2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 1
publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
2FJ7C 1HQ3D 4WU9A 4MRIA 5T67A 3W98A 4G91C 4X23A 3MGPC 3MGRB 2NZDA 5GT3B 5B2JB 1EQZB 2Y0SA 3CCV1 4LD9C 2CWEA 4XUJC 3MNND 2RBLA 3AZKB 1Q812 4ZUXC 2RT9A 4WU8A 3CD61 2F2AC 1USPA 2OOYB 5IP9I 1N8R1 2HIOC 3NQJA 1JJ2Z 5B1LC 3WTPE 1P3FA 3X1SA 4J8WD 1K732 4NB9A 3MGRC 5FLXf 5GT3C 4H9SC 5B2JC 5AY8B 1M1AA 1EQZC 2PYOA 2K3RA 3EEDA 4E33A 3JAMf 3CCSZ 3LZ0B 3MGQA 4YS3A 3B6GD 1M18B 1RO0A 3AZKC 2F4MA 2R92I 1WWIA 5AVBD 3AZFA 1P3IB 1ID3B 3Q87A 2OTLZ 1B6WA 4A3EI 3CC4Z 3B0BA 5DNMD 1P3BD 2JA7I 1ZH1A 1P3OB 3AZJD 5T64A 3PO3S 3LELA 2ZAEB 5AV8B 1VQPZ 2QA41 3CCR1 5AY8C 4XX2A 1JFIB 4M6BA 1S72Z 2VF1A 4R8PD 3LZ1B 3GTGI 1QVFY 2JIOA 3LZ0C 4JJNB 3GTMI 3REID 1P34D 3EPLA 1KRLA 1M18C 3G6EZ 3X1TD 1U35B 1ID3C 1P3IC 3CCL1 4RVFA 3VB9A 3RZDI 5B0YC 4WU9B 1P3OC 4NH1C 3W98B 1VQO1 5GSUA 4X23B 1X3WA 2GU2A 2NZDB 5C3EI 1VQN1 5AV8C 1ZB8A 2F8ND 2ZY4A 2V3VA 1P3PA 3UT9A 3LZ1C 1U35A 4XZQD 4JJNC 1P3GA 3MVDD 1YUKA 4WU8B 1USPB 5C3IB 1U35C 3NQJB 3CQZI 3AV1D 3VMIA 1R4VA 3VH6A 1P3FB 1W2BZ 4Y52I 4WU9C 1P3KD 3W98C 5IP7I 4X23C 1PZRA 2NQBA 1M1AB 2PYOB 4LD9D 2NZDC 2IZ3A 2NVYI 4A3CI 1Y1VS 4MD7A 3MGQB 4YS3B 4E31A 1HTAA 4ZUXD 2LY8A 4WU8C 2HIOD 3AZFB 2F4OA 5B1LD 3TE5B 5C3IC 3H3VJ 3NQUA 3TDHB 2VPZA 5BO0A 3TU4D 1TZYA 1P3FC 2DE5A 2JIRA 3MGRD 3CCS1 3I4NI 5B2JD 2E7ZA 2K5RA 1RLYA 1NJI2 2Q51A 3FQMA 5E5AB 2AROB 1M1AC 2PYOC 1I6HI 3HOWI 1YHQZ 4A3II 1M1K2 3MGQC 5AV9A 4YS3C 3LUSA 3CC2Z 2CV5B 2OTJZ 3CC41 2OTL1 2VQRA 5T6BA 3AZFC 2Y2GA 3MGSB 1YUAA 4AYBA 1VQP1 5GSUB 1S721 5C4JI 2BYMB 2ZY2A 2AROC 5E5AC 3LZ0D 1P3PB 2JE5A 4H9OA 3UT9B 3G6E1 1P3GB 1M18D 2JIQA 4DRBA 1N1JA 2Y2PA 5B0ZA 1ID3D 2JIPA 3H0MC 3AZNA 2RHBA 5KDMA 3MGSC 3AZEA 1P3OD 2BJOA 4KUDA 3OW2Y 1P3LA 1L1OC 3EG5B 5GSUC 2YU9I 2NQBB 2LFUA 1Q862 4KGCD 3IX0A 4NBHA 4JJND 1VQ4Z 1P3PC 3UT9C 3S15I 1P3GC 4Y7NI 1VQ9Z 4Z66B 3BG1B 1K8A1 3NQUB 1VLAA 1BFMA 5GT0B 5BO0B 4WU9D 3EPKA 1TZYB 5CPKA 3W98D 3WAAA 4X23D 1FDIA 4E2YA 2V8KA 3KWQB 2NQBC 5A2Qb 3J80f 2H85A 3G71Z 5DNNA 5B32A 1KC82 3RELA 2Y2IA 2J6AA 3UTAB 4WU8D 3S1RI 3NH8A 4Z66C 2HUEB 3LJAA 5B24A 4CL1A 1P3FD 1VQOZ 1S32A 3WA9D 1TZYC 1ZLAA 5AV6A 3KIFA 1M1AD 3W96D 4H9NA 1KX5B 1YHQ1 3KWQC 3CC21 1M19A 3MGQD 3AZID 2OTJ1 1Z02A 3VH5W 3UTAC 2NVTI 2Y2NA 1TFIA 5LL6f 1KX3A 4DQYB 5B2IA 3AZNB 2FJ7B 1KQSY 3AZLD 3HKZA 1P3LB 2G2KA 4CAYB 2VPXA 4BBSI 1P3MA 4H9PA 2AROD 5BNXA 5E5AD 1KX5C 1ZB9A 2JNYA 5CM2M 3CCU1 2QEXZ 1N8R2 4A3DI 3C1CA 5CP6A 2CV5D 5AV5A 3NH4A 3OW2Z 3MGSD 3AZHA 1YJWZ 3S1QI 3AZNC 4NBAA 5A2Qf 1X0TA 3WTPB 4KUDC 1Z01A 1P3LC 1AOIB 2JIMA 2PM9A 1W2BY 3W99A 1R9TI 3S16I 4E32A 2G5IC 1VQ41 2M48A 5DNNB 5B32B 3UT9D 1I50I 1K9M1 3CPWY 3RELB 1VQ91 4KHAA 1P3GD 3O62D 1Y1VI 3IFUA 4HGZA 2VUMI 4UUZB 4RVDA 4E2ZA 4A3BI 3LJAB 5B24B 4HGAB 3X1UB 2AKLA 2GTIA 1S32B 1Y8CA 3X1VA 5AV6B 3G711 3WTPC 3GTPI 2NQBD 1AOIC 4H9NB 2PK7A 3AYWA 1M19B 5DNNC 5B32C 3RELC 3WKJA 1DL6A 3VH6T 4Z66D 4RVGA 4QLCA 2GTHA 1KX3B 5CPIA 5B2IB 1TWHI 3VMHA 5GT0D 3KUYD 5B0YB 3LJAC 5B24C 1TZYD 4HGAC 3X1UC 4NBFA 1S32C 1KD11 5AV6C 2E2HI 3KWQD 1P3MB 5BNXB 4WNNA 4H9RB 5JA4A 1M19C 1X3ZA 1YJ9Z 3C1CB 5CP6B 3UTAD 1JWHC 1KQSZ 2Q4ZA 5AV5B 3HOYI 2E2JI 3AZHB 5GXQA 1KX3C 3CCUZ 5B2IC 2Y2LA 2OOXB 2WB1A 5C4XI 3A6ND 4Z5TD 1QXFA 2VUGA 1KX5D 3W99B 4HH4A 2QEX1 1P3MC 3W97A 3AN2D 2IV2X 1W2EA 3IR7A 2JA8I 3C1BA 2UWXA 3C1CC 5CP6C 3CD6Z 2VPYA 1VQMZ 2Y2JA 1YJW1 5AV5C 2FJ7D 2R6MA 1YJNZ 3AZHC 1VQ81 1RQFA 3F3FC 3X1SB 3MGPD 1P3LD 3X1VB 3J81b 5B31A 5FUGA 2JR6A 3GKQA 4H9QA 4XUJD 3CPWZ 3W99C 4QTTA 3AYWB 5BNVA 4YM6A 2V8IA 2RVQC 4NOZA 4A3JI 3HOXI 2AYDA 1HQ3A 3AV2A 3S1MI 4BXXI 3G4SZ 2DE6A 2IZ4A 3F6TA 3WTPD 3X1SC 3NDIA 3LELB 5GT3D 3A1KA 3X1VC 1AOID 1EQZD 1ML8A 1Q821 5DNND 1F66A 4RS4A 3AYWC 5JA4B 3CCEZ 3RELD 3AZKD 3CCJZ 2XD1A 3V9RA 4A93I 5GXQB 5B24D 3X1UD 4Z2MH 3KFUG 1VQ7Z 2V8JA 5AV6D 4NBDA 3B6FA 3LELC 5AY8D 3B6GA 1YJ91 2PMZA 5B33A 1K8A2 5BS7A 2BG1A 1VQKZ 2Y2OA 5DNMA 1P3ID 1P3BA 2JMOA 2B63I 1KX3D 3J81f 1KX4A 5GXQC 5B0YD 4J8VA 2R7ZI 5AV8D 1LQLA 5FUGB 1BH9A 4R8PA 4H9QB 1P3MD 2YADA 1S7MA 3REIA 3LZ1D 5BNVB 4YM6B 3REJA 1TWAI 4NBGA 3I56Z 1VQM1 3X1TA 4DK1A 1Y1WI 2JSSA 1VQ5Z 3C1BC 2YFWA 1YJN1 5AV5D 1U35D 3BG0B 3AZHD 3AV2B 3D2LA 5AVCA 5G49A 4A3LI 5D1OA 3MZLB 1KU5A 3P5JB 3HOVI 3GTQI 2NZDD 2F8NA 3W99D 4XZQA 1F66B 3MVDA 4MD8A 3KXBA 4YM6C 4NBEA 5AV9B 3ESWA 3V9RB 3H0GI 2JA6I 2G5HC 3AV1A 4MH4A 3REKA 1HQ3C 1P3KA 3AV2C 3G4S1 3S17I 3CC71 3X1SD 3B6FB 3EERA 3I55Z 2PYOD 3PO3I 3CCE1 2ZY3A 3AZGA 3B6GB 3CCJ1 4YS3D 1F66C 4H9OB 5B33B 4DGLA 2HIOA 5AV9C 2QKDA 2WAQA 2V45A 1N1JB 5B0ZB 3AZFD 3MONA 1VQ71 3TU4A 5BT1C 1KX4B 3H0LC 5KDMB 3MGRA 3AZEB 2F8NH 2JUBA 4H9SA 4J8VB 3NH5A 4KUDB 3CXCY 2QR1B 3B0DC 3LELD 1K9M2 1BH9B 5F99A 4R8PB 5JRGA 3B6FC 4G92B 4NB8A 5B1MA 3J7A4 4J8XA 3CCMZ 3REJB 3B6GC 4EWCA 2W03A 1VQK1 