CCEZ 1VQP1 1ML8A 5T64A 3CCRZ 2JA6I 2QKDA 4E2YA 4BXXI 3D6WA 2QRCB 3CXCY 4NBCA 3I55Z 3I561 3EERA 3G4SZ 2VF1A 2O4HA 3CC4Z 1K8A2 3CCV1 3FQQA 1Z02A 1RO4A 4NBEA 3I07A 2GTHA 3CD61 2HU9A 2Q51A 2QLVB 4MONA 4A3EI 5FLXb 3VMGA 2LFUA 3GTMS 3CD6Z 3NH5A 4A3BI 3CQZI 3F3PC 3CCSZ 1VQ61 3PO2I 3HKZA 1K731 2NVYI 1VQ6Z 3CME1 3CMAZ 5D1OA 5IP9I 5D1OB 1YIJ1 3CMEZ 2J6AA 1RQFA 1QVGZ 5FLMI 3JAMb 2Y0SA 4AYBA 3GTOI 3HOYI 2AKLA 3S1RI 2QREB 3I551 3I56Z 1R9TI 1Z03A 2G2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1KD1 1;  1VQ4 Z;  3CMA 1;  1YJN 1;  3CPW Z;  2OTJ 1;  1VQ7 Z;  1K9M 1;  3CCJ Z;  1S72 1;  1K9M 2;  1W2B Y;  1M1K 1;  1KQS Y;  3CCQ 1;  1M1K 2;  3CC2 Z;  1VQM Z;  1VQ8 Z;  1NJI 2;  1VQN Z;  1M90 1;  1YIT Z;  1YJW Z;  3CXC Z;  2QEX 1;  1VQL 1;  1Q81 1;  3CCS 1;  1K73 2;  1KC8 2;  1VQ4 1;  1Q81 2;  1YJW 1;  1QVF Y;  1K8A 1;  1S72 Z;  1Q7Y 1;  3CCJ 1;  3OW2 Y;  3CCQ Z;  1YIJ Z;  3CC2 1;  1N8R 1;  1VQ8 1;  1VQO Z;  1N8R 2;  1VQM 1;  1YIT 1;  3CCU Z;  1YI2 Z;  1QVG Y;  1VQL Z;  1Q7Y 2;  2OTL Z;  2QEX Z;  3CCE Z;  3CC4 1;  1VQP 1;  3G6E 1;  1VQ5 1;  3CCR Z;  1Q86 2;  3CC7 1;  3CCV Z;  3CCM 1;  3CPW Y;  1JJ2 Z;  1VQ7 1;  3G71 1;  3CXC Y;  1VQO 1;  3CCU 1;  1KD1 2;  3I56 1;  3I55 Z;  3G4S Z;  3G71 Z;  1YHQ Z;  2OTL 1;  3CCE 1;  3G6E Z;  1VQ5 Z;  3CC4 Z;  1YHQ 1;  1VQP Z;  3CCV 1;  1K8A 2;  2OTJ Z;  3CC7 Z;  1M90 2;  1W2B Z;  3CCM Z;  1NJI 1;  1KQS Z;  3CD6 1;  3CCL Z;  3G4S 1;  3CD6 Z;  1Q82 1;  3CCL 1;  3CCS Z;  1YI2 1;  1VQ6 1;  1VQ9 Z;  1QVF Z;  1VQK Z;  1K73 1;  1KC8 1;  1YJN Z;  1VQ6 Z;  3CME 1;  3CMA Z;  2QA4 1;  1Q82 2;  1YIJ 1;  3CME Z;  1YJ9 Z;  1JJ2 Y;  1QVG Z;  3OW2 Z;  1YJ9 1;  1Q86 1;  1VQN 1;  3I55 1;  3I56 Z;  1VQK 1;  1VQ9 1;  3CCR 1; 
#chains in the Genus database with same CATH topology
 5AN9 F;  1VQ7 Z;  1N2F A;  3CCJ Z;  2B63 I;  3S1Q I;  1W2B Y;  1M1K 2;  3CC2 Z;  1VQM Z;  2E2I I;  2PM9 A;  1NJI 2;  2R92 I;  1M90 1;  5D1P A;  3CXC Z;  4E32 A;  3FQM A;  3CCS 1;  2RHB A;  1QVF Y;  1K8A 1;  3VB9 A;  3KIF A;  1Q7Y 1;  1L1O C;  2P28 A;  3VMI A;  1YIJ Z;  1VQ8 1;  5FLX f;  1YIT 1;  3CCU Z;  