2RPRA

Solution structure of the fifth flywch domain of flywch-type zinc finger-containing protein 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
GSSGSSGLRPLEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEALRQRERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLYWCH-type zinc finger-containing protein 1
publication title Solution structure of the fifth FLYWCH domain of FLYWCH-type zinc finger-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 10
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04500 FLYWCH FLYWCH zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.240 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rprA00
2RPRA
chains in the Genus database with same CATH superfamily
1VQM1 2Y0SA 3RZOI 1VQOZ 1QVFY 2V45A 1W2BY 1YI21 2QR1B 3CXCY 4BBSI 4DGLA 4MONA 5D1PA 4BY1I 2JA8I 4A3LI 3S16I 2HF1A 2VPZA 2V8KA 2JA5I 3KIHA 2AKLA 1KQSY 4E30A 1VQ51 1Q812 1Q16A 1VQ9Z 1M902 2GTHA 5IP7I 3CCS1 3GTLI 3GTPI 3CCL1 1YJ91 4XX2A 3BG1B 2DE7A 1VQNZ 2F4OA 1YIJZ 3CCRZ 4E2XA 1VQL1 2IZ4A 2JIRA 2QKDA 1QVGZ 4RS4A 3S2DI 1YJN1 2HU9A 1DL6A 2O53A 4NBGA 1ZB9A 3CCE1 3J80b 1Z02A 1Q811 4MD9A 5T64A 1M901 5FLMI 3CCM1 1RO4A 4Y7NI 2RPRA 3GTOI 1K8A2 2JS4A 4E32A 3HOXI 2OTJZ 1SIWA 2E7ZA 1VQO1 3VB9A 3F3PC 3S2HI 1TFIA 1YUAA 3CC7Z 2LIYA 1K9M2 1QVGY 1WZNA 4CL1A 3CC41 3HOWI 5CM2M 4NB8A 5IT9b 3HOUI 3H3VJ 2R92I 2BJOA 5LL6f 3GKQA 1K732 2W04A 1ZH1A 3K7AI 1WW9A 3PO2I 1USPB 4NBHA 4E31A 2E2II 1YUKA 4NBEA 2VUMI 2NVXI 1VQ91 2VPXA 1K9M1 5FLXf 5AN9F 3QWUA 3I561 4A3FI 1YIJ1 2K3RA 3NDJA 3CCR1 3S1QI 1P9NA 3FQMA 4HGZA 5T6BA 3BG0B 3MZLB 4RVGA 2NVQI 3S15I 3PO3I 1M1K2 2VF1A 1K731 2JMOA 1Y8CA 1TWCI 3CCJ1 1USPA 2E2JI 2LEXA 1QYPA 4NBBA 3I07A 1Q822 2QRCB 3CD6Z 1TWHI 3EEDA 2JIMA 2E2HI 2OTJ1 5IP9I 2YU9I 1M1K1 3J81b 2EGTA 2IV2X 2QRDB 3CC71 3CC4Z 1QF8A 5A2Qb 1Q821 4RVHA 3CC21 2RBLA 3CQZI 1NUIA 2B63I 3HKZA 2VUGA 3IR7A 3VMIA 1TWGI 2AYDA 3S17I 2Q4ZA 4A3DI 