5B33C 3X1TB 2JA5I 4TNUA 2YFWB 2DE7A 5B0ZC 5DNMC 4E44A 3AFAA 5GXQD 5AVCB 5G49B 5B32G 1KX4C 4NFTA 3AZEC 5CPKB 5D1OB 3WAAB 4J8VC 5GSUD 2M6NA 3UTBA 1VQ8Z 1Q9CA 1Q7Y1 3LZ0A 1BH8A 4R8PC 4G92C 5FLXb 3IP4C 3I561 1VQ51 1P3AA 3REIC 3KXBB 3REJC 5CPJA 1P3PD 1NP6A 3JAMb 4BY7I 3X1TC 3AV1B 1KD12 3REKB 1P3KB 4MONA 3VH6W 5AVCC 2LEXA 2O4HA 5CPKC 4NBBA 1ZLAB 3WAAC 3CMAZ 4NFRA 1QVGY 4KGCA 3AZGB 1WIIA 3KXBC 4A3FI 2VPWA 2Y2KA 2OZKA 3S2DI 1M901 3AV1C 3TU4B 3AV2D 4A3MI 1A7WA 3REKC 1P3KC 3QWUA 4NE5A 2W04A 4RV9A 3I551 1ZLAC 3KSYA 5F99B 1WCMI 5JRGB 4H9PB 2NAPA 5B1MB 4J8XB 1F66D 1TWGI 3AZGC 1TWFI 1VQ6Z 5AV9D 3FDDA 5FLMI 2BYKA 1N2FA 4J8UA 1H3OA 2LIYA 5BT1D 3CXCZ 3AFAB 4WZSB 1RO4A 3TU4C 3WA9A 3CCQZ 1RO2A 1VQLZ 2RIQA 3W96A 3UTBB 3B6FD 2ZM5A 3CCM1 1P9NA 1BH8B 5F99C 3AZIA 5JRGC 3AL0C 1WJ2A 5AN9F 5B1MC 3HOZI 4J8XC 1P3AB 5B33D 3S1NI 1WWSA 3VH5A 5CPJB 4KHAB 4ZBJB 3CCRZ 3S2HI 5B40A 2KPIA 5B0ZD 3A1IA 4HGYA 1Q811 2HU9A 3AZLA 4WJ3C 1WW9A 2E2II 3AZND 3AFAC 1KX4D 3AZED 1Q822 3GTLI 2J8PA 4J8VD 4KUDD 5E5AA 2AROA 3UTBC 4KGCB 4EO5B 4NBCA 1K731 4QTUA 3GTOI 3REHA 3AZMA 3REJD 2CV5A 1P3AC 5CPJC 2JS4A 3WKJB 4ZBJC 1FDOA 1T3UA 3MGSA 4AWLB 1YI2Z 4QLCB 4NE3A 5CPIB 5AVCD 1QVGZ 1ULYA 5CPKD 3CMA1 3WAAD 2BYMA 4MD9A 3CC7Z 3H0RC 3MNNA 2E9HA 4KGCC 4EO5C 1PFTA 2XD5A 1SFOI 4WNNB 5B32D 3O62A 3I07A 3KXBD 1Z03A 1AA6A 3WKJC 4X6AI 3MZKB 2BYKB 4MXUA 4J8UB 1H3OB 4AWLC 4QLCC 4A3GI 4J8WA 3REKD 3LJAD 5CPIC 3WA9B 1S32D 1ZLAD 3W96B 1F1EA 3GTJI 3AZIB 4A3KI 1VQ61 3RZOI 3W97B 3AZGD 1M19D 1YIJZ 2P3YA 3M4OI 3B0CW 2O53A 4Z66A 5AVBA 3C1BB 3CCQ1 5B31G 5B40B 1QF8A 4Z2MG 1VQL1 4UPKA 5GT0A 2Y2MA 3KUYA 4J8UC 3AZLB 5B2ID 3AZJA 3WA9C 4E2XA 3CMEZ 3KWQA 3T4NB 3W96C 5B31B 3B0CT 5F99D 4CSRA 5JRGD 3D9XA 5B1MD 3AZIC 4J8XD 3REHB 3AZMB 3UTAA 1P34A 2F8NK 3W97C 3K7AI 3VMGA 3J80b 3C1CD 5CP6D 2YFVA 5CHLB 1TAFA 2HF1A 3GCFA 5B40C 3AFAD 1HQ3B 2KI7B 3AZLC 3F3PC 3A6NA 4Z5TA 1QVFZ 3GTMS 1KX5A 5IT9b 2NVXI 3UTBD 1SIWA 3MNNB 5B31C 3AN2A 3IF8A 1NJI1 2Y2HA 3REHC 2RVQD 4E45A 3O62B 3AZMC 5CPJD 2CV5C 1P3AD 3D6WA 1YITZ 1YI21 1M1K1 1K83I 2FJ7A 2DQNC 1WZNA 2I3CA 2QLVB 4J8WB 3MGPA 2QREB 3NDJA 4S1TA 3R45A 3U50C 2NVQI 4CAYA 4LD9A 3B0DB 4XUJA 3X1VD 2EGTA 1TWCI 3CCVZ 3MNNC 4ZUXA 3AYWD 2QRDB 3O62C 1NUIA 5AVBB 3WKJD 4E30A 2ZY5A 5B1LA 4QLCD 5DNMB 1P3BB 3KUYB 3EPHA 4BY1I 3M3YI 5CPID 3AZJB 1JJ2Y 3WTPA 4J8WC 1Q7Y2 2R93I 3FQQA 5GT3A 5B2JA 1AOIA 1EQZA 4E2WA 2L5AA 1YIJ1 4CSRB 3EPJA 4NE6A 3AZKA 3REIB 1P34B 4UUZA 3NFZA 1Q861 3GTKI 3S14I 2YFVB 5AVBC 5BS7C 1TAFB 2F8NG 4J8UD 3X1UA 5IT9f 1P3BC 5GT0C 3KUYC 3FKII 3CME1 3AZJC 2W8SA 4Z5TB 3A6NB 1I3QI 2FFFB 5AY8A 3I4MI 2IO5B 4DRAA 3AN2B 2F8NB 1Q16A 2QA4Z 4RVHA 2Y2QA 3W97D 4XZQB 1M18A 1M902 3MVDB 2DF4C 1P34C 1ID3A 3C1BD 1P3IA 5C44I 1KC81 1Z2CB 5B40D 2HUEC 4WV4B 5B0YA 3CCLZ 1P3OA 4G91B 5D1PA 3MGPB 2QRCB 3R45B 4BBRI 5AV8A 2P28A 3A6NC 4Z5TC 4LD9B 4XUJB 1VQNZ 1JFIA 5B31D 3VH5T 2IO5C 3PO2I 3LZ1A 4H9RA 3AN2C 3KIHA 4JJNA 1RNIA 3REHD 3AZMD 4ZUXB 1QYPA 4YM6D 4XZQC 2RPRA 3VTNA 1YIT1 1B67A 3MVDC 2JCHA 2HIOB 5B1LB 3HOUI
chains in the Genus database with same CATH topology
2FJ7C 1HQ3D 4WU9A 4MRIA 5T67A 3W98A 4G91C 4X23A 3MGPC 3MGRB 2NZDA 5GT3B 5B2JB 1EQZB 2Y0SA 3CCV1 4LD9C 2CWEA 4XUJC 3MNND 2RBLA 3AZKB 1Q812 4ZUXC 2RT9A 4WU8A 3CD61 2F2AC 1USPA 2OOYB 5IP9I 1N8R1 2HIOC 3NQJA 1JJ2Z 5B1LC 3WTPE 1P3FA 3X1SA 4J8WD 1K732 4NB9A 3MGRC 5FLXf 5GT3C 4H9SC 5B2JC 5AY8B 1M1AA 1EQZC 2PYOA 2K3RA 3EEDA 4E33A 3JAMf 3CCSZ 3LZ0B 3MGQA 4YS3A 3B6GD 1M18B 1RO0A 3AZKC 2F4MA 2R92I 1WWIA 5AVBD 3AZFA 1P3IB 1ID3B 3Q87A 2OTLZ 1B6WA 4A3EI 3CC4Z 3B0BA 5DNMD 1P3BD 2JA7I 1ZH1A 1P3OB 3AZJD 5T64A 3PO3S 3LELA 2ZAEB 5AV8B 1VQPZ 2QA41 3CCR1 5AY8C 4XX2A 1JFIB 4M6BA 1S72Z 2VF1A 4R8PD 3LZ1B 3GTGI 1QVFY 3GTMI 3LZ0C 4JJNB 3REID 1P34D 3EPLA 1KRLA 1M18C 3G6EZ 3X1TD 1U35B 1ID3C 1P3IC 3CCL1 4RVFA 3VB9A 3RZDI 5B0YC 4WU9B 1P3OC 4NH1C 3W98B 1VQO1 5GSUA 4X23B 1X3WA 2GU2A 2NZDB 5C3EI 1VQN1 5AV8C 1ZB8A 2F8ND 2ZY4A 1P3PA 3UT9A 3LZ1C 1U35A 4XZQD 4JJNC 1P3GA 3MVDD 1YUKA 4WU8B 1USPB 5C3IB 1U35C 3NQJB 3CQZI 3AV1D 3VMIA 1R4VA 3VH6A 1P3FB 1W2BZ 4Y52I 4WU9C 1P3KD 3W98C 5IP7I 4X23C 1PZRA 2NQBA 1M1AB 2PYOB 4LD9D 2NZDC 2IZ3A 2NVYI 4A3CI 1Y1VS 4MD7A 3MGQB 4YS3B 4E31A 1HTAA 4ZUXD 2LY8A 4WU8C 2HIOD 3AZFB 2F4OA 5B1LD 3TE5B 5C3IC 3H3VJ 3NQUA 3TDHB 5BO0A 3TU4D 1TZYA 1P3FC 2DE5A 3MGRD 3CCS1 3I4NI 5B2JD 2K5RA 1NJI2 1RLYA 2Q51A 3FQMA 5E5AB 2AROB 1M1AC 2PYOC 1I6HI 3HOWI 1YHQZ 4A3II 1M1K2 3MGQC 5AV9A 4YS3C 3LUSA 3CC2Z 2CV5B 2OTJZ 3CC41 2OTL1 2VQRA 5T6BA 3AZFC 2Y2GA 3MGSB 1YUAA 4AYBA 1VQP1 5GSUB 1S721 5C4JI 2BYMB 2ZY2A 2AROC 5E5AC 3LZ0D 1P3PB 2JE5A 4H9OA 3UT9B 3G6E1 1P3GB 1M18D 4DRBA 1N1JA 2Y2PA 5B0ZA 1ID3D 3H0MC 3AZNA 2RHBA 5KDMA 3MGSC 3AZEA 1P3OD 2BJOA 4KUDA 3OW2Y 1P3LA 1L1OC 3EG5B 5GSUC 2YU9I 2NQBB 2LFUA 1Q862 4KGCD 3IX0A 4NBHA 4JJND 1VQ4Z 1P3PC 3UT9C 3S15I 