2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 1
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
1NP6A 1VQLZ 3W96B 2R7ZI 1B6WA 4S1TA 2ZY3A 1KC82 5CP6D 1P34C 3C1BC 3JAMf 3J81b 1VQ9Z 2NQBA 1ULYA 1KX5B 4WU9B 2E7ZA 1NJI1 3KWQA 4HGAC 3WKJB 5B0ZA 4QLCD 2V8IA 1YJ9Z 5B24D 3B0DB 4RVHA 4XX2A 5B40A 1S721 4Y52I 4J8VA 5BNVA 1P3PA 4NBAA 5B32G 3H0RC 5AV8A 3A6ND 3B6GB 1ID3D 1HQ3D 5FUGB 3S1MI 4WZSB 3REJB 3X1UB 3REKC 2AYDA 5AV6D 3REJD 3AZJA 1SFOI 5GXQA 1WW9A 3UTAC 3CCUZ 2JIOA 3FQMA 4CAYA 3MGQC 3KXBC 3AZFA 5CPIA 2O53A 5A2Qf 1ML8A 1YJN1 3AZMB 2F8NB 4A3MI 3O62B 4KGCB 3W96A 1Y1WI 1KX4C 1Q861 2W04A 1ZB9A 1P34D 5T64A 1QF8A 3WTPE 5BNXB 4KHAA 3LZ1D 4WU8C 5E5AB 5B2ID 1TAFB 1KX3A 1EQZA 1RQFA 3U50C 4H9NA 4WU9A 1RO0A 1W2BY 1QVFY 2JNYA 2LIYA 3WKJC 4NBHA 3JAMb 3I07A 3KIFA 3LZ0B 5JRGB 3LJAC 2BYKA 4R8PD 1P3OB 3PO3S 5B40B 3LELC 3AN2C 1P3AB 1PFTA 2V45A 3D9XA 4RVGA 2QA41 1I3QI 4QTUA 2JA8I 5AV9D 3RELD 5AVCD 4MONA 1X3WA 2NVYI 5FLMI 4HGZA 1KD11 1N1JB 3AFAC 3AZIC 3F3PC 3CC4Z 3WAAA 2JA6I 4BXXI 3W97C 1TWAI 4H9SA 4NBDA 1KX5C 2XD1A 2Y2LA 3VH5W 5DNMD 5DNNB 5F99D 3MGRD 4J8UA 4KUDA 5DNND 5B0YD 2JS4A 5B31C 3I56Z 4Z66D 5IT9b 5B1MD 5AV5C 1P3KA 3CMA1 4WU8B 4XUJD 1F66C 4H9NB 2RBLA 2OTJ1 3MNND 2Y2JA 2LY8A 5B31G 3AZHA 2O4HA 4RV9A 3AZGA 3F3FC 3UTAB 2BYKB 2Y2QA 3REIA 3CCV1 2F8NA 3BG1B 5BS7C 1P3FD 3R45B 5AV9C 4H9QB 3LZ0D 5D1OA 2YFVB 2YFWB 1TZYC 5BT1D 1P3GA 4LD9D 4YS3D 2UWXA 1ZB8A 1FDIA 5JA4A 3LJAD 5FUGA 3CXCY 3X1UA 3AZJB 2VUGA 2R93I 5B1LD 1VQ71 3AV1B 2JA7I 1M18D 1YIJZ 4E31A 3RZOI 3AZMA 5CPJA 4LD9C 3O62A 2JR6A 2P3YA 2JA5I 3S17I 4BBSI 5B1LA 1P3BA 5KDMB 1F66B 1VQ61 2W8SA 2KPIA 4Z5TB 5AV6B 1KX3B 3H0MC 4X23C 1EQZB 5C44I 5B32D 4HGYA 3B0BA 1VQL1 5GSUD 4YS3A 1P3MB 3Q87A 3KUYA 4E2YA 4A3JI 2E2HI 4NBCA 4J8XA 4Z2MG 3AV2D 3AZEA 4HH4A 1P3ID 3CPWY 3LZ0A 2M48A 2FJ7C 3CCQ1 3X1TA 3MVDB 3R45A 2HIOC 1P3OA 1VQN1 3REID 3AZLD 1P3AA 4EO5C 4DK1A 3TU4C 1KRLA 3I4MI 3GTMI 2DF4C 4A93I 5JA4B 5B24C 5F99C 3MGRC 3NH8A 3CMEZ 5CP6B 1N1JA 3IF8A 3J81f 3CC2Z 2K3RA 1P3LB 4NFTA 1X3ZA 2V8JA 4CSRB 3M4OI 3AV1A 1DL6A 2ZM5A 1P3AD 2FFFB 5AVBB 4Z66A 3MGPA 1P3OD 5CPJB 5DNNA 3A1IA 3X1TD 3S1RI 2NZDC 5B2JA 1P3IA 5B33B 4J8XD 5AV9B 3B0CT 3KUYD 3W99B 2B63I 3G4S1 1YJW1 1TFIA 3AZLC 2K5RA 3HOYI 1I50I 3WKJD 1A7WA 3UTBB 4Y7NI 1AOIA 4H9PA 2JCHA 3AZKC 3AV2C 3MGSA 2RPRA 1VQPZ 3VMHA 3MVDA 5B1MB 3S1QI 3AZMD 5GSUC 1NUIA 3LZ1C 5B32C 3HOXI 4H9QA 3GTKI 3X1SB 2HF1A 3EPJA 2VQRA 1S32A 2CV5A 3OW2Y 1WZNA 1TZYB 4DQYB 1YITZ 4JJNB 3X1UD 4AWLB 4A3EI 4ZUXB 1RNIA 2ZY5A 3I4NI 5C3EI 3UTAD 3NFZA 3CCMZ 1VQNZ 2E9HA 1VQ91 3CCSZ 5AVBA 3MGPB 1VQO1 3REKD 2OTLZ 1HQ3C 2R92I 4R8PB 3AZFD 5CPID 3AZHD 4MRIA 1BH9A 3HOWI 3MNNA 4KGCC 5GXQD 1T3UA 3TU4B 5AV6A 3AZJD 2Q51A 3MZLB 2PM9A 2HUEC 2P28A 1F1EA 3CCM1 4QLCB 3G711 4XUJA 1P3MC 5AV8D 3AZKB 5B1MA 3UT9D 3AZEB 5B40D 3C1BD 5GT0C 5CPKA 3D2LA 3X1TB 1K731 3J80f 5FLXb 3X1SC 1M901 2JSSA 2RVQD 4Z5TD 5AVCB 5B0ZB 1F66D 4NOZA 1YHQ1 3GTPI 2AROC 4JJNA 5B33C 2NQBD 4ZUXA 4E2XA 3REHC 1ZLAC 3KFUG 5BNVB 2HIOD 5CP6A 4EWCA 1ID3B 3RELA 2YU9I 3WTPB 2F8NG 1P3LC 1YJWZ 1U35C 1Z02A 4R8PA 3NH5A 5E5AD 3CCE1 2I3CA 1YUAA 4YM6A 3X1VA 2J6AA 2OOXB 5BO0B 3AYWD 1M1AB 2L5AA 3VH5T 1KX4B 1ZH1A 5B2IA 1QVGY 2JE5A 1L1OC 1M18C 1N2FA 2CWEA 2PYOD 2VF1A 3VTNA 1P34A 4KHAB 4J8WA 1ZLAD 4E44A 2IZ3A 2NQBC 3W96D 3S16I 3KWQC 2F8NK 5B0ZC 4G92C 1KQSZ 1VQ41 1Y8CA 3TDHB 1YIT1 3NQUA 5AV5B 5B40C 2PK7A 2JUBA 3TE5B 2KI7B 4M6BA 1P3FC 1ID3A 4RVDA 5AV8C 5C4JI 5GT3B 2QA4Z 3UTBD 1M19D 3B6FB 1KQSY 5IT9f 2GTIA 3A1KA 3MGQD 3GTGI 3FQQA 3AZJC 4NB8A 3GTOI 4E2ZA 1JFIA 4A3KI 5AY8D 3A6NB 1QYPA 4ZBJB 5CPIC 3MGQA 3VMIA 5B0ZD 5AN9F 1M19A 2EGTA 3KWQD 4J8UB 3I551 3MNNB 3W96C 1KX4A 5B31B 5B2IB 5B31D 2XD5A 5B0YC 1S7MA 3IP4C 1P3KB 4QLCC 4WU8A 1Y1VI 5DNMC 1YJNZ 1KX5D 4WU9C 3W97D 1M1K2 3W98D 5CPKB 1YHQZ 2QEXZ 3AFAD 4UUZA 3AL0C 2JIPA 3AZHB 2VPWA 3AZGB 4WJ3C 4NE6A 5AVCC 3B0DC 2HU9A 4MXUA 3LELA 3AN2A 4NH1C 3NQJA 4EO5B 3AYWA 2QR1B 5GT3A 3EERA 2OTJZ 2YFWA 3X1VD 2PYOB 2JIMA 3CCQZ 2DE5A 3WTPC 3CC7Z 3AFAA 3AZIA 1TWGI 2Y2IA 1JFIB 3WAAC 2Y0SA 3W97A 1WCMI 1KX5A 3X1SD 4J8UC 2NZDB 1WJ2A 5B31A 1JJ2Y 5BO0A 4ZUXD 1M1AA 3EPHA 2Q4ZA 1Q812 5DNMB 2JIRA 1F66A 3AZNA 4Z5TA 3AZLB 2V8KA 3MZKB 3NDJA 1RO2A 3B6FC 2QREB 1K9M2 2ZAEB 3CXCZ 4KGCD 3REJC 3REKB 3CPWZ 2Y2HA 3UT9A 3J7A4 3AZHC 3S1NI 3AZGC 1TWFI 1WWIA 3REIC 3A6NC 3LELB 3AN2B 4CAYB 5CPIB 5BS7A 4NFRA 2FJ7D 4XZQC 3AYWB 1VQP1 3H3VJ 5AY8C 3GTJI 1P3GC 1VQ5Z 2WB1A 1KC81 1BH8B 4Z2MH 3AZIB 5FLXf 3UTBC 3X1UC 3W97B 2OOYB 2QRCB 3K7AI 1QVGZ 1NJI2 3C1BB 2G2KA 2RIQA 5AVBD 2IO5B 3VH6T 2RT9A 2G5IC 3CD61 4DRAA 4Z66B 3AZMC 3CMAZ 3O62C 3WA9C 3D6WA 1Q9CA 1VQ51 2CV5D 1S32D 3W99A 3CC21 4H9OA 4X23A 5E5AA 2PYOC 4DGLA 3RZDI 3QWUA 3C1CA 3MVDD 1TZYD 5BT1C 3B6GC 5C4XI 1AOIB 1LQLA 3CC41 2F4OA 4WV4B 3GKQA 1S72Z 4BY1I 1W2EA 5JRGA 4NBGA 