3JAMf 1X3WA 1YJWZ 1ZB8A 2G2KA 3OW2Z 4NB9A 2QREB 2OOXB 3I56Z 1S72Z 4RVFA 3IX0A 2K5RA 4E2YA 1L1OC 2NAPA 1VQP1 2GTIA 2OTLZ 3MZKB 4NOZA 1FDOA 1TWFI 3CCJZ 3CMEZ 3LUSA 1RO0A 2JIQA 2WAQA 4AYBA 1RNIA 4E33A 2V8JA 2NVTI 3CD61 1Q862 2QEXZ 1RLYA 3J7A4 3OW2Y 3H0GI 1PFTA 3GTMS 3CCUZ 3G6E1 3VMHA 2M6NA 5A2Qf 3GTJI 2ZAEB 3U50C 4MH4A 1VQ41 4A3CI 5C44I 2JNYA 1R9TI 2OZKA 3CC2Z 4A3II 3CCV1 1Q861 3ESWA 4NBDA 2JA6I 1YJW1 4A3MI 1JJ2Z 2H85A 5C4XI 2VPWA 2KPIA 2YADA 4RVDA 3VMGA 1S721 1I50I 3J80f 1KRLA 3S1RI 3I4NI 1VQPZ 3HOYI 4A3GI 2RHBA 1KD12 4MXUA 3CMAZ 1LQLA 2JUBA 1N2FA 2J6AA 3PO3S 2OTL1 3FKII 3TE5B 3Q87A 4TNUA 2RIQA 3CME1 3D6WA 3GTQI 1NP6A 1YHQ1 5C3EI 2R7ZI 2QEX1 1VQ6Z 1JJ2Y 4A3JI 3G6EZ 3CCU1 2JR6A 1KD11 3D2LA 3NH5A 3G4SZ 5IT9f 1RO2A 1VQ4Z 3S1NI 2WB1A 2P3YA 2DE6A 5D1OB 1VQ8Z 3GTKI 3CCVZ 4MD7A 1YITZ 1Y1VI 3I4MI 2P28A 1VQ71 1X3ZA 3IF8A 4HGYA 3CCQZ 2NVYI 2OOYB 2R6MA 3GCFA 5T67A 3RZDI 2GU2A 1NJI1 1SFOI 3TDHB 4A3EI 3HOVI 2RT9A 1QXFA 3HOZI 2M48A 5D1OA 3NDIA 1I3QI 1WIIA 3CMA1 2V3VA 4Y52I 3D9XA 4A3KI 2QLVB 3G71Z 3FQQA 1I6HI 1N8R2 1AA6A 4S1TA 1VLAA 3M4OI 1S7MA 1YHQZ 1Z01A 2E9HA 4DK1A 3J81f 4NFRA 2DE5A 2KI7B 2QA4Z 1WJ2A 1VQ61 5FLXb 2PK7A 3T4NB 2PMZA 3VTNA 3I55Z 1TWAI 1FDIA 3NH4A 2IZ3A 3P5JB 3G4S1 4RV9A 3GTGI 1VQK1 3KIFA 1N8R1 2Q51A 4QTUA 2O4HA 1VQ81 2V8IA 1K83I 1YIT1 4MD8A 1WCMI 1VQ7Z 3GTMI 1VQMZ 3IFUA 3S14I 4NBCA 4BBRI 1KC82 3EERA 3NH8A 1Y1WI 2PM9A 4MRIA 1YI2Z 3CCQ1 1X0TA 2R93I 4EWCA 2I3CA 3CPWZ 4BXXI 4HH4A 1K8A1 4NH1C 2JIPA 1KC81 1VQ5Z 1Z03A 1Q7Y2 4E2WA 3CCSZ 3G711 2W03A 3CCLZ 1YJ9Z 4A93I 4NBFA 2VPYA 4NBAA 4A3BI 3MONA 1VQN1 2F4MA 3F3FC 1JWHC 1QVFZ 1ML8A 3JAMb 1VQLZ 1W2BZ 2QA41 3NFZA 3CXCZ 5C4JI 3CPWY 2JA7I 4E2ZA 4DQYB 1YJNZ 3M3YI 4BY7I 4QTTA 3I551 3CCEZ 4X6AI 1RQFA 1Q7Y1 3S1MI 1NJI2 2JIOA 1VQKZ 3CCMZ 1KQSZ 1Y1VS 2LFUA
chains in the Genus database with same CATH topology
