2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
3AZJB 2YU9I 3B0DB 3O62C 4LD9A 4EO5B 1KX5B 4J8UB 2H85A 4NB8A 4BBRI 3AYWC 3X1TC 1P3ID 1RQFA 3GTJI 5B1MD 3X1VC 1VQKZ 2JA5I 4DQYB 3F6TA 5B2IB 3AZED 3R45B 3REJB 1YIJ1 1P3LA 2R7ZI 3WTPB 5B1LC 3I561 2YFVB 3UTAA 1P3OA 1K9M2 2BYMB 2XD1A 3NFZA 5D1OA 2R93I 1VQM1 1P34A 2DE6A 2V3VA 3GTMS 1P3FD 5C3IB 4WV4B 3GTPI 5JA4A 2P28A 2RHBA 5B1MB 3O62A 5DNNC 1Q822 3X1UA 2F8NK 2PYOC 3AYWA 5CPKD 1BH9B 4J8XC 2WAQA 1HTAA 4H9QB 1KU5A 3X1VA 3AZFD 4KGCA 5GT0D 2QR1B 3WAAC 2JNYA 4KUDB 3VH6A 3C1CC 5BNXA 1RO2A 1N8R2 5B1LA 5GSUC 3MGSA 3RELA 3G711 4Z2MH 1VQN1 3MZLB 2R92I 1P3GB 4A3FI 3AZLD 3J81b 3KWQD 2JE5A 2VPYA 2GTIA 4Y7NI 4WU9D 1KRLA 3AZKA 3MGPC 3TU4D 3AZFB 3WA9C 2VF1A 3NDIA 1M1K1 4R8PC 5DNNA 1M901 3C1BC 3KXBD 1KX4C 2PYOA 2RPRA 3G4S1 3WAAA 3AZLB 4NB9A 3C1CA 5DNMC 3KWQB 5CPIA 2JIPA 4BXXI 5GSUA 2V8KA 4WU9B 4EWCA 5B0YC 1TAFA 3B6GC 4YS3B 3W97B 2E7ZA 3D6WA 4E2YA 5C44I 3B0CW 1AA6A 4J8WB 3VH5A 4CSRA 1P3OD 5AV6D 3PO2I 3WKJC 4DGLA 2E2JI 3MGPA 1P34D 3WA9A 4LD9B 3CCLZ 4BY7I 4R8PA 2RVQD 4H9NA 3CMA1 3VH6T 3AN2C 3C1BA 4G92B 1S32D 1VQ91 5B24C 3CPWY 3J80f 3AZJC 4WU8C 3B0DC 3W96C 2CWEA 2AYDA 4EO5C 1KX5C 1P3LB 3VMGA 3AYWD 3X1TD 3MNNB 3LZ1A 4H9PA 5C4XI 5DNMA 2OTJ1 1B6WA 3UTAB 1P3OB 3X1VD 5D1OB 3EPJA 5A2Qb 3NQJA 5B0YA 5AVCC 3KIFA 2OTL1 1P34B 3B6GA 2Y0SA 1W2BZ 1K9M1 1VQ4Z 3WTPC 3S17I 2UWXA 5B1LD 4H9OA 5JA4B 1N2FA 4E30A 3WKJA 3O62B 2IZ3A 4BBSI 2QLVB 5B33A 2BYKA 3X1UB 1P3PC 1F66A 3GCFA 4H9SC 3S1MI 3AN2A 1BFMA 4KGCB 5B24A 1Q821 3HOUI 4WU8A 1P9NA 5BO0A 3W96A 5DNND 1M19A 1QYPA 1TWHI 1YIJZ 3GTQI 3JAMf 2PYOD 5BNXB 3I56Z 4J8XD 5FUGA 5B31A 3MGSB 3VH5T 3RELB 2E2II 5E5AC 5B0ZA 1B67A 5AVCA 3WAAD 1N8R1 5AV8B 4AWLC 3R45A 3LZ0A 3C1CD 3WTPA 1YIT1 5GSUD 5IT9f 4DK1A 4Z2MG 3AZKB 2O53A 2PK7A 1VQPZ 3AV1B 1WWIA 1P3GC 5DNNB 4A3LI 1P3PA 3I4MI 1TWFI 4H9SA 2PYOB 3S14I 2W03A 2V45A 4YM6A 4A3KI 2M6NA 2RBLA 2IZ4A 3WA9D 2Y2LA 3PO3S 2G5IC 1VQ5Z 3C1BD 5CPIB 1KX4D 3HKZA 3G71Z 5GSUB 2JIMA 4A3DI 1TAFB 2Y2MA 5E5AA 1VQNZ 4XUJB 3CQZI 4NOZA 1ML8A 3Q87A 1VQ71 4NH1C 2NQBD 4CSRB 3MGPB 3B6GD 3WA9B 4YS3C 4HH4A 5GT3C 1P3GA 5CP6C 4Z5TD 4R8PB 4H9NB 1Z03A 3I551 1DL6A 4E2ZA 1WWSA 3MGQA 3C1BB 3AZNA 1EQZA 4NBAA 4TNUA 4A3EI 2GTHA 1JJ2Y 3CD61 3X1SD 2Y2PA 4DRBA 1JWHC 3TE5B 4E33A 4LD9C 2HF1A 3G4SZ 3CCL1 3LZ1B 4H9PB 3AN2D 5DNMB 1JFIA 4G92C 1ULYA 5B24D 1ZLAD 3S16I 3AZJD 4WU8D 3NQJB 5B0YB 4RVFA 1S72Z 1KX5D 2AKLA 5AY8C 1P3LC 1YJNZ 1KD12 3MNNC 3W99C 2LFUA 4H9OB 5B31G 2YFWA 1USPA 3HOYI 5B32A 3VMHA 3WKJB 5AVCD 1X0TA 5B2ID 1M18C 4QTUA 3JAMb 5B33B 1F66B 1P3AA 2JCHA 5GT3A 5CP6A 3WTPD 1Y1VI 3CMAZ 1VQ9Z 4A3BI 5BS7C 4WU8B 1N1JA 3CC4Z 5BO0B 3W96B 3CC21 1M19B 3X1UC 1NUIA 4NBFA 4E44A 3CPWZ 2OTJZ 5FUGB 5B31B 3MVDB 3OW2Y 4KGCC 5B0ZB 2OTLZ 5AVCB 1VLAA 2W04A 3S2DI 2RT9A 5AY8A 3LZ0B 4MD8A 2Y2QA 2NAPA 3MNNA 3W99A 2I3CA 3VH6W 3MGSC 3RELC 2W8SA 5E5AD 1WCMI 2Y2KA 3EG5B 1M18A 4KUDD 5F99A 5AV8C 2KI7B 1P3PB 2LIYA 2VQRA 3CC71 4NBHA 3CCJZ 3IFUA 3H0LC 2DQNC 4YM6B 5BS7A 3AZKC 2OOXB 1FDIA 3AV1C 1P3GD 1VQP1 3AL0C 2ZM5A 2HIOB 3AV2B 1T3UA 5FLMI 4JJNB 1QVGY 5E5AB 2ZY4A 1WIIA 3S15I 4AWLB 4E2XA 1TWGI 5CPIC 3KIHA 1VQ51 1YITZ 1K8A1 5C3EI 2JSSA 2CV5B 4A3CI 1SIWA 4XUJC 5AV8A 1K83I 1VQ81 3CCR1 3MGQB 3AZNB 1EQZB 3CCQZ 2J8PA 5B32G 2J6AA 1KX3C 3VH5W 4YS3D 3W97D 5GT3D 3AV1A 5CP6D 4WJ3C 5AN9F 4ZUXC 2IV2X 4J8WD 1JFIB 1PFTA 1Q812 1Q862 2V8JA 3M3YI 4HGAC 2F8NH 4LD9D 1VQ7Z 3LZ1C 2JA7I 3I4NI 2YFWB 1USPB 5B32B 3D9XA 1NJI2 1S721 1VQ6Z 4HGZA 1P3AB 5GT3B 1P3LD 4XUJA 5CP6B 2G2KA 3I55Z 3MNND 1U35A 3I07A 1YJN1 3CD6Z 2VUGA 3UTAD 2JIRA 2DE7A 1N1JB 4A3II 5GXQB 1M18D 1KX3A 4X23C 1Y1WI 3EPLA 5B33C 1F66C 1ZH1A 3REKA 1RNIA 4ZUXA 3B6FC 2V8IA 1KQSY 1K8A2 1TFIA 3EERA 1JJ2Z 1YUKA 1TZYA 3O62D 2F8NA 4E32A 1M19C 3X1UD 3CC41 2G5HC 5AY8B 1YJW1 1YI21 3W99B 3CME1 4G91C 5B31C 3MVDC 4KGCD 5B0ZC 2JIOA 1M18B 2BJOA 5KDMA 5F99B 1A7WA 1X3ZA 1VQOZ 4UUZA 3J81f 3LZ0C 3J7A4 3CCE1 3KUYC 2RIQA 3MGSD 3RELD 1P3MB 1Q7Y2 3CXCY 3MONA 3CC2Z 5AV8D 4X23A 2NZDB 4Z66C 1FDOA 3VTNA 3B6FA 4YM6C 3AZIC 3AZKD 3AV1D 3IR7A 3NQUB 2VPZA 1QVFY 1TWCI 3F3PC 2HUEC 2Y2OA 1Z2CB 2HIOC 3OW2Z 3AV2C 4JJNC 3MVDA 4NE6A 3UT9A 3K7AI 3MZKB 3NH4A 3CCV1 4A3JI 2JIQA 3REIA 3MGRC 4NBDA 3CC7Z 3GTMI 5CPID 2VPWA 3KUYA 3AZMC 1P3BA 1P3KC 1S7MA 3T4NB 2CV5C 1RLYA 4XUJD 3IX0A 4Z66A 3LELA 1QF8A 3MGQC 3AZNC 1EQZC 3BG0B 3HOWI 3CCQ1 3AZIA 2JMOA 1KX3D 5AV9C 3MGPD 3CCEZ 1Q811 4QLCC 1Q861 2P3YA 4NE3A 4R8PD 4S1TA 1QVGZ 1Z01A 4WZSB 2HIOA 4UPKA 3AV2A 5IP7I 4JJNA 1VQL1 2F8ND 2F8NG 5C4JI 3AFAA 1VQ8Z 3LZ1D 3MGRA 1U35B 3CCRZ 1W2EA 5DNMD 3J80b 3W98C 3AZMA 5B32C 5B0YD 1P3KA 1KX3B 4J8VC 1YHQZ 2CV5A 1VQ61 1P3AC 3REKB 4ZUXB 3EPKA 1Q9CA 5BT1C 3RZOI 3AZGA 3EPHA 4RVGA 3FQMA 2QEX1 1Y8CA 3WKJD 1TZYB 4HGAB 5GXQC 5AV9A 4X23D 2F8NB 5B33D 4QLCA 1F66D 1X3WA 5FLXf 5CPKC 3CCM1 1HQ3B 1P3IA 3B6FD 