2RPRA

Solution structure of the fifth flywch domain of flywch-type zinc finger-containing protein 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
GSSGSSGLRPLEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEALRQRERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords FLYWCH-type zinc finger-containing protein 1
publication title Solution structure of the fifth FLYWCH domain of FLYWCH-type zinc finger-containing protein 1
rcsb
source organism Homo sapiens
total genus 10
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04500 FLYWCH FLYWCH zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.240 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rprA00
2RPRA
chains in the Genus database with same CATH superfamily
1VQPZ 2VF1A 2PMZA 4NBEA 5T6BA 3CCR1 1KC82 3GTGI 1TWFI 3EERA 2QKDA 3BG0B 1JJ2Z 2OZKA 4E32A 2JNYA 2JIMA 2F4MA 5IP7I 1VLAA 4S1TA 3CCSZ 4NBAA 3OW2Y 2JIOA 4QTTA 5AN9F 3CPWZ 2NVYI 1Y1VS 2R92I 1Q16A 2DE6A 4Y7NI 2J6AA 2JA8I 3VMGA 4MONA 4E2XA 2QRCB 5FLXb 3CCM1 3HKZA 2E2HI 4QTUA 5A2Qf 1W2BZ 1P9NA 4NBCA 3G71Z 3VB9A 4A3DI 2JA6I 3CMAZ 2E2JI 1RO4A 3P5JB 3S2HI 3GTPI 2JIPA 1I50I 2WAQA 1YIJZ 3G4S1 4HH4A 2R7ZI 2M6NA 4E33A 3MZKB 2V8JA 1K9M2 4BBRI 1X3ZA 4MRIA 1JJ2Y 1VQ5Z 3I55Z 2P3YA 4BBSI 3HOYI 1RNIA 1TWAI 3I56Z 1VQO1 4NOZA 3CCEZ 3ESWA 4DK1A 3D2LA 4A3LI 3CPWY 1VQ9Z 1TWGI 2LFUA 2LIYA 3H3VJ 2VPXA 5CM2M 1RO2A 3PO2I 3K7AI 3M4OI 3F3PC 3IF8A 2OTLZ 1VQ81 1Y8CA 4MD9A 2KPIA 2JR6A 4AYBA 3S1QI 2YADA 1W2BY 3QWUA 4BY7I 1KC81 1RQFA 3EEDA 4A3GI 1QYPA 2WB1A 1VQ7Z 3H0GI 2NVQI 4MD7A 2QLVB 3F3FC 3J81b 3CCJ1 4EWCA 1SFOI 1NJI2 1VQN1 1VQK1 1M1K2 1TWHI 2JIRA 1YJN1 1FDIA 3CCLZ 1VQ6Z 1YHQ1 1VQ41 2P28A 2QA41 2G2KA 2QR1B 2R93I 1RLYA 3GKQA 3HOXI 3TE5B 3CC71 2GTIA 1S72Z 1Q7Y2 4NBGA 3M3YI 3GTJI 2GU2A 2RBLA 4BXXI 3S1RI 3CD6Z 2QREB 4TNUA 4MXUA 5T64A 3CQZI 3CC4Z 2JUBA 3IR7A 2Q51A 3CCS1 5IP9I 2DE5A 3GTQI 1QVGZ 2NVTI 1K9M1 4NFRA 3FQMA 2V8IA 