1VQM1 2Y0SA 3RZOI 1VQOZ 1QVFY 1W2BY 1YI21 2QR1B 3CXCY 4BBSI 4DGLA 4MONA 5D1PA 4BY1I 2JA8I 4A3LI 3S16I 2HF1A 2V8KA 2JA5I 3KIHA 2AKLA 1KQSY 4E30A 1VQ51 1Q812 1VQ9Z 1M902 2GTHA 5IP7I 3CCS1 3GTLI 3GTPI 3CCL1 1YJ91 4XX2A 3BG1B 2DE7A 1VQNZ 2F4OA 1YIJZ 3CCRZ 4E2XA 1VQL1 2IZ4A 2QKDA 1QVGZ 4RS4A 3S2DI 1YJN1 2HU9A 1DL6A 2O53A 4NBGA 1ZB9A 3CCE1 3J80b 1Z02A 1Q811 4MD9A 5T64A 1M901 5FLMI 3CCM1 1RO4A 4Y7NI 2RPRA 3GTOI 1K8A2 2JS4A 4E32A 3HOXI 2OTJZ 1VQO1 3VB9A 3F3PC 3S2HI 1TFIA 1YUAA 3CC7Z 2LIYA 1K9M2 1QVGY 4CL1A 3CC41 3HOWI 5CM2M 4NB8A 5IT9b 3HOUI 3H3VJ 2R92I 2BJOA 5LL6f 3GKQA 1K732 2W04A 1ZH1A 3K7AI 1WW9A 3PO2I 1USPB 4NBHA 4E31A 2E2II 1YUKA 4NBEA 2VUMI 2NVXI 1VQ91 1K9M1 5FLXf 5AN9F 3QWUA 3I561 4A3FI 1YIJ1 2K3RA 3NDJA 3CCR1 3S1QI 1P9NA 3FQMA 4HGZA 5T6BA 3BG0B 3MZLB 4RVGA 2NVQI 3S15I 3PO3I 1M1K2 2VF1A 1K731 2JMOA 1TWCI 3CCJ1 1USPA 2E2JI 1QYPA 4NBBA 3I07A 1Q822 2QRCB 3CD6Z 1TWHI 3EEDA 2E2HI 2OTJ1 5IP9I 2YU9I 1M1K1 3J81b 2EGTA 2QRDB 3CC71 3CC4Z 1QF8A 5A2Qb 1Q821 4RVHA 3CC21 2RBLA 3CQZI 1NUIA 2B63I 3HKZA 2VUGA 3VMIA 1TWGI 3S17I 2Q4ZA 4A3DI 3JAMf 1X3WA 1YJWZ 1ZB8A 2G2KA 3OW2Z 4NB9A 2QREB 2OOXB 3I56Z 1S72Z 4RVFA 3IX0A 2K5RA 4E2YA 1L1OC 1VQP1 2GTIA 2OTLZ 3MZKB 4NOZA 1TWFI 3CCJZ 3CMEZ 3LUSA 1RO0A 2WAQA 4AYBA 1RNIA 4E33A 2V8JA 2NVTI 3CD61 1Q862 2QEXZ 1RLYA 3J7A4 3OW2Y 3H0GI 1PFTA 3GTMS 3CCUZ 3G6E1 3VMHA 2M6NA 5A2Qf 3GTJI 2ZAEB 3U50C 4MH4A 1VQ41 4A3CI 5C44I 2JNYA 1R9TI 2OZKA 3CC2Z 4A3II 3CCV1 1Q861 3ESWA 4NBDA 2JA6I 1YJW1 4A3MI 1JJ2Z 2H85A 5C4XI 2KPIA 2YADA 4RVDA 3VMGA 1S721 1I50I 3J80f 1KRLA 3S1RI 3I4NI 1VQPZ 3HOYI 4A3GI 2RHBA 1KD12 4MXUA 3CMAZ 1LQLA 2JUBA 1N2FA 2J6AA 3PO3S 2OTL1 3FKII 3TE5B 3Q87A 4TNUA 2RIQA 3CME1 3D6WA 3GTQI 1NP6A 1YHQ1 5C3EI 2R7ZI 2QEX1 1VQ6Z 1JJ2Y 4A3JI 3G6EZ 3CCU1 2JR6A 1KD11 3NH5A 3G4SZ 5IT9f 1RO2A 1VQ4Z 3S1NI 2WB1A 2P3YA 2DE6A 5D1OB 1VQ8Z 3GTKI 3CCVZ 4MD7A 1YITZ 1Y1VI 3I4MI 2P28A 1VQ71 1X3ZA 3IF8A 4HGYA 3CCQZ 2NVYI 2OOYB 2R6MA 3GCFA 5T67A 3RZDI 2GU2A 1NJI1 1SFOI 3TDHB 4A3EI 3HOVI 2RT9A 3HOZI 