1P3GC 4Y7NI 1VQ9Z 4Z66B 3BG1B 1K8A1 3NQUB 1VLAA 1BFMA 5GT0B 5BO0B 4WU9D 3EPKA 1TZYB 5CPKA 3W98D 3WAAA 4X23D 4E2YA 2V8KA 3KWQB 2NQBC 5A2Qb 3J80f 2H85A 3G71Z 5DNNA 5B32A 1KC82 3RELA 2Y2IA 2J6AA 3UTAB 4WU8D 3S1RI 3NH8A 4Z66C 2HUEB 3LJAA 5B24A 4CL1A 1P3FD 1VQOZ 1S32A 3WA9D 1TZYC 1ZLAA 5AV6A 3KIFA 1M1AD 3W96D 4H9NA 1KX5B 1YHQ1 3KWQC 3CC21 1M19A 3MGQD 3AZID 2OTJ1 1Z02A 3VH5W 3UTAC 2NVTI 2Y2NA 1TFIA 5LL6f 1KX3A 4DQYB 5B2IA 3AZNB 2FJ7B 1KQSY 3AZLD 3HKZA 1P3LB 2G2KA 4CAYB 4BBSI 1P3MA 4H9PA 2AROD 5BNXA 5E5AD 1KX5C 1ZB9A 2JNYA 5CM2M 3CCU1 2QEXZ 1N8R2 4A3DI 3C1CA 5CP6A 2CV5D 5AV5A 3NH4A 3OW2Z 3MGSD 3AZHA 1YJWZ 3S1QI 3AZNC 4NBAA 5A2Qf 1X0TA 3WTPB 4KUDC 1Z01A 1P3LC 1AOIB 2PM9A 3S16I 1W2BY 3W99A 1R9TI 4E32A 2G5IC 1VQ41 2M48A 5DNNB 5B32B 3UT9D 1I50I 1K9M1 3CPWY 3RELB 1VQ91 4KHAA 1P3GD 3O62D 1Y1VI 3IFUA 4HGZA 2VUMI 4UUZB 4RVDA 4E2ZA 4A3BI 3LJAB 5B24B 4HGAB 3X1UB 2AKLA 2GTIA 1S32B 3X1VA 5AV6B 3G711 3WTPC 3GTPI 2NQBD 1AOIC 4H9NB 2PK7A 3AYWA 1M19B 5DNNC 5B32C 3RELC 3WKJA 1DL6A 3VH6T 4Z66D 4RVGA 4QLCA 2GTHA 1KX3B 5CPIA 5B2IB 1TWHI 3VMHA 5GT0D 3KUYD 5B0YB 3LJAC 5B24C 1TZYD 4HGAC 3X1UC 4NBFA 1S32C 1KD11 5AV6C 2E2HI 3KWQD 1P3MB 5BNXB 4WNNA 4H9RB 5JA4A 1M19C 1X3ZA 1YJ9Z 3C1CB 5CP6B 3UTAD 1JWHC 1KQSZ 2Q4ZA 5AV5B 3HOYI 2E2JI 3AZHB 5GXQA 1KX3C 5B2IC 2Y2LA 2OOXB 2WB1A 5C4XI 3A6ND 4Z5TD 2VUGA 1KX5D 3W99B 4HH4A 2QEX1 1P3MC 3W97A 3AN2D 1W2EA 2JA8I 3C1BA 2UWXA 3C1CC 5CP6C 3CD6Z 1VQMZ 1YJW1 2Y2JA 5AV5C 2FJ7D 2R6MA 1YJNZ 3AZHC 1VQ81 1RQFA 3F3FC 3X1SB 3MGPD 1P3LD 3X1VB 3J81b 5B31A 5FUGA 2JR6A 3GKQA 4H9QA 4XUJD 3CPWZ 3W99C 4QTTA 3AYWB 5BNVA 4YM6A 2V8IA 2RVQC 4NOZA 4A3JI 3HOXI 1HQ3A 3AV2A 3S1MI 4BXXI 3G4SZ 2DE6A 2IZ4A 3F6TA 3WTPD 3X1SC 3NDIA 3LELB 5GT3D 3A1KA 3X1VC 1AOID 1EQZD 1ML8A 1Q821 5DNND 1F66A 4RS4A 3AYWC 5JA4B 3CCEZ 3RELD 3AZKD 3CCJZ 2XD1A 3V9RA 4A93I 5GXQB 5B24D 3X1UD 4Z2MH 3KFUG 1VQ7Z 2V8JA 5AV6D 4NBDA 3B6FA 3LELC 5AY8D 3B6GA 1YJ91 2PMZA 5B33A 1K8A2 5BS7A 2BG1A 1VQKZ 2Y2OA 5DNMA 1P3ID 1P3BA 2JMOA 2B63I 1KX3D 3J81f 1KX4A 5GXQC 5B0YD 4J8VA 2R7ZI 5AV8D 1LQLA 5FUGB 1BH9A 4R8PA 4H9QB 1P3MD 2YADA 1S7MA 3REIA 3LZ1D 5BNVB 4YM6B 3REJA 1TWAI 4NBGA 3I56Z 1VQM1 3X1TA 4DK1A 1Y1WI 2JSSA 1VQ5Z 3C1BC 2YFWA 1YJN1 5AV5D 1U35D 3BG0B 3AZHD 3AV2B 5AVCA 5G49A 4A3LI 5D1OA 3MZLB 1KU5A 3P5JB 3HOVI 3GTQI 2NZDD 2F8NA 3W99D 4XZQA 1F66B 3MVDA 4MD8A 3KXBA 4YM6C 4NBEA 5AV9B 3ESWA 3V9RB 3H0GI 2JA6I 2G5HC 3AV1A 4MH4A 3REKA 1HQ3C 1P3KA 3AV2C 3G4S1 3S17I 3CC71 3X1SD 3B6FB 3EERA 3I55Z 2PYOD 3PO3I 3CCE1 2ZY3A 3AZGA 3B6GB 3CCJ1 4YS3D 1F66C 4H9OB 5B33B 4DGLA 2HIOA 5AV9C 2QKDA 2WAQA 1N1JB 5B0ZB 3AZFD 3MONA 1VQ71 3TU4A 5BT1C 1KX4B 3H0LC 5KDMB 3MGRA 3AZEB 2F8NH 2JUBA 4H9SA 4J8VB 3NH5A 4KUDB 3CXCY 2QR1B 3B0DC 3LELD 1K9M2 1BH9B 5F99A 4R8PB 5JRGA 3B6FC 4G92B 4NB8A 5B1MA 3J7A4 4J8XA 3CCMZ 3REJB 3B6GC 4EWCA 2W03A 1VQK1 5B33C 3X1TB 2JA5I 4TNUA 2YFWB 2DE7A 5B0ZC 5DNMC 4E44A 3AFAA 5GXQD 5AVCB 5G49B 5B32G 1KX4C 4NFTA 3AZEC 5CPKB 5D1OB 3WAAB 4J8VC 5GSUD 2M6NA 3UTBA 1VQ8Z 1Q9CA 1Q7Y1 3LZ0A 1BH8A 4R8PC 4G92C 5FLXb 3IP4C 3I561 1VQ51 1P3AA 3REIC 3KXBB 3REJC 5CPJA 1P3PD 1NP6A 3JAMb 4BY7I 3X1TC 3AV1B 1KD12 3REKB 1P3KB 4MONA 3VH6W 5AVCC 2O4HA 5CPKC 4NBBA 1ZLAB 3WAAC 3CMAZ 4NFRA 1QVGY 4KGCA 3AZGB 1WIIA 3KXBC 4A3FI 2Y2KA 2OZKA 3S2DI 1M901 3AV1C 3TU4B 3AV2D 4A3MI 1A7WA 3REKC 1P3KC 3QWUA 4NE5A 2W04A 4RV9A 3I551 1ZLAC 3KSYA 5F99B 1WCMI 5JRGB 4H9PB 5B1MB 4J8XB 1F66D 1TWGI 3AZGC 1TWFI 1VQ6Z 5AV9D 3FDDA 5FLMI 2BYKA 1N2FA 4J8UA 1H3OA 2LIYA 5BT1D 3CXCZ 3AFAB 4WZSB 1RO4A 3TU4C 3WA9A 3CCQZ 1RO2A 1VQLZ 2RIQA 3W96A 3UTBB 3B6FD 2ZM5A 3CCM1 1P9NA 1BH8B 5F99C 3AZIA 5JRGC 3AL0C 3HOZI 5AN9F 5B1MC 4J8XC 1P3AB 5B33D 3S1NI 1WWSA 3VH5A 5CPJB 4KHAB 4ZBJB 3CCRZ 3S2HI 5B40A 2KPIA 5B0ZD 3A1IA 4HGYA 1Q811 2HU9A 3AZLA 4WJ3C 1WW9A 2E2II 3AZND 3AFAC 1KX4D 3AZED 1Q822 3GTLI 2J8PA 4J8VD 4KUDD 5E5AA 2AROA 3UTBC 4KGCB 4EO5B 4NBCA 1K731 4QTUA 3GTOI 3REHA 3AZMA 3REJD 2CV5A 1P3AC 5CPJC 2JS4A 3WKJB 4ZBJC 1YI2Z 1T3UA 3MGSA 4AWLB 4QLCB 4NE3A 5CPIB 5AVCD 1QVGZ 1ULYA 5CPKD 3CMA1 3WAAD 2BYMA 4MD9A 3CC7Z 3H0RC 3MNNA 2E9HA 4KGCC 4EO5C 1PFTA 2XD5A 1SFOI 4WNNB 5B32D 3O62A 3I07A 3KXBD 1Z03A 3WKJC 4X6AI 3MZKB 2BYKB 4MXUA 4J8UB 1H3OB 4AWLC 4QLCC 4A3GI 4J8WA 3REKD 3LJAD 5CPIC 3WA9B 1S32D 1ZLAD 3W96B 1F1EA 3GTJI 3AZIB 4A3KI 1VQ61 3RZOI 3W97B 3AZGD 1M19D 1YIJZ 2P3YA 3M4OI 3B0CW 2O53A 4Z66A 5AVBA 3C1BB 3CCQ1 5B31G 5B40B 1QF8A 4Z2MG 1VQL1 4UPKA 5GT0A 2Y2MA 3KUYA 4J8UC 3AZLB 5B2ID 3AZJA 3WA9C 4E2XA 3CMEZ 3KWQA 3T4NB 3W96C 5B31B 3B0CT 5F99D 4CSRA 5JRGD 3D9XA 5B1MD 3AZIC 4J8XD 3REHB 3AZMB 3UTAA 1P34A 2F8NK 3W97C 3K7AI 3VMGA 3J80b 3C1CD 5CP6D 2YFVA 5CHLB 1TAFA 2HF1A 3GCFA 5B40C 3AFAD 1HQ3B 2KI7B 3AZLC 3F3PC 3A6NA 4Z5TA 1QVFZ 3GTMS 1KX5A 5IT9b 2NVXI 3UTBD 3MNNB 5B31C 3AN2A 3IF8A 1NJI1 2Y2HA 3REHC 2RVQD 4E45A 3O62B 3AZMC 5CPJD 