1VQL Z;  2DE5 A;  1Y1V I;  2R6M A;  4Y52 I;  3CC4 1;  3QWU A;  1Q86 2;  4MD8 A;  4NBD A;  3S1M I;  1X3W A;  1JJ2 Z;  1VQ7 1;  1DL6 A;  1TWC I;  1NUI A;  3U50 C;  3G71 1;  5CM2 M;  4HGY A;  3JAM f;  4E31 A;  1KD1 2;  3G71 Z;  3F3F C;  4RV9 A;  1YHQ Z;  4NH1 C;  3CCE 1;  1JWH C;  2QRD B;  3IF8 A;  2JUB A;  2OZK A;  1YHQ 1;  1TWH I;  4MH4 A;  2JA5 I;  3CC7 Z;  2V8K A;  3CCM Z;  1I50 I;  2AYD A;  2VPX A;  2QR1 B;  3CCL Z;  3GTM I;  1Q16 A;  3IX0 A;  2P3Y A;  3G4S 1;  2KI7 B;  1Q82 1;  3CCL 1;  3H3V J;  2YAD A;  1VLA A;  2RBL A;  2F4M A;  5C44 I;  3NDJ A;  4NBG A;  2QA4 1;  4A3J I;  2JA8 I;  2BJO A;  3S2H I;  3RZD I;  1YJ9 Z;  2KPI A;  3PO3 I;  2V45 A;  3TDH B;  4RVG A;  1SIW A;  4NB8 A;  2RT9 A;  1YJ9 1;  3GTJ I;  2NVQ I;  2YU9 I;  2M48 A;  1I3Q I;  3CMA 1;  1VQ4 Z;  1YJN 1;  3T4N B;  2PMZ A;  1K9M 2;  3GKQ A;  3GCF A;  1M1K 1;  2H85 A;  3LUS A;  3NH4 A;  3VTN A;  4BY7 I;  1VQN Z;  4RVF A;  2NVT I;  2F4O A;  4RVD A;  2OOX B;  4RS4 A;  2JMO A;  2VUG A;  1LQL A;  1X0T A;  2JR6 A;  3P5J B;  5C4X I;  3OW2 Y;  4EWC A;  3HOV I;  5IP7 I;  1FDO A;  1RO0 A;  4A3K I;  3CC2 1;  2EGT A;  4NFR A;  2LEX A;  3RZO I;  1YI2 Z;  2IZ3 A;  3S16 I;  1SFO I;  3HOW I;  4MXU A;  3HOU I;  3G6E 1;  1VQ5 1;  1USP B;  3CC7 1;  2E9H A;  3MZL B;  3CCM 1;  1KRL A;  2JIO A;  2HF1 A;  4MD7 A;  4Y7N I;  3S17 I;  1VQO 1;  3CCU 1;  2O53 A;  1S7M A;  2M6N A;  2OTL 1;  4HH4 A;  3GTQ I;  2OOY B;  1W2B Z;  1NJI 1;  3M3Y I;  3TE5 B;  3GTG I;  2LIY A;  4DK1 A;  2NAP A;  2VUM I;  2WAQ A;  1QF8 A;  1YI2 1;  4A3F I;  2JIQ A;  1P9N A;  1VQK Z;  1RLY A;  2JIR A;  4RVH A;  1RNI A;  1YJN Z;  2GU2 A;  1I6H I;  4E2Z A;  1JJ2 Y;  5C3E I;  4NOZ A;  3BG1 B;  2JA7 I;  1ZB8 A;  3D9X A;  4A3D I;  4BBS I;  1Q86 1;  1VQN 1;  4E2X A;  2NVX I;  1VQ9 1;  1Y1W I;  3K7A I;  4DQY B;  2QA4 Z;  3S2D I;  1TWG I;  4NBA A;  3D2L A;  1K9M 1;  1TWF I;  1S72 1;  3CCQ 1;  2DE7 A;  3MON A;  3FKI I;  1ZB9 A;  1Z01 A;  3NDI A;  1TFI A;  1YJW Z;  1X3Z A;  4DGL A;  1KC8 2;  4BBR I;  1VQ4 1;  1Q81 2;  1QXF A;  5LL6 f;  1YJW 1;  4MD9 A;  4E33 A;  4NBF A;  2W04 A;  1FDI