2M48A 5D1OA 3NDIA 1I3QI 1WIIA 3CMA1 4Y52I 3D9XA 4A3KI 2QLVB 3G71Z 3FQQA 1I6HI 1N8R2 4S1TA 1VLAA 3M4OI 1S7MA 1YHQZ 1Z01A 2E9HA 4DK1A 3J81f 4NFRA 2DE5A 2KI7B 2QA4Z 1VQ61 5FLXb 2PK7A 3T4NB 2PMZA 3VTNA 3I55Z 1TWAI 3NH4A 2IZ3A 3P5JB 3G4S1 4RV9A 3GTGI 1VQK1 3KIFA 1N8R1 2Q51A 4QTUA 2O4HA 1VQ81 2V8IA 1K83I 1YIT1 4MD8A 1WCMI 1VQ7Z 3GTMI 1VQMZ 3IFUA 3S14I 4NBCA 4BBRI 1KC82 3EERA 3NH8A 1Y1WI 2PM9A 4MRIA 1YI2Z 3CCQ1 1X0TA 2R93I 4EWCA 2I3CA 3CPWZ 4BXXI 4HH4A 1K8A1 4NH1C 1KC81 1VQ5Z 1Z03A 1Q7Y2 4E2WA 3CCSZ 3G711 2W03A 3CCLZ 1YJ9Z 4A93I 4NBFA 4A3BI 4NBAA 3MONA 1VQN1 2F4MA 3F3FC 1JWHC 1QVFZ 1ML8A 3JAMb 1VQLZ 1W2BZ 2QA41 3NFZA 3CXCZ 5C4JI 3CPWY 2JA7I 4E2ZA 4DQYB 1YJNZ 3M3YI 4BY7I 4QTTA 3I551 3CCEZ 4X6AI 1RQFA 1Q7Y1 3S1MI 1NJI2 1VQKZ 3CCMZ 1KQSZ 1Y1VS 2LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPR A; 
#chains in the Genus database with same CATH topology
 1VQM 1;  2Y0S A;  3RZO I;  1VQO Z;  1QVF Y;  2V45 A;  1W2B Y;  1YI2 1;  2QR1 B;  3CXC Y;  4BBS I;  4DGL A;  4MON A;  5D1P A;  4BY1 I;  2JA8 I;  4A3L I;  3S16 I;  2HF1 A;  2VPZ A;  2V8K A;  2JA5 I;  3KIH A;  2AKL A;  1KQS Y;  4E30 A;  1VQ5 1;  1Q81 2;  1Q16 A;  1VQ9 Z;  1M90 2;  2GTH A;  5IP7 I;  3CCS 1;  3GTL I;  3GTP I;  3CCL 1;  1YJ9 1;  4XX2 A;  3BG1 B;  2DE7 A;  1VQN Z;  2F4O A;  1YIJ Z;  3CCR Z;  4E2X A;  1VQL 1;  2IZ4 A;  2JIR A;  2QKD A;  1QVG Z;  4RS4 A;  3S2D I;  1YJN 1;  2HU9 A;  1DL6 A;  2O53 A;  4NBG A;  1ZB9 A;  3CCE 1;  3J80 b;  1Z02 A;  1Q81 1;  4MD9 A;  5T64 A;  1M90 1;  5FLM I;  3CCM 1;  1RO4 A;  4Y7N I;  2RPR A;  3GTO I;  1K8A 2;  2JS4 A;  4E32 A;  3HOX I;  2OTJ Z;  1SIW A;  2E7Z A;  1VQO 1;  3VB9 A;  3F3P C;  3S2H I;  1TFI A;  1YUA A;  3CC7 Z;  2LIY A;  1K9M 2;  1QVG Y;  1WZN A;  4CL1 A;  3CC4 1;  3HOW I;  5CM2 M;  4NB8 A;  5IT9 b;  3HOU I;  3H3V J;  2R92 I;  2BJO A;  5LL6 f;  3GKQ A;  1K73 2;  2W04 A;  1ZH1 A;  3K7A I;  1WW9 A;  3PO2 I;  1USP B;  4NBH