2CV5C 1P3AD 3D6WA 1YITZ 1YI21 1M1K1 1K83I 2FJ7A 2DQNC 2I3CA 2QLVB 2QREB 4J8WB 3MGPA 3NDJA 4S1TA 3U50C 3R45A 3CCUZ 2NVQI 4CAYA 4LD9A 3B0DB 4XUJA 3X1VD 2EGTA 1TWCI 3CCVZ 3MNNC 4ZUXA 3AYWD 2QRDB 3O62C 1NUIA 5AVBB 3WKJD 4E30A 2ZY5A 5B1LA 4QLCD 5DNMB 1P3BB 3KUYB 3EPHA 4BY1I 3M3YI 5CPID 3AZJB 1JJ2Y 3WTPA 4J8WC 1Q7Y2 2R93I 3FQQA 5GT3A 5B2JA 1AOIA 1EQZA 4E2WA 2L5AA 1YIJ1 4CSRB 3EPJA 4NE6A 3AZKA 3REIB 1P34B 4UUZA 3NFZA 1Q861 3GTKI 3S14I 2YFVB 5AVBC 5BS7C 1TAFB 2F8NG 4J8UD 3X1UA 5IT9f 1P3BC 5GT0C 3KUYC 3FKII 3CME1 3AZJC 2W8SA 4Z5TB 3A6NB 1I3QI 2FFFB 5AY8A 3I4MI 2IO5B 4DRAA 3AN2B 2F8NB 2QA4Z 4RVHA 2Y2QA 3W97D 4XZQB 1M18A 1M902 3MVDB 2DF4C 1P34C 1ID3A 3C1BD 1P3IA 5C44I 1KC81 1Z2CB 5B40D 2HUEC 4WV4B 5B0YA 3CCLZ 1P3OA 4G91B 5D1PA 3MGPB 2QRCB 3R45B 4BBRI 5AV8A 2P28A 3A6NC 4Z5TC 4LD9B 4XUJB 1VQNZ 1JFIA 5B31D 3VH5T 2IO5C 3PO2I 3LZ1A 4H9RA 3AN2C 3KIHA 4JJNA 1RNIA 3REHD 3AZMD 4ZUXB 1QYPA 4YM6D 4XZQC 2RPRA 3VTNA 1YIT1 1B67A 3MVDC 2JCHA 2HIOB 5B1LB 3HOUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 2FJ7 C;  1HQ3 D;  4WU9 A;  4MRI A;  5T67 A;  3W98 A;  4G91 C;  4X23 A;  3MGP C;  3MGR B;  2NZD A;  5GT3 B;  5B2J B;  1EQZ B;  2Y0S A;  3CCV 1;  4LD9 C;  2CWE A;  4XUJ C;  3MNN D;  2RBL A;  3AZK B;  1Q81 2;  4ZUX C;  2RT9 A;  4WU8 A;  3CD6 1;  2F2A C;  1USP A;  2OOY B;  5IP9 I;  1N8R 1;  2HIO C;  3NQJ A;  1JJ2 Z;  5B1L C;  3WTP E;  1P3F A;  3X1S A;  4J8W D;  1K73 2;  4NB9 A;  3MGR C;  5FLX f;  5GT3 C;  4H9S C;  5B2J C;  5AY8 B;  1M1A A;  1EQZ C;  2PYO A;  2K3R A;  3EED A;  4E33 A;  3JAM f;  3CCS Z;  3LZ0 B;  3MGQ A;  4YS3 A;  3B6G D;  1M18 B;  1RO0 A;  3AZK C;  2F4M A;  2R92 I;  1WWI A;  5AVB D;  3AZF A;  1P3I B;  1ID3 B;  3Q87 A;  2OTL Z;  1B6W A;  4A3E I;  3CC4 Z;  3B0B A;  5DNM D;  1P3B D;  2JA7 I;  1ZH1 A;  1P3O B;  3AZJ D;  5T64 A;  3PO3 S;  3LEL A;  2ZAE B;  5AV8 B;  1VQP Z;  2QA4 1;  3CCR 1;  5AY8 C;  4XX2 A;  1JFI B;  4M6B A;  1S72 Z;  2VF1 A;  4R8P D;  3LZ1 B;  3GTG I;  1QVF Y;  2JIO A;  3LZ0 C;  4JJN B;  3GTM I;  3REI D;  1P34 D;  3EPL A;  1KRL A;  1M18 C;  3G6E Z;  3X1T D;  1U35 B;  1ID3 C;  1P3I C;  3CCL 1;  4RVF A;  3VB9 A;  3RZD I;  5B0Y C;  4WU9 B;  1P3O C;  4NH1 C;  3W98 B;  1VQO 1;  5GSU A;  4X23 B;  1X3W A;  2GU2 A;  2NZD B;  5C3E I;  1VQN 1;  5AV8 C;  1ZB8 A;  2F8N D;  2ZY4 A;  2V3V A;  1P3P A;  3UT9 A;  3LZ1 C;  1U35 A;  4XZQ D;  4JJN C;  1P3G A;  3MVD D;  1YUK A;  4WU8 B;  1USP B;  5C3I B;  1U35 C;  3NQJ B;  3CQZ I;  3AV1 D;  3VMI A;  1R4V A;  3VH6 A;  1P3F B;  1W2B Z;  4Y52 I;  4WU9 C;  1P3K D;  3W98 C;  5IP7 I;  4X23 C;  1PZR A;  2NQB A;  1M1A B;  2PYO B;  4LD9 D;  2NZD C;  2IZ3 A;  2NVY I;  4A3C I;  1Y1V S;  4MD7 A;  3MGQ B;  4YS3 B;  4E31 A;  1HTA A;  4ZUX D;  2LY8 A;  4WU8 C;  2HIO D;  3AZF B;  2F4O A;  5B1L D;  3TE5 B;  5C3I C;  3H3V J;  3NQU A;  3TDH B;  2VPZ A;  5BO0 A;  3TU4 D;  1TZY A;  1P3F C;  2DE5 A;  2JIR A;  3MGR D;  3CCS 1;  3I4N I;  5B2J D;  2E7Z A;  2K5R A;  1RLY A;  1NJI 2;  2Q51 A;  3FQM A;  5E5A B;  2ARO B;  1M1A C;  2PYO C;  1I6H I;  3HOW I;  1YHQ Z;  4A3I I;  1M1K 2;  3MGQ C;  5AV9 A;  4YS3 C;  3LUS A;  3CC2 Z;  2CV5 B;  2OTJ Z;  3CC4 1;  2OTL 1;  2VQR A;  5T6B A;  3AZF C;  2Y2G A;  3MGS B;  1YUA A;  4AYB A;  1VQP 1;  5GSU B;  1S72 1;  5C4J I;  2BYM B;  2ZY2 A;  2ARO C;  5E5A C;  3LZ0 D;  1P3P B;  2JE5 A;  4H9O A;  3UT9 B;  3G6E 1;  1P3G B;  1M18 D;  2JIQ A;  4DRB A;  1N1J A;  2Y2P A;  5B0Z A;  1ID3 D;  2JIP A;  3H0M C;  3AZN A;  2RHB A;  5KDM A;  3MGS C;  3AZE A;  1P3O D;  2BJO A;  4KUD A;  3OW2 Y;  1P3L A;  1L1O C;  3EG5 B;  5GSU C;  2YU9 I;  2NQB B;  2LFU A;  1Q86 2;  4KGC D;  3IX0 A;  4NBH A;  4JJN D;  1VQ4 Z;  1P3P C;  3UT9 C;  3S15 I;  1P3G C;  4Y7N I;  1VQ9 Z;  4Z66 B;  3BG1 B;  1K8A 1;  3NQU B;  1VLA A;  1BFM A;  5GT0 B;  5BO0 B;  4WU9 D;  3EPK A;  1TZY B;  5CPK A;  3W98 D;  3WAA A;  4X23 D;  1FDI A;  4E2Y A;  2V8K A;  3KWQ B;  2NQB C;  5A2Q b;  3J80 f;  2H85 A;  3G71 Z;  5DNN A;  5B32 A;  1KC8 2;  3REL A;  2Y2I A;  2J6A A;  3UTA B;  4WU8 D;  3S1R I;  3NH8 A;  4Z66 C;  2HUE B;  3LJA A;  5B24 A;  4CL1 A;  1P3F D;  1VQO Z;  1S32 A;  3WA9 D;  1TZY C;  1ZLA A;  5AV6 A;  3KIF A;  1M1A D;  3W96 D;  4H9N A;  1KX5 B;  1YHQ 1;  3KWQ C;  3CC2 1;  1M19 A;  3MGQ D;  3AZI D;  2OTJ 1;  1Z02 A;  3VH5 W;  3UTA C;  2NVT I;  2Y2N A;  1TFI A;  5LL6 f;  1KX3 A;  4DQY B;  5B2I A;  3AZN B;  2FJ7 B;  1KQS Y;  3AZL D;  3HKZ A;  1P3L B;  2G2K A;  4CAY B;  2VPX A;  4BBS I;  1P3M A;  4H9P A;  2ARO D;  5BNX A;  5E5A D;  1KX5 C;  1ZB9 A;  2JNY A;  5CM2 M;  3CCU 1;  2QEX Z;  1N8R 2;  4A3D I;  3C1C A;  5CP6 A;  2CV5 D;  5AV5 A;  3NH4 A;  3OW2 Z;  3MGS D;  3AZH A;  1YJW Z;  3S1Q I;  3AZN C;  4NBA A;  5A2Q f;  1X0T A;  3WTP B;  4KUD C;  1Z01 A;  1P3L C;  1AOI B;  2JIM A;  2PM9 A;  