3T4NB 4A3MI 3GTOI 2HF1A 4A3BI 3CC2Z 2OOYB 3KIHA 2OTJZ 3IFUA 3CCVZ 3I4NI 2RT9A 3D6WA 3J80f 2Q4ZA 3CCQZ 3LUSA 4E30A 1WIIA 5T67A 1I6HI 3MONA 3HOWI 5IT9f 2ZAEB 2V3VA 2E9HA 3G711 2K3RA 3GTMI 2H85A 2K5RA 1NP6A 1N8R2 1VQLZ 3CMA1 1QXFA 2JMOA 4DGLA 3JAMb 2AKLA 1VQOZ 2DE7A 3G6EZ 1YIJ1 3GTKI 4MH4A 3S1MI 1Z02A 3MZLB 5C3EI 4X6AI 3NDJA 2JS4A 1YITZ 3J7A4 2R6MA 2VPWA 3I551 1VQ51 1KQSZ 1JWHC 2GTHA 2NAPA 1Z03A 1NJI1 3CCE1 1YUAA 1QVGY 3S17I 1M1K1 1YJWZ 4CL1A 4NB9A 1YI21 1VQMZ 3RZOI 4E31A 4RVGA 3S15I 1RO0A 2QRDB 4RS4A 2OTL1 3PO3I 1TFIA 4NBBA 1WJ2A 3CME1 3GTLI 2KI7B 1Q7Y1 3CCU1 2AYDA 1YJ9Z 1TWCI 1N2FA 3VMHA 2O4HA 4A3II 3RZDI 1M902 3NH8A 1YJNZ 2JA7I 1QF8A 2QEXZ 1VQ71 1FDOA 4A3KI 2F4OA 4E2WA 3CCRZ 3GTMS 1K732 1S7MA 2I3CA 1ZH1A 4RV9A 1SIWA 3J81f 1QVFZ 1ZB8A 2BJOA 3HOZI 2LEXA 3CCL1 1KQSY 2HU9A 3Q87A 4DQYB 3I4MI 4A3CI 1VQP1 4MD8A 1LQLA 3NH5A 3FQQA 2VUMI 2PM9A 2IV2X 1Q862 1ML8A 2IZ4A 3U50C 1S721 1YUKA 3HOVI 3CXCZ 2M48A 1DL6A 1R9TI 1KRLA 4NB8A 4A3FI 5A2Qb 2E2II 3CD61 1N8R1 2V45A 3CCMZ 1K83I 2PK7A 3J80b 5FLMI 2JA5I 3PO3S 4E2ZA 1USPB 3CC41 3HOUI 1L1OC 2RPRA 2B63I 5IT9b 3I07A 2EGTA 1WZNA 4XX2A 5C44I 3G4SZ 2NVXI 2O53A 4NH1C 3CC21 1QVFY 5D1PA 2VPZA 2OTJ1 5FLXf 2Y0SA 3CCV1 4A93I 2W03A 4NBHA 3CCQ1 4BY1I 2YU9I 1WW9A 2JIQA 1WCMI 3KIFA 3IX0A 2RIQA 3CXCY 1VQL1 3I561 4A3JI 2VUGA 3NH4A 1AA6A 4RVDA 1VQ8Z 1K8A1 3VTNA 3G6E1 3NDIA 5D1OA 3GCFA 1VQ91 2VPYA 4NBDA 3JAMf 1M901 1I3QI 3D9XA 1Y1WI 1YIT1 1YI2Z 3FKII 1KD11 1Y1VI 2IZ3A 3S14I 1K731 3VMIA 4E2YA 5C4XI 3OW2Z 1Q811 2RHBA 3CMEZ 1YJW1 1NUIA 2OOXB 3CCJZ 2W04A 3CCUZ 1VQM1 1K8A2 1VQNZ 1VQKZ 1Z01A 1Q821 4Y52I 1Q861 5C4JI 1YHQZ 1USPA 4RVHA 3S1NI 4HGZA 4A3EI 1KD12 1VQ4Z 3NFZA 1X3WA 2QA4Z 2E7ZA 1YJ91 3S2DI 4RVFA 1X0TA 1Q812 4HGYA 3TDHB 3CC7Z 5LL6f 3BG1B 1ZB9A 3S16I 1VQ61 1PFTA 5D1OB 2QEX1 2V8KA 4NBFA 1Q822
chains in the Genus database with same CATH topology