A;  4E31 A;  2E2I I;  1YUK A;  4NBE A;  2VUM I;  2NVX I;  1VQ9 1;  2VPX A;  1K9M 1;  5FLX f;  5AN9 F;  3QWU A;  3I56 1;  4A3F I;  1YIJ 1;  2K3R A;  3NDJ A;  3CCR 1;  3S1Q I;  1P9N A;  3FQM A;  4HGZ A;  5T6B A;  3BG0 B;  3MZL B;  4RVG A;  2NVQ I;  3S15 I;  3PO3 I;  1M1K 2;  2VF1 A;  1K73 1;  2JMO A;  1Y8C A;  1TWC I;  3CCJ 1;  1USP A;  2E2J I;  2LEX A;  1QYP A;  4NBB A;  3I07 A;  1Q82 2;  2QRC B;  3CD6 Z;  1TWH I;  3EED A;  2JIM A;  2E2H I;  2OTJ 1;  5IP9 I;  2YU9 I;  1M1K 1;  3J81 b;  2EGT A;  2IV2 X;  2QRD B;  3CC7 1;  3CC4 Z;  1QF8 A;  5A2Q b;  1Q82 1;  4RVH A;  3CC2 1;  2RBL A;  3CQZ I;  1NUI A;  2B63 I;  3HKZ A;  2VUG A;  3IR7 A;  3VMI A;  1TWG I;  2AYD A;  3S17 I;  2Q4Z A;  4A3D I;  3JAM f;  1X3W A;  1YJW Z;  1ZB8 A;  2G2K A;  3OW2 Z;  4NB9 A;  2QRE B;  2OOX B;  3I56 Z;  1S72 Z;  4RVF A;  3IX0 A;  2K5R A;  4E2Y A;  1L1O C;  2NAP A;  1VQP 1;  2GTI A;  2OTL Z;  3MZK B;  4NOZ A;  1FDO A;  1TWF I;  3CCJ Z;  3CME Z;  3LUS A;  1RO0 A;  2JIQ A;  2WAQ A;  4AYB A;  1RNI A;  4E33 A;  2V8J A;  2NVT I;  3CD6 1;  1Q86 2;  2QEX Z;  1RLY A;  3J7A 4;  3OW2 Y;  3H0G I;  1PFT A;  3GTM S;  3CCU Z;  3G6E 1;  3VMH A;  2M6N A;  5A2Q f;  3GTJ I;  2ZAE B;  3U50 C;  4MH4 A;  1VQ4 1;  4A3C I;  5C44 I;  2JNY A;  1R9T I;  2OZK A;  3CC2 Z;  4A3I I;  3CCV 1;  1Q86 1;  3ESW A;  4NBD A;  2JA6 I;  1YJW 1;  4A3M I;  1JJ2 Z;  2H85 A;  5C4X I;  2VPW A;  2KPI A;  2YAD A;  4RVD A;  3VMG A;  1S72 1;  1I50 I;  3J80 f;  1KRL A;  3S1R I;  3I4N I;  1VQP Z;  3HOY I;  4A3G I;  2RHB A;  1KD1 2;  4MXU A;  3CMA Z;  1LQL A;  2JUB A;  1N2F A;  2J6A A;  3PO3 S;  2OTL 1;  3FKI I;  3TE5 B;  3Q87 A;  4TNU A;  2RIQ A;  3CME 1;  3D6W A;  3GTQ I;  1NP6 A;  1YHQ 1;  5C3E I;  2R7Z I;  2QEX 1;  1VQ6 Z;  1JJ2 Y;  4A3J I;  3G6E Z;  3CCU 1;  2JR6 A;  1KD1 1;  3D2L A;  3NH5 A;  3G4S Z;  5IT9 f;  1RO2 A;  1VQ4 Z;  3S1N I;  2WB1 A;  2P3Y A;  2DE6 A;  5D1O B;  1VQ8 Z;  3GTK I;  