2E2JI 2HIOA 2Y2GA 5GSUB 1P3AC 1TWHI 3KXBB 3NQJB 5IP9I 1Q862 4A3CI 3W98C 2DE6A 4E30A 3M3YI 4JJND 2VUMI 1P3LD 3S15I 5B2JD 2GU2A 3AFAB 2IV2X 3V9RB 5CPKD 4A3FI 3C1BA 1Z03A 1QVFZ 3MGPD 1VQ6Z 3TU4D 3AV1D 1K83I 5B33D 4Z66C 4AYBA 1U35B 4E2WA 3FKII 2NZDA 2BJOA 4E45A 2NVXI 1H3OB 2NAPA 1M902 3LJAB 3GTMS 3GTLI 1VQKZ 4J8VC 1P3PC 2YFVA 3OW2Z 4TNUA 1P3GB 3AZLA 1P3MD 2BYMA 1M18B 2HUEB 4QTTA 3REKA 2ZY2A 4XUJB 3UT9B 3AZKA 3AZED 3AV2A 3MGSC 1AOIC 5GXQC 2QEX1 3UTAA 2HIOB 3REIB 5GSUA 5GT0B 1Q16A 5B32A 3KXBA 3AZFC 3CCJZ 1Q822 4NBFA 1K8A2 2NVTI 2Y2NA 1VQK1 1S32C 4NE3A 2AKLA 3EEDA 5KDMA 1P3FB 3O62D 3T4NB 1KX3C 1USPB 5IP7I 1EQZC 2VPZA 4A3II 4UPKA 2H85A 1JWHC 3S2DI 3MGSD 4YS3B 1VLAA 1AOID 2DE7A 3VH6A 2M6NA 3B0CW 3WKJA 4G92B 3CQZI 1TWCI 3I561 2QLVB 1H3OA 2PMZA 3KXBD 3LJAA 1N8R1 2F8NH 1U35D 5B1LB 4J8VB 1P3PB 3X1VB 2JIQA 3G71Z 4MH4A 5AV8B 3AZKD 2LFUA 2BYMB 4X23B 1W2BZ 3MGRB 4A3BI 1P3MA 3C1CB 3REHD 5AV5D 3H0GI 3AZGD 5GXQB 3PO2I 4J8XB 4J8WB 5GT0A 4H9SC 4CSRA 5B32B 2RVQC 2NZDD 1Z01A 4KUDC 3GTQI 5GT0D 1WWSA 1P3IB 5B33A 4ZUXC 5AV5A 1P3KC 3REHA 5BNXA 5CP6C 4KUDD 4DRBA 2G5HC 3J80b 3V9RA 4J8UD 3CD6Z 2J8PA 3CCEZ 1P3LA 3CCLZ 1FDOA 3G4SZ 2F2AC 1U35A 3MGSB 4R8PC 3WAAD 1YI2Z 1R9TI 1M1K1 3LZ1B 2FJ7B 3GCFA 5JRGD 4YM6C 1X0TA 2VPYA 5AV9A 3I55Z 1N8R2 2E2II 1P3BD 2F4MA 1TZYA 5LL6f 2ZY4A 5CPJD 5B2IC 3S14I 1M18A 5B24B 4NBBA 1Q7Y2 2IZ4A 2LEXA 4X23D 3CME1 4J8WC 4H9PB 3H0LC 1KD12 2Y2OA 4G91B 2NVQI 2QRDB 5G49B 4WU9D 3CCR1 3HKZA 1HQ3B 3HOUI 4UUZB 1EQZD 4WNNB 5CPJC 1P3GD 4LD9A 2CV5B 4E33A 5B1LC 2BG1A 1P3BC 1P3FA 1ID3C 1USPA 1Q811 1R4VA 4MD8A 1Z2CB 1BFMA 4YS3C 3ESWA 1VQ8Z 3KUYC 3IX0A 1K9M1 4RS4A 4J8XC 3AZEC 3FDDA 4E32A 3LZ0C 3CCS1 2FJ7A 2DQNC 3CC71 3X1TC 3IR7A 3VMGA 1M19C 1P3OC 1YIJ1 5C3IC 1P3KD 5D1OB 1VQ7Z 3WA9B 3TU4A 3G6E1 5B0YA 1B67A 5B24A 1HTAA 4BBRI 5F99A 3HOVI 4QLCA 1ZLAB 3MGRA 5DNMA 4NB9A 3HOZI 3AZNB 1RO4A 3BG0B 1VQMZ 1Q7Y1 5G49A 2QKDA 2IO5C 3AV1C 1M1AD 3MGPC 4WNNA 5DNNC 4LD9B 5AVCA 5B2JC 3G6EZ 1P3IC 2Y2MA 1P3BB 1P9NA 4XZQB 3AYWC 3KIHA 3C1CD 3REHB 3VH5A 5GT3C 5T67A 1YI21 1JJ2Z 3NH4A 3AZID 3RELB 1I6HI 3WTPA 5A2Qb 1BH8A 3W99D 3KUYB 1YUKA 5T6BA 4A3DI 3VH6W 4ZBJC 4RVFA 1K732 3MVDC 3B6GD 3KWQB 3LZ1A 1KX3D 5C3IB 4YM6B 1VQOZ 2OTL1 3EPKA 2CV5C 1M1AC 2V3VA 2WAQA 4NBEA 2AROB 5CM2M 1VQ4Z 3WA9D 3AZNC 2YADA 4Z5TC 1P34B 3CCRZ 4H9OB 4WU8D 3B6FA 4X6AI 4G91C 1Y1VS 4H9RA 5CHLB 3REJA 3IFUA 5AVBC 3UT9C 5D1PA 2RHBA 1KX4D 1HQ3A 3F6TA 2GTHA 5B2JB 4MD9A 3A6NA 3NQUB 1PZRA 3EG5B 4XZQA 4J8VD 1P3PD 5AY8A 3MNNC 4KGCA 1SIWA 1WIIA 3W98B 5AV6C 4XZQD 3LUSA 3AZND 4MD7A 3UTBA 4XUJC 1TAFA 2JMOA 2OZKA 5B1MC 3CCL1 3S2HI 5CPKC 2NQBB 3MGQB 3KSYA 1M19B 3B6FD 4HGAB 3X1SA 3EPLA 1S32B 1AA6A 3CCJ1 3WA9A 3NDIA 1K8A1 2AROA 4JJNC 2F8ND 4AWLC 3CCU1 2Y2PA 5B0YB 1VQM1 1KU5A 5F99B 2Y2KA 3W99C 1ZLAA 4J8WD 3VB9A 3P5JB 5E5AC 2VPXA 3MONA 2PYOA 3RELC 4H9RB 5GT3D 1QXFA 3C1CC 3B6GA 3CCVZ 4A3GI 4BY7I 2W03A 3WAAB 4CL1A 3LELD 3AN2D 3AV2B 1RLYA 1Q821 4A3LI 4NE5A 1YJ91 5JRGC 4YM6D 3PO3I 3WTPD 5AY8B 1BH9B 3AZFB 3X1VC 4KUDB 3W98A 2R6MA 1VQ81 2AROD
chains in the Genus database with same CATH topology
1NP6A 1VQLZ 3W96B 2R7ZI 1B6WA 4S1TA 2ZY3A 1KC82 5CP6D 1P34C 3C1BC 3JAMf 3J81b 1VQ9Z 2NQBA 1ULYA 1KX5B 4WU9B 1NJI1 3KWQA 4HGAC 3WKJB 5B0ZA 4QLCD 2V8IA 1YJ9Z 5B24D 3B0DB 4RVHA 4XX2A 5B40A 1S721 4Y52I 4J8VA 5BNVA 1P3PA 4NBAA 5B32G 3H0RC 5AV8A 3A6ND 3B6GB 1ID3D 1HQ3D 5FUGB 3S1MI 4WZSB 3REJB 3X1UB 3REKC 1SFOI 5AV6D 3REJD 3AZJA 5GXQA 1WW9A 3UTAC 3CCUZ 3FQMA 4CAYA 3MGQC 3KXBC 3AZFA 5CPIA 2O53A 5A2Qf 1ML8A 1YJN1 3AZMB 2F8NB 4A3MI 3O62B 4KGCB 3W96A 1Y1WI 1KX4C 1Q861 2W04A 1ZB9A 1P34D 5T64A 1QF8A 3WTPE 5BNXB 4KHAA 3LZ1D 4WU8C 5E5AB 5B2ID 1TAFB 1KX3A 1EQZA 1RQFA 3U50C 4H9NA 4WU9A 1RO0A 1W2BY 1QVFY 2JNYA 2LIYA 3WKJC 4NBHA 3JAMb 3I07A 3KIFA 3LZ0B 5JRGB 3LJAC 2BYKA 4R8PD 1P3OB 3PO3S 5B40B 3LELC 3AN2C 1P3AB 1PFTA 3D9XA 4RVGA 2QA41 1I3QI 4QTUA 2JA8I 5AV9D 3RELD 5AVCD 4MONA 1X3WA 2NVYI 5FLMI 4HGZA 1KD11 1N1JB 3AFAC 3AZIC 3F3PC 3CC4Z 3WAAA 2JA6I 4BXXI 3W97C 1TWAI 4H9SA 4NBDA 1KX5C 2XD1A 2Y2LA 3VH5W 5DNMD 5DNNB 5F99D 3MGRD 4J8UA 4KUDA 5DNND 5B0YD 2JS4A 5B31C 3I56Z 4Z66D 5IT9b 5B1MD 5AV5C 1P3KA 3CMA1 4WU8B 4XUJD 1F66C 4H9NB 2RBLA 2OTJ1 3MNND 2Y2JA 2LY8A 5B31G 3AZHA 2O4HA 4RV9A 3AZGA 3F3FC 3UTAB 2BYKB 2Y2QA 3REIA 3CCV1 2F8NA 3BG1B 5BS7C 1P3FD 3R45B 5AV9C 4H9QB 3LZ0D 5D1OA 2YFVB 2YFWB 1TZYC 5BT1D 1P3GA 4LD9D 4YS3D 2UWXA 1ZB8A 5JA4A 3LJAD 5FUGA 3CXCY 3X1UA 3AZJB 2VUGA 2R93I 5B1LD 1VQ71 3AV1B 2JA7I 1M18D 1YIJZ 4E31A 3RZOI 3AZMA 5CPJA 4LD9C 3O62A 2JR6A 2P3YA 2JA5I 3S17I 4BBSI 5B1LA 1P3BA 5KDMB 1F66B 1VQ61 2W8SA 2KPIA 4Z5TB 5AV6B 1KX3B 3H0MC 4X23C 1EQZB 5C44I 5B32D 4HGYA 3B0BA 1VQL1 5GSUD 4YS3A 1P3MB 3Q87A 3KUYA 4E2YA 4A3JI 2E2HI 4NBCA 4J8XA 4Z2MG 3AV2D 3AZEA 4HH4A 1P3ID 3CPWY 3LZ0A 2M48A 2FJ7C 3CCQ1 3X1TA 3MVDB 