A;  2JIM A;  1WW9 A;  5IT9 f;  4X6A I;  1WII A;  4MRI A;  3I4N I;  2E7Z A;  1VQO Z;  1N8R 2;  2DE6 A;  1QVG Y;  1Q7Y 2;  2OTL Z;  2VPZ A;  1ZH1 A;  4E30 A;  3IR7 A;  2QEX Z;  2IV2 X;  4A3I I;  3CCV Z;  1AA6 A;  3CPW Y;  3M4O I;  1TWA I;  2V8J A;  4A3M I;  3I4M I;  1Y1V S;  3GTP I;  3HOZ I;  4HGZ A;  4A3G I;  2W03 A;  3G6E Z;  1VQ5 Z;  4S1T A;  4TNU A;  1VQP Z;  2OTJ Z;  1M90 2;  5T6B A;  3GTL I;  1YUK A;  1KQS Z;  3EED A;  3BG0 B;  1WCM I;  3MZK B;  2E2J I;  3PO3 S;  1VQ9 Z;  1QVF Z;  1QYP A;  3S15 I;  3J7A 4;  1KC8 1;  3IFU A;  4NB9 A;  3ESW A;  1Q82 2;  1RO2 A;  5A2Q f;  2JS4 A;  3J80 f;  3OW2 Z;  4CL1 A;  2JIP A;  1VQK 1;  4NBB A;  2V8I A;  3CCR 1;  4QTT A;  2I3C A;  3NH8 A;  1KD1 1;  1YUA A;  3CPW Z;  4NBH A;  2OTJ 1;  5IT9 b;  2WB1 A;  2PK7 A;  3KIH A;  2K3R A;  4BY1 I;  1KQS Y;  2RPR A;  2GTI A;  2K5R A;  2ZAE B;  2IZ4 A;  3J80 b;  3HOX I;  4XX2 A;  2RIQ A;  1VQ8 Z;  1NP6 A;  5A2Q b;  2JNY A;  3Q87 A;  5T67 A;  1YIT Z;  5C4J I;  2QEX 1;  1VQL 1;  1Q81 1;  1K73 2;  2R93 I;  4A3L I;  4A93 I;  3NFZ A;  2E2H I;  1S72 Z;  1K83 I;  3J81 b;  1PFT A;  3CCJ 1;  2R7Z I;  3S1N I;  3CCQ Z;  4E2W A;  3H0G I;  4QTU A;  1N8R 1;  3J81 f;  1USP A;  1VQM 1;  2Q4Z A;  3S14 I;  3GTK I;  3VMH A;  4A3C I;  3CCE Z;  1WZN A;  1VQP 1;  1ML8 A;  5T64 A;  3CCR Z;  2JA6 I;  2QKD A;  4E2Y A;  4BXX I;  3D6W A;  2QRC B;  1WJ2 A;  3CXC Y;  4NBC A;  3I55 Z;  3I56 1;  3EER A;  3G4S Z;  2VF1 A;  2O4H A;  3CC4 Z;  1K8A 2;  3CCV 1;  3FQQ A;  1Z02 A;  1RO4 A;  4NBE A;  3I07 A;  2GTH A;  2VPW A;  3CD6 1;  2HU9 A;  2Q51 A;  2QLV B;  4MON A;  4A3E I;  5FLX b;  3VMG A;  1Y8C A;  2LFU A;  3GTM S;  3CD6 Z;  3NH5 A;  4A3B I;  3CQZ I;  3F3P C;  3CCS Z;  1VQ6 1;  3PO2 I;  3HKZ A;  1K73 1;  2NVY I;  1VQ6 Z;  3CME 1;  3CMA Z;  5D1O A;  5IP9 I;  5D1O B;  1YIJ 1;  3CME Z;  2J6A A;  1RQF A;  1QVG Z;  5FLM I;  3JAM b;  2Y0S A;  4AYB A;  3GTO I;  3HOY I;  2AKL A;  3S1R I;  2QRE B;  3I55 1;  3I56 Z;  2V3V A;  1R9T I;  1Z03 A;  2VPY A;  2G2K A; 
#chains in the Genus database with same CATH homology