3CCV Z;  4MD7 A;  1YIT Z;  1Y1V I;  3I4M I;  2P28 A;  1VQ7 1;  1X3Z A;  3IF8 A;  4HGY A;  3CCQ Z;  2NVY I;  2OOY B;  2R6M A;  3GCF A;  5T67 A;  3RZD I;  2GU2 A;  1NJI 1;  1SFO I;  3TDH B;  4A3E I;  3HOV I;  2RT9 A;  1QXF A;  3HOZ I;  2M48 A;  5D1O A;  3NDI A;  1I3Q I;  1WII A;  3CMA 1;  2V3V A;  4Y52 I;  3D9X A;  4A3K I;  2QLV B;  3G71 Z;  3FQQ A;  1I6H I;  1N8R 2;  1AA6 A;  4S1T A;  1VLA A;  3M4O I;  1S7M A;  1YHQ Z;  1Z01 A;  2E9H A;  4DK1 A;  3J81 f;  4NFR A;  2DE5 A;  2KI7 B;  2QA4 Z;  1WJ2 A;  1VQ6 1;  5FLX b;  2PK7 A;  3T4N B;  2PMZ A;  3VTN A;  3I55 Z;  1TWA I;  1FDI A;  3NH4 A;  2IZ3 A;  3P5J B;  3G4S 1;  4RV9 A;  3GTG I;  1VQK 1;  3KIF A;  1N8R 1;  2Q51 A;  4QTU A;  2O4H A;  1VQ8 1;  2V8I A;  1K83 I;  1YIT 1;  4MD8 A;  1WCM I;  1VQ7 Z;  3GTM I;  1VQM Z;  3IFU A;  3S14 I;  4NBC A;  4BBR I;  1KC8 2;  3EER A;  3NH8 A;  1Y1W I;  2PM9 A;  4MRI A;  1YI2 Z;  3CCQ 1;  1X0T A;  2R93 I;  4EWC A;  2I3C A;  3CPW Z;  4BXX I;  4HH4 A;  1K8A 1;  4NH1 C;  2JIP A;  1KC8 1;  1VQ5 Z;  1Z03 A;  1Q7Y 2;  4E2W A;  3CCS Z;  3G71 1;  2W03 A;  3CCL Z;  1YJ9 Z;  4A93 I;  4NBF A;  2VPY A;  4NBA A;  4A3B I;  3MON A;  1VQN 1;  2F4M A;  3F3F C;  1JWH C;  1QVF Z;  1ML8 A;  3JAM b;  1VQL Z;  1W2B Z;  2QA4 1;  3NFZ A;  3CXC Z;  5C4J I;  3CPW Y;  2JA7 I;  4E2Z A;  4DQY B;  1YJN Z;  3M3Y I;  4BY7 I;  4QTT A;  3I55 1;  3CCE Z;  4X6A I;  1RQF A;  1Q7Y 1;  3S1M I;  1NJI 2;  2JIO A;  1VQK Z;  3CCM Z;  1KQS Z;  1Y1V S;  2LFU A; 
#chains in the Genus database with same CATH homology
 1VQM 1;  2Y0S A;  3RZO I;  1VQO Z;  1QVF Y;  1W2B Y;  1YI2 1;  2QR1 B;  3CXC Y;  4BBS I;  4DGL A;  4MON A;  5D1P A;  4BY1 I;  2JA8 I;  4A3L I;  3S16 I;  2HF1 A;  2V8K A;  2JA5 I;  3KIH A;  2AKL A;  1KQS Y;  4E30 A;  1VQ5 1;  1Q81 2;  1VQ9 Z;  1M90 2;  2GTH A;  5IP7 I;  3CCS 1;  3GTL I;  3GTP I;  3CCL 1;  1YJ9 1;  4XX2 A;  3BG1 B;  2DE7 A;  1VQN Z;  2F4O A;  1YIJ Z;  