3R45A 2HIOC 1P3OA 1VQN1 3REID 3AZLD 1P3AA 4EO5C 4DK1A 3TU4C 1KRLA 3I4MI 3GTMI 2DF4C 4A93I 5JA4B 5B24C 5F99C 3MGRC 3NH8A 3CMEZ 5CP6B 1N1JA 3IF8A 3J81f 3CC2Z 2K3RA 1P3LB 4NFTA 1X3ZA 2V8JA 4CSRB 3M4OI 3AV1A 1DL6A 2ZM5A 1P3AD 2FFFB 5AVBB 4Z66A 3MGPA 1P3OD 5CPJB 5DNNA 3A1IA 3X1TD 3S1RI 2NZDC 5B2JA 1P3IA 5B33B 4J8XD 5AV9B 3B0CT 3KUYD 3W99B 2B63I 3G4S1 1YJW1 1TFIA 3AZLC 2K5RA 3HOYI 1I50I 3WKJD 1A7WA 3UTBB 4Y7NI 1AOIA 4H9PA 2JCHA 3AZKC 3AV2C 3MGSA 2RPRA 1VQPZ 3VMHA 3MVDA 5B1MB 3S1QI 3AZMD 5GSUC 1NUIA 3LZ1C 5B32C 3HOXI 4H9QA 3GTKI 3X1SB 2HF1A 3EPJA 2VQRA 1S32A 2CV5A 3OW2Y 1TZYB 4DQYB 1YITZ 4JJNB 3X1UD 4AWLB 4A3EI 4ZUXB 1RNIA 2ZY5A 3I4NI 5C3EI 3UTAD 3NFZA 3CCMZ 1VQNZ 2E9HA 1VQ91 3CCSZ 5AVBA 3MGPB 1VQO1 3REKD 2OTLZ 1HQ3C 2R92I 4R8PB 3AZFD 5CPID 3AZHD 4MRIA 1BH9A 3HOWI 3MNNA 4KGCC 5GXQD 1T3UA 3TU4B 5AV6A 3AZJD 2Q51A 3MZLB 2PM9A 2HUEC 2P28A 1F1EA 3CCM1 4QLCB 3G711 4XUJA 1P3MC 5AV8D 3AZKB 5B1MA 3UT9D 3AZEB 5B40D 3C1BD 5GT0C 5CPKA 3X1TB 1K731 3J80f 5FLXb 3X1SC 1M901 2JSSA 2RVQD 4Z5TD 5AVCB 5B0ZB 1F66D 4NOZA 1YHQ1 3GTPI 2AROC 4JJNA 5B33C 2NQBD 4ZUXA 4E2XA 3REHC 1ZLAC 3KFUG 5BNVB 2HIOD 5CP6A 4EWCA 1ID3B 3RELA 2YU9I 3WTPB 2F8NG 1P3LC 1YJWZ 1U35C 1Z02A 4R8PA 3NH5A 5E5AD 3CCE1 2I3CA 1YUAA 4YM6A 3X1VA 2J6AA 2OOXB 5BO0B 3AYWD 1M1AB 2L5AA 3VH5T 1KX4B 1ZH1A 5B2IA 1QVGY 2JE5A 1L1OC 1M18C 1N2FA 2CWEA 2PYOD 2VF1A 3VTNA 1P34A 4KHAB 4J8WA 1ZLAD 4E44A 2IZ3A 2NQBC 3W96D 3S16I 3KWQC 2F8NK 5B0ZC 4G92C 1KQSZ 1VQ41 1YIT1 3TDHB 3NQUA 5AV5B 5B40C 2PK7A 2JUBA 3TE5B 2KI7B 4M6BA 1P3FC 1ID3A 4RVDA 5AV8C 5C4JI 5GT3B 2QA4Z 3UTBD 1M19D 3B6FB 1KQSY 5IT9f 2GTIA 3A1KA 3MGQD 3GTGI 3FQQA 3AZJC 4NB8A 3GTOI 4E2ZA 1JFIA 4A3KI 5AY8D 3A6NB 1QYPA 4ZBJB 5CPIC 3MGQA 3VMIA 5B0ZD 5AN9F 1M19A 2EGTA 3KWQD 4J8UB 3I551 3MNNB 3W96C 1KX4A 5B31B 5B2IB 5B31D 2XD5A 5B0YC 1S7MA 3IP4C 1P3KB 4QLCC 4WU8A 1Y1VI 5DNMC 1YJNZ 1KX5D 4WU9C 3W97D 1M1K2 3W98D 5CPKB 1YHQZ 2QEXZ 3AFAD 4UUZA 3AL0C 3AZHB 3AZGB 4WJ3C 4NE6A 5AVCC 3B0DC 2HU9A 4MXUA 3LELA 3AN2A 4NH1C 3NQJA 4EO5B 3AYWA 2QR1B 5GT3A 3EERA 2OTJZ 2YFWA 3X1VD 2PYOB 3CCQZ 2DE5A 3WTPC 3CC7Z 3AFAA 3AZIA 1TWGI 2Y2IA 1JFIB 3WAAC 2Y0SA 3W97A 1WCMI 1KX5A 3X1SD 4J8UC 2NZDB 5B31A 1JJ2Y 5BO0A 4ZUXD 1M1AA 3EPHA 2Q4ZA 1Q812 5DNMB 1F66A 3AZNA 4Z5TA 3AZLB 2V8KA 3MZKB 3NDJA 1RO2A 3B6FC 2QREB 1K9M2 2ZAEB 3CXCZ 4KGCD 3REJC 3REKB 3CPWZ 2Y2HA 3UT9A 3J7A4 3AZHC 3S1NI 3AZGC 1TWFI 1WWIA 3REIC 3A6NC 3LELB 3AN2B 4CAYB 5CPIB 5BS7A 4NFRA 2FJ7D 4XZQC 3AYWB 1VQP1 3H3VJ 5AY8C 3GTJI 1P3GC 1VQ5Z 2WB1A 1KC81 1BH8B 4Z2MH 3AZIB 5FLXf 3UTBC 3X1UC 3W97B 2OOYB 2QRCB 3K7AI 1QVGZ 1NJI2 3C1BB 2G2KA 2RIQA 5AVBD 2IO5B 3VH6T 2RT9A 2G5IC 3CD61 4DRAA 4Z66B 3AZMC 3CMAZ 3O62C 3WA9C 3D6WA 1Q9CA 1VQ51 2CV5D 1S32D 3W99A 3CC21 4H9OA 4X23A 5E5AA 2PYOC 4DGLA 3RZDI 3QWUA 3C1CA 3MVDD 1TZYD 5BT1C 3B6GC 5C4XI 1AOIB 1LQLA 3CC41 2F4OA 4WV4B 3GKQA 1S72Z 4BY1I 1W2EA 5JRGA 4NBGA 2E2JI 2HIOA 2Y2GA 5GSUB 1P3AC 1TWHI 3KXBB 3NQJB 5IP9I 1Q862 4A3CI 3W98C 2DE6A 4E30A 3M3YI 4JJND 2VUMI 1P3LD 3S15I 5B2JD 2GU2A 3AFAB 3V9RB 5CPKD 4A3FI 3C1BA 1Z03A 1QVFZ 3MGPD 1VQ6Z 3TU4D 3AV1D 1K83I 5B33D 4Z66C 4AYBA 1U35B 4E2WA 3FKII 2NZDA 2BJOA 4E45A 2NVXI 1H3OB 1M902 3LJAB 3GTMS 3GTLI 1VQKZ 4J8VC 1P3PC 2YFVA 3OW2Z 4TNUA 1P3GB 3AZLA 1P3MD 2BYMA 1M18B 2HUEB 4QTTA 3REKA 2ZY2A 4XUJB 3UT9B 3AZKA 3AZED 3AV2A 3MGSC 1AOIC 5GXQC 2QEX1 3UTAA 2HIOB 3REIB 5GSUA 5GT0B 5B32A 3KXBA 3AZFC 3CCJZ 1Q822 4NBFA 1K8A2 2NVTI 2Y2NA 1VQK1 1S32C 4NE3A 2AKLA 3EEDA 5KDMA 1P3FB 3O62D 3T4NB 1KX3C 1USPB 5IP7I 1EQZC 3S2DI 4A3II 4UPKA 2H85A 1JWHC 3MGSD 4YS3B 1VLAA 1AOID 2DE7A 3VH6A 2M6NA 3B0CW 3WKJA 4G92B 3CQZI 1TWCI 3I561 2QLVB 1H3OA 2PMZA 3KXBD 3LJAA 1N8R1 2F8NH 1U35D 5B1LB 4J8VB 1P3PB 3X1VB 3G71Z 4MH4A 5AV8B 3AZKD 2LFUA 2BYMB 4X23B 1W2BZ 3MGRB 4A3BI 1P3MA 3C1CB 3REHD 5AV5D 3H0GI 3AZGD 5GXQB 3PO2I 4J8XB 4J8WB 5GT0A 4H9SC 4CSRA 5B32B 2RVQC 2NZDD 1Z01A 4KUDC 3GTQI 5GT0D 1WWSA 1P3IB 5B33A 4ZUXC 5AV5A 1P3KC 3REHA 5BNXA 5CP6C 4KUDD 4DRBA 2G5HC 3J80b 3V9RA 4J8UD 3CD6Z 2J8PA 3CCEZ 1P3LA 3CCLZ 3G4SZ 2F2AC 1U35A 3MGSB 4R8PC 3WAAD 1YI2Z 1R9TI 1M1K1 3LZ1B 2FJ7B 3GCFA 5JRGD 4YM6C 1X0TA 3I55Z 5AV9A 2E2II 1N8R2 1P3BD 2F4MA 1TZYA 5LL6f 2ZY4A 5CPJD 5B2IC 3S14I 1M18A 5B24B 4NBBA 1Q7Y2 2IZ4A 4X23D 3CME1 4J8WC 4H9PB 3H0LC 1KD12 2Y2OA 4G91B 2NVQI 2QRDB 5G49B 4WU9D 3CCR1 3HKZA 1HQ3B 3HOUI 4UUZB 1EQZD 4WNNB 5CPJC 1P3GD 4LD9A 2CV5B 4E33A 5B1LC 2BG1A 1P3BC 1P3FA 1ID3C 1USPA 1Q811 1R4VA 4MD8A 1Z2CB 1BFMA 4YS3C 3ESWA 1VQ8Z 3KUYC 3IX0A 1K9M1 4RS4A 4J8XC 3AZEC 3FDDA 4E32A 3LZ0C 3CCS1 2FJ7A 2DQNC 3CC71 3X1TC 3VMGA 1M19C 1P3OC 1YIJ1 5C3IC 1P3KD 5D1OB 1VQ7Z 3WA9B 3TU4A 3G6E1 5B0YA 1B67A 5B24A 1HTAA 4BBRI 5F99A 3HOVI 4QLCA 1ZLAB 3MGRA 5DNMA 4NB9A 3HOZI 3AZNB 1RO4A 3BG0B 1VQMZ 1Q7Y1 5G49A 2QKDA 2IO5C 3AV1C 1M1AD 3MGPC 4WNNA 5DNNC 