1VQPZ 2VF1A 2PMZA 4NBEA 5T6BA 3CCR1 1KC82 3GTGI 1TWFI 3EERA 2QKDA 3BG0B 1JJ2Z 2OZKA 4E32A 2JNYA 2F4MA 5IP7I 1VLAA 4S1TA 3CCSZ 4NBAA 3OW2Y 4QTTA 5AN9F 3CPWZ 2NVYI 1Y1VS 2R92I 2DE6A 4Y7NI 2J6AA 2JA8I 3VMGA 4MONA 4E2XA 2QRCB 5FLXb 3CCM1 3HKZA 2E2HI 4QTUA 5A2Qf 1W2BZ 1P9NA 4NBCA 3G71Z 3VB9A 4A3DI 2JA6I 3CMAZ 2E2JI 1RO4A 3P5JB 3S2HI 3GTPI 1I50I 2WAQA 1YIJZ 3G4S1 4HH4A 2R7ZI 2M6NA 4E33A 3MZKB 2V8JA 1K9M2 4BBRI 1X3ZA 4MRIA 1JJ2Y 1VQ5Z 3I55Z 2P3YA 4BBSI 3HOYI 1RNIA 1TWAI 3I56Z 1VQO1 4NOZA 3CCEZ 3ESWA 4DK1A 4A3LI 3CPWY 1VQ9Z 1TWGI 2LFUA 2LIYA 3H3VJ 5CM2M 1RO2A 3PO2I 3K7AI 3M4OI 3F3PC 3IF8A 2OTLZ 1VQ81 4MD9A 2KPIA 2JR6A 4AYBA 3S1QI 2YADA 1W2BY 3QWUA 4BY7I 1KC81 1RQFA 3EEDA 4A3GI 1QYPA 2WB1A 1VQ7Z 3H0GI 2NVQI 4MD7A 2QLVB 3F3FC 3J81b 3CCJ1 4EWCA 1SFOI 1NJI2 1VQN1 1VQK1 1M1K2 1TWHI 1YJN1 3CCLZ 1VQ6Z 1YHQ1 1VQ41 2P28A 2QA41 2G2KA 2QR1B 2R93I 1RLYA 3GKQA 3HOXI 3TE5B 3CC71 2GTIA 1S72Z 1Q7Y2 4NBGA 3M3YI 3GTJI 2GU2A 2RBLA 4BXXI 3S1RI 3CD6Z 2QREB 4TNUA 4MXUA 5T64A 3CQZI 3CC4Z 2JUBA 2Q51A 3CCS1 5IP9I 2DE5A 3GTQI 1QVGZ 2NVTI 1K9M1 4NFRA 3FQMA 2V8IA 3T4NB 4A3MI 3GTOI 2HF1A 4A3BI 3CC2Z 2OOYB 3KIHA 2OTJZ 3IFUA 3CCVZ 3I4NI 2RT9A 3D6WA 3J80f 2Q4ZA 3CCQZ 3LUSA 4E30A 1WIIA 5T67A 1I6HI 3MONA 3HOWI 5IT9f 2ZAEB 2E9HA 3G711 2K3RA 3GTMI 2H85A 2K5RA 1NP6A 1N8R2 1VQLZ 3CMA1 2JMOA 4DGLA 3JAMb 2AKLA 1VQOZ 2DE7A 3G6EZ 1YIJ1 3GTKI 4MH4A 3S1MI 1Z02A 3MZLB 5C3EI 4X6AI 3NDJA 2JS4A 1YITZ 3J7A4 2R6MA 1VQ51 3I551 1KQSZ 1JWHC 2GTHA 1Z03A 1NJI1 3CCE1 1YUAA 1QVGY 3S17I 1M1K1 1YJWZ 4CL1A 4NB9A 1YI21 1VQMZ 3RZOI 4E31A 4RVGA 3S15I 1RO0A 2QRDB 4RS4A 2OTL1 3PO3I 1TFIA 4NBBA 3CME1 3GTLI 2KI7B 1Q7Y1 3CCU1 1YJ9Z 1TWCI 1N2FA 3VMHA 2O4HA 4A3II 3RZDI 1M902 3NH8A 1YJNZ 2JA7I 1QF8A 2QEXZ 1VQ71 4A3KI 2F4OA 4E2WA 3CCRZ 3GTMS 1K732 1S7MA 2I3CA 1ZH1A 4RV9A 3J81f 1QVFZ 1ZB8A 2BJOA 3HOZI 3CCL1 1KQSY 2HU9A 3Q87A 4DQYB 3I4MI 4A3CI 1VQP1 4MD8A 1LQLA 3NH5A 3FQQA 2VUMI 2PM9A 1Q862 1ML8A 2IZ4A 3U50C 1S721 1YUKA 3HOVI 3CXCZ 2M48A 1DL6A 1R9TI 1KRLA 4NB8A 