1W2B Y;  3W99 A;  1R9T I;  3S16 I;  4E32 A;  2G5I C;  1VQ4 1;  2M48 A;  5DNN B;  5B32 B;  3UT9 D;  1I50 I;  1K9M 1;  3CPW Y;  3REL B;  1VQ9 1;  4KHA A;  1P3G D;  3O62 D;  1Y1V I;  3IFU A;  4HGZ A;  2VUM I;  4UUZ B;  4RVD A;  4E2Z A;  4A3B I;  3LJA B;  5B24 B;  4HGA B;  3X1U B;  2AKL A;  2GTI A;  1S32 B;  1Y8C A;  3X1V A;  5AV6 B;  3G71 1;  3WTP C;  3GTP I;  2NQB D;  1AOI C;  4H9N B;  2PK7 A;  3AYW A;  1M19 B;  5DNN C;  5B32 C;  3REL C;  3WKJ A;  1DL6 A;  3VH6 T;  4Z66 D;  4RVG A;  4QLC A;  2GTH A;  1KX3 B;  5CPI A;  5B2I B;  1TWH I;  3VMH A;  5GT0 D;  3KUY D;  5B0Y B;  3LJA C;  5B24 C;  1TZY D;  4HGA C;  3X1U C;  4NBF A;  1S32 C;  1KD1 1;  5AV6 C;  2E2H I;  3KWQ D;  1P3M B;  5BNX B;  4WNN A;  4H9R B;  5JA4 A;  1M19 C;  1X3Z A;  1YJ9 Z;  3C1C B;  5CP6 B;  3UTA D;  1JWH C;  1KQS Z;  2Q4Z A;  5AV5 B;  3HOY I;  2E2J I;  3AZH B;  5GXQ A;  1KX3 C;  3CCU Z;  5B2I C;  2Y2L A;  2OOX B;  2WB1 A;  5C4X I;  3A6N D;  4Z5T D;  1QXF A;  2VUG A;  1KX5 D;  3W99 B;  4HH4 A;  2QEX 1;  1P3M C;  3W97 A;  3AN2 D;  2IV2 X;  1W2E A;  3IR7 A;  2JA8 I;  3C1B A;  2UWX A;  3C1C C;  5CP6 C;  3CD6 Z;  2VPY A;  1VQM Z;  2Y2J A;  1YJW 1;  5AV5 C;  2FJ7 D;  2R6M A;  1YJN Z;  3AZH C;  1VQ8 1;  1RQF A;  3F3F C;  3X1S B;  3MGP D;  1P3L D;  3X1V B;  3J81 b;  5B31 A;  5FUG A;  2JR6 A;  3GKQ A;  4H9Q A;  4XUJ D;  3CPW Z;  3W99 C;  4QTT A;  3AYW B;  5BNV A;  4YM6 A;  2V8I A;  2RVQ C;  4NOZ A;  4A3J I;  3HOX I;  2AYD A;  1HQ3 A;  3AV2 A;  3S1M I;  4BXX I;  3G4S Z;  2DE6 A;  2IZ4 A;  3F6T A;  3WTP D;  3X1S C;  3NDI A;  3LEL B;  5GT3 D;  3A1K A;  3X1V C;  1AOI D;  1EQZ D;  1ML8 A;  1Q82 1;  5DNN D;  1F66 A;  4RS4 A;  3AYW C;  5JA4 B;  3CCE Z;  3REL D;  3AZK D;  3CCJ Z;  2XD1 A;  3V9R A;  4A93 I;  5GXQ B;  5B24 D;  3X1U D;  4Z2M H;  3KFU G;  1VQ7 Z;  2V8J A;  5AV6 D;  4NBD A;  3B6F A;  3LEL C;  5AY8 D;  3B6G A;  1YJ9 1;  2PMZ A;  5B33 A;  1K8A 2;  5BS7 A;  2BG1 A;  1VQK Z;  2Y2O A;  5DNM A;  1P3I D;  1P3B A;  2JMO A;  2B63 I;  1KX3 D;  3J81 f;  1KX4 A;  5GXQ C;  5B0Y D;  4J8V A;  2R7Z I;  5AV8 D;  1LQL A;  5FUG B;  1BH9 A;  4R8P A;  4H9Q B;  1P3M D;  2YAD A;  1S7M A;  3REI A;  3LZ1 D;  5BNV B;  4YM6 B;  3REJ A;  1TWA I;  4NBG A;  3I56 Z;  1VQM 1;  3X1T A;  4DK1 A;  1Y1W I;  2JSS A;  1VQ5 Z;  3C1B C;  2YFW A;  1YJN 1;  5AV5 D;  1U35 D;  3BG0 B;  3AZH D;  3AV2 B;  3D2L A;  5AVC A;  5G49 A;  4A3L I;  5D1O A;  3MZL B;  1KU5 A;  3P5J B;  3HOV I;  3GTQ I;  2NZD D;  2F8N A;  3W99 D;  4XZQ A;  1F66 B;  3MVD A;  4MD8 A;  3KXB A;  4YM6 C;  4NBE A;  5AV9 B;  3ESW A;  3V9R B;  3H0G I;  2JA6 I;  2G5H C;  3AV1 A;  4MH4 A;  3REK A;  1HQ3 C;  1P3K A;  3AV2 C;  3G4S 1;  3S17 I;  3CC7 1;  3X1S D;  3B6F B;  3EER A;  3I55 Z;  2PYO D;  3PO3 I;  3CCE 1;  2ZY3 A;  3AZG A;  3B6G B;  3CCJ 1;  4YS3 D;  1F66 C;  4H9O B;  5B33 B;  4DGL A;  2HIO A;  5AV9 C;  2QKD A;  2WAQ A;  2V45 A;  1N1J B;  5B0Z B;  3AZF D;  3MON A;  1VQ7 1;  3TU4 A;  5BT1 C;  1KX4 B;  3H0L C;  5KDM B;  3MGR A;  3AZE B;  2F8N H;  2JUB A;  4H9S A;  4J8V B;  3NH5 A;  4KUD B;  3CXC Y;  2QR1 B;  3B0D C;  3LEL D;  1K9M 2;  1BH9 B;  5F99 A;  4R8P B;  5JRG A;  3B6F C;  4G92 B;  4NB8 A;  5B1M A;  3J7A 4;  4J8X A;  3CCM Z;  3REJ B;  3B6G C;  4EWC A;  2W03 A;  1VQK 1;  5B33 C;  3X1T B;  2JA5 I;  4TNU A;  2YFW B;  2DE7 A;  5B0Z C;  5DNM C;  4E44 A;  3AFA A;  5GXQ D;  5AVC B;  5G49 B;  5B32 G;  1KX4 C;  4NFT A;  3AZE C;  5CPK B;  5D1O B;  3WAA B;  4J8V C;  5GSU D;  2M6N A;  3UTB A;  1VQ8 Z;  1Q9C A;  1Q7Y 1;  3LZ0 A;  1BH8 A;  4R8P C;  4G92 C;  5FLX b;  3IP4 C;  3I56 1;  1VQ5 1;  1P3A A;  3REI C;  3KXB B;  3REJ C;  5CPJ A;  1P3P D;  1NP6 A;  3JAM b;  4BY7 I;  3X1T C;  3AV1 B;  1KD1 2;  3REK B;  1P3K B;  4MON A;  3VH6 W;  5AVC C;  2LEX A;  2O4H A;  5CPK C;  4NBB A;  1ZLA B;  3WAA C;  3CMA Z;  4NFR A;  1QVG Y;  4KGC A;  3AZG B;  1WII A;  3KXB C;  4A3F I;  2VPW A;  2Y2K A;  2OZK A;  3S2D I;  1M90 1;  3AV1 C;  3TU4 B;  3AV2 D;  4A3M I;  1A7W A;  3REK C;  1P3K C;  3QWU A;  4NE5 A;  2W04 A;  4RV9 A;  3I55 1;  1ZLA C;  3KSY A;  5F99 B;  1WCM I;  5JRG B;  4H9P B;  2NAP A;  5B1M B;  4J8X B;  1F66 D;  1TWG I;  3AZG C;  1TWF I;  1VQ6 Z;  5AV9 D;  3FDD A;  5FLM I;  2BYK A;  1N2F A;  4J8U A;  1H3O A;  2LIY A;  5BT1 D;  3CXC Z;  3AFA B;  4WZS B;  1RO4 A;  3TU4 C;  3WA9 A;  3CCQ Z;  1RO2 A;  1VQL Z;  2RIQ A;  3W96 A;  3UTB B;  3B6F D;  2ZM5 A;  3CCM 1;  1P9N A;  1BH8 B;  5F99 C;  3AZI A;  5JRG C;  3AL0 C;  1WJ2 A;  5AN9 F;  5B1M C;  3HOZ I;  4J8X C;  1P3A B;  5B33 D;  3S1N I;  1WWS A;  3VH5 A;  5CPJ B;  4KHA B;  4ZBJ B;  3CCR Z;  3S2H I;  5B40 A;  2KPI A;  5B0Z D;  3A1I A;  4HGY A;  1Q81 1;  2HU9 A;  3AZL A;  4WJ3 C;  1WW9 A;  2E2I I;  3AZN D;  3AFA C;  1KX4 D;  3AZE D;  1Q82 2;  3GTL I;  2J8P A;  4J8V D;  