4LD9B 5AVCA 5B2JC 3G6EZ 1P3IC 2Y2MA 1P3BB 1P9NA 4XZQB 3AYWC 3KIHA 3C1CD 3REHB 3VH5A 5GT3C 5T67A 1YI21 1JJ2Z 3NH4A 3AZID 3RELB 1I6HI 3WTPA 5A2Qb 1BH8A 3W99D 3KUYB 1YUKA 5T6BA 4A3DI 3VH6W 4ZBJC 4RVFA 1K732 3MVDC 3B6GD 3KWQB 3LZ1A 1KX3D 5C3IB 4YM6B 1VQOZ 2OTL1 3EPKA 2CV5C 1M1AC 2WAQA 4NBEA 2AROB 5CM2M 1VQ4Z 3WA9D 3AZNC 2YADA 4Z5TC 1P34B 3CCRZ 4H9OB 4WU8D 3B6FA 4X6AI 4G91C 1Y1VS 4H9RA 5CHLB 3REJA 3IFUA 5AVBC 3UT9C 5D1PA 2RHBA 1KX4D 1HQ3A 3F6TA 2GTHA 5B2JB 4MD9A 3A6NA 3NQUB 1PZRA 3EG5B 4XZQA 4J8VD 1P3PD 5AY8A 3MNNC 4KGCA 1WIIA 3W98B 5AV6C 4XZQD 3LUSA 3AZND 4MD7A 3UTBA 4XUJC 1TAFA 2JMOA 2OZKA 5B1MC 3CCL1 3S2HI 5CPKC 2NQBB 3MGQB 3KSYA 1M19B 3B6FD 4HGAB 3X1SA 3EPLA 1S32B 3CCJ1 3WA9A 3NDIA 1K8A1 2AROA 4JJNC 2F8ND 4AWLC 3CCU1 2Y2PA 5B0YB 1VQM1 1KU5A 5F99B 2Y2KA 3W99C 1ZLAA 4J8WD 3VB9A 3P5JB 5E5AC 3MONA 2PYOA 3RELC 4H9RB 5GT3D 3CCVZ 3C1CC 3B6GA 4A3GI 4BY7I 2W03A 3WAAB 4CL1A 3LELD 3AN2D 3AV2B 1RLYA 1Q821 4A3LI 4NE5A 1YJ91 5JRGC 4YM6D 3PO3I 3WTPD 5AY8B 1BH9B 3AZFB 3X1VC 4KUDB 3W98A 2R6MA 1VQ81 2AROD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 1NP6 A;  1VQL Z;  3W96 B;  2R7Z I;  1B6W A;  4S1T A;  2ZY3 A;  1KC8 2;  5CP6 D;  1P34 C;  3C1B C;  3JAM f;  3J81 b;  1VQ9 Z;  2NQB A;  1ULY A;  1KX5 B;  4WU9 B;  2E7Z A;  1NJI 1;  3KWQ A;  4HGA C;  3WKJ B;  5B0Z A;  4QLC D;  2V8I A;  1YJ9 Z;  5B24 D;  3B0D B;  4RVH A;  4XX2 A;  5B40 A;  1S72 1;  4Y52 I;  4J8V A;  5BNV A;  1P3P A;  4NBA A;  5B32 G;  3H0R C;  5AV8 A;  3A6N D;  3B6G B;  1ID3 D;  1HQ3 D;  5FUG B;  3S1M I;  4WZS B;  3REJ B;  3X1U B;  3REK C;  2AYD A;  5AV6 D;  3REJ D;  3AZJ A;  1SFO I;  5GXQ A;  1WW9 A;  3UTA C;  3CCU Z;  2JIO A;  3FQM A;  4CAY A;  3MGQ C;  3KXB C;  3AZF A;  5CPI A;  2O53 A;  5A2Q f;  1ML8 A;  1YJN 1;  3AZM B;  2F8N B;  4A3M I;  3O62 B;  4KGC B;  3W96 A;  1Y1W I;  1KX4 C;  1Q86 1;  2W04 A;  1ZB9 A;  1P34 D;  5T64 A;  1QF8 A;  3WTP E;  5BNX B;  4KHA A;  3LZ1 D;  4WU8 C;  5E5A B;  5B2I D;  1TAF B;  1KX3 A;  1EQZ A;  1RQF A;  3U50 C;  4H9N A;  4WU9 A;  1RO0 A;  1W2B Y;  1QVF Y;  2JNY A;  2LIY A;  3WKJ C;  4NBH A;  3JAM b;  3I07 A;  3KIF A;  3LZ0 B;  5JRG B;  3LJA C;  2BYK A;  4R8P D;  1P3O B;  3PO3 S;  5B40 B;  3LEL C;  3AN2 C;  1P3A B;  1PFT A;  2V45 A;  3D9X A;  4RVG A;  2QA4 1;  1I3Q I;  4QTU A;  2JA8 I;  5AV9 D;  3REL D;  5AVC D;  4MON A;  1X3W A;  2NVY I;  5FLM I;  4HGZ A;  1KD1 1;  1N1J B;  3AFA C;  3AZI C;  3F3P C;  3CC4 Z;  3WAA A;  2JA6 I;  4BXX I;  3W97 C;  1TWA I;  4H9S A;  4NBD A;  1KX5 C;  2XD1 A;  2Y2L A;  3VH5 W;  5DNM D;  5DNN B;  5F99 D;  3MGR D;  4J8U A;  4KUD A;  5DNN D;  5B0Y D;  2JS4 A;  5B31 C;  3I56 Z;  4Z66 D;  5IT9 b;  5B1M D;  5AV5 C;  1P3K A;  3CMA 1;  4WU8 B;  4XUJ D;  1F66 C;  4H9N B;  2RBL A;  2OTJ 1;  3MNN D;  2Y2J A;  2LY8 A;  5B31 G;  3AZH A;  2O4H A;  4RV9 A;  3AZG A;  3F3F C;  3UTA B;  2BYK B;  2Y2Q A;  3REI A;  3CCV 1;  2F8N A;  3BG1 B;  5BS7 C;  1P3F D;  3R45 B;  5AV9 C;  4H9Q B;  3LZ0 D;  5D1O A;  2YFV B;  2YFW B;  1TZY C;  5BT1 D;  1P3G A;  4LD9 D;  4YS3 D;  2UWX A;  1ZB8 A;  1FDI A;  5JA4 A;  3LJA D;  5FUG A;  3CXC Y;  3X1U A;  3AZJ B;  2VUG A;  2R93 I;  5B1L D;  1VQ7 1;  3AV1 B;  2JA7 I;  1M18 D;  1YIJ Z;  4E31 A;  3RZO I;  3AZM A;  5CPJ A;  4LD9 C;  3O62 A;  2JR6 A;  2P3Y A;  2JA5 I;  3S17 I;  4BBS I;  5B1L A;  1P3B A;  5KDM B;  1F66 B;  1VQ6 1;  2W8S A;  2KPI A;  4Z5T B;  5AV6 B;  1KX3 B;  3H0M C;  4X23 C;  1EQZ B;  5C44 I;  5B32 D;  4HGY A;  3B0B A;  1VQL 1;  5GSU D;  4YS3 A;  1P3M B;  3Q87 A;  3KUY A;  4E2Y A;  4A3J I;  2E2H I;  4NBC A;  4J8X A;  4Z2M G;  3AV2 D;  3AZE A;  4HH4 A;  1P3I D;  3CPW Y;  3LZ0 A;  2M48 A;  2FJ7 C;  3CCQ 1;  3X1T A;  3MVD B;  3R45 A;  2HIO C;  1P3O A;  1VQN 1;  3REI D;  3AZL D;  1P3A A;  4EO5 C;  4DK1 A;  3TU4 C;  1KRL A;  3I4M I;  3GTM I;  2DF4 C;  4A93 I;  5JA4 B;  5B24 C;  5F99 C;  3MGR C;  3NH8 A;  3CME Z;  5CP6 B;  1N1J A;  3IF8 A;  3J81 f;  3CC2 Z;  2K3R A;  1P3L B;  4NFT A;  1X3Z A;  2V8J A;  4CSR B;  3M4O I;  3AV1 A;  1DL6 A;  2ZM5 A;  1P3A D;  2FFF B;  5AVB B;  4Z66 A;  3MGP A;  1P3O D;  5CPJ B;  5DNN A;  3A1I A;  3X1T D;  3S1R I;  2NZD C;  5B2J A;  1P3I A;  5B33 B;  4J8X D;  5AV9 B;  3B0C T;  3KUY D;  3W99 B;  2B63 I;  3G4S 1;  1YJW 1;  1TFI A;  3AZL C;  2K5R A;  3HOY I;  1I50 I;  3WKJ D;  1A7W A;  3UTB B;  4Y7N I;  1AOI A;  4H9P A;  2JCH A;  3AZK C;  3AV2 C;  3MGS A;  2RPR A;  1VQP Z;  3VMH A;  3MVD A;  5B1M B;  3S1Q I;  3AZM D;  5GSU C;  1NUI A;  3LZ1 C;  5B32 C;  3HOX I;  4H9Q A;  3GTK I;  3X1S B;  2HF1 A;  3EPJ A;  2VQR A;  1S32 A;  2CV5 A;  3OW2 Y;  1WZN A;  1TZY B;  4DQY B;  1YIT Z;  4JJN B;  3X1U D;  4AWL B;  4A3E I;  4ZUX B;  1RNI A;  2ZY5 A;  3I4N I;  5C3E I;  3UTA D;  3NFZ A;  3CCM Z;  1VQN Z;  2E9H A;  1VQ9 1;  3CCS