4CAYA 5GT0C 3CCS1 3B0CT 4MH4A 3AZEA 3W96D 4A3MI 5KDMB 1M19D 3BG1B 2NVXI 3G6EZ 4UUZB 1AOIC 5JRGC 5B31D 2ZAEB 3MVDD 3W98A 2LY8A 1NP6A 5B0ZD 2DE5A 2JS4A 1M1AB 4MXUA 2FFFB 2NVQI 4J8VA 4X23B 5F99C 1P3FA 1VQO1 3LZ0D 2L5AA 3KUYD 3A6NC 3LJAB 3B6FB 1P3MC 1ZB9A 3KSYA 4NBEA 1WW9A 5GXQA 4Z66D 1P3PD 2NZDC 1KQSZ 3KXBC 5CPKA 3QWUA 4MONA 3CMEZ 1YI2Z 1Q16A 3D2LA 1YJWZ 4YM6D 4G91B 5IT9b 3UT9B 5GT0A 1WZNA 3REIB 3H3VJ 1AOIA 5CPJC 5AVBC 2VPXA 2HIOD 5JRGA 3KUYB 3AV2D 1P3BB 2QRCB 4JJND 2QREB 2ZY2A 4MD9A 2OZKA 1ID3B 4Z66B 3LELB 3VB9A 5AV6C 3A6NA 3AZMD 3IP4C 3CXCZ 3AZIB 1P3MA 1P3KD 2QA41 2CV5D 3U50C 2NZDA 1S32C 3KXBA 1K732 3MGQD 2HUEB 3AZND 1EQZD 3LUSA 3S1RI 5AV9D 3CCVZ 1QVFZ 4QLCD 3ESWA 3AFAB 1H3OA 3NQUA 5B2JC 5B40B 4RVHA 3V9RA 3MGRB 2F4MA 3A1KA 5CPJA 4ZBJB 5AVBA 3IF8A 1LQLA 3AZMB 2E2HI 5FLXb 1P3KB 4HGYA 2F2AC 5LL6f 1U35C 1KC82 3AZGB 5AV6A 3W98D 3S2HI 5B32D 2IO5C 3REHC 5AV9B 4J8VD 2JA8I 2Y2IA 4QLCB 1P3AD 2JR6A 1YHQ1 3REKC 1P3IB 1S32A 5BT1D 3PO3I 1L1OC 1VQLZ 4CAYB 4X6AI 5A2Qf 1TZYC 5GXQD 3AZEB 5B2JA 3X1TA 1HQ3C 1RO0A 3VMIA 3EEDA 1WJ2A 3W98B 2QKDA 1BH8A 3AZHC 4J8VB 1KD11 3UTBC 2FJ7C 1P3FB 1AOID 5AY8D 4H9RA 3G6E1 2Y2GA 5JRGD 1Z02A 3W99D 1RO4A 4A3GI 2QEXZ 3CCUZ 3REHA 2B63I 1M1AC 1YJ9Z 2WB1A 5F99D 3CCMZ 5CPKB 4NBGA 3HOZI 3A6ND 2R6MA 4WNNA 3LJAC 1P3MD 4XZQC 4DRAA 3TDHB 2K3RA 3F3FC 5GT0B 3CCSZ 2NZDD 2AROC 1AOIB 1HQ3A 5JRGB 5CHLB 4J8XA 3UT9C 4RVDA 2QRDB 1SFOI 1ZB8A 3AZHA 3REIC 3UTBA 2FJ7A 5CPJD 5AVBD 3KFUG 2NQBC 5AV5C 5G49A 3A6NB 1R9TI 1P3BC 3TU4B 4KHAA 1M1AA 2F4OA 4Z5TC 1YUAA 2JUBA 5D1PA 1ID3C 3HOVI 3B0BA 3KXBB 3LELC 3H0RC 3LJAA 4XZQA 3X1SC 1Y1VS 4XX2A 5T6BA 1K731 3GTLI 1H3OB 4Y52I 3V9RB 2AROA 1KX4A 1ZLAC 5CPJB 5AVBB 2JA6I 2PMZA 2YADA 1F1EA 4E45A 4J8UC 5B2JD 3AFAC 4NE5A 3CCJ1 5B40C 5T67A 3S1NI 5BNVA 2NQBA 4QTTA 4ZBJC 5AV5A 5AV6B 2M48A 1VQK1 3GKQA 5B2IC 2QA4Z 1R4VA 3REJC 1KC81 4Z5TA 1I50I 1ID3A 1U35D 1S32B 3AZGC 3REHD 3X1SA 2BG1A 5B2JB 3AYWB 3X1TB 3REKD 5C3IC 3FDDA 4ZUXD 2XD5A 1P3IC 1ZLAA 3X1VB 5B1MC 3AZJA 4BY1I 1TZYD 1BH8B 3AZEC 2E9HA 1KX5A 2K5RA 4J8UA 2PM9A 2Q4ZA 3H0MC 4H9RB 1HQ3D 5B1LB 5B40A 3GTOI 1NJI1 2Q51A 4E31A 1VQMZ 2IO5B 5B2IA 3REHB 3AZHD 4KUDC 3REJA 3UTBD 2FJ7D 2KPIA 1P3FC 3GTKI 4WNNB 2YFVA 3RZDI 2BYMA 2NVYI 3CCU1 1M1AD 5T64A 1TWAI 1YJ91 2Y2HA 2Y2NA 4J8XB 2Y2JA 3LJAD 3GTGI 2ZY3A 4XZQD 4NFTA 5B1MA 3NH5A 3AZFC 3WAAB 2LEXA 3AZHB 3UTBB 2AROD 3C1CB 2FJ7B 1I3QI 4NBBA 3M4OI 1BH9A 5G49B 1QXFA 3P5JB 3NH8A 4H9QA 3UT9D 4E2WA 4KHAB 4KUDA 2HU9A 2ZY5A 3REID 3AZLC 4A93I 3KWQC 1Q7Y1 3H0GI 5AV5D 3FQQA 3HOXI 4WU9C 1P3BD 2EGTA 4XZQB 3FKII 4CL1A 3TU4C 3W97C 4NFRA 1ID3D 2AROB 3LELD 4J8WC 1KX4B 2DF4C 1M1K2 1M902 3AZID 4RS4A 3AZFA 5CM2M 1PZRA 3A1IA 3NDJA 2OOYB 5BNVB 2NQBB 2NVTI 5AV5B 4M6BA 2VUMI 1I6HI 3B6GB 4AYBA 3WTPE 4J8UD 3AFAD 4Z5TB 2O4HA 3AZLA 5B40D 3MGRD 3KWQA 4NBCA 1W2BY 3UTAC 1P3OC 3S1QI 5IP9I 4WU9A 2GU2A 3X1SB 4MRIA 1P34C 2BYKB 3W97A 3REJD 3TU4A 4YS3A 1VQ41 2RVQC 4MD7A 3AN2B 4J8WA 1ZLAB 4RV9A 5B24B 3AZGD
chains in the Genus database with same CATH topology
3AZJB 2YU9I 3B0DB 3O62C 4LD9A 4EO5B 1KX5B 4J8UB 2H85A 4NB8A 4BBRI 3AYWC 3X1TC 1P3ID 1RQFA 3GTJI 5B1MD 3X1VC 1VQKZ 2JA5I 4DQYB 3F6TA 5B2IB 3AZED 3R45B 3REJB 1YIJ1 1P3LA 2R7ZI 3WTPB 5B1LC 3I561 2YFVB 3UTAA 1P3OA 1K9M2 2BYMB 2XD1A 3NFZA 5D1OA 2R93I 1VQM1 1P34A 2DE6A 3GTMS 1P3FD 5C3IB 4WV4B 3GTPI 5JA4A 2P28A 2RHBA 5B1MB 3O62A 5DNNC 1Q822 3X1UA 2F8NK 2PYOC 3AYWA 5CPKD 1BH9B 4J8XC 2WAQA 1HTAA 4H9QB 1KU5A 3X1VA 3AZFD 4KGCA 5GT0D 2QR1B 3WAAC 2JNYA 4KUDB 3VH6A 3C1CC 5BNXA 1RO2A 1N8R2 5B1LA 5GSUC 3MGSA 3RELA 3G711 4Z2MH 1VQN1 3MZLB 2R92I 1P3GB 4A3FI 3AZLD 3J81b 3KWQD 2JE5A 2GTIA 4Y7NI 4WU9D 1KRLA 3AZKA 3MGPC 3TU4D 3AZFB 3WA9C 2VF1A 3NDIA 1M1K1 4R8PC 5DNNA 1M901 3C1BC 3KXBD 1KX4C 2PYOA 2RPRA 3G4S1 3WAAA 3AZLB 4NB9A 3C1CA 5DNMC 3KWQB 5CPIA 4BXXI 5GSUA 2V8KA 4WU9B 4EWCA 5B0YC 1TAFA 3B6GC 4YS3B 3W97B 3D6WA 4E2YA 5C44I 3B0CW 4J8WB 3VH5A 4CSRA 1P3OD 5AV6D 3PO2I 3WKJC 4DGLA 2E2JI 3MGPA 1P34D 3WA9A 4LD9B 3CCLZ 4BY7I 4R8PA 2RVQD 4H9NA 3CMA1 3VH6T 3AN2C 3C1BA 4G92B 1S32D 1VQ91 5B24C 3CPWY 3J80f 3AZJC 4WU8C 3B0DC 3W96C 2CWEA 4EO5C 1KX5C 1P3LB 3VMGA 3AYWD 3X1TD 3MNNB 3LZ1A 4H9PA 5C4XI 5DNMA 2OTJ1 1B6WA 3UTAB 1P3OB 3X1VD 5D1OB 3EPJA 5A2Qb 3NQJA 5B0YA 5AVCC 3KIFA 2OTL1 1P34B 3B6GA 2Y0SA 1W2BZ 1K9M1 1VQ4Z 3WTPC 3S17I 2UWXA 5B1LD 4H9OA 5JA4B 1N2FA 4E30A 3WKJA 3O62B 2IZ3A 4BBSI 2QLVB 5B33A 2BYKA 3X1UB 1P3PC 1F66A 3GCFA 4H9SC 3S1MI 3AN2A 1BFMA 4KGCB 5B24A 1Q821 3HOUI 4WU8A 1P9NA 5BO0A 3W96A 5DNND 1M19A 1QYPA 1TWHI 1YIJZ 3GTQI 3JAMf 2PYOD 5BNXB 3I56Z 4J8XD 5FUGA 5B31A 3MGSB 3VH5T 3RELB 2E2II 5E5AC 5B0ZA 1B67A 5AVCA 3WAAD 1N8R1 5AV8B 4AWLC 3R45A 3LZ0A 3C1CD 3WTPA 1YIT1 5GSUD 5IT9f 4DK1A 4Z2MG 3AZKB 2O53A 2PK7A 1VQPZ 3AV1B 1WWIA 1P3GC 5DNNB 4A3LI 1P3PA 3I4MI 1TWFI 4H9SA 2PYOB 3S14I 2W03A 