3CCR Z;  4E2X A;  1VQL 1;  2IZ4 A;  2QKD A;  1QVG Z;  4RS4 A;  3S2D I;  1YJN 1;  2HU9 A;  1DL6 A;  2O53 A;  4NBG A;  1ZB9 A;  3CCE 1;  3J80 b;  1Z02 A;  1Q81 1;  4MD9 A;  5T64 A;  1M90 1;  5FLM I;  3CCM 1;  1RO4 A;  4Y7N I;  2RPR A;  3GTO I;  1K8A 2;  2JS4 A;  4E32 A;  3HOX I;  2OTJ Z;  1VQO 1;  3VB9 A;  3F3P C;  3S2H I;  1TFI A;  1YUA A;  3CC7 Z;  2LIY A;  1K9M 2;  1QVG Y;  4CL1 A;  3CC4 1;  3HOW I;  5CM2 M;  4NB8 A;  5IT9 b;  3HOU I;  3H3V J;  2R92 I;  2BJO A;  5LL6 f;  3GKQ A;  1K73 2;  2W04 A;  1ZH1 A;  3K7A I;  1WW9 A;  3PO2 I;  1USP B;  4NBH A;  4E31 A;  2E2I I;  1YUK A;  4NBE A;  2VUM I;  2NVX I;  1VQ9 1;  1K9M 1;  5FLX f;  5AN9 F;  3QWU A;  3I56 1;  4A3F I;  1YIJ 1;  2K3R A;  3NDJ A;  3CCR 1;  3S1Q I;  1P9N A;  3FQM A;  4HGZ A;  5T6B A;  3BG0 B;  3MZL B;  4RVG A;  2NVQ I;  3S15 I;  3PO3 I;  1M1K 2;  2VF1 A;  1K73 1;  2JMO A;  1TWC I;  3CCJ 1;  1USP A;  2E2J I;  1QYP A;  4NBB A;  3I07 A;  1Q82 2;  2QRC B;  3CD6 Z;  1TWH I;  3EED A;  2E2H I;  2OTJ 1;  5IP9 I;  2YU9 I;  1M1K 1;  3J81 b;  2EGT A;  2QRD B;  3CC7 1;  3CC4 Z;  1QF8 A;  5A2Q b;  1Q82 1;  4RVH A;  3CC2 1;  2RBL A;  3CQZ I;  1NUI A;  2B63 I;  3HKZ A;  2VUG A;  3VMI A;  1TWG I;  3S17 I;  2Q4Z A;  4A3D I;  3JAM f;  1X3W A;  1YJW Z;  1ZB8 A;  2G2K A;  3OW2 Z;  4NB9 A;  2QRE B;  2OOX B;  3I56 Z;  1S72 Z;  4RVF A;  3IX0 A;  2K5R A;  4E2Y A;  1L1O C;  1VQP 1;  2GTI A;  2OTL Z;  3MZK B;  4NOZ A;  1TWF I;  3CCJ Z;  3CME Z;  3LUS A;  1RO0 A;  2WAQ A;  4AYB A;  1RNI A;  4E33 A;  2V8J A;  2NVT I;  3CD6 1;  1Q86 2;  2QEX Z;  1RLY A;  3J7A 4;  3OW2 Y;  3H0G I;  1PFT A;  3GTM S;  3CCU Z;  3G6E 1;  3VMH A;  2M6N A;  5A2Q f;  3GTJ I;  2ZAE B;  3U50 C;  4MH4 A;  1VQ4 1;  4A3C I;  5C44 I;  2JNY A;  1R9T I;  2OZK A;  3CC2 Z;  4A3I I;  3CCV 1;  1Q86 1;  3ESW A;  4NBD A;  2JA6 I;  1YJW 1;  4A3M I;  1JJ2 Z;  2H85 A;  5C4X I;  2KPI A;  2YAD A;  4RVD A;  3VMG A;  1S72 1;  