Z;  5AVB A;  3MGP B;  1VQO 1;  3REK D;  2OTL Z;  1HQ3 C;  2R92 I;  4R8P B;  3AZF D;  5CPI D;  3AZH D;  4MRI A;  1BH9 A;  3HOW I;  3MNN A;  4KGC C;  5GXQ D;  1T3U A;  3TU4 B;  5AV6 A;  3AZJ D;  2Q51 A;  3MZL B;  2PM9 A;  2HUE C;  2P28 A;  1F1E A;  3CCM 1;  4QLC B;  3G71 1;  4XUJ A;  1P3M C;  5AV8 D;  3AZK B;  5B1M A;  3UT9 D;  3AZE B;  5B40 D;  3C1B D;  5GT0 C;  5CPK A;  3D2L A;  3X1T B;  1K73 1;  3J80 f;  5FLX b;  3X1S C;  1M90 1;  2JSS A;  2RVQ D;  4Z5T D;  5AVC B;  5B0Z B;  1F66 D;  4NOZ A;  1YHQ 1;  3GTP I;  2ARO C;  4JJN A;  5B33 C;  2NQB D;  4ZUX A;  4E2X A;  3REH C;  1ZLA C;  3KFU G;  5BNV B;  2HIO D;  5CP6 A;  4EWC A;  1ID3 B;  3REL A;  2YU9 I;  3WTP B;  2F8N G;  1P3L C;  1YJW Z;  1U35 C;  1Z02 A;  4R8P A;  3NH5 A;  5E5A D;  3CCE 1;  2I3C A;  1YUA A;  4YM6 A;  3X1V A;  2J6A A;  2OOX B;  5BO0 B;  3AYW D;  1M1A B;  2L5A A;  3VH5 T;  1KX4 B;  1ZH1 A;  5B2I A;  1QVG Y;  2JE5 A;  1L1O C;  1M18 C;  1N2F A;  2CWE A;  2PYO D;  2VF1 A;  3VTN A;  1P34 A;  4KHA B;  4J8W A;  1ZLA D;  4E44 A;  2IZ3 A;  2NQB C;  3W96 D;  3S16 I;  3KWQ C;  2F8N K;  5B0Z C;  4G92 C;  1KQS Z;  1VQ4 1;  1Y8C A;  3TDH B;  1YIT 1;  3NQU A;  5AV5 B;  5B40 C;  2PK7 A;  2JUB A;  3TE5 B;  2KI7 B;  4M6B A;  1P3F C;  1ID3 A;  4RVD A;  5AV8 C;  5C4J I;  5GT3 B;  2QA4 Z;  3UTB D;  1M19 D;  3B6F B;  1KQS Y;  5IT9 f;  2GTI A;  3A1K A;  3MGQ D;  3GTG I;  3FQQ A;  3AZJ C;  4NB8 A;  3GTO I;  4E2Z A;  1JFI A;  4A3K I;  5AY8 D;  3A6N B;  1QYP A;  4ZBJ B;  5CPI C;  3MGQ A;  3VMI A;  5B0Z D;  5AN9 F;  1M19 A;  2EGT A;  3KWQ D;  4J8U B;  3I55 1;  3MNN B;  3W96 C;  1KX4 A;  5B31 B;  5B2I B;  5B31 D;  2XD5 A;  5B0Y C;  1S7M A;  3IP4 C;  1P3K B;  4QLC C;  4WU8 A;  1Y1V I;  5DNM C;  1YJN Z;  1KX5 D;  4WU9 C;  3W97 D;  1M1K 2;  3W98 D;  5CPK B;  1YHQ Z;  2QEX Z;  3AFA D;  4UUZ A;  3AL0 C;  2JIP A;  3AZH B;  2VPW A;  3AZG B;  4WJ3 C;  4NE6 A;  5AVC C;  3B0D C;  2HU9 A;  4MXU A;  3LEL A;  3AN2 A;  4NH1 C;  3NQJ A;  4EO5 B;  3AYW A;  2QR1 B;  5GT3 A;  3EER A;  2OTJ Z;  2YFW A;  3X1V D;  2PYO B;  2JIM A;  3CCQ Z;  2DE5 A;  3WTP C;  3CC7 Z;  3AFA A;  3AZI A;  1TWG I;  2Y2I A;  1JFI B;  3WAA C;  2Y0S A;  3W97 A;  1WCM I;  1KX5 A;  3X1S D;  4J8U C;  2NZD B;  1WJ2 A;  5B31 A;  1JJ2 Y;  5BO0 A;  4ZUX D;  1M1A A;  3EPH A;  2Q4Z A;  1Q81 2;  5DNM B;  2JIR A;  1F66 A;  3AZN A;  4Z5T A;  3AZL B;  2V8K A;  3MZK B;  3NDJ A;  1RO2 A;  3B6F C;  2QRE B;  1K9M 2;  2ZAE B;  3CXC Z;  4KGC D;  3REJ C;  3REK B;  3CPW Z;  2Y2H A;  3UT9 A;  3J7A 4;  3AZH C;  3S1N I;  3AZG C;  1TWF I;  1WWI A;  3REI C;  3A6N C;  3LEL B;  3AN2 B;  4CAY B;  5CPI B;  5BS7 A;  4NFR A;  2FJ7 D;  4XZQ C;  3AYW B;  1VQP 1;  3H3V J;  5AY8 C;  3GTJ I;  1P3G C;  1VQ5 Z;  2WB1 A;  1KC8 1;  1BH8 B;  4Z2M H;  3AZI B;  5FLX f;  3UTB C;  3X1U C;  3W97 B;  2OOY B;  2QRC B;  3K7A I;  1QVG Z;  1NJI 2;  3C1B B;  2G2K A;  2RIQ A;  5AVB D;  2IO5 B;  3VH6 T;  2RT9 A;  2G5I C;  3CD6 1;  4DRA A;  4Z66 B;  3AZM C;  3CMA Z;  3O62 C;  3WA9 C;  3D6W A;  1Q9C A;  1VQ5 1;  2CV5 D;  1S32 D;  3W99 A;  3CC2 1;  4H9O A;  4X23 A;  5E5A A;  2PYO C;  4DGL A;  3RZD I;  3QWU A;  3C1C A;  3MVD D;  1TZY D;  5BT1 C;  3B6G C;  5C4X I;  1AOI B;  1LQL A;  3CC4 1;  2F4O A;  4WV4 B;  3GKQ A;  1S72 Z;  4BY1 I;  1W2E A;  5JRG A;  4NBG A;  2E2J I;  2HIO A;  2Y2G A;  5GSU B;  1P3A C;  1TWH I;  3KXB B;  3NQJ B;  5IP9 I;  1Q86 2;  4A3C I;  3W98 C;  2DE6 A;  4E30 A;  3M3Y I;  4JJN D;  2VUM I;  1P3L D;  3S15 I;  5B2J D;  2GU2 A;  3AFA B;  2IV2 X;  3V9R B;  5CPK D;  4A3F I;  3C1B A;  1Z03 A;  1QVF Z;  3MGP D;  1VQ6 Z;  3TU4 D;  3AV1 D;  1K83 I;  5B33 D;  4Z66 C;  4AYB A;  1U35 B;  4E2W A;  3FKI I;  2NZD A;  2BJO A;  4E45 A;  2NVX I;  1H3O B;  2NAP A;  1M90 2;  3LJA B;  3GTM S;  3GTL I;  1VQK Z;  4J8V C;  1P3P C;  2YFV A;  3OW2 Z;  4TNU A;  1P3G B;  3AZL A;  1P3M D;  2BYM A;  1M18 B;  2HUE B;  4QTT A;  3REK A;  2ZY2 A;  4XUJ B;  3UT9 B;  3AZK A;  3AZE D;  3AV2 A;  3MGS C;  1AOI C;  5GXQ C;  2QEX 1;  3UTA A;  2HIO B;  3REI B;  5GSU A;  5GT0 B;  1Q16 A;  5B32 A;  3KXB A;  3AZF C;  3CCJ Z;  1Q82 2;  4NBF A;  1K8A 2;  2NVT I;  2Y2N A;  1VQK 1;  1S32 C;  4NE3 A;  2AKL A;  3EED A;  5KDM A;  1P3F B;  3O62 D;  3T4N B;  1KX3 C;  1USP B;  5IP7 I;  1EQZ C;  2VPZ A;  4A3I I;  4UPK A;  2H85 A;  1JWH C;  3S2D I;  3MGS D;  4YS3 B;  1VLA A;  1AOI D;  2DE7 A;  3VH6 A;  2M6N A;  3B0C W;  3WKJ A;  4G92 B;  3CQZ I;  1TWC I;  3I56 1;  2QLV B;  1H3O A;  2PMZ A;  3KXB D;  3LJA A;  1N8R 1;  2F8N H;  1U35 D;  5B1L B;  4J8V B;  1P3P B;  3X1V B;  2JIQ A;  3G71 Z;  4MH4 A;  5AV8 B;  3AZK D;  2LFU A;  2BYM B;  4X23 B;  1W2B Z;  3MGR B;  4A3B I;  1P3M A;  3C1C B;  3REH D;  5AV5 D;  3H0G I;  3AZG D;  5GXQ B;  3PO2 I;  4J8X B;  4J8W B;  5GT0 