 5AN9 F;  1VQ7 Z;  1N2F A;  3CCJ Z;  2B63 I;  3S1Q I;  1W2B Y;  1M1K 2;  3CC2 Z;  1VQM Z;  2E2I I;  2PM9 A;  1NJI 2;  2R92 I;  1M90 1;  5D1P A;  3CXC Z;  4E32 A;  3FQM A;  3CCS 1;  2RHB A;  1QVF Y;  1K8A 1;  3VB9 A;  3KIF A;  1Q7Y 1;  1L1O C;  2P28 A;  3VMI A;  1YIJ Z;  1VQ8 1;  5FLX f;  1YIT 1;  3CCU Z;  1VQL Z;  2DE5 A;  1Y1V I;  2R6M A;  4Y52 I;  3CC4 1;  3QWU A;  1Q86 2;  4MD8 A;  4NBD A;  3S1M I;  1X3W A;  1JJ2 Z;  1VQ7 1;  1DL6 A;  1TWC I;  1NUI A;  3U50 C;  3G71 1;  5CM2 M;  4HGY A;  3JAM f;  4E31 A;  1KD1 2;  3G71 Z;  3F3F C;  4RV9 A;  1YHQ Z;  4NH1 C;  3CCE 1;  1JWH C;  2QRD B;  3IF8 A;  2JUB A;  2OZK A;  1YHQ 1;  1TWH I;  4MH4 A;  2JA5 I;  3CC7 Z;  2V8K A;  3CCM Z;  1I50 I;  2QR1 B;  3CCL Z;  3GTM I;  3IX0 A;  2P3Y A;  3G4S 1;  2KI7 B;  1Q82 1;  3CCL 1;  3H3V J;  2YAD A;  1VLA A;  2RBL A;  2F4M A;  5C44 I;  3NDJ A;  4NBG A;  2QA4 1;  4A3J I;  2JA8 I;  2BJO A;  3S2H I;  3RZD I;  1YJ9 Z;  2KPI A;  3PO3 I;  3TDH B;  4RVG A;  4NB8 A;  2RT9 A;  1YJ9 1;  3GTJ I;  2NVQ I;  2YU9 I;  2M48 A;  1I3Q I;  3CMA 1;  1VQ4 Z;  1YJN 1;  3T4N B;  2PMZ A;  1K9M 2;  3GKQ A;  3GCF A;  1M1K 1;  2H85 A;  3LUS A;  3NH4 A;  3VTN A;  4BY7 I;  1VQN Z;  4RVF A;  2NVT I;  2F4O A;  4RVD A;  2OOX B;  4RS4 A;  2JMO A;  2VUG A;  1LQL A;  1X0T A;  2JR6 A;  3P5J B;  5C4X I;  3OW2 Y;  4EWC A;  3HOV I;  5IP7 I;  1RO0 A;  4A3K I;  3CC2 1;  2EGT A;  4NFR A;  3RZO I;  1YI2 Z;  2IZ3 A;  3S16 I;  1SFO I;  3HOW I;  4MXU A;  3HOU I;  3G6E 1;  1VQ5 1;  1USP B;  3CC7 1;  2E9H A;  3MZL B;  3CCM 1;  1KRL A;  2HF1 A;  4MD7 A;  4Y7N I;  3S17 I;  1VQO 1;  3CCU 1;  2O53 A;  1S7M A;  2M6N A;  2OTL 1;  4HH4 A;  3GTQ I;  2OOY B;  1W2B Z;  1NJI 1;  3M3Y I;  3TE5 B;  3GTG I;  2LIY A;  4DK1 A;  2VUM I;  2WAQ A;  1QF8 A;  1YI2 1;  4A3F I;  1P9N A;  1VQK Z;  1RLY A;  4RVH A;  1RNI A;  1YJN Z;  2GU2 A;  1I6H I;  4E2Z A;  1JJ2 Y;  5C3E I;  4NOZ A;  3BG1 B;  2JA7 I;  1ZB8 A;  3D9X A;  4A3D I;  4BBS I;  1Q86 1;  1VQN 1;  4E2X A;  2NVX I;  1VQ9 1;  1Y1W I;  3K7A I;  4DQY B;  2QA4 Z;  3S2D I;  1TWG I;  4NBA A;  1K9M 1;  1TWF I;  1S72 1;  3CCQ 1;  2DE7 A;  3MON A;  3FKI