4YM6A 4A3KI 2M6NA 2RBLA 2IZ4A 3WA9D 2Y2LA 3PO3S 2G5IC 1VQ5Z 3C1BD 5CPIB 1KX4D 3HKZA 3G71Z 5GSUB 4A3DI 1TAFB 2Y2MA 5E5AA 1VQNZ 4XUJB 3CQZI 4NOZA 1ML8A 3Q87A 1VQ71 4NH1C 2NQBD 4CSRB 3MGPB 3B6GD 3WA9B 4YS3C 4HH4A 5GT3C 1P3GA 5CP6C 4Z5TD 4R8PB 4H9NB 1Z03A 3I551 1DL6A 4E2ZA 1WWSA 3MGQA 3C1BB 3AZNA 1EQZA 4NBAA 4TNUA 4A3EI 2GTHA 1JJ2Y 3CD61 3X1SD 2Y2PA 4DRBA 1JWHC 3TE5B 4E33A 4LD9C 2HF1A 3G4SZ 3CCL1 3LZ1B 4H9PB 3AN2D 5DNMB 1JFIA 4G92C 1ULYA 5B24D 1ZLAD 3S16I 3AZJD 4WU8D 3NQJB 5B0YB 4RVFA 1S72Z 1KX5D 2AKLA 5AY8C 1P3LC 1YJNZ 1KD12 3MNNC 3W99C 2LFUA 4H9OB 5B31G 2YFWA 1USPA 3HOYI 5B32A 3VMHA 3WKJB 5AVCD 1X0TA 5B2ID 1M18C 4QTUA 3JAMb 5B33B 1F66B 1P3AA 2JCHA 5GT3A 5CP6A 3WTPD 1Y1VI 3CMAZ 1VQ9Z 4A3BI 5BS7C 4WU8B 1N1JA 3CC4Z 5BO0B 3W96B 3CC21 1M19B 3X1UC 1NUIA 4NBFA 4E44A 3CPWZ 2OTJZ 5FUGB 5B31B 3MVDB 3OW2Y 4KGCC 5B0ZB 2OTLZ 5AVCB 1VLAA 2W04A 3S2DI 2RT9A 5AY8A 3LZ0B 4MD8A 2Y2QA 3MNNA 3W99A 2I3CA 3VH6W 3MGSC 3RELC 2W8SA 5E5AD 1WCMI 2Y2KA 3EG5B 1M18A 4KUDD 5F99A 5AV8C 2KI7B 1P3PB 2LIYA 2VQRA 3CC71 4NBHA 3CCJZ 3IFUA 3H0LC 2DQNC 4YM6B 5BS7A 3AZKC 2OOXB 3AV1C 1P3GD 1VQP1 3AL0C 2ZM5A 2HIOB 3AV2B 1T3UA 5FLMI 4JJNB 1QVGY 5E5AB 2ZY4A 1WIIA 3S15I 4AWLB 4E2XA 1TWGI 5CPIC 3KIHA 1VQ51 1YITZ 1K8A1 5C3EI 2JSSA 2CV5B 4A3CI 4XUJC 5AV8A 1K83I 1VQ81 3CCR1 3MGQB 3AZNB 1EQZB 3CCQZ 2J8PA 5B32G 2J6AA 1KX3C 3VH5W 4YS3D 3W97D 5GT3D 3AV1A 5CP6D 4WJ3C 5AN9F 4ZUXC 4J8WD 1JFIB 1PFTA 1Q812 1Q862 2V8JA 3M3YI 4HGAC 2F8NH 4LD9D 1VQ7Z 3LZ1C 2JA7I 3I4NI 2YFWB 1USPB 5B32B 3D9XA 1NJI2 1S721 1VQ6Z 4HGZA 1P3AB 5GT3B 1P3LD 4XUJA 5CP6B 2G2KA 3I55Z 3MNND 1U35A 3I07A 1YJN1 3CD6Z 2VUGA 3UTAD 2DE7A 1N1JB 4A3II 5GXQB 1M18D 1KX3A 4X23C 1Y1WI 3EPLA 5B33C 1F66C 1ZH1A 3REKA 1RNIA 4ZUXA 3B6FC 2V8IA 1KQSY 1K8A2 1TFIA 3EERA 1JJ2Z 1YUKA 1TZYA 3O62D 2F8NA 4E32A 1M19C 3X1UD 3CC41 2G5HC 5AY8B 1YJW1 1YI21 3W99B 3CME1 4G91C 5B31C 3MVDC 4KGCD 5B0ZC 1M18B 2BJOA 5KDMA 5F99B 1A7WA 1X3ZA 1VQOZ 4UUZA 3J81f 3LZ0C 3J7A4 3CCE1 3KUYC 2RIQA 3MGSD 3RELD 1P3MB 1Q7Y2 3CXCY 3MONA 3CC2Z 5AV8D 4X23A 2NZDB 4Z66C 3VTNA 3B6FA 4YM6C 3AZIC 3AZKD 3AV1D 3NQUB 1QVFY 1TWCI 3F3PC 2HUEC 2Y2OA 1Z2CB 2HIOC 3OW2Z 3AV2C 4JJNC 3MVDA 4NE6A 3UT9A 3K7AI 3MZKB 3NH4A 3CCV1 4A3JI 3REIA 3MGRC 4NBDA 3CC7Z 3GTMI 5CPID 3KUYA 3AZMC 1P3BA 1P3KC 1S7MA 3T4NB 2CV5C 1RLYA 4XUJD 3IX0A 4Z66A 3LELA 1QF8A 3MGQC 3AZNC 1EQZC 3BG0B 3HOWI 3CCQ1 3AZIA 2JMOA 1KX3D 5AV9C 3MGPD 3CCEZ 1Q811 4QLCC 1Q861 2P3YA 4NE3A 4R8PD 4S1TA 1QVGZ 1Z01A 4WZSB 2HIOA 4UPKA 3AV2A 5IP7I 4JJNA 1VQL1 2F8ND 2F8NG 5C4JI 3AFAA 1VQ8Z 3LZ1D 3MGRA 1U35B 3CCRZ 1W2EA 5DNMD 3J80b 3W98C 3AZMA 5B32C 5B0YD 1P3KA 1KX3B 4J8VC 1YHQZ 2CV5A 1VQ61 1P3AC 3REKB 4ZUXB 3EPKA 1Q9CA 5BT1C 3RZOI 3AZGA 3EPHA 4RVGA 3FQMA 2QEX1 3WKJD 1TZYB 4HGAB 5GXQC 5AV9A 4X23D 2F8NB 5B33D 4QLCA 1F66D 1X3WA 5FLXf 5CPKC 3CCM1 1HQ3B 1P3IA 3B6FD 4CAYA 5GT0C 3CCS1 3B0CT 4MH4A 3AZEA 3W96D 4A3MI 5KDMB 1M19D 3BG1B 2NVXI 3G6EZ 4UUZB 1AOIC 5JRGC 5B31D 2ZAEB 3MVDD 3W98A 2LY8A 1NP6A 5B0ZD 2DE5A 2JS4A 1M1AB 4MXUA 2FFFB 2NVQI 4J8VA 4X23B 5F99C 1P3FA 1VQO1 3LZ0D 2L5AA 3KUYD 3A6NC 3LJAB 3B6FB 1P3MC 1ZB9A 3KSYA 4NBEA 1WW9A 5GXQA 4Z66D 1P3PD 2NZDC 1KQSZ 3KXBC 5CPKA 3QWUA 4MONA 3CMEZ 1YI2Z 1YJWZ 5IT9b 4YM6D 4G91B 3UT9B 5GT0A 3REIB 3H3VJ 1AOIA 5CPJC 5AVBC 2HIOD 5JRGA 3KUYB 3AV2D 1P3BB 2QRCB 4JJND 2QREB 2ZY2A 4MD9A 2OZKA 1ID3B 4Z66B 3LELB 3VB9A 5AV6C 3A6NA 3AZMD 3IP4C 3CXCZ 3AZIB 1P3MA 1P3KD 2QA41 2CV5D 3U50C 2NZDA 1S32C 3KXBA 1K732 3MGQD 2HUEB 3AZND 1EQZD 3LUSA 3S1RI 5AV9D 3CCVZ 1QVFZ 4QLCD 3ESWA 3AFAB 1H3OA 3NQUA 5B2JC 5B40B 4RVHA 3V9RA 3MGRB 2F4MA 3A1KA 5CPJA 4ZBJB 5AVBA 3IF8A 1LQLA 3AZMB 2E2HI 5FLXb 1P3KB 4HGYA 2F2AC 5LL6f 1U35C 1KC82 3AZGB 5AV6A 3W98D 3S2HI 5B32D 2IO5C 3REHC 5AV9B 4J8VD 2JA8I 2Y2IA 4QLCB 1P3AD 2JR6A 1YHQ1 3REKC 1P3IB 1S32A 5BT1D 3PO3I 1L1OC 1VQLZ 4CAYB 4X6AI 5A2Qf 1TZYC 5GXQD 3AZEB 5B2JA 3X1TA 1HQ3C 1RO0A 3VMIA 3EEDA 3W98B 2QKDA 1BH8A 3AZHC 4J8VB 1KD11 3UTBC 2FJ7C 1P3FB 1AOID 5AY8D 4H9RA 3G6E1 2Y2GA 5JRGD 1Z02A 3W99D 1RO4A 4A3GI 2QEXZ 3CCUZ 3REHA 2B63I 1M1AC 1YJ9Z 2WB1A 5F99D 3CCMZ 5CPKB 4NBGA 3HOZI 3A6ND 2R6MA 4WNNA 3LJAC 1P3MD 4XZQC 4DRAA 3TDHB 2K3RA 3F3FC 5GT0B 3CCSZ 2NZDD 2AROC 1AOIB 1HQ3A 5JRGB 5CHLB 4J8XA 3UT9C 4RVDA 2QRDB 1SFOI 1ZB8A 3AZHA 3REIC 3UTBA 2FJ7A 5CPJD 5AVBD 3KFUG 2NQBC 5AV5C 5G49A 3A6NB 1R9TI 1P3BC 3TU4B 4KHAA 1M1AA 2F4OA 4Z5TC 1YUAA 2JUBA 5D1PA 1ID3C 3HOVI 3B0BA 3KXBB 3LELC 3H0RC 3LJAA 4XZQA 3X1SC 1Y1VS 4XX2A 5T6BA 1K731 3GTLI 1H3OB 4Y52I 3V9RB 2AROA 1KX4A 1ZLAC 5CPJB 5AVBB 2JA6I 2PMZA 2YADA 1F1EA 4E45A 4J8UC 5B2JD 3AFAC 4NE5A 3CCJ1 5B40C 5T67A 3S1NI 5BNVA 2NQBA 4QTTA 4ZBJC 5AV5A 5AV6B 2M48A 1VQK1 3GKQA 5B2IC 2QA4Z 1R4VA 3REJC 1KC81 4Z5TA 1I50I 1ID3A 1U35D 1S32B 3AZGC 3REHD 3X1SA 2BG1A 5B2JB 3AYWB 3X1TB 3REKD 5C3IC 3FDDA 4ZUXD 2XD5A 1P3IC 1ZLAA 3X1VB 