4A3FI 5A2Qb 2E2II 3CD61 1N8R1 3CCMZ 1K83I 2PK7A 3J80b 5FLMI 2JA5I 3PO3S 4E2ZA 1USPB 3CC41 3HOUI 1L1OC 2RPRA 2B63I 5IT9b 3I07A 2EGTA 4XX2A 5C44I 3G4SZ 2NVXI 2O53A 4NH1C 3CC21 1QVFY 5D1PA 2OTJ1 5FLXf 2Y0SA 3CCV1 4A93I 2W03A 4NBHA 3CCQ1 4BY1I 2YU9I 1WW9A 1WCMI 3KIFA 3IX0A 2RIQA 3CXCY 1VQL1 3I561 4A3JI 2VUGA 3NH4A 4RVDA 1VQ8Z 1K8A1 3VTNA 3G6E1 3NDIA 5D1OA 3GCFA 1VQ91 4NBDA 3JAMf 1M901 1I3QI 3D9XA 1Y1WI 1YIT1 1YI2Z 3FKII 1KD11 1Y1VI 2IZ3A 3S14I 1K731 3VMIA 4E2YA 5C4XI 3OW2Z 1Q811 2RHBA 3CMEZ 1YJW1 1NUIA 2OOXB 3CCJZ 2W04A 3CCUZ 1VQM1 1K8A2 1VQNZ 1VQKZ 1Z01A 1Q821 4Y52I 1Q861 5C4JI 1YHQZ 1USPA 4RVHA 3S1NI 4HGZA 4A3EI 1KD12 1VQ4Z 3NFZA 1X3WA 2QA4Z 3S2DI 1YJ91 4RVFA 1X0TA 1Q812 4HGYA 3TDHB 3CC7Z 5LL6f 3BG1B 1ZB9A 3S16I 1VQ61 1PFTA 5D1OB 2QEX1 2V8KA 4NBFA 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPR A; 
#chains in the Genus database with same CATH topology
 1VQP Z;  2VF1 A;  2PMZ A;  4NBE A;  5T6B A;  3CCR 1;  1KC8 2;  3GTG I;  1TWF I;  3EER A;  2QKD A;  3BG0 B;  1JJ2 Z;  2OZK A;  4E32 A;  2JNY A;  2JIM A;  2F4M A;  5IP7 I;  1VLA A;  4S1T A;  3CCS Z;  4NBA A;  3OW2 Y;  2JIO A;  4QTT A;  5AN9 F;  3CPW Z;  2NVY I;  1Y1V S;  2R92 I;  1Q16 A;  2DE6 A;  4Y7N I;  2J6A A;  2JA8 I;  3VMG A;  4MON A;  4E2X A;  2QRC B;  5FLX b;  3CCM 1;  3HKZ A;  2E2H I;  4QTU A;  5A2Q f;  1W2B Z;  1P9N A;  4NBC A;  3G71 Z;  3VB9 A;  4A3D I;  2JA6 I;  3CMA Z;  2E2J I;  1RO4 A;  3P5J B;  3S2H I;  3GTP I;  2JIP A;  1I50 I;  2WAQ A;  1YIJ Z;  3G4S 1;  4HH4 A;  2R7Z I;  2M6N A;  4E33 A;  3MZK B;  2V8J A;  1K9M 2;  4BBR I;  1X3Z A;  4MRI A;  1JJ2 Y;  1VQ5 Z;  3I55 Z;  2P3Y A;  4BBS I;  3HOY I;  1RNI A;  1TWA I;  3I56 Z;  1VQO 1;  4NOZ A;  3CCE Z;  3ESW A;  4DK1 A;  3D2L A;  4A3L I;  3CPW Y;  1VQ9 Z;  1TWG I;  2LFU A;  2LIY A;  3H3V J;  2VPX A;  5CM2 M;  1RO2 A;  3PO2 I;  3K7A I;  3M4O I;  3F3P C;  3IF8 A;  2OTL Z;  1VQ8 1;  1Y8C A;  4MD9 A;  2KPI