4KUD D;  5E5A A;  2ARO A;  3UTB C;  4KGC B;  4EO5 B;  4NBC A;  1K73 1;  4QTU A;  3GTO I;  3REH A;  3AZM A;  3REJ D;  2CV5 A;  1P3A C;  5CPJ C;  2JS4 A;  3WKJ B;  4ZBJ C;  1FDO A;  1T3U A;  3MGS A;  4AWL B;  1YI2 Z;  4QLC B;  4NE3 A;  5CPI B;  5AVC D;  1QVG Z;  1ULY A;  5CPK D;  3CMA 1;  3WAA D;  2BYM A;  4MD9 A;  3CC7 Z;  3H0R C;  3MNN A;  2E9H A;  4KGC C;  4EO5 C;  1PFT A;  2XD5 A;  1SFO I;  4WNN B;  5B32 D;  3O62 A;  3I07 A;  3KXB D;  1Z03 A;  1AA6 A;  3WKJ C;  4X6A I;  3MZK B;  2BYK B;  4MXU A;  4J8U B;  1H3O B;  4AWL C;  4QLC C;  4A3G I;  4J8W A;  3REK D;  3LJA D;  5CPI C;  3WA9 B;  1S32 D;  1ZLA D;  3W96 B;  1F1E A;  3GTJ I;  3AZI B;  4A3K I;  1VQ6 1;  3RZO I;  3W97 B;  3AZG D;  1M19 D;  1YIJ Z;  2P3Y A;  3M4O I;  3B0C W;  2O53 A;  4Z66 A;  5AVB A;  3C1B B;  3CCQ 1;  5B31 G;  5B40 B;  1QF8 A;  4Z2M G;  1VQL 1;  4UPK A;  5GT0 A;  2Y2M A;  3KUY A;  4J8U C;  3AZL B;  5B2I D;  3AZJ A;  3WA9 C;  4E2X A;  3CME Z;  3KWQ A;  3T4N B;  3W96 C;  5B31 B;  3B0C T;  5F99 D;  4CSR A;  5JRG D;  3D9X A;  5B1M D;  3AZI C;  4J8X D;  3REH B;  3AZM B;  3UTA A;  1P34 A;  2F8N K;  3W97 C;  3K7A I;  3VMG A;  3J80 b;  3C1C D;  5CP6 D;  2YFV A;  5CHL B;  1TAF A;  2HF1 A;  3GCF A;  5B40 C;  3AFA D;  1HQ3 B;  2KI7 B;  3AZL C;  3F3P C;  3A6N A;  4Z5T A;  1QVF Z;  3GTM S;  1KX5 A;  5IT9 b;  2NVX I;  3UTB D;  1SIW A;  3MNN B;  5B31 C;  3AN2 A;  3IF8 A;  1NJI 1;  2Y2H A;  3REH C;  2RVQ D;  4E45 A;  3O62 B;  3AZM C;  5CPJ D;  2CV5 C;  1P3A D;  3D6W A;  1YIT Z;  1YI2 1;  1M1K 1;  1K83 I;  2FJ7 A;  2DQN C;  1WZN A;  2I3C A;  2QLV B;  4J8W B;  3MGP A;  2QRE B;  3NDJ A;  4S1T A;  3R45 A;  3U50 C;  2NVQ I;  4CAY A;  4LD9 A;  3B0D B;  4XUJ A;  3X1V D;  2EGT A;  1TWC I;  3CCV Z;  3MNN C;  4ZUX A;  3AYW D;  2QRD B;  3O62 C;  1NUI A;  5AVB B;  3WKJ D;  4E30 A;  2ZY5 A;  5B1L A;  4QLC D;  5DNM B;  1P3B B;  3KUY B;  3EPH A;  4BY1 I;  3M3Y I;  5CPI D;  3AZJ B;  1JJ2 Y;  3WTP A;  4J8W C;  1Q7Y 2;  2R93 I;  3FQQ A;  5GT3 A;  5B2J A;  1AOI A;  1EQZ A;  4E2W A;  2L5A A;  1YIJ 1;  4CSR B;  3EPJ A;  4NE6 A;  3AZK A;  3REI B;  1P34 B;  4UUZ A;  3NFZ A;  1Q86 1;  3GTK I;  3S14 I;  2YFV B;  5AVB C;  5BS7 C;  1TAF B;  2F8N G;  4J8U D;  3X1U A;  5IT9 f;  1P3B C;  5GT0 C;  3KUY C;  3FKI I;  3CME 1;  3AZJ C;  2W8S A;  4Z5T B;  3A6N B;  1I3Q I;  2FFF B;  5AY8 A;  3I4M I;  2IO5 B;  4DRA A;  3AN2 B;  2F8N B;  1Q16 A;  2QA4 Z;  4RVH A;  2Y2Q A;  3W97 D;  4XZQ B;  1M18 A;  1M90 2;  3MVD B;  2DF4 C;  1P34 C;  1ID3 A;  3C1B D;  1P3I A;  5C44 I;  1KC8 1;  1Z2C B;  5B40 D;  2HUE C;  4WV4 B;  5B0Y A;  3CCL Z;  1P3O A;  4G91 B;  5D1P A;  3MGP B;  2QRC B;  3R45 B;  4BBR I;  5AV8 A;  2P28 A;  3A6N C;  4Z5T C;  4LD9 B;  4XUJ B;  1VQN Z;  1JFI A;  5B31 D;  3VH5 T;  2IO5 C;  3PO2 I;  3LZ1 A;  4H9R A;  3AN2 C;  3KIH A;  4JJN A;  1RNI A;  3REH D;  3AZM D;  4ZUX B;  1QYP A;  4YM6 D;  4XZQ C;  2RPR A;  3VTN A;  1YIT 1;  1B67 A;  3MVD C;  2JCH A;  2HIO B;  5B1L B;  3HOU I; 
#chains in the Genus database with same CATH homology
 2FJ7 C;  1HQ3 D;  4WU9 A;  4MRI A;  5T67 A;  3W98 A;  4G91 C;  4X23 A;  3MGP C;  3MGR B;  2NZD A;  5GT3 B;  5B2J B;  1EQZ B;  2Y0S A;  3CCV 1;  4LD9 C;  2CWE A;  4XUJ C;  3MNN D;  2RBL A;  3AZK B;  1Q81 2;  4ZUX C;  2RT9 A;  4WU8 A;  3CD6 1;  2F2A C;  1USP A;  2OOY B;  5IP9 I;  1N8R 1;  2HIO C;  3NQJ A;  1JJ2 Z;  5B1L C;  3WTP E;  1P3F A;  3X1S A;  4J8W D;  1K73 2;  4NB9 A;  3MGR C;  5FLX f;  5GT3 C;  4H9S C;  5B2J C;  5AY8 B;  1M1A A;  1EQZ C;  2PYO A;  2K3R A;  3EED A;  4E33 A;  3JAM f;  3CCS Z;  3LZ0 B;  3MGQ A;  4YS3 A;  3B6G D;  1M18 B;  1RO0 A;  3AZK C;  2F4M A;  2R92 I;  1WWI A;  5AVB D;  3AZF A;  1P3I B;  1ID3 B;  3Q87 A;  2OTL Z;  1B6W A;  4A3E I;  3CC4 Z;  3B0B A;  5DNM D;  1P3B D;  2JA7 I;  1ZH1 A;  1P3O B;  3AZJ D;  5T64 A;  3PO3 S;  3LEL A;  2ZAE B;  5AV8 B;  1VQP Z;  2QA4 1;  3CCR 1;  5AY8 C;  4XX2 A;  1JFI B;  4M6B A;  1S72 Z;  2VF1 A;  4R8P D;  3LZ1 B;  3GTG I;  1QVF Y;  3GTM I;  3LZ0 C;  4JJN B;  3REI D;  1P34 D;  3EPL A;  1KRL A;  1M18 C;  3G6E Z;  3X1T D;  1U35 B;  1ID3 C;  1P3I C;  3CCL 1;  4RVF A;  3VB9 A;  3RZD I;  5B0Y C;  4WU9 B;  1P3O C;  4NH1 C;  3W98 B;  1VQO 1;  5GSU A;  4X23 B;  1X3W A;  2GU2 A;  2NZD B;  5C3E I;  1VQN 1;  5AV8 C;  1ZB8 A;  2F8N D;  2ZY4 A;  1P3P A;  3UT9 A;  3LZ1 C;  1U35 A;  4XZQ D;  4JJN C;  1P3G A;  3MVD D;  1YUK A;  4WU8 B;  1USP B;  5C3I B;  1U35 C;  3NQJ B;  3CQZ I;  3AV1 D;  3VMI A;  1R4V A;  3VH6 A;  1P3F B;  1W2B Z;  4Y52 I;  4WU9 C;  1P3K D;  3W98 C;  5IP7 I;  4X23 C;  1PZR A;  2NQB A;  1M1A B;  2PYO B;  4LD9 D;  2NZD C;  2IZ3 A;  2NVY I;  4A3C I;  1Y1V S;  4MD7 A;  3MGQ B;  4YS3 B;  4E31 A;  1HTA A;  4ZUX D;  2LY8 A;  4WU8 C;  2HIO D;  3AZF B;  2F4O A;  5B1L D;  3TE5 B;  