5B1MC 3AZJA 4BY1I 1TZYD 1BH8B 3AZEC 2E9HA 1KX5A 2K5RA 4J8UA 2PM9A 2Q4ZA 3H0MC 4H9RB 1HQ3D 5B1LB 5B40A 3GTOI 1NJI1 2Q51A 4E31A 1VQMZ 2IO5B 5B2IA 3REHB 3AZHD 4KUDC 3REJA 3UTBD 2FJ7D 2KPIA 1P3FC 3GTKI 4WNNB 2YFVA 3RZDI 2BYMA 2NVYI 3CCU1 1M1AD 5T64A 1TWAI 1YJ91 2Y2HA 2Y2NA 4J8XB 2Y2JA 3LJAD 3GTGI 2ZY3A 4XZQD 4NFTA 5B1MA 3NH5A 3AZFC 3WAAB 3AZHB 3UTBB 2AROD 3C1CB 2FJ7B 1I3QI 4NBBA 3M4OI 1BH9A 5G49B 3P5JB 3NH8A 4H9QA 3UT9D 4E2WA 4KHAB 4KUDA 2HU9A 2ZY5A 3REID 3AZLC 4A93I 3KWQC 1Q7Y1 3H0GI 5AV5D 3FQQA 3HOXI 4WU9C 1P3BD 2EGTA 4XZQB 3FKII 4CL1A 3TU4C 3W97C 4NFRA 1ID3D 2AROB 3LELD 4J8WC 1KX4B 2DF4C 1M1K2 1M902 3AZID 4RS4A 3AZFA 5CM2M 1PZRA 3A1IA 3NDJA 2OOYB 5BNVB 2NQBB 2NVTI 5AV5B 4M6BA 2VUMI 1I6HI 3B6GB 4AYBA 3WTPE 4J8UD 3AFAD 4Z5TB 2O4HA 3AZLA 5B40D 3MGRD 3KWQA 4NBCA 1W2BY 3UTAC 1P3OC 3S1QI 5IP9I 4WU9A 2GU2A 3X1SB 4MRIA 1P34C 2BYKB 3W97A 3REJD 3TU4A 4YS3A 1VQ41 2RVQC 4MD7A 3AN2B 4J8WA 1ZLAB 4RV9A 5B24B 3AZGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 3AZJ B;  2YU9 I;  3B0D B;  3O62 C;  4LD9 A;  4EO5 B;  1KX5 B;  4J8U B;  2H85 A;  4NB8 A;  4BBR I;  3AYW C;  3X1T C;  1P3I D;  1RQF A;  3GTJ I;  5B1M D;  3X1V C;  1VQK Z;  2JA5 I;  4DQY B;  3F6T A;  5B2I B;  3AZE D;  3R45 B;  3REJ B;  1YIJ 1;  1P3L A;  2R7Z I;  3WTP B;  5B1L C;  3I56 1;  2YFV B;  3UTA A;  1P3O A;  1K9M 2;  2BYM B;  2XD1 A;  3NFZ A;  5D1O A;  2R93 I;  1VQM 1;  1P34 A;  2DE6 A;  2V3V A;  3GTM S;  1P3F D;  5C3I B;  4WV4 B;  3GTP I;  5JA4 A;  2P28 A;  2RHB A;  5B1M B;  3O62 A;  5DNN C;  1Q82 2;  3X1U A;  2F8N K;  2PYO C;  3AYW A;  5CPK D;  1BH9 B;  4J8X C;  2WAQ A;  1HTA A;  4H9Q B;  1KU5 A;  3X1V A;  3AZF D;  4KGC A;  5GT0 D;  2QR1 B;  3WAA C;  2JNY A;  4KUD B;  3VH6 A;  3C1C C;  5BNX A;  1RO2 A;  1N8R 2;  5B1L A;  5GSU C;  3MGS A;  3REL A;  3G71 1;  4Z2M H;  1VQN 1;  3MZL B;  2R92 I;  1P3G B;  4A3F I;  3AZL D;  3J81 b;  3KWQ D;  2JE5 A;  2VPY A;  2GTI A;  4Y7N I;  4WU9 D;  1KRL A;  3AZK A;  3MGP C;  3TU4 D;  3AZF B;  3WA9 C;  2VF1 A;  3NDI A;  1M1K 1;  4R8P C;  5DNN A;  1M90 1;  3C1B C;  3KXB D;  1KX4 C;  2PYO A;  2RPR A;  3G4S 1;  3WAA A;  3AZL B;  4NB9 A;  3C1C A;  5DNM C;  3KWQ B;  5CPI A;  2JIP A;  4BXX I;  5GSU A;  2V8K A;  4WU9 B;  4EWC A;  5B0Y C;  1TAF A;  3B6G C;  4YS3 B;  3W97 B;  2E7Z A;  3D6W A;  4E2Y A;  5C44 I;  3B0C W;  1AA6 A;  4J8W B;  3VH5 A;  4CSR A;  1P3O D;  5AV6 D;  3PO2 I;  3WKJ C;  4DGL A;  2E2J I;  3MGP A;  1P34 D;  3WA9 A;  4LD9 B;  3CCL Z;  4BY7 I;  4R8P A;  2RVQ D;  4H9N A;  3CMA 1;  3VH6 T;  3AN2 C;  3C1B A;  4G92 B;  1S32 D;  1VQ9 1;  5B24 C;  3CPW Y;  3J80 f;  3AZJ C;  4WU8 C;  3B0D C;  3W96 C;  2CWE A;  2AYD A;  4EO5 C;  1KX5 C;  1P3L B;  3VMG A;  3AYW D;  3X1T D;  3MNN B;  3LZ1 A;  4H9P A;  5C4X I;  5DNM A;  2OTJ 1;  1B6W A;  3UTA B;  1P3O B;  3X1V D;  5D1O B;  3EPJ A;  5A2Q b;  3NQJ A;  5B0Y A;  5AVC C;  3KIF A;  2OTL 1;  1P34 B;  3B6G A;  2Y0S A;  1W2B Z;  1K9M 1;  1VQ4 Z;  3WTP C;  3S17 I;  2UWX A;  5B1L D;  4H9O A;  5JA4 B;  1N2F A;  4E30 A;  3WKJ A;  3O62 B;  2IZ3 A;  4BBS I;  2QLV B;  5B33 A;  2BYK A;  3X1U B;  1P3P C;  1F66 A;  3GCF A;  4H9S C;  3S1M I;  3AN2 A;  1BFM A;  4KGC B;  5B24 A;  1Q82 1;  3HOU I;  4WU8 A;  1P9N A;  5BO0 A;  3W96 A;  5DNN D;  1M19 A;  1QYP A;  1TWH I;  1YIJ Z;  3GTQ I;  3JAM f;  2PYO D;  5BNX B;  3I56 Z;  4J8X D;  5FUG A;  5B31 A;  3MGS B;  3VH5 T;  3REL B;  2E2I I;  5E5A C;  5B0Z A;  1B67 A;  5AVC A;  3WAA D;  1N8R 1;  5AV8 B;  4AWL C;  3R45 A;  3LZ0 A;  3C1C D;  3WTP A;  1YIT 1;  5GSU D;  5IT9 f;  4DK1 A;  4Z2M G;  3AZK B;  2O53 A;  2PK7 A;  1VQP Z;  3AV1 B;  1WWI A;  1P3G C;  5DNN B;  4A3L I;  1P3P A;  3I4M I;  1TWF I;  4H9S A;  2PYO B;  3S14 I;  2W03 A;  2V45 A;  4YM6 A;  4A3K I;  2M6N A;  2RBL A;  2IZ4 A;  3WA9 D;  2Y2L A;  3PO3 S;  2G5I C;  1VQ5 Z;  3C1B D;  5CPI B;  1KX4 D;  3HKZ A;  3G71 Z;  5GSU B;  2JIM A;  4A3D I;  1TAF B;  2Y2M A;  5E5A A;  1VQN Z;  4XUJ B;  3CQZ I;  4NOZ A;  1ML8 A;  3Q87 A;  1VQ7 1;  4NH1 C;  2NQB D;  4CSR B;  3MGP B;  3B6G D;  3WA9 B;  4YS3 C;  4HH4 A;  5GT3 C;  1P3G A;  5CP6 C;  4Z5T D;  4R8P B;  4H9N B;  1Z03 A;  3I55 1;  1DL6 A;  4E2Z A;  1WWS A;  3MGQ A;  3C1B B;  3AZN A;  1EQZ A;  4NBA A;  4TNU A;  4A3E I;  2GTH A;  1JJ2 Y;  3CD6 1;  3X1S D;  2Y2P A;  4DRB A;  1JWH C;  3TE5 B;  4E33 A;  4LD9 C;  2HF1 A;  3G4S Z;  3CCL 1;  3LZ1 B;  4H9P B;  3AN2 D;  5DNM B;  1JFI A;  4G92 C;  1ULY A;  5B24 D;  1ZLA D;  3S16 I;  3AZJ D;  4WU8 D;  3NQJ B;  5B0Y B;  4RVF A;  1S72 Z;  1KX5 D;  2AKL A;  5AY8 C;  1P3L C;  1YJN Z;  1KD1 2;  3MNN C;  3W99 C;  2LFU A;  4H9O B;  5B31 G;  2YFW A;  1USP A;  3HOY I;  5B32 A;  3VMH A;  3WKJ B;  5AVC D;  1X0T A;  5B2I D;  1M18 C;  4QTU A;  3JAM b;  5B33 B;  1F66 B;  1P3A A;  2JCH A;  5GT3 A;  