A;  2JR6 A;  4AYB A;  3S1Q I;  2YAD A;  1W2B Y;  3QWU A;  4BY7 I;  1KC8 1;  1RQF A;  3EED A;  4A3G I;  1QYP A;  2WB1 A;  1VQ7 Z;  3H0G I;  2NVQ I;  4MD7 A;  2QLV B;  3F3F C;  3J81 b;  3CCJ 1;  4EWC A;  1SFO I;  1NJI 2;  1VQN 1;  1VQK 1;  1M1K 2;  1TWH I;  2JIR A;  1YJN 1;  1FDI A;  3CCL Z;  1VQ6 Z;  1YHQ 1;  1VQ4 1;  2P28 A;  2QA4 1;  2G2K A;  2QR1 B;  2R93 I;  1RLY A;  3GKQ A;  3HOX I;  3TE5 B;  3CC7 1;  2GTI A;  1S72 Z;  1Q7Y 2;  4NBG A;  3M3Y I;  3GTJ I;  2GU2 A;  2RBL A;  4BXX I;  3S1R I;  3CD6 Z;  2QRE B;  4TNU A;  4MXU A;  5T64 A;  3CQZ I;  3CC4 Z;  2JUB A;  3IR7 A;  2Q51 A;  3CCS 1;  5IP9 I;  2DE5 A;  3GTQ I;  1QVG Z;  2NVT I;  1K9M 1;  4NFR A;  3FQM A;  2V8I A;  3T4N B;  4A3M I;  3GTO I;  2HF1 A;  4A3B I;  3CC2 Z;  2OOY B;  3KIH A;  2OTJ Z;  3IFU A;  3CCV Z;  3I4N I;  2RT9 A;  3D6W A;  3J80 f;  2Q4Z A;  3CCQ Z;  3LUS A;  4E30 A;  1WII A;  5T67 A;  1I6H I;  3MON A;  3HOW I;  5IT9 f;  2ZAE B;  2V3V A;  2E9H A;  3G71 1;  2K3R A;  3GTM I;  2H85 A;  2K5R A;  1NP6 A;  1N8R 2;  1VQL Z;  3CMA 1;  1QXF A;  2JMO A;  4DGL A;  3JAM b;  2AKL A;  1VQO Z;  2DE7 A;  3G6E Z;  1YIJ 1;  3GTK I;  4MH4 A;  3S1M I;  1Z02 A;  3MZL B;  5C3E I;  4X6A I;  3NDJ A;  2JS4 A;  1YIT Z;  3J7A 4;  2R6M A;  2VPW A;  3I55 1;  1VQ5 1;  1KQS Z;  1JWH C;  2GTH A;  2NAP A;  1Z03 A;  1NJI 1;  3CCE 1;  1YUA A;  1QVG Y;  3S17 I;  1M1K 1;  1YJW Z;  4CL1 A;  4NB9 A;  1YI2 1;  1VQM Z;  3RZO I;  4E31 A;  4RVG A;  3S15 I;  1RO0 A;  2QRD B;  4RS4 A;  2OTL 1;  3PO3 I;  1TFI A;  4NBB A;  1WJ2 A;  3CME 1;  3GTL I;  2KI7 B;  1Q7Y 1;  3CCU 1;  2AYD A;  1YJ9 Z;  1TWC I;  1N2F A;  3VMH A;  2O4H A;  4A3I I;  3RZD I;  1M90 2;  3NH8 A;  1YJN Z;  2JA7 I;  1QF8 A;  2QEX Z;  1VQ7 1;  1FDO A;  4A3K I;  2F4O A;  4E2W A;  3CCR Z;  3GTM S;  1K73 2;  1S7M A;  2I3C A;  1ZH1 A;  4RV9 A;  1SIW A;  3J81 f;  1QVF Z;  1ZB8 A;  2BJO A;  3HOZ I;  2LEX A;  3CCL 1;  1KQS Y;  2HU9 A;  