5C3I C;  3H3V J;  3NQU A;  3TDH B;  5BO0 A;  3TU4 D;  1TZY A;  1P3F C;  2DE5 A;  3MGR D;  3CCS 1;  3I4N I;  5B2J D;  2K5R A;  1NJI 2;  1RLY A;  2Q51 A;  3FQM A;  5E5A B;  2ARO B;  1M1A C;  2PYO C;  1I6H I;  3HOW I;  1YHQ Z;  4A3I I;  1M1K 2;  3MGQ C;  5AV9 A;  4YS3 C;  3LUS A;  3CC2 Z;  2CV5 B;  2OTJ Z;  3CC4 1;  2OTL 1;  2VQR A;  5T6B A;  3AZF C;  2Y2G A;  3MGS B;  1YUA A;  4AYB A;  1VQP 1;  5GSU B;  1S72 1;  5C4J I;  2BYM B;  2ZY2 A;  2ARO C;  5E5A C;  3LZ0 D;  1P3P B;  2JE5 A;  4H9O A;  3UT9 B;  3G6E 1;  1P3G B;  1M18 D;  4DRB A;  1N1J A;  2Y2P A;  5B0Z A;  1ID3 D;  3H0M C;  3AZN A;  2RHB A;  5KDM A;  3MGS C;  3AZE A;  1P3O D;  2BJO A;  4KUD A;  3OW2 Y;  1P3L A;  1L1O C;  3EG5 B;  5GSU C;  2YU9 I;  2NQB B;  2LFU A;  1Q86 2;  4KGC D;  3IX0 A;  4NBH A;  4JJN D;  1VQ4 Z;  1P3P C;  3UT9 C;  3S15 I;  1P3G C;  4Y7N I;  1VQ9 Z;  4Z66 B;  3BG1 B;  1K8A 1;  3NQU B;  1VLA A;  1BFM A;  5GT0 B;  5BO0 B;  4WU9 D;  3EPK A;  1TZY B;  5CPK A;  3W98 D;  3WAA A;  4X23 D;  4E2Y A;  2V8K A;  3KWQ B;  2NQB C;  5A2Q b;  3J80 f;  2H85 A;  3G71 Z;  5DNN A;  5B32 A;  1KC8 2;  3REL A;  2Y2I A;  2J6A A;  3UTA B;  4WU8 D;  3S1R I;  3NH8 A;  4Z66 C;  2HUE B;  3LJA A;  5B24 A;  4CL1 A;  1P3F D;  1VQO Z;  1S32 A;  3WA9 D;  1TZY C;  1ZLA A;  5AV6 A;  3KIF A;  1M1A D;  3W96 D;  4H9N A;  1KX5 B;  1YHQ 1;  3KWQ C;  3CC2 1;  1M19 A;  3MGQ D;  3AZI D;  2OTJ 1;  1Z02 A;  3VH5 W;  3UTA C;  2NVT I;  2Y2N A;  1TFI A;  5LL6 f;  1KX3 A;  4DQY B;  5B2I A;  3AZN B;  2FJ7 B;  1KQS Y;  3AZL D;  3HKZ A;  1P3L B;  2G2K A;  4CAY B;  4BBS I;  1P3M A;  4H9P A;  2ARO D;  5BNX A;  5E5A D;  1KX5 C;  1ZB9 A;  2JNY A;  5CM2 M;  3CCU 1;  2QEX Z;  1N8R 2;  4A3D I;  3C1C A;  5CP6 A;  2CV5 D;  5AV5 A;  3NH4 A;  3OW2 Z;  3MGS D;  3AZH A;  1YJW Z;  3S1Q I;  3AZN C;  4NBA A;  5A2Q f;  1X0T A;  3WTP B;  4KUD C;  1Z01 A;  1P3L C;  1AOI B;  2PM9 A;  3S16 I;  1W2B Y;  3W99 A;  1R9T I;  4E32 A;  2G5I C;  1VQ4 1;  2M48 A;  5DNN B;  5B32 B;  3UT9 D;  1I50 I;  1K9M 1;  3CPW Y;  3REL B;  1VQ9 1;  4KHA A;  1P3G D;  3O62 D;  1Y1V I;  3IFU A;  4HGZ A;  2VUM I;  4UUZ B;  4RVD A;  4E2Z A;  4A3B I;  3LJA B;  5B24 B;  4HGA B;  3X1U B;  2AKL A;  2GTI A;  1S32 B;  3X1V A;  5AV6 B;  3G71 1;  3WTP C;  3GTP I;  2NQB D;  1AOI C;  4H9N B;  2PK7 A;  3AYW A;  1M19 B;  5DNN C;  5B32 C;  3REL C;  3WKJ A;  1DL6 A;  3VH6 T;  4Z66 D;  4RVG A;  4QLC A;  2GTH A;  1KX3 B;  5CPI A;  5B2I B;  1TWH I;  3VMH A;  5GT0 D;  3KUY D;  5B0Y B;  3LJA C;  5B24 C;  1TZY D;  4HGA C;  3X1U C;  4NBF A;  1S32 C;  1KD1 1;  5AV6 C;  2E2H I;  3KWQ D;  1P3M B;  5BNX B;  4WNN A;  4H9R B;  5JA4 A;  1M19 C;  1X3Z A;  1YJ9 Z;  3C1C B;  5CP6 B;  3UTA D;  1JWH C;  1KQS Z;  2Q4Z A;  5AV5 B;  3HOY I;  2E2J I;  3AZH B;  5GXQ A;  1KX3 C;  5B2I C;  2Y2L A;  2OOX B;  2WB1 A;  5C4X I;  3A6N D;  4Z5T D;  2VUG A;  1KX5 D;  3W99 B;  4HH4 A;  2QEX 1;  1P3M C;  3W97 A;  3AN2 D;  1W2E A;  2JA8 I;  3C1B A;  2UWX A;  3C1C C;  5CP6 C;  3CD6 Z;  1VQM Z;  1YJW 1;  2Y2J A;  5AV5 C;  2FJ7 D;  2R6M A;  1YJN Z;  3AZH C;  1VQ8 1;  1RQF A;  3F3F C;  3X1S B;  3MGP D;  1P3L D;  3X1V B;  3J81 b;  5B31 A;  5FUG A;  2JR6 A;  3GKQ A;  4H9Q A;  4XUJ D;  3CPW Z;  3W99 C;  4QTT A;  3AYW B;  5BNV A;  4YM6 A;  2V8I A;  2RVQ C;  4NOZ A;  4A3J I;  3HOX I;  1HQ3 A;  3AV2 A;  3S1M I;  4BXX I;  3G4S Z;  2DE6 A;  2IZ4 A;  3F6T A;  3WTP D;  3X1S C;  3NDI A;  3LEL B;  5GT3 D;  3A1K A;  3X1V C;  1AOI D;  1EQZ D;  1ML8 A;  1Q82 1;  5DNN D;  1F66 A;  4RS4 A;  3AYW C;  5JA4 B;  3CCE Z;  3REL D;  3AZK D;  3CCJ Z;  2XD1 A;  3V9R A;  4A93 I;  5GXQ B;  5B24 D;  3X1U D;  4Z2M H;  3KFU G;  1VQ7 Z;  2V8J A;  5AV6 D;  4NBD A;  3B6F A;  3LEL C;  5AY8 D;  3B6G A;  1YJ9 1;  2PMZ A;  5B33 A;  1K8A 2;  5BS7 A;  2BG1 A;  1VQK Z;  2Y2O A;  5DNM A;  1P3I D;  1P3B A;  2JMO A;  2B63 I;  1KX3 D;  3J81 f;  1KX4 A;  5GXQ C;  5B0Y D;  4J8V A;  2R7Z I;  5AV8 D;  1LQL A;  5FUG B;  1BH9 A;  4R8P A;  4H9Q B;  1P3M D;  2YAD A;  1S7M A;  3REI A;  3LZ1 D;  5BNV B;  4YM6 B;  3REJ A;  1TWA I;  4NBG A;  3I56 Z;  1VQM 1;  3X1T A;  4DK1 A;  1Y1W I;  2JSS A;  1VQ5 Z;  3C1B C;  2YFW A;  1YJN 1;  5AV5 D;  1U35 D;  3BG0 B;  3AZH D;  3AV2 B;  5AVC A;  5G49 A;  4A3L I;  5D1O A;  3MZL B;  1KU5 A;  3P5J B;  3HOV I;  3GTQ I;  2NZD D;  2F8N A;  3W99 D;  4XZQ A;  1F66 B;  3MVD A;  4MD8 A;  3KXB A;  4YM6 C;  4NBE A;  5AV9 B;  3ESW A;  3V9R B;  3H0G I;  2JA6 I;  2G5H C;  3AV1 A;  4MH4 A;  3REK A;  1HQ3 C;  1P3K A;  3AV2 C;  3G4S 1;  3S17 I;  3CC7 1;  3X1S D;  3B6F B;  3EER A;  3I55 Z;  2PYO D;  3PO3 I;  3CCE 1;  2ZY3 A;  3AZG A;  3B6G B;  3CCJ 1;  4YS3 D;  1F66 C;  4H9O B;  5B33 B;  4DGL A;  2HIO A;  5AV9 C;  2QKD A;  2WAQ A;  1N1J B;  5B0Z B;  3AZF D;  3MON A;  1VQ7 1;  3TU4 A;  5BT1 C;  1KX4 