5CP6 A;  3WTP D;  1Y1V I;  3CMA Z;  1VQ9 Z;  4A3B I;  5BS7 C;  4WU8 B;  1N1J A;  3CC4 Z;  5BO0 B;  3W96 B;  3CC2 1;  1M19 B;  3X1U C;  1NUI A;  4NBF A;  4E44 A;  3CPW Z;  2OTJ Z;  5FUG B;  5B31 B;  3MVD B;  3OW2 Y;  4KGC C;  5B0Z B;  2OTL Z;  5AVC B;  1VLA A;  2W04 A;  3S2D I;  2RT9 A;  5AY8 A;  3LZ0 B;  4MD8 A;  2Y2Q A;  2NAP A;  3MNN A;  3W99 A;  2I3C A;  3VH6 W;  3MGS C;  3REL C;  2W8S A;  5E5A D;  1WCM I;  2Y2K A;  3EG5 B;  1M18 A;  4KUD D;  5F99 A;  5AV8 C;  2KI7 B;  1P3P B;  2LIY A;  2VQR A;  3CC7 1;  4NBH A;  3CCJ Z;  3IFU A;  3H0L C;  2DQN C;  4YM6 B;  5BS7 A;  3AZK C;  2OOX B;  1FDI A;  3AV1 C;  1P3G D;  1VQP 1;  3AL0 C;  2ZM5 A;  2HIO B;  3AV2 B;  1T3U A;  5FLM I;  4JJN B;  1QVG Y;  5E5A B;  2ZY4 A;  1WII A;  3S15 I;  4AWL B;  4E2X A;  1TWG I;  5CPI C;  3KIH A;  1VQ5 1;  1YIT Z;  1K8A 1;  5C3E I;  2JSS A;  2CV5 B;  4A3C I;  1SIW A;  4XUJ C;  5AV8 A;  1K83 I;  1VQ8 1;  3CCR 1;  3MGQ B;  3AZN B;  1EQZ B;  3CCQ Z;  2J8P A;  5B32 G;  2J6A A;  1KX3 C;  3VH5 W;  4YS3 D;  3W97 D;  5GT3 D;  3AV1 A;  5CP6 D;  4WJ3 C;  5AN9 F;  4ZUX C;  2IV2 X;  4J8W D;  1JFI B;  1PFT A;  1Q81 2;  1Q86 2;  2V8J A;  3M3Y I;  4HGA C;  2F8N H;  4LD9 D;  1VQ7 Z;  3LZ1 C;  2JA7 I;  3I4N I;  2YFW B;  1USP B;  5B32 B;  3D9X A;  1NJI 2;  1S72 1;  1VQ6 Z;  4HGZ A;  1P3A B;  5GT3 B;  1P3L D;  4XUJ A;  5CP6 B;  2G2K A;  3I55 Z;  3MNN D;  1U35 A;  3I07 A;  1YJN 1;  3CD6 Z;  2VUG A;  3UTA D;  2JIR A;  2DE7 A;  1N1J B;  4A3I I;  5GXQ B;  1M18 D;  1KX3 A;  4X23 C;  1Y1W I;  3EPL A;  5B33 C;  1F66 C;  1ZH1 A;  3REK A;  1RNI A;  4ZUX A;  3B6F C;  2V8I A;  1KQS Y;  1K8A 2;  1TFI A;  3EER A;  1JJ2 Z;  1YUK A;  1TZY A;  3O62 D;  2F8N A;  4E32 A;  1M19 C;  3X1U D;  3CC4 1;  2G5H C;  5AY8 B;  1YJW 1;  1YI2 1;  3W99 B;  3CME 1;  4G91 C;  5B31 C;  3MVD C;  4KGC D;  5B0Z C;  2JIO A;  1M18 B;  2BJO A;  5KDM A;  5F99 B;  1A7W A;  1X3Z A;  1VQO Z;  4UUZ A;  3J81 f;  3LZ0 C;  3J7A 4;  3CCE 1;  3KUY C;  2RIQ A;  3MGS D;  3REL D;  1P3M B;  1Q7Y 2;  3CXC Y;  3MON A;  3CC2 Z;  5AV8 D;  4X23 A;  2NZD B;  4Z66 C;  1FDO A;  3VTN A;  3B6F A;  4YM6 C;  3AZI C;  3AZK D;  3AV1 D;  3IR7 A;  3NQU B;  2VPZ A;  1QVF Y;  1TWC I;  3F3P C;  2HUE C;  2Y2O A;  1Z2C B;  2HIO C;  3OW2 Z;  3AV2 C;  4JJN C;  3MVD A;  4NE6 A;  3UT9 A;  3K7A I;  3MZK B;  3NH4 A;  3CCV 1;  4A3J I;  2JIQ A;  3REI A;  3MGR C;  4NBD A;  3CC7 Z;  3GTM I;  5CPI D;  2VPW A;  3KUY A;  3AZM C;  1P3B A;  1P3K C;  1S7M A;  3T4N B;  2CV5 C;  1RLY A;  4XUJ D;  3IX0 A;  4Z66 A;  3LEL A;  1QF8 A;  3MGQ C;  3AZN C;  1EQZ C;  3BG0 B;  3HOW I;  3CCQ 1;  3AZI A;  2JMO A;  1KX3 D;  5AV9 C;  3MGP D;  3CCE Z;  1Q81 1;  4QLC C;  1Q86 1;  2P3Y A;  4NE3 A;  4R8P D;  4S1T A;  1QVG Z;  1Z01 A;  4WZS B;  2HIO A;  4UPK A;  3AV2 A;  5IP7 I;  4JJN A;  1VQL 1;  2F8N D;  2F8N G;  5C4J I;  3AFA A;  1VQ8 Z;  3LZ1 D;  3MGR A;  1U35 B;  3CCR Z;  1W2E A;  5DNM D;  3J80 b;  3W98 C;  3AZM A;  5B32 C;  5B0Y D;  1P3K A;  1KX3 B;  4J8V C;  1YHQ Z;  2CV5 A;  1VQ6 1;  1P3A C;  3REK B;  4ZUX B;  3EPK A;  1Q9C A;  5BT1 C;  3RZO I;  3AZG A;  3EPH A;  4RVG A;  3FQM A;  2QEX 1;  1Y8C A;  3WKJ D;  1TZY B;  4HGA B;  5GXQ C;  5AV9 A;  4X23 D;  2F8N B;  5B33 D;  4QLC A;  1F66 D;  1X3W A;  5FLX f;  5CPK C;  3CCM 1;  1HQ3 B;  1P3I A;  3B6F D;  4CAY A;  5GT0 C;  3CCS 1;  3B0C T;  4MH4 A;  3AZE A;  3W96 D;  4A3M I;  5KDM B;  1M19 D;  3BG1 B;  2NVX I;  3G6E Z;  4UUZ B;  1AOI C;  5JRG C;  5B31 D;  2ZAE B;  3MVD D;  3W98 A;  2LY8 A;  1NP6 A;  5B0Z D;  2DE5 A;  2JS4 A;  1M1A B;  4MXU A;  2FFF B;  2NVQ I;  4J8V A;  4X23 B;  5F99 C;  1P3F A;  1VQO 1;  3LZ0 D;  2L5A A;  3KUY D;  3A6N C;  3LJA B;  3B6F B;  1P3M C;  1ZB9 A;  3KSY A;  4NBE A;  1WW9 A;  5GXQ A;  4Z66 D;  1P3P D;  2NZD C;  1KQS Z;  3KXB C;  5CPK A;  3QWU A;  4MON A;  3CME Z;  1YI2 Z;  1Q16 A;  3D2L A;  1YJW Z;  4YM6 D;  4G91 B;  5IT9 b;  3UT9 B;  5GT0 A;  1WZN A;  3REI B;  3H3V J;  1AOI A;  5CPJ C;  5AVB C;  2VPX A;  2HIO D;  5JRG A;  3KUY B;  3AV2 D;  1P3B B;  2QRC B;  4JJN D;  2QRE B;  2ZY2 A;  4MD9 A;  2OZK A;  1ID3 B;  4Z66 B;  3LEL B;  3VB9 A;  5AV6 C;  3A6N A;  3AZM D;  3IP4 C;  3CXC Z;  3AZI B;  1P3M A;  1P3K D;  2QA4 1;  2CV5 D;  3U50 C;  2NZD A;  1S32 C;  3KXB A;  1K73 2;  3MGQ D;  2HUE B;  3AZN D;  1EQZ D;  3LUS A;  3S1R I;  5AV9 D;  3CCV Z;  1QVF Z;  4QLC D;  3ESW A;  3AFA B;  1H3O A;  3NQU A;  5B2J C;  5B40 B;  4RVH A;  3V9R A;  3MGR B;  2F4M A;  3A1K A;  5CPJ A;  4ZBJ B;  5AVB A;  3IF8 A;  1LQL A;  3AZM B;  2E2H I;  5FLX b;  1P3K B;  4HGY A;  2F2A C;  5LL6 f;  1U35 C;  1KC8 2;  3AZG B;  5AV6 A;  3W98 D;  3S2H I;  5B32 D;  2IO5 C;  3REH C;  5AV9 B;  4J8V D;  2JA8 I;  2Y2I A;  4QLC B;  1P3A D;  2JR6 A;  1YHQ 1;  3REK C;  1P3I B;  1S32 A;  5BT1 D;  3PO3 