3Q87 A;  4DQY B;  3I4M I;  4A3C I;  1VQP 1;  4MD8 A;  1LQL A;  3NH5 A;  3FQQ A;  2VUM I;  2PM9 A;  2IV2 X;  1Q86 2;  1ML8 A;  2IZ4 A;  3U50 C;  1S72 1;  1YUK A;  3HOV I;  3CXC Z;  2M48 A;  1DL6 A;  1R9T I;  1KRL A;  4NB8 A;  4A3F I;  5A2Q b;  2E2I I;  3CD6 1;  1N8R 1;  2V45 A;  3CCM Z;  1K83 I;  2PK7 A;  3J80 b;  5FLM I;  2JA5 I;  3PO3 S;  4E2Z A;  1USP B;  3CC4 1;  3HOU I;  1L1O C;  2RPR A;  2B63 I;  5IT9 b;  3I07 A;  2EGT A;  1WZN A;  4XX2 A;  5C44 I;  3G4S Z;  2NVX I;  2O53 A;  4NH1 C;  3CC2 1;  1QVF Y;  5D1P A;  2VPZ A;  2OTJ 1;  5FLX f;  2Y0S A;  3CCV 1;  4A93 I;  2W03 A;  4NBH A;  3CCQ 1;  4BY1 I;  2YU9 I;  1WW9 A;  2JIQ A;  1WCM I;  3KIF A;  3IX0 A;  2RIQ A;  3CXC Y;  1VQL 1;  3I56 1;  4A3J I;  2VUG A;  3NH4 A;  1AA6 A;  4RVD A;  1VQ8 Z;  1K8A 1;  3VTN A;  3G6E 1;  3NDI A;  5D1O A;  3GCF A;  1VQ9 1;  2VPY A;  4NBD A;  3JAM f;  1M90 1;  1I3Q I;  3D9X A;  1Y1W I;  1YIT 1;  1YI2 Z;  3FKI I;  1KD1 1;  1Y1V I;  2IZ3 A;  3S14 I;  1K73 1;  3VMI A;  4E2Y A;  5C4X I;  3OW2 Z;  1Q81 1;  2RHB A;  3CME Z;  1YJW 1;  1NUI A;  2OOX B;  3CCJ Z;  2W04 A;  3CCU Z;  1VQM 1;  1K8A 2;  1VQN Z;  1VQK Z;  1Z01 A;  1Q82 1;  4Y52 I;  1Q86 1;  5C4J I;  1YHQ Z;  1USP A;  4RVH A;  3S1N I;  4HGZ A;  4A3E I;  1KD1 2;  1VQ4 Z;  3NFZ A;  1X3W A;  2QA4 Z;  2E7Z A;  1YJ9 1;  3S2D I;  4RVF A;  1X0T A;  1Q81 2;  4HGY A;  3TDH B;  3CC7 Z;  5LL6 f;  3BG1 B;  1ZB9 A;  3S16 I;  1VQ6 1;  1PFT A;  5D1O B;  2QEX 1;  2V8K A;  4NBF A;  1Q82 2; 
#chains in the Genus database with same CATH homology
 1VQP Z;  2VF1 A;  2PMZ A;  4NBE A;  5T6B A;  3CCR 1;  1KC8 2;  3GTG I;  1TWF I;  3EER A;  2QKD A;  3BG0 B;  1JJ2 Z;  2OZK A;  4E32 A;  2JNY A;  2F4M A;  5IP7 I;  1VLA A;  4S1T A;  3CCS Z;  4NBA A;  3OW2 Y;  4QTT A;  5AN9 F;  3CPW Z;  2NVY I;  1Y1V S;  2R92 I;  2DE6 A;  4Y7N I;  2J6A A;  2JA8 I;  3VMG A;  4MON A;  4E2X A;  2QRC B;  5FLX b;  3CCM 1;  3HKZ A;  