A;  4H9S C;  4CSR A;  5B32 B;  2RVQ C;  2NZD D;  1Z01 A;  4KUD C;  3GTQ I;  5GT0 D;  1WWS A;  1P3I B;  5B33 A;  4ZUX C;  5AV5 A;  1P3K C;  3REH A;  5BNX A;  5CP6 C;  4KUD D;  4DRB A;  2G5H C;  3J80 b;  3V9R A;  4J8U D;  3CD6 Z;  2J8P A;  3CCE Z;  1P3L A;  3CCL Z;  1FDO A;  3G4S Z;  2F2A C;  1U35 A;  3MGS B;  4R8P C;  3WAA D;  1YI2 Z;  1R9T I;  1M1K 1;  3LZ1 B;  2FJ7 B;  3GCF A;  5JRG D;  4YM6 C;  1X0T A;  2VPY A;  5AV9 A;  3I55 Z;  1N8R 2;  2E2I I;  1P3B D;  2F4M A;  1TZY A;  5LL6 f;  2ZY4 A;  5CPJ D;  5B2I C;  3S14 I;  1M18 A;  5B24 B;  4NBB A;  1Q7Y 2;  2IZ4 A;  2LEX A;  4X23 D;  3CME 1;  4J8W C;  4H9P B;  3H0L C;  1KD1 2;  2Y2O A;  4G91 B;  2NVQ I;  2QRD B;  5G49 B;  4WU9 D;  3CCR 1;  3HKZ A;  1HQ3 B;  3HOU I;  4UUZ B;  1EQZ D;  4WNN B;  5CPJ C;  1P3G D;  4LD9 A;  2CV5 B;  4E33 A;  5B1L C;  2BG1 A;  1P3B C;  1P3F A;  1ID3 C;  1USP A;  1Q81 1;  1R4V A;  4MD8 A;  1Z2C B;  1BFM A;  4YS3 C;  3ESW A;  1VQ8 Z;  3KUY C;  3IX0 A;  1K9M 1;  4RS4 A;  4J8X C;  3AZE C;  3FDD A;  4E32 A;  3LZ0 C;  3CCS 1;  2FJ7 A;  2DQN C;  3CC7 1;  3X1T C;  3IR7 A;  3VMG A;  1M19 C;  1P3O C;  1YIJ 1;  5C3I C;  1P3K D;  5D1O B;  1VQ7 Z;  3WA9 B;  3TU4 A;  3G6E 1;  5B0Y A;  1B67 A;  5B24 A;  1HTA A;  4BBR I;  5F99 A;  3HOV I;  4QLC A;  1ZLA B;  3MGR A;  5DNM A;  4NB9 A;  3HOZ I;  3AZN B;  1RO4 A;  3BG0 B;  1VQM Z;  1Q7Y 1;  5G49 A;  2QKD A;  2IO5 C;  3AV1 C;  1M1A D;  3MGP C;  4WNN A;  5DNN C;  4LD9 B;  5AVC A;  5B2J C;  3G6E Z;  1P3I C;  2Y2M A;  1P3B B;  1P9N A;  4XZQ B;  3AYW C;  3KIH A;  3C1C D;  3REH B;  3VH5 A;  5GT3 C;  5T67 A;  1YI2 1;  1JJ2 Z;  3NH4 A;  3AZI D;  3REL B;  1I6H I;  3WTP A;  5A2Q b;  1BH8 A;  3W99 D;  3KUY B;  1YUK A;  5T6B A;  4A3D I;  3VH6 W;  4ZBJ C;  4RVF A;  1K73 2;  3MVD C;  3B6G D;  3KWQ B;  3LZ1 A;  1KX3 D;  5C3I B;  4YM6 B;  1VQO Z;  2OTL 1;  3EPK A;  2CV5 C;  1M1A C;  2V3V A;  2WAQ A;  4NBE A;  2ARO B;  5CM2 M;  1VQ4 Z;  3WA9 D;  3AZN C;  2YAD A;  4Z5T C;  1P34 B;  3CCR Z;  4H9O B;  4WU8 D;  3B6F A;  4X6A I;  4G91 C;  1Y1V S;  4H9R A;  5CHL B;  3REJ A;  3IFU A;  5AVB C;  3UT9 C;  5D1P A;  2RHB A;  1KX4 D;  1HQ3 A;  3F6T A;  2GTH A;  5B2J B;  4MD9 A;  3A6N A;  3NQU B;  1PZR A;  3EG5 B;  4XZQ A;  4J8V D;  1P3P D;  5AY8 A;  3MNN C;  4KGC A;  1SIW A;  1WII A;  3W98 B;  5AV6 C;  4XZQ D;  3LUS A;  3AZN D;  4MD7 A;  3UTB A;  4XUJ C;  1TAF A;  2JMO A;  2OZK A;  5B1M C;  3CCL 1;  3S2H I;  5CPK C;  2NQB B;  3MGQ B;  3KSY A;  1M19 B;  3B6F D;  4HGA B;  3X1S A;  3EPL A;  1S32 B;  1AA6 A;  3CCJ 1;  3WA9 A;  3NDI A;  1K8A 1;  2ARO A;  4JJN C;  2F8N D;  4AWL C;  3CCU 1;  2Y2P A;  5B0Y B;  1VQM 1;  1KU5 A;  5F99 B;  2Y2K A;  3W99 C;  1ZLA A;  4J8W D;  3VB9 A;  3P5J B;  5E5A C;  2VPX A;  3MON A;  2PYO A;  3REL C;  4H9R B;  5GT3 D;  1QXF A;  3C1C C;  3B6G A;  3CCV Z;  4A3G I;  4BY7 I;  2W03 A;  3WAA B;  4CL1 A;  3LEL D;  3AN2 D;  3AV2 B;  1RLY A;  1Q82 1;  4A3L I;  4NE5 A;  1YJ9 1;  5JRG C;  4YM6 D;  3PO3 I;  3WTP D;  5AY8 B;  1BH9 B;  3AZF B;  3X1V C;  4KUD B;  3W98 A;  2R6M A;  1VQ8 1;  2ARO D; 
#chains in the Genus database with same CATH homology
 1NP6 A;  1VQL Z;  3W96 B;  2R7Z I;  1B6W A;  4S1T A;  2ZY3 A;  1KC8 2;  5CP6 D;  1P34 C;  3C1B C;  3JAM f;  3J81 b;  1VQ9 Z;  2NQB A;  1ULY A;  1KX5 B;  4WU9 B;  1NJI 1;  3KWQ A;  4HGA C;  3WKJ B;  5B0Z A;  4QLC D;  2V8I A;  1YJ9 Z;  5B24 D;  3B0D B;  4RVH A;  4XX2 A;  5B40 A;  1S72 1;  4Y52 I;  4J8V A;  5BNV A;  1P3P A;  4NBA A;  5B32 G;  3H0R C;  5AV8 A;  3A6N D;  3B6G B;  1ID3 D;  1HQ3 D;  5FUG B;  3S1M I;  4WZS B;  3REJ B;  3X1U B;  3REK C;  1SFO I;  5AV6 D;  3REJ D;  3AZJ A;  5GXQ A;  1WW9 A;  3UTA C;  3CCU Z;  3FQM A;  4CAY A;  3MGQ C;  3KXB C;  3AZF A;  5CPI A;  2O53 A;  5A2Q f;  1ML8 A;  1YJN 1;  3AZM B;  2F8N B;  4A3M I;  3O62 B;  4KGC B;  3W96 A;  1Y1W I;  1KX4 C;  1Q86 1;  2W04 A;  1ZB9 A;  1P34 D;  5T64 A;  1QF8 A;  3WTP E;  5BNX B;  4KHA A;  3LZ1 D;  4WU8 C;  5E5A B;  5B2I D;  1TAF B;  1KX3 A;  1EQZ A;  1RQF A;  3U50 C;  4H9N A;  4WU9 A;  1RO0 A;  1W2B Y;  1QVF Y;  2JNY A;  2LIY A;  3WKJ C;  4NBH A;  3JAM b;  3I07 A;  3KIF A;  3LZ0 B;  5JRG B;  3LJA C;  2BYK A;  4R8P D;  1P3O B;  3PO3 S;  5B40 B;  3LEL C;  3AN2 C;  1P3A B;  1PFT A;  3D9X A;  4RVG A;  2QA4 1;  1I3Q I;  4QTU A;  2JA8 I;  5AV9 D;  3REL D;  5AVC D;  4MON A;  1X3W A;  2NVY I;  5FLM I;  4HGZ A;  1KD1 1;  1N1J B;  3AFA C;  3AZI C;  3F3P C;  3CC4 Z;  3WAA A;  2JA6 I;  4BXX I;  3W97 C;  1TWA I;  4H9S A;  4NBD A;  1KX5 C;  2XD1 A;  2Y2L A;  3VH5 W;  5DNM D;  5DNN B;  5F99 D;  3MGR D;  4J8U A;  4KUD A;  5DNN D;  5B0Y D;  2JS4 A;  5B31 C;  3I56 Z;  4Z66 D;  5IT9 b;  5B1M D;  5AV5 C;  1P3K A;  3CMA 1;  4WU8 B;  4XUJ D;  1F66 C;  4H9N B;  2RBL A;  2OTJ 1;  3MNN D;  