I;  1L1O C;  1VQL Z;  4CAY B;  4X6A I;  5A2Q f;  1TZY C;  5GXQ D;  3AZE B;  5B2J A;  3X1T A;  1HQ3 C;  1RO0 A;  3VMI A;  3EED A;  1WJ2 A;  3W98 B;  2QKD A;  1BH8 A;  3AZH C;  4J8V B;  1KD1 1;  3UTB C;  2FJ7 C;  1P3F B;  1AOI D;  5AY8 D;  4H9R A;  3G6E 1;  2Y2G A;  5JRG D;  1Z02 A;  3W99 D;  1RO4 A;  4A3G I;  2QEX Z;  3CCU Z;  3REH A;  2B63 I;  1M1A C;  1YJ9 Z;  2WB1 A;  5F99 D;  3CCM Z;  5CPK B;  4NBG A;  3HOZ I;  3A6N D;  2R6M A;  4WNN A;  3LJA C;  1P3M D;  4XZQ C;  4DRA A;  3TDH B;  2K3R A;  3F3F C;  5GT0 B;  3CCS Z;  2NZD D;  2ARO C;  1AOI B;  1HQ3 A;  5JRG B;  5CHL B;  4J8X A;  3UT9 C;  4RVD A;  2QRD B;  1SFO I;  1ZB8 A;  3AZH A;  3REI C;  3UTB A;  2FJ7 A;  5CPJ D;  5AVB D;  3KFU G;  2NQB C;  5AV5 C;  5G49 A;  3A6N B;  1R9T I;  1P3B C;  3TU4 B;  4KHA A;  1M1A A;  2F4O A;  4Z5T C;  1YUA A;  2JUB A;  5D1P A;  1ID3 C;  3HOV I;  3B0B A;  3KXB B;  3LEL C;  3H0R C;  3LJA A;  4XZQ A;  3X1S C;  1Y1V S;  4XX2 A;  5T6B A;  1K73 1;  3GTL I;  1H3O B;  4Y52 I;  3V9R B;  2ARO A;  1KX4 A;  1ZLA C;  5CPJ B;  5AVB B;  2JA6 I;  2PMZ A;  2YAD A;  1F1E A;  4E45 A;  4J8U C;  5B2J D;  3AFA C;  4NE5 A;  3CCJ 1;  5B40 C;  5T67 A;  3S1N I;  5BNV A;  2NQB A;  4QTT A;  4ZBJ C;  5AV5 A;  5AV6 B;  2M48 A;  1VQK 1;  3GKQ A;  5B2I C;  2QA4 Z;  1R4V A;  3REJ C;  1KC8 1;  4Z5T A;  1I50 I;  1ID3 A;  1U35 D;  1S32 B;  3AZG C;  3REH D;  3X1S A;  2BG1 A;  5B2J B;  3AYW B;  3X1T B;  3REK D;  5C3I C;  3FDD A;  4ZUX D;  2XD5 A;  1P3I C;  1ZLA A;  3X1V B;  5B1M C;  3AZJ A;  4BY1 I;  1TZY D;  1BH8 B;  3AZE C;  2E9H A;  1KX5 A;  2K5R A;  4J8U A;  2PM9 A;  2Q4Z A;  3H0M C;  4H9R B;  1HQ3 D;  5B1L B;  5B40 A;  3GTO I;  1NJI 1;  2Q51 A;  4E31 A;  1VQM Z;  2IO5 B;  5B2I A;  3REH B;  3AZH D;  4KUD C;  3REJ A;  3UTB D;  2FJ7 D;  2KPI A;  1P3F C;  3GTK I;  4WNN B;  2YFV A;  3RZD I;  2BYM A;  2NVY I;  3CCU 1;  1M1A D;  5T64 A;  1TWA I;  1YJ9 1;  2Y2H A;  2Y2N A;  4J8X B;  2Y2J A;  3LJA D;  3GTG I;  2ZY3 A;  4XZQ D;  4NFT A;  5B1M A;  3NH5 A;  3AZF C;  3WAA B;  2LEX A;  3AZH B;  3UTB B;  2ARO D;  3C1C B;  2FJ7 B;  1I3Q I;  4NBB A;  3M4O I;  1BH9 A;  5G49 B;  1QXF A;  3P5J B;  3NH8 A;  4H9Q A;  3UT9 D;  4E2W A;  4KHA B;  4KUD A;  2HU9 A;  2ZY5 A;  3REI D;  3AZL C;  4A93 I;  3KWQ C;  1Q7Y 1;  3H0G I;  5AV5 D;  3FQQ A;  3HOX I;  4WU9 C;  1P3B D;  2EGT A;  4XZQ B;  3FKI I;  4CL1 A;  3TU4 C;  3W97 C;  4NFR A;  1ID3 D;  2ARO B;  3LEL D;  4J8W C;  1KX4 B;  2DF4 C;  1M1K 2;  1M90 2;  3AZI D;  4RS4 A;  3AZF A;  5CM2 M;  1PZR A;  3A1I A;  3NDJ A;  2OOY B;  5BNV B;  2NQB B;  2NVT I;  5AV5 B;  4M6B A;  2VUM I;  1I6H I;  3B6G B;  4AYB A;  3WTP E;  4J8U D;  3AFA D;  4Z5T B;  2O4H A;  3AZL A;  5B40 D;  3MGR D;  3KWQ A;  4NBC A;  1W2B Y;  3UTA C;  1P3O C;  3S1Q I;  5IP9 I;  4WU9 A;  2GU2 A;  3X1S B;  4MRI A;  1P34 C;  2BYK B;  3W97 A;  3REJ D;  3TU4 A;  4YS3 A;  1VQ4 1;  2RVQ C;  4MD7 A;  3AN2 B;  4J8W A;  1ZLA B;  4RV9 A;  5B24 B;  3AZG D; 
#chains in the Genus database with same CATH homology
 3AZJ B;  2YU9 I;  3B0D B;  3O62 C;  4LD9 A;  4EO5 B;  1KX5 B;  4J8U B;  2H85 A;  4NB8 A;  4BBR I;  3AYW C;  3X1T C;  1P3I D;  1RQF A;  3GTJ I;  5B1M D;  3X1V C;  1VQK Z;  2JA5 I;  4DQY B;  3F6T A;  5B2I B;  3AZE D;  3R45 B;  3REJ B;  1YIJ 1;  1P3L A;  2R7Z I;  3WTP B;  5B1L C;  3I56 1;  2YFV B;  3UTA A;  1P3O A;  1K9M 2;  2BYM B;  2XD1 A;  3NFZ A;  5D1O A;  2R93 I;  1VQM 1;  1P34 A;  2DE6 A;  3GTM S;  1P3F D;  5C3I B;  4WV4 B;  3GTP I;  5JA4 A;  2P28 A;  2RHB A;  5B1M B;  3O62 A;  5DNN C;  1Q82 2;  3X1U A;  2F8N K;  2PYO C;  3AYW A;  5CPK D;  1BH9 B;  4J8X C;  2WAQ A;  1HTA A;  4H9Q B;  1KU5 A;  3X1V A;  3AZF D;  4KGC A;  5GT0 D;  2QR1 B;  3WAA C;  2JNY A;  4KUD B;  3VH6 A;  3C1C C;  5BNX A;  1RO2 A;  1N8R 2;  5B1L A;  5GSU C;  3MGS A;  3REL A;  3G71 1;  4Z2M H;  1VQN 1;  3MZL B;  2R92 I;  1P3G B;  4A3F I;  3AZL D;  3J81 b;  3KWQ D;  2JE5 A;  2GTI A;  4Y7N I;  4WU9 D;  1KRL A;  3AZK A;  3MGP C;  3TU4 D;  3AZF B;  3WA9 C;  2VF1 A;  3NDI A;  1M1K 1;  4R8P C;  5DNN A;  1M90 1;  3C1B C;  3KXB D;  1KX4 C;  2PYO A;  2RPR A;  3G4S 1;  3WAA A;  3AZL B;  4NB9 A;  3C1C A;  5DNM C;  3KWQ B;  5CPI A;  4BXX I;  5GSU A;  2V8K A;  4WU9 B;  4EWC A;  5B0Y C;  1TAF A;  3B6G C;  4YS3 B;  3W97 B;  3D6W A;  4E2Y A;  5C44 I;  3B0C W;  4J8W B;  3VH5 A;  4CSR A;  1P3O D;  5AV6 D;  3PO2 I;  3WKJ C;  4DGL A;  2E2J I;  3MGP A;  1P34 D;  3WA9 A;  4LD9 B;  3CCL Z;  4BY7 I;  4R8P A;  2RVQ D;  4H9N A;  3CMA 1;  3VH6 T;  3AN2 C;  3C1B A;  4G92 B;  1S32 D;  1VQ9 1;  5B24 C;  3CPW Y;  3J80 f;  3AZJ C;  4WU8 C;  3B0D C;  3W96 C;  2CWE A;  4EO5 C;  1KX5 C;  1P3L B;  3VMG A;  3AYW D;  3X1T D;  3MNN B;  3LZ1 A;  4H9P A;  5C4X I;  5DNM A;  2OTJ 1;  1B6W A;  3UTA B;  1P3O B;  3X1V D;  