2E2H I;  4QTU A;  5A2Q f;  1W2B Z;  1P9N A;  4NBC A;  3G71 Z;  3VB9 A;  4A3D I;  2JA6 I;  3CMA Z;  2E2J I;  1RO4 A;  3P5J B;  3S2H I;  3GTP I;  1I50 I;  2WAQ A;  1YIJ Z;  3G4S 1;  4HH4 A;  2R7Z I;  2M6N A;  4E33 A;  3MZK B;  2V8J A;  1K9M 2;  4BBR I;  1X3Z A;  4MRI A;  1JJ2 Y;  1VQ5 Z;  3I55 Z;  2P3Y A;  4BBS I;  3HOY I;  1RNI A;  1TWA I;  3I56 Z;  1VQO 1;  4NOZ A;  3CCE Z;  3ESW A;  4DK1 A;  4A3L I;  3CPW Y;  1VQ9 Z;  1TWG I;  2LFU A;  2LIY A;  3H3V J;  5CM2 M;  1RO2 A;  3PO2 I;  3K7A I;  3M4O I;  3F3P C;  3IF8 A;  2OTL Z;  1VQ8 1;  4MD9 A;  2KPI A;  2JR6 A;  4AYB A;  3S1Q I;  2YAD A;  1W2B Y;  3QWU A;  4BY7 I;  1KC8 1;  1RQF A;  3EED A;  4A3G I;  1QYP A;  2WB1 A;  1VQ7 Z;  3H0G I;  2NVQ I;  4MD7 A;  2QLV B;  3F3F C;  3J81 b;  3CCJ 1;  4EWC A;  1SFO I;  1NJI 2;  1VQN 1;  1VQK 1;  1M1K 2;  1TWH I;  1YJN 1;  3CCL Z;  1VQ6 Z;  1YHQ 1;  1VQ4 1;  2P28 A;  2QA4 1;  2G2K A;  2QR1 B;  2R93 I;  1RLY A;  3GKQ A;  3HOX I;  3TE5 B;  3CC7 1;  2GTI A;  1S72 Z;  1Q7Y 2;  4NBG A;  3M3Y I;  3GTJ I;  2GU2 A;  2RBL A;  4BXX I;  3S1R I;  3CD6 Z;  2QRE B;  4TNU A;  4MXU A;  5T64 A;  3CQZ I;  3CC4 Z;  2JUB A;  2Q51 A;  3CCS 1;  5IP9 I;  2DE5 A;  3GTQ I;  1QVG Z;  2NVT I;  1K9M 1;  4NFR A;  3FQM A;  2V8I A;  3T4N B;  4A3M I;  3GTO I;  2HF1 A;  4A3B I;  3CC2 Z;  2OOY B;  3KIH A;  2OTJ Z;  3IFU A;  3CCV Z;  3I4N I;  2RT9 A;  3D6W A;  3J80 f;  2Q4Z A;  3CCQ Z;  3LUS A;  4E30 A;  1WII A;  5T67 A;  1I6H I;  3MON A;  3HOW I;  5IT9 f;  2ZAE B;  2E9H A;  3G71 1;  2K3R A;  3GTM I;  2H85 A;  2K5R A;  1NP6 A;  1N8R 2;  1VQL Z;  3CMA 1;  2JMO A;  4DGL A;  3JAM b;  2AKL A;  1VQO Z;  2DE7 A;  3G6E Z;  1YIJ 1;  3GTK I;  4MH4 A;  3S1M I;  1Z02 A;  3MZL B;  5C3E I;  4X6A I;  3NDJ A;  2JS4 A;  1YIT Z;  3J7A 4;  2R6M A;  1VQ5 1;  3I55 1;  1KQS Z;  1JWH C;  2GTH A;  1Z03 A;  1NJI 1;  3CCE 1;  1YUA A;  1QVG Y;  3S17 I;  1M1K 1;  1YJW Z;  4CL1 A;  4NB9 A;  1YI2 