2Y2J A;  2LY8 A;  5B31 G;  3AZH A;  2O4H A;  4RV9 A;  3AZG A;  3F3F C;  3UTA B;  2BYK B;  2Y2Q A;  3REI A;  3CCV 1;  2F8N A;  3BG1 B;  5BS7 C;  1P3F D;  3R45 B;  5AV9 C;  4H9Q B;  3LZ0 D;  5D1O A;  2YFV B;  2YFW B;  1TZY C;  5BT1 D;  1P3G A;  4LD9 D;  4YS3 D;  2UWX A;  1ZB8 A;  5JA4 A;  3LJA D;  5FUG A;  3CXC Y;  3X1U A;  3AZJ B;  2VUG A;  2R93 I;  5B1L D;  1VQ7 1;  3AV1 B;  2JA7 I;  1M18 D;  1YIJ Z;  4E31 A;  3RZO I;  3AZM A;  5CPJ A;  4LD9 C;  3O62 A;  2JR6 A;  2P3Y A;  2JA5 I;  3S17 I;  4BBS I;  5B1L A;  1P3B A;  5KDM B;  1F66 B;  1VQ6 1;  2W8S A;  2KPI A;  4Z5T B;  5AV6 B;  1KX3 B;  3H0M C;  4X23 C;  1EQZ B;  5C44 I;  5B32 D;  4HGY A;  3B0B A;  1VQL 1;  5GSU D;  4YS3 A;  1P3M B;  3Q87 A;  3KUY A;  4E2Y A;  4A3J I;  2E2H I;  4NBC A;  4J8X A;  4Z2M G;  3AV2 D;  3AZE A;  4HH4 A;  1P3I D;  3CPW Y;  3LZ0 A;  2M48 A;  2FJ7 C;  3CCQ 1;  3X1T A;  3MVD B;  3R45 A;  2HIO C;  1P3O A;  1VQN 1;  3REI D;  3AZL D;  1P3A A;  4EO5 C;  4DK1 A;  3TU4 C;  1KRL A;  3I4M I;  3GTM I;  2DF4 C;  4A93 I;  5JA4 B;  5B24 C;  5F99 C;  3MGR C;  3NH8 A;  3CME Z;  5CP6 B;  1N1J A;  3IF8 A;  3J81 f;  3CC2 Z;  2K3R A;  1P3L B;  4NFT A;  1X3Z A;  2V8J A;  4CSR B;  3M4O I;  3AV1 A;  1DL6 A;  2ZM5 A;  1P3A D;  2FFF B;  5AVB B;  4Z66 A;  3MGP A;  1P3O D;  5CPJ B;  5DNN A;  3A1I A;  3X1T D;  3S1R I;  2NZD C;  5B2J A;  1P3I A;  5B33 B;  4J8X D;  5AV9 B;  3B0C T;  3KUY D;  3W99 B;  2B63 I;  3G4S 1;  1YJW 1;  1TFI A;  3AZL C;  2K5R A;  3HOY I;  1I50 I;  3WKJ D;  1A7W A;  3UTB B;  4Y7N I;  1AOI A;  4H9P A;  2JCH A;  3AZK C;  3AV2 C;  3MGS A;  2RPR A;  1VQP Z;  3VMH A;  3MVD A;  5B1M B;  3S1Q I;  3AZM D;  5GSU C;  1NUI A;  3LZ1 C;  5B32 C;  3HOX I;  4H9Q A;  3GTK I;  3X1S B;  2HF1 A;  3EPJ A;  2VQR A;  1S32 A;  2CV5 A;  3OW2 Y;  1TZY B;  4DQY B;  1YIT Z;  4JJN B;  3X1U D;  4AWL B;  4A3E I;  4ZUX B;  1RNI A;  2ZY5 A;  3I4N I;  5C3E I;  3UTA D;  3NFZ A;  3CCM Z;  1VQN Z;  2E9H A;  1VQ9 1;  3CCS Z;  5AVB A;  3MGP B;  1VQO 1;  3REK D;  2OTL Z;  1HQ3 C;  2R92 I;  4R8P B;  3AZF D;  5CPI D;  3AZH D;  4MRI A;  1BH9 A;  3HOW I;  3MNN A;  4KGC C;  5GXQ D;  1T3U A;  3TU4 B;  5AV6 A;  3AZJ D;  2Q51 A;  3MZL B;  2PM9 A;  2HUE C;  2P28 A;  1F1E A;  3CCM 1;  4QLC B;  3G71 1;  4XUJ A;  1P3M C;  5AV8 D;  3AZK B;  5B1M A;  3UT9 D;  3AZE B;  5B40 D;  3C1B D;  5GT0 C;  5CPK A;  3X1T B;  1K73 1;  3J80 f;  5FLX b;  3X1S C;  1M90 1;  2JSS A;  2RVQ D;  4Z5T D;  5AVC B;  5B0Z B;  1F66 D;  4NOZ A;  1YHQ 1;  3GTP I;  2ARO C;  4JJN A;  5B33 C;  2NQB D;  4ZUX A;  4E2X A;  3REH C;  1ZLA C;  3KFU G;  5BNV B;  2HIO D;  5CP6 A;  4EWC A;  1ID3 B;  3REL A;  2YU9 I;  3WTP B;  2F8N G;  1P3L C;  1YJW Z;  1U35 C;  1Z02 A;  4R8P A;  3NH5 A;  5E5A D;  3CCE 1;  2I3C A;  1YUA A;  4YM6 A;  3X1V A;  2J6A A;  2OOX B;  5BO0 B;  3AYW D;  1M1A B;  2L5A A;  3VH5 T;  1KX4 B;  1ZH1 A;  5B2I A;  1QVG Y;  2JE5 A;  1L1O C;  1M18 C;  1N2F A;  2CWE A;  2PYO D;  2VF1 A;  3VTN A;  1P34 A;  4KHA B;  4J8W A;  1ZLA D;  4E44 A;  2IZ3 A;  2NQB C;  3W96 D;  3S16 I;  3KWQ C;  2F8N K;  5B0Z C;  4G92 C;  1KQS Z;  1VQ4 1;  1YIT 1;  3TDH B;  3NQU A;  5AV5 B;  5B40 C;  2PK7 A;  2JUB A;  3TE5 B;  2KI7 B;  4M6B A;  1P3F C;  1ID3 A;  4RVD A;  5AV8 C;  5C4J I;  5GT3 B;  2QA4 Z;  3UTB D;  1M19 D;  3B6F B;  1KQS Y;  5IT9 f;  2GTI A;  3A1K A;  3MGQ D;  3GTG I;  3FQQ A;  3AZJ C;  4NB8 A;  3GTO I;  4E2Z A;  1JFI A;  4A3K I;  5AY8 D;  3A6N B;  1QYP A;  4ZBJ B;  5CPI C;  3MGQ A;  3VMI A;  5B0Z D;  5AN9 F;  1M19 A;  2EGT A;  3KWQ D;  4J8U B;  3I55 1;  3MNN B;  3W96 C;  1KX4 A;  5B31 B;  5B2I B;  5B31 D;  2XD5 A;  5B0Y C;  1S7M A;  3IP4 C;  1P3K B;  4QLC C;  4WU8 A;  1Y1V I;  5DNM C;  1YJN Z;  1KX5 D;  4WU9 C;  3W97 D;  1M1K 2;  3W98 D;  5CPK B;  1YHQ Z;  2QEX Z;  3AFA D;  4UUZ A;  3AL0 C;  3AZH B;  3AZG B;  4WJ3 C;  4NE6 A;  5AVC C;  3B0D C;  2HU9 A;  4MXU A;  3LEL A;  3AN2 A;  4NH1 C;  3NQJ A;  4EO5 B;  3AYW A;  2QR1 B;  5GT3 A;  3EER A;  2OTJ Z;  2YFW A;  3X1V D;  2PYO B;  3CCQ Z;  2DE5 A;  3WTP C;  3CC7 Z;  3AFA A;  3AZI A;  1TWG I;  2Y2I A;  1JFI B;  3WAA C;  2Y0S A;  3W97 A;  1WCM I;  1KX5 A;  3X1S D;  4J8U C;  2NZD B;  5B31 A;  1JJ2 Y;  5BO0 A;  4ZUX D;  1M1A A;  3EPH A;  2Q4Z A;  1Q81 2;  5DNM B;  1F66 A;  3AZN A;  4Z5T A;  3AZL B;  2V8K A;  3MZK B;  3NDJ A;  1RO2 A;  3B6F C;  2QRE B;  1K9M 2;  2ZAE B;  3CXC Z;  4KGC D;  3REJ C;  3REK B;  3CPW Z;  2Y2H A;  3UT9 A;  3J7A 4;  3AZH C;  3S1N I;  3AZG C;  1TWF I;  1WWI A;  3REI C;  3A6N C;  3LEL B;  3AN2 B;  4CAY B;  5CPI B;  5BS7 A;  4NFR A;  2FJ7 D;  4XZQ C;  3AYW B;  1VQP 1;  3H3V J;  5AY8 C;  3GTJ I;  1P3G C;  1VQ5 Z;  2WB1 A;  1KC8 1;  1BH8 B;  4Z2M H;  3AZI B;  5FLX f;  3UTB C;  3X1U C;  3W97 B;  2OOY B;  2QRC B;  3K7A I;  