5D1O B;  3EPJ A;  5A2Q b;  3NQJ A;  5B0Y A;  5AVC C;  3KIF A;  2OTL 1;  1P34 B;  3B6G A;  2Y0S A;  1W2B Z;  1K9M 1;  1VQ4 Z;  3WTP C;  3S17 I;  2UWX A;  5B1L D;  4H9O A;  5JA4 B;  1N2F A;  4E30 A;  3WKJ A;  3O62 B;  2IZ3 A;  4BBS I;  2QLV B;  5B33 A;  2BYK A;  3X1U B;  1P3P C;  1F66 A;  3GCF A;  4H9S C;  3S1M I;  3AN2 A;  1BFM A;  4KGC B;  5B24 A;  1Q82 1;  3HOU I;  4WU8 A;  1P9N A;  5BO0 A;  3W96 A;  5DNN D;  1M19 A;  1QYP A;  1TWH I;  1YIJ Z;  3GTQ I;  3JAM f;  2PYO D;  5BNX B;  3I56 Z;  4J8X D;  5FUG A;  5B31 A;  3MGS B;  3VH5 T;  3REL B;  2E2I I;  5E5A C;  5B0Z A;  1B67 A;  5AVC A;  3WAA D;  1N8R 1;  5AV8 B;  4AWL C;  3R45 A;  3LZ0 A;  3C1C D;  3WTP A;  1YIT 1;  5GSU D;  5IT9 f;  4DK1 A;  4Z2M G;  3AZK B;  2O53 A;  2PK7 A;  1VQP Z;  3AV1 B;  1WWI A;  1P3G C;  5DNN B;  4A3L I;  1P3P A;  3I4M I;  1TWF I;  4H9S A;  2PYO B;  3S14 I;  2W03 A;  4YM6 A;  4A3K I;  2M6N A;  2RBL A;  2IZ4 A;  3WA9 D;  2Y2L A;  3PO3 S;  2G5I C;  1VQ5 Z;  3C1B D;  5CPI B;  1KX4 D;  3HKZ A;  3G71 Z;  5GSU B;  4A3D I;  1TAF B;  2Y2M A;  5E5A A;  1VQN Z;  4XUJ B;  3CQZ I;  4NOZ A;  1ML8 A;  3Q87 A;  1VQ7 1;  4NH1 C;  2NQB D;  4CSR B;  3MGP B;  3B6G D;  3WA9 B;  4YS3 C;  4HH4 A;  5GT3 C;  1P3G A;  5CP6 C;  4Z5T D;  4R8P B;  4H9N B;  1Z03 A;  3I55 1;  1DL6 A;  4E2Z A;  1WWS A;  3MGQ A;  3C1B B;  3AZN A;  1EQZ A;  4NBA A;  4TNU A;  4A3E I;  2GTH A;  1JJ2 Y;  3CD6 1;  3X1S D;  2Y2P A;  4DRB A;  1JWH C;  3TE5 B;  4E33 A;  4LD9 C;  2HF1 A;  3G4S Z;  3CCL 1;  3LZ1 B;  4H9P B;  3AN2 D;  5DNM B;  1JFI A;  4G92 C;  1ULY A;  5B24 D;  1ZLA D;  3S16 I;  3AZJ D;  4WU8 D;  3NQJ B;  5B0Y B;  4RVF A;  1S72 Z;  1KX5 D;  2AKL A;  5AY8 C;  1P3L C;  1YJN Z;  1KD1 2;  3MNN C;  3W99 C;  2LFU A;  4H9O B;  5B31 G;  2YFW A;  1USP A;  3HOY I;  5B32 A;  3VMH A;  3WKJ B;  5AVC D;  1X0T A;  5B2I D;  1M18 C;  4QTU A;  3JAM b;  5B33 B;  1F66 B;  1P3A A;  2JCH A;  5GT3 A;  5CP6 A;  3WTP D;  1Y1V I;  3CMA Z;  1VQ9 Z;  4A3B I;  5BS7 C;  4WU8 B;  1N1J A;  3CC4 Z;  5BO0 B;  3W96 B;  3CC2 1;  1M19 B;  3X1U C;  1NUI A;  4NBF A;  4E44 A;  3CPW Z;  2OTJ Z;  5FUG B;  5B31 B;  3MVD B;  3OW2 Y;  4KGC C;  5B0Z B;  2OTL Z;  5AVC B;  1VLA A;  2W04 A;  3S2D I;  2RT9 A;  5AY8 A;  3LZ0 B;  4MD8 A;  2Y2Q A;  3MNN A;  3W99 A;  2I3C A;  3VH6 W;  3MGS C;  3REL C;  2W8S A;  5E5A D;  1WCM I;  2Y2K A;  3EG5 B;  1M18 A;  4KUD D;  5F99 A;  5AV8 C;  2KI7 B;  1P3P B;  2LIY A;  2VQR A;  3CC7 1;  4NBH A;  3CCJ Z;  3IFU A;  3H0L C;  2DQN C;  4YM6 B;  5BS7 A;  3AZK C;  2OOX B;  3AV1 C;  1P3G D;  1VQP 1;  3AL0 C;  2ZM5 A;  2HIO B;  3AV2 B;  1T3U A;  5FLM I;  4JJN B;  1QVG Y;  5E5A B;  2ZY4 A;  1WII A;  3S15 I;  4AWL B;  4E2X A;  1TWG I;  5CPI C;  3KIH A;  1VQ5 1;  1YIT Z;  1K8A 1;  5C3E I;  2JSS A;  2CV5 B;  4A3C I;  4XUJ C;  5AV8 A;  1K83 I;  1VQ8 1;  3CCR 1;  3MGQ B;  3AZN B;  1EQZ B;  3CCQ Z;  2J8P A;  5B32 G;  2J6A A;  1KX3 C;  3VH5 W;  4YS3 D;  3W97 D;  5GT3 D;  3AV1 A;  5CP6 D;  4WJ3 C;  5AN9 F;  4ZUX C;  4J8W D;  1JFI B;  1PFT A;  1Q81 2;  1Q86 2;  2V8J A;  3M3Y I;  4HGA C;  2F8N H;  4LD9 D;  1VQ7 Z;  3LZ1 C;  2JA7 I;  3I4N I;  2YFW B;  1USP B;  5B32 B;  3D9X A;  1NJI 2;  1S72 1;  1VQ6 Z;  4HGZ A;  1P3A B;  5GT3 B;  1P3L D;  4XUJ A;  5CP6 B;  2G2K A;  3I55 Z;  3MNN D;  1U35 A;  3I07 A;  1YJN 1;  3CD6 Z;  2VUG A;  3UTA D;  2DE7 A;  1N1J B;  4A3I I;  5GXQ B;  1M18 D;  1KX3 A;  4X23 C;  1Y1W I;  3EPL A;  5B33 C;  1F66 C;  1ZH1 A;  3REK A;  1RNI A;  4ZUX A;  3B6F C;  2V8I A;  1KQS Y;  1K8A 2;  1TFI A;  3EER A;  1JJ2 Z;  1YUK A;  1TZY A;  3O62 D;  2F8N A;  4E32 A;  1M19 C;  3X1U D;  3CC4 1;  2G5H C;  5AY8 B;  1YJW 1;  1YI2 1;  3W99 B;  3CME 1;  4G91 C;  5B31 C;  3MVD C;  4KGC D;  5B0Z C;  1M18 B;  2BJO A;  5KDM A;  5F99 B;  1A7W A;  1X3Z A;  1VQO Z;  4UUZ A;  3J81 f;  3LZ0 C;  3J7A 4;  3CCE 1;  3KUY C;  2RIQ A;  3MGS D;  3REL D;  1P3M B;  1Q7Y 2;  3CXC Y;  3MON A;  3CC2 Z;  5AV8 D;  4X23 A;  2NZD B;  4Z66 C;  3VTN A;  3B6F A;  4YM6 C;  3AZI C;  3AZK D;  3AV1 D;  3NQU B;  1QVF Y;  1TWC I;  3F3P C;  2HUE C;  2Y2O A;  1Z2C B;  2HIO C;  3OW2 Z;  3AV2 C;  4JJN C;  3MVD A;  4NE6 A;  3UT9 A;  3K7A I;  3MZK B;  3NH4 A;  3CCV 1;  4A3J I;  3REI A;  3MGR C;  4NBD A;  3CC7 Z;  3GTM I;  5CPI D;  3KUY A;  3AZM C;  1P3B A;  1P3K C;  1S7M A;  3T4N B;  2CV5 C;  1RLY A;  4XUJ D;  3IX0 A;  4Z66 A;  3LEL A;  1QF8 A;  3MGQ C;  3AZN C;  1EQZ C;  3BG0 B;  3HOW I;  3CCQ 1;  3AZI A;  2JMO A;  1KX3 D;  5AV9 C;  3MGP D;  3CCE Z;  1Q81 1;  4QLC C;  1Q86 1;  2P3Y A;  4NE3 A;  4R8P D;  4S1T A;  1QVG Z;  1Z01 A;  4WZS B;  2HIO A;  4UPK A;  3AV2 A;  5IP7 I;  4JJN A;  1VQL 1;  2F8N D;  2F8N G;  5C4J I;  3AFA A;  1VQ8 Z;  3LZ1 D;  3MGR A;  1U35 B;  3CCR Z;  1W2E A;  5DNM D;  3J80 b;  3W98 C;  