1;  1VQM Z;  3RZO I;  4E31 A;  4RVG A;  3S15 I;  1RO0 A;  2QRD B;  4RS4 A;  2OTL 1;  3PO3 I;  1TFI A;  4NBB A;  3CME 1;  3GTL I;  2KI7 B;  1Q7Y 1;  3CCU 1;  1YJ9 Z;  1TWC I;  1N2F A;  3VMH A;  2O4H A;  4A3I I;  3RZD I;  1M90 2;  3NH8 A;  1YJN Z;  2JA7 I;  1QF8 A;  2QEX Z;  1VQ7 1;  4A3K I;  2F4O A;  4E2W A;  3CCR Z;  3GTM S;  1K73 2;  1S7M A;  2I3C A;  1ZH1 A;  4RV9 A;  3J81 f;  1QVF Z;  1ZB8 A;  2BJO A;  3HOZ I;  3CCL 1;  1KQS Y;  2HU9 A;  3Q87 A;  4DQY B;  3I4M I;  4A3C I;  1VQP 1;  4MD8 A;  1LQL A;  3NH5 A;  3FQQ A;  2VUM I;  2PM9 A;  1Q86 2;  1ML8 A;  2IZ4 A;  3U50 C;  1S72 1;  1YUK A;  3HOV I;  3CXC Z;  2M48 A;  1DL6 A;  1R9T I;  1KRL A;  4NB8 A;  4A3F I;  5A2Q b;  2E2I I;  3CD6 1;  1N8R 1;  3CCM Z;  1K83 I;  2PK7 A;  3J80 b;  5FLM I;  2JA5 I;  3PO3 S;  4E2Z A;  1USP B;  3CC4 1;  3HOU I;  1L1O C;  2RPR A;  2B63 I;  5IT9 b;  3I07 A;  2EGT A;  4XX2 A;  5C44 I;  3G4S Z;  2NVX I;  2O53 A;  4NH1 C;  3CC2 1;  1QVF Y;  5D1P A;  2OTJ 1;  5FLX f;  2Y0S A;  3CCV 1;  4A93 I;  2W03 A;  4NBH A;  3CCQ 1;  4BY1 I;  2YU9 I;  1WW9 A;  1WCM I;  3KIF A;  3IX0 A;  2RIQ A;  3CXC Y;  1VQL 1;  3I56 1;  4A3J I;  2VUG A;  3NH4 A;  4RVD A;  1VQ8 Z;  1K8A 1;  3VTN A;  3G6E 1;  3NDI A;  5D1O A;  3GCF A;  1VQ9 1;  4NBD A;  3JAM f;  1M90 1;  1I3Q I;  3D9X A;  1Y1W I;  1YIT 1;  1YI2 Z;  3FKI I;  1KD1 1;  1Y1V I;  2IZ3 A;  3S14 I;  1K73 1;  3VMI A;  4E2Y A;  5C4X I;  3OW2 Z;  1Q81 1;  2RHB A;  3CME Z;  1YJW 1;  1NUI A;  2OOX B;  3CCJ Z;  2W04 A;  3CCU Z;  1VQM 1;  1K8A 2;  1VQN Z;  1VQK Z;  1Z01 A;  1Q82 1;  4Y52 I;  1Q86 1;  5C4J I;  1YHQ Z;  1USP A;  4RVH A;  3S1N I;  4HGZ A;  4A3E I;  1KD1 2;  1VQ4 Z;  3NFZ A;  1X3W A;  2QA4 Z;  3S2D I;  1YJ9 1;  4RVF A;  1X0T A;  1Q81 2;  4HGY A;  3TDH B;  3CC7 Z;  5LL6 f;  3BG1 B;  1ZB9 A;  3S16 I;  1VQ6 1;  1PFT A;  5D1O B;  2QEX 1;  2V8K A;  4NBF A;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...