1I50 I;  3J80 f;  1KRL A;  3S1R I;  3I4N I;  1VQP Z;  3HOY I;  4A3G I;  2RHB A;  1KD1 2;  4MXU A;  3CMA Z;  1LQL A;  2JUB A;  1N2F A;  2J6A A;  3PO3 S;  2OTL 1;  3FKI I;  3TE5 B;  3Q87 A;  4TNU A;  2RIQ A;  3CME 1;  3D6W A;  3GTQ I;  1NP6 A;  1YHQ 1;  5C3E I;  2R7Z I;  2QEX 1;  1VQ6 Z;  1JJ2 Y;  4A3J I;  3G6E Z;  3CCU 1;  2JR6 A;  1KD1 1;  3NH5 A;  3G4S Z;  5IT9 f;  1RO2 A;  1VQ4 Z;  3S1N I;  2WB1 A;  2P3Y A;  2DE6 A;  5D1O B;  1VQ8 Z;  3GTK I;  3CCV Z;  4MD7 A;  1YIT Z;  1Y1V I;  3I4M I;  2P28 A;  1VQ7 1;  1X3Z A;  3IF8 A;  4HGY A;  3CCQ Z;  2NVY I;  2OOY B;  2R6M A;  3GCF A;  5T67 A;  3RZD I;  2GU2 A;  1NJI 1;  1SFO I;  3TDH B;  4A3E I;  3HOV I;  2RT9 A;  3HOZ I;  2M48 A;  5D1O A;  3NDI A;  1I3Q I;  1WII A;  3CMA 1;  4Y52 I;  3D9X A;  4A3K I;  2QLV B;  3G71 Z;  3FQQ A;  1I6H I;  1N8R 2;  4S1T A;  1VLA A;  3M4O I;  1S7M A;  1YHQ Z;  1Z01 A;  2E9H A;  4DK1 A;  3J81 f;  4NFR A;  2DE5 A;  2KI7 B;  2QA4 Z;  1VQ6 1;  5FLX b;  2PK7 A;  3T4N B;  2PMZ A;  3VTN A;  3I55 Z;  1TWA I;  3NH4 A;  2IZ3 A;  3P5J B;  3G4S 1;  4RV9 A;  3GTG I;  1VQK 1;  3KIF A;  1N8R 1;  2Q51 A;  4QTU A;  2O4H A;  1VQ8 1;  2V8I A;  1K83 I;  1YIT 1;  4MD8 A;  1WCM I;  1VQ7 Z;  3GTM I;  1VQM Z;  3IFU A;  3S14 I;  4NBC A;  4BBR I;  1KC8 2;  3EER A;  3NH8 A;  1Y1W I;  2PM9 A;  4MRI A;  1YI2 Z;  3CCQ 1;  1X0T A;  2R93 I;  4EWC A;  2I3C A;  3CPW Z;  4BXX I;  4HH4 A;  1K8A 1;  4NH1 C;  1KC8 1;  1VQ5 Z;  1Z03 A;  1Q7Y 2;  4E2W A;  3CCS Z;  3G71 1;  2W03 A;  3CCL Z;  1YJ9 Z;  4A93 I;  4NBF A;  4A3B I;  4NBA A;  3MON A;  1VQN 1;  2F4M A;  3F3F C;  1JWH C;  1QVF Z;  1ML8 A;  3JAM b;  1VQL Z;  1W2B Z;  2QA4 1;  3NFZ A;  3CXC Z;  5C4J I;  3CPW Y;  2JA7 I;  4E2Z A;  4DQY B;  1YJN Z;  3M3Y I;  4BY7 I;  4QTT A;  3I55 1;  3CCE Z;  4X6A I;  1RQF A;  1Q7Y 1;  3S1M I;  1NJI 2;  1VQK Z;  3CCM Z;  1KQS Z;  1Y1V S;  2LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...