3AZM A;  5B32 C;  5B0Y D;  1P3K A;  1KX3 B;  4J8V C;  1YHQ Z;  2CV5 A;  1VQ6 1;  1P3A C;  3REK B;  4ZUX B;  3EPK A;  1Q9C A;  5BT1 C;  3RZO I;  3AZG A;  3EPH A;  4RVG A;  3FQM A;  2QEX 1;  3WKJ D;  1TZY B;  4HGA B;  5GXQ C;  5AV9 A;  4X23 D;  2F8N B;  5B33 D;  4QLC A;  1F66 D;  1X3W A;  5FLX f;  5CPK C;  3CCM 1;  1HQ3 B;  1P3I A;  3B6F D;  4CAY A;  5GT0 C;  3CCS 1;  3B0C T;  4MH4 A;  3AZE A;  3W96 D;  4A3M I;  5KDM B;  1M19 D;  3BG1 B;  2NVX I;  3G6E Z;  4UUZ B;  1AOI C;  5JRG C;  5B31 D;  2ZAE B;  3MVD D;  3W98 A;  2LY8 A;  1NP6 A;  5B0Z D;  2DE5 A;  2JS4 A;  1M1A B;  4MXU A;  2FFF B;  2NVQ I;  4J8V A;  4X23 B;  5F99 C;  1P3F A;  1VQO 1;  3LZ0 D;  2L5A A;  3KUY D;  3A6N C;  3LJA B;  3B6F B;  1P3M C;  1ZB9 A;  3KSY A;  4NBE A;  1WW9 A;  5GXQ A;  4Z66 D;  1P3P D;  2NZD C;  1KQS Z;  3KXB C;  5CPK A;  3QWU A;  4MON A;  3CME Z;  1YI2 Z;  1YJW Z;  5IT9 b;  4YM6 D;  4G91 B;  3UT9 B;  5GT0 A;  3REI B;  3H3V J;  1AOI A;  5CPJ C;  5AVB C;  2HIO D;  5JRG A;  3KUY B;  3AV2 D;  1P3B B;  2QRC B;  4JJN D;  2QRE B;  2ZY2 A;  4MD9 A;  2OZK A;  1ID3 B;  4Z66 B;  3LEL B;  3VB9 A;  5AV6 C;  3A6N A;  3AZM D;  3IP4 C;  3CXC Z;  3AZI B;  1P3M A;  1P3K D;  2QA4 1;  2CV5 D;  3U50 C;  2NZD A;  1S32 C;  3KXB A;  1K73 2;  3MGQ D;  2HUE B;  3AZN D;  1EQZ D;  3LUS A;  3S1R I;  5AV9 D;  3CCV Z;  1QVF Z;  4QLC D;  3ESW A;  3AFA B;  1H3O A;  3NQU A;  5B2J C;  5B40 B;  4RVH A;  3V9R A;  3MGR B;  2F4M A;  3A1K A;  5CPJ A;  4ZBJ B;  5AVB A;  3IF8 A;  1LQL A;  3AZM B;  2E2H I;  5FLX b;  1P3K B;  4HGY A;  2F2A C;  5LL6 f;  1U35 C;  1KC8 2;  3AZG B;  5AV6 A;  3W98 D;  3S2H I;  5B32 D;  2IO5 C;  3REH C;  5AV9 B;  4J8V D;  2JA8 I;  2Y2I A;  4QLC B;  1P3A D;  2JR6 A;  1YHQ 1;  3REK C;  1P3I B;  1S32 A;  5BT1 D;  3PO3 I;  1L1O C;  1VQL Z;  4CAY B;  4X6A I;  5A2Q f;  1TZY C;  5GXQ D;  3AZE B;  5B2J A;  3X1T A;  1HQ3 C;  1RO0 A;  3VMI A;  3EED A;  3W98 B;  2QKD A;  1BH8 A;  3AZH C;  4J8V B;  1KD1 1;  3UTB C;  2FJ7 C;  1P3F B;  1AOI D;  5AY8 D;  4H9R A;  3G6E 1;  2Y2G A;  5JRG D;  1Z02 A;  3W99 D;  1RO4 A;  4A3G I;  2QEX Z;  3CCU Z;  3REH A;  2B63 I;  1M1A C;  1YJ9 Z;  2WB1 A;  5F99 D;  3CCM Z;  5CPK B;  4NBG A;  3HOZ I;  3A6N D;  2R6M A;  4WNN A;  3LJA C;  1P3M D;  4XZQ C;  4DRA A;  3TDH B;  2K3R A;  3F3F C;  5GT0 B;  3CCS Z;  2NZD D;  2ARO C;  1AOI B;  1HQ3 A;  5JRG B;  5CHL B;  4J8X A;  3UT9 C;  4RVD A;  2QRD B;  1SFO I;  1ZB8 A;  3AZH A;  3REI C;  3UTB A;  2FJ7 A;  5CPJ D;  5AVB D;  3KFU G;  2NQB C;  5AV5 C;  5G49 A;  3A6N B;  1R9T I;  1P3B C;  3TU4 B;  4KHA A;  1M1A A;  2F4O A;  4Z5T C;  1YUA A;  2JUB A;  5D1P A;  1ID3 C;  3HOV I;  3B0B A;  3KXB B;  3LEL C;  3H0R C;  3LJA A;  4XZQ A;  3X1S C;  1Y1V S;  4XX2 A;  5T6B A;  1K73 1;  3GTL I;  1H3O B;  4Y52 I;  3V9R B;  2ARO A;  1KX4 A;  1ZLA C;  5CPJ B;  5AVB B;  2JA6 I;  2PMZ A;  2YAD A;  1F1E A;  4E45 A;  4J8U C;  5B2J D;  3AFA C;  4NE5 A;  3CCJ 1;  5B40 C;  5T67 A;  3S1N I;  5BNV A;  2NQB A;  4QTT A;  4ZBJ C;  5AV5 A;  5AV6 B;  2M48 A;  1VQK 1;  3GKQ A;  5B2I C;  2QA4 Z;  1R4V A;  3REJ C;  1KC8 1;  4Z5T A;  1I50 I;  1ID3 A;  1U35 D;  1S32 B;  3AZG C;  3REH D;  3X1S A;  2BG1 A;  5B2J B;  3AYW B;  3X1T B;  3REK D;  5C3I C;  3FDD A;  4ZUX D;  2XD5 A;  1P3I C;  1ZLA A;  3X1V B;  5B1M C;  3AZJ A;  4BY1 I;  1TZY D;  1BH8 B;  3AZE C;  2E9H A;  1KX5 A;  2K5R A;  4J8U A;  2PM9 A;  2Q4Z A;  3H0M C;  4H9R B;  1HQ3 D;  5B1L B;  5B40 A;  3GTO I;  1NJI 1;  2Q51 A;  4E31 A;  1VQM Z;  2IO5 B;  5B2I A;  3REH B;  3AZH D;  4KUD C;  3REJ A;  3UTB D;  2FJ7 D;  2KPI A;  1P3F C;  3GTK I;  4WNN B;  2YFV A;  3RZD I;  2BYM A;  2NVY I;  3CCU 1;  1M1A D;  5T64 A;  1TWA I;  1YJ9 1;  2Y2H A;  2Y2N A;  4J8X B;  2Y2J A;  3LJA D;  3GTG I;  2ZY3 A;  4XZQ D;  4NFT A;  5B1M A;  3NH5 A;  3AZF C;  3WAA B;  3AZH B;  3UTB B;  2ARO D;  3C1C B;  2FJ7 B;  1I3Q I;  4NBB A;  3M4O I;  1BH9 A;  5G49 B;  3P5J B;  3NH8 A;  4H9Q A;  3UT9 D;  4E2W A;  4KHA B;  4KUD A;  2HU9 A;  2ZY5 A;  3REI D;  3AZL C;  4A93 I;  3KWQ C;  1Q7Y 1;  3H0G I;  5AV5 D;  3FQQ A;  3HOX I;  4WU9 C;  1P3B D;  2EGT A;  4XZQ B;  3FKI I;  4CL1 A;  3TU4 C;  3W97 C;  4NFR A;  1ID3 D;  2ARO B;  3LEL D;  4J8W C;  1KX4 B;  2DF4 C;  1M1K 2;  1M90 2;  3AZI D;  4RS4 A;  3AZF A;  5CM2 M;  1PZR A;  3A1I A;  3NDJ A;  2OOY B;  5BNV B;  2NQB B;  2NVT I;  5AV5 B;  4M6B A;  2VUM I;  1I6H I;  3B6G B;  4AYB A;  3WTP E;  4J8U D;  3AFA D;  4Z5T B;  2O4H A;  3AZL A;  5B40 D;  3MGR D;  3KWQ A;  4NBC A;  1W2B Y;  3UTA C;  1P3O C;  3S1Q I;  5IP9 I;  4WU9 A;  2GU2 A;  3X1S B;  4MRI A;  1P34 C;  2BYK B;  3W97 A;  3REJ D;  3TU4 A;  4YS3 A;  1VQ4 1;  2RVQ C;  4MD7 A;  3AN2 B;  4J8W A;  1ZLA B;  4RV9 A;  5B24 B;  3AZG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...