I;  1ZB9 A;  1Z01 A;  3NDI A;  1TFI A;  1YJW Z;  1X3Z A;  4DGL A;  1KC8 2;  4BBR I;  1VQ4 1;  1Q81 2;  5LL6 f;  1YJW 1;  4MD9 A;  4E33 A;  4NBF A;  2W04 A;  1WW9 A;  5IT9 f;  4X6A I;  1WII A;  4MRI A;  3I4N I;  1VQO Z;  1N8R 2;  2DE6 A;  1QVG Y;  1Q7Y 2;  2OTL Z;  1ZH1 A;  4E30 A;  2QEX Z;  4A3I I;  3CCV Z;  3CPW Y;  3M4O I;  1TWA I;  2V8J A;  4A3M I;  3I4M I;  1Y1V S;  3GTP I;  3HOZ I;  4HGZ A;  4A3G I;  2W03 A;  3G6E Z;  1VQ5 Z;  4S1T A;  4TNU A;  1VQP Z;  2OTJ Z;  1M90 2;  5T6B A;  3GTL I;  1YUK A;  1KQS Z;  3EED A;  3BG0 B;  1WCM I;  3MZK B;  2E2J I;  3PO3 S;  1VQ9 Z;  1QVF Z;  1QYP A;  3S15 I;  3J7A 4;  1KC8 1;  3IFU A;  4NB9 A;  3ESW A;  1Q82 2;  1RO2 A;  5A2Q f;  2JS4 A;  3J80 f;  3OW2 Z;  4CL1 A;  1VQK 1;  4NBB A;  2V8I A;  3CCR 1;  4QTT A;  2I3C A;  3NH8 A;  1KD1 1;  1YUA A;  3CPW Z;  4NBH A;  2OTJ 1;  5IT9 b;  2WB1 A;  2PK7 A;  3KIH A;  2K3R A;  4BY1 I;  1KQS Y;  2RPR A;  2GTI A;  2K5R A;  2ZAE B;  2IZ4 A;  3J80 b;  3HOX I;  4XX2 A;  2RIQ A;  1VQ8 Z;  1NP6 A;  5A2Q b;  2JNY A;  3Q87 A;  5T67 A;  1YIT Z;  5C4J I;  2QEX 1;  1VQL 1;  1Q81 1;  1K73 2;  2R93 I;  4A3L I;  4A93 I;  3NFZ A;  2E2H I;  1S72 Z;  1K83 I;  3J81 b;  1PFT A;  3CCJ 1;  2R7Z I;  3S1N I;  3CCQ Z;  4E2W A;  3H0G I;  4QTU A;  1N8R 1;  3J81 f;  1USP A;  1VQM 1;  2Q4Z A;  3S14 I;  3GTK I;  3VMH A;  4A3C I;  3CCE Z;  1VQP 1;  1ML8 A;  5T64 A;  3CCR Z;  2JA6 I;  2QKD A;  4E2Y A;  4BXX I;  3D6W A;  2QRC B;  3CXC Y;  4NBC A;  3I55 Z;  3I56 1;  3EER A;  3G4S Z;  2VF1 A;  2O4H A;  3CC4 Z;  1K8A 2;  3CCV 1;  3FQQ A;  1Z02 A;  1RO4 A;  4NBE A;  3I07 A;  2GTH A;  3CD6 1;  2HU9 A;  2Q51 A;  2QLV B;  4MON A;  4A3E I;  5FLX b;  3VMG A;  2LFU A;  3GTM S;  3CD6 Z;  3NH5 A;  4A3B I;  3CQZ I;  3F3P C;  3CCS Z;  1VQ6 1;  3PO2 I;  3HKZ A;  1K73 1;  2NVY I;  1VQ6 Z;  3CME 1;  3CMA Z;  5D1O A;  5IP9 I;  5D1O B;  1YIJ 1;  3CME Z;  2J6A A;  1RQF A;  1QVG Z;  5FLM I;  3JAM b;  2Y0S A;  4AYB A;  3GTO I;  3HOY I;  2AKL A;  3S1R I;  2QRE B;  3I55 1;  3I56 Z;  1R9T I;  1Z03 A;  2G2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...