B;  3H0L C;  5KDM B;  3MGR A;  3AZE B;  2F8N H;  2JUB A;  4H9S A;  4J8V B;  3NH5 A;  4KUD B;  3CXC Y;  2QR1 B;  3B0D C;  3LEL D;  1K9M 2;  1BH9 B;  5F99 A;  4R8P B;  5JRG A;  3B6F C;  4G92 B;  4NB8 A;  5B1M A;  3J7A 4;  4J8X A;  3CCM Z;  3REJ B;  3B6G C;  4EWC A;  2W03 A;  1VQK 1;  5B33 C;  3X1T B;  2JA5 I;  4TNU A;  2YFW B;  2DE7 A;  5B0Z C;  5DNM C;  4E44 A;  3AFA A;  5GXQ D;  5AVC B;  5G49 B;  5B32 G;  1KX4 C;  4NFT A;  3AZE C;  5CPK B;  5D1O B;  3WAA B;  4J8V C;  5GSU D;  2M6N A;  3UTB A;  1VQ8 Z;  1Q9C A;  1Q7Y 1;  3LZ0 A;  1BH8 A;  4R8P C;  4G92 C;  5FLX b;  3IP4 C;  3I56 1;  1VQ5 1;  1P3A A;  3REI C;  3KXB B;  3REJ C;  5CPJ A;  1P3P D;  1NP6 A;  3JAM b;  4BY7 I;  3X1T C;  3AV1 B;  1KD1 2;  3REK B;  1P3K B;  4MON A;  3VH6 W;  5AVC C;  2O4H A;  5CPK C;  4NBB A;  1ZLA B;  3WAA C;  3CMA Z;  4NFR A;  1QVG Y;  4KGC A;  3AZG B;  1WII A;  3KXB C;  4A3F I;  2Y2K A;  2OZK A;  3S2D I;  1M90 1;  3AV1 C;  3TU4 B;  3AV2 D;  4A3M I;  1A7W A;  3REK C;  1P3K C;  3QWU A;  4NE5 A;  2W04 A;  4RV9 A;  3I55 1;  1ZLA C;  3KSY A;  5F99 B;  1WCM I;  5JRG B;  4H9P B;  5B1M B;  4J8X B;  1F66 D;  1TWG I;  3AZG C;  1TWF I;  1VQ6 Z;  5AV9 D;  3FDD A;  5FLM I;  2BYK A;  1N2F A;  4J8U A;  1H3O A;  2LIY A;  5BT1 D;  3CXC Z;  3AFA B;  4WZS B;  1RO4 A;  3TU4 C;  3WA9 A;  3CCQ Z;  1RO2 A;  1VQL Z;  2RIQ A;  3W96 A;  3UTB B;  3B6F D;  2ZM5 A;  3CCM 1;  1P9N A;  1BH8 B;  5F99 C;  3AZI A;  5JRG C;  3AL0 C;  3HOZ I;  5AN9 F;  5B1M C;  4J8X C;  1P3A B;  5B33 D;  3S1N I;  1WWS A;  3VH5 A;  5CPJ B;  4KHA B;  4ZBJ B;  3CCR Z;  3S2H I;  5B40 A;  2KPI A;  5B0Z D;  3A1I A;  4HGY A;  1Q81 1;  2HU9 A;  3AZL A;  4WJ3 C;  1WW9 A;  2E2I I;  3AZN D;  3AFA C;  1KX4 D;  3AZE D;  1Q82 2;  3GTL I;  2J8P A;  4J8V D;  4KUD D;  5E5A A;  2ARO A;  3UTB C;  4KGC B;  4EO5 B;  4NBC A;  1K73 1;  4QTU A;  3GTO I;  3REH A;  3AZM A;  3REJ D;  2CV5 A;  1P3A C;  5CPJ C;  2JS4 A;  3WKJ B;  4ZBJ C;  1YI2 Z;  1T3U A;  3MGS A;  4AWL B;  4QLC B;  4NE3 A;  5CPI B;  5AVC D;  1QVG Z;  1ULY A;  5CPK D;  3CMA 1;  3WAA D;  2BYM A;  4MD9 A;  3CC7 Z;  3H0R C;  3MNN A;  2E9H A;  4KGC C;  4EO5 C;  1PFT A;  2XD5 A;  1SFO I;  4WNN B;  5B32 D;  3O62 A;  3I07 A;  3KXB D;  1Z03 A;  3WKJ C;  4X6A I;  3MZK B;  2BYK B;  4MXU A;  4J8U B;  1H3O B;  4AWL C;  4QLC C;  4A3G I;  4J8W A;  3REK D;  3LJA D;  5CPI C;  3WA9 B;  1S32 D;  1ZLA D;  3W96 B;  1F1E A;  3GTJ I;  3AZI B;  4A3K I;  1VQ6 1;  3RZO I;  3W97 B;  3AZG D;  1M19 D;  1YIJ Z;  2P3Y A;  3M4O I;  3B0C W;  2O53 A;  4Z66 A;  5AVB A;  3C1B B;  3CCQ 1;  5B31 G;  5B40 B;  1QF8 A;  4Z2M G;  1VQL 1;  4UPK A;  5GT0 A;  2Y2M A;  3KUY A;  4J8U C;  3AZL B;  5B2I D;  3AZJ A;  3WA9 C;  4E2X A;  3CME Z;  3KWQ A;  3T4N B;  3W96 C;  5B31 B;  3B0C T;  5F99 D;  4CSR A;  5JRG D;  3D9X A;  5B1M D;  3AZI C;  4J8X D;  3REH B;  3AZM B;  3UTA A;  1P34 A;  2F8N K;  3W97 C;  3K7A I;  3VMG A;  3J80 b;  3C1C D;  5CP6 D;  2YFV A;  5CHL B;  1TAF A;  2HF1 A;  3GCF A;  5B40 C;  3AFA D;  1HQ3 B;  2KI7 B;  3AZL C;  3F3P C;  3A6N A;  4Z5T A;  1QVF Z;  3GTM S;  1KX5 A;  5IT9 b;  2NVX I;  3UTB D;  3MNN B;  5B31 C;  3AN2 A;  3IF8 A;  1NJI 1;  2Y2H A;  3REH C;  2RVQ D;  4E45 A;  3O62 B;  3AZM C;  5CPJ D;  2CV5 C;  1P3A D;  3D6W A;  1YIT Z;  1YI2 1;  1M1K 1;  1K83 I;  2FJ7 A;  2DQN C;  2I3C A;  2QLV B;  2QRE B;  4J8W B;  3MGP A;  3NDJ A;  4S1T A;  3U50 C;  3R45 A;  3CCU Z;  2NVQ I;  4CAY A;  4LD9 A;  3B0D B;  4XUJ A;  3X1V D;  2EGT A;  1TWC I;  3CCV Z;  3MNN C;  4ZUX A;  3AYW D;  2QRD B;  3O62 C;  1NUI A;  5AVB B;  3WKJ D;  4E30 A;  2ZY5 A;  5B1L A;  4QLC D;  5DNM B;  1P3B B;  3KUY B;  3EPH A;  4BY1 I;  3M3Y I;  5CPI D;  3AZJ B;  1JJ2 Y;  3WTP A;  4J8W C;  1Q7Y 2;  2R93 I;  3FQQ A;  5GT3 A;  5B2J A;  1AOI A;  1EQZ A;  4E2W A;  2L5A A;  1YIJ 1;  4CSR B;  3EPJ A;  4NE6 A;  3AZK A;  3REI B;  1P34 B;  4UUZ A;  3NFZ A;  1Q86 1;  3GTK I;  3S14 I;  2YFV B;  5AVB C;  5BS7 C;  1TAF B;  2F8N G;  4J8U D;  3X1U A;  5IT9 f;  1P3B C;  5GT0 C;  3KUY C;  3FKI I;  3CME 1;  3AZJ C;  2W8S A;  4Z5T B;  3A6N B;  1I3Q I;  2FFF B;  5AY8 A;  3I4M I;  2IO5 B;  4DRA A;  3AN2 B;  2F8N B;  2QA4 Z;  4RVH A;  2Y2Q A;  3W97 D;  4XZQ B;  1M18 A;  1M90 2;  3MVD B;  2DF4 C;  1P34 C;  1ID3 A;  3C1B D;  1P3I A;  5C44 I;  1KC8 1;  1Z2C B;  5B40 D;  2HUE C;  4WV4 B;  5B0Y A;  3CCL Z;  1P3O A;  4G91 B;  5D1P A;  3MGP B;  2QRC B;  3R45 B;  4BBR I;  5AV8 A;  2P28 A;  3A6N C;  4Z5T C;  4LD9 B;  4XUJ B;  1VQN Z;  1JFI A;  5B31 D;  3VH5 T;  2IO5 C;  3PO2 I;  3LZ1 A;  4H9R A;  3AN2 C;  3KIH A;  4JJN A;  1RNI A;  3REH D;  3AZM D;  4ZUX B;  1QYP A;  4YM6 D;  4XZQ C;  2RPR A;  3VTN A;  1YIT 1;  1B67 A;  3MVD C;  2JCH A;  2HIO B;  5B1L B;  3HOU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...