1QVG Z;  1NJI 2;  3C1B B;  2G2K A;  2RIQ A;  5AVB D;  2IO5 B;  3VH6 T;  2RT9 A;  2G5I C;  3CD6 1;  4DRA A;  4Z66 B;  3AZM C;  3CMA Z;  3O62 C;  3WA9 C;  3D6W A;  1Q9C A;  1VQ5 1;  2CV5 D;  1S32 D;  3W99 A;  3CC2 1;  4H9O A;  4X23 A;  5E5A A;  2PYO C;  4DGL A;  3RZD I;  3QWU A;  3C1C A;  3MVD D;  1TZY D;  5BT1 C;  3B6G C;  5C4X I;  1AOI B;  1LQL A;  3CC4 1;  2F4O A;  4WV4 B;  3GKQ A;  1S72 Z;  4BY1 I;  1W2E A;  5JRG A;  4NBG A;  2E2J I;  2HIO A;  2Y2G A;  5GSU B;  1P3A C;  1TWH I;  3KXB B;  3NQJ B;  5IP9 I;  1Q86 2;  4A3C I;  3W98 C;  2DE6 A;  4E30 A;  3M3Y I;  4JJN D;  2VUM I;  1P3L D;  3S15 I;  5B2J D;  2GU2 A;  3AFA B;  3V9R B;  5CPK D;  4A3F I;  3C1B A;  1Z03 A;  1QVF Z;  3MGP D;  1VQ6 Z;  3TU4 D;  3AV1 D;  1K83 I;  5B33 D;  4Z66 C;  4AYB A;  1U35 B;  4E2W A;  3FKI I;  2NZD A;  2BJO A;  4E45 A;  2NVX I;  1H3O B;  1M90 2;  3LJA B;  3GTM S;  3GTL I;  1VQK Z;  4J8V C;  1P3P C;  2YFV A;  3OW2 Z;  4TNU A;  1P3G B;  3AZL A;  1P3M D;  2BYM A;  1M18 B;  2HUE B;  4QTT A;  3REK A;  2ZY2 A;  4XUJ B;  3UT9 B;  3AZK A;  3AZE D;  3AV2 A;  3MGS C;  1AOI C;  5GXQ C;  2QEX 1;  3UTA A;  2HIO B;  3REI B;  5GSU A;  5GT0 B;  5B32 A;  3KXB A;  3AZF C;  3CCJ Z;  1Q82 2;  4NBF A;  1K8A 2;  2NVT I;  2Y2N A;  1VQK 1;  1S32 C;  4NE3 A;  2AKL A;  3EED A;  5KDM A;  1P3F B;  3O62 D;  3T4N B;  1KX3 C;  1USP B;  5IP7 I;  1EQZ C;  3S2D I;  4A3I I;  4UPK A;  2H85 A;  1JWH C;  3MGS D;  4YS3 B;  1VLA A;  1AOI D;  2DE7 A;  3VH6 A;  2M6N A;  3B0C W;  3WKJ A;  4G92 B;  3CQZ I;  1TWC I;  3I56 1;  2QLV B;  1H3O A;  2PMZ A;  3KXB D;  3LJA A;  1N8R 1;  2F8N H;  1U35 D;  5B1L B;  4J8V B;  1P3P B;  3X1V B;  3G71 Z;  4MH4 A;  5AV8 B;  3AZK D;  2LFU A;  2BYM B;  4X23 B;  1W2B Z;  3MGR B;  4A3B I;  1P3M A;  3C1C B;  3REH D;  5AV5 D;  3H0G I;  3AZG D;  5GXQ B;  3PO2 I;  4J8X B;  4J8W B;  5GT0 A;  4H9S C;  4CSR A;  5B32 B;  2RVQ C;  2NZD D;  1Z01 A;  4KUD C;  3GTQ I;  5GT0 D;  1WWS A;  1P3I B;  5B33 A;  4ZUX C;  5AV5 A;  1P3K C;  3REH A;  5BNX A;  5CP6 C;  4KUD D;  4DRB A;  2G5H C;  3J80 b;  3V9R A;  4J8U D;  3CD6 Z;  2J8P A;  3CCE Z;  1P3L A;  3CCL Z;  3G4S Z;  2F2A C;  1U35 A;  3MGS B;  4R8P C;  3WAA D;  1YI2 Z;  1R9T I;  1M1K 1;  3LZ1 B;  2FJ7 B;  3GCF A;  5JRG D;  4YM6 C;  1X0T A;  3I55 Z;  5AV9 A;  2E2I I;  1N8R 2;  1P3B D;  2F4M A;  1TZY A;  5LL6 f;  2ZY4 A;  5CPJ D;  5B2I C;  3S14 I;  1M18 A;  5B24 B;  4NBB A;  1Q7Y 2;  2IZ4 A;  4X23 D;  3CME 1;  4J8W C;  4H9P B;  3H0L C;  1KD1 2;  2Y2O A;  4G91 B;  2NVQ I;  2QRD B;  5G49 B;  4WU9 D;  3CCR 1;  3HKZ A;  1HQ3 B;  3HOU I;  4UUZ B;  1EQZ D;  4WNN B;  5CPJ C;  1P3G D;  4LD9 A;  2CV5 B;  4E33 A;  5B1L C;  2BG1 A;  1P3B C;  1P3F A;  1ID3 C;  1USP A;  1Q81 1;  1R4V A;  4MD8 A;  1Z2C B;  1BFM A;  4YS3 C;  3ESW A;  1VQ8 Z;  3KUY C;  3IX0 A;  1K9M 1;  4RS4 A;  4J8X C;  3AZE C;  3FDD A;  4E32 A;  3LZ0 C;  3CCS 1;  2FJ7 A;  2DQN C;  3CC7 1;  3X1T C;  3VMG A;  1M19 C;  1P3O C;  1YIJ 1;  5C3I C;  1P3K D;  5D1O B;  1VQ7 Z;  3WA9 B;  3TU4 A;  3G6E 1;  5B0Y A;  1B67 A;  5B24 A;  1HTA A;  4BBR I;  5F99 A;  3HOV I;  4QLC A;  1ZLA B;  3MGR A;  5DNM A;  4NB9 A;  3HOZ I;  3AZN B;  1RO4 A;  3BG0 B;  1VQM Z;  1Q7Y 1;  5G49 A;  2QKD A;  2IO5 C;  3AV1 C;  1M1A D;  3MGP C;  4WNN A;  5DNN C;  4LD9 B;  5AVC A;  5B2J C;  3G6E Z;  1P3I C;  2Y2M A;  1P3B B;  1P9N A;  4XZQ B;  3AYW C;  3KIH A;  3C1C D;  3REH B;  3VH5 A;  5GT3 C;  5T67 A;  1YI2 1;  1JJ2 Z;  3NH4 A;  3AZI D;  3REL B;  1I6H I;  3WTP A;  5A2Q b;  1BH8 A;  3W99 D;  3KUY B;  1YUK A;  5T6B A;  4A3D I;  3VH6 W;  4ZBJ C;  4RVF A;  1K73 2;  3MVD C;  3B6G D;  3KWQ B;  3LZ1 A;  1KX3 D;  5C3I B;  4YM6 B;  1VQO Z;  2OTL 1;  3EPK A;  2CV5 C;  1M1A C;  2WAQ A;  4NBE A;  2ARO B;  5CM2 M;  1VQ4 Z;  3WA9 D;  3AZN C;  2YAD A;  4Z5T C;  1P34 B;  3CCR Z;  4H9O B;  4WU8 D;  3B6F A;  4X6A I;  4G91 C;  1Y1V S;  4H9R A;  5CHL B;  3REJ A;  3IFU A;  5AVB C;  3UT9 C;  5D1P A;  2RHB A;  1KX4 D;  1HQ3 A;  3F6T A;  2GTH A;  5B2J B;  4MD9 A;  3A6N A;  3NQU B;  1PZR A;  3EG5 B;  4XZQ A;  4J8V D;  1P3P D;  5AY8 A;  3MNN C;  4KGC A;  1WII A;  3W98 B;  5AV6 C;  4XZQ D;  3LUS A;  3AZN D;  4MD7 A;  3UTB A;  4XUJ C;  1TAF A;  2JMO A;  2OZK A;  5B1M C;  3CCL 1;  3S2H I;  5CPK C;  2NQB B;  3MGQ B;  3KSY A;  1M19 B;  3B6F D;  4HGA B;  3X1S A;  3EPL A;  1S32 B;  3CCJ 1;  3WA9 A;  3NDI A;  1K8A 1;  2ARO A;  4JJN C;  2F8N D;  4AWL C;  3CCU 1;  2Y2P A;  5B0Y B;  1VQM 1;  1KU5 A;  5F99 B;  2Y2K A;  3W99 C;  1ZLA A;  4J8W D;  3VB9 A;  3P5J B;  5E5A C;  3MON A;  2PYO A;  3REL C;  4H9R B;  5GT3 D;  3CCV Z;  3C1C C;  3B6G A;  4A3G I;  4BY7 I;  2W03 A;  3WAA B;  4CL1 A;  3LEL D;  3AN2 D;  3AV2 B;  1RLY A;  1Q82 1;  4A3L I;  4NE5 A;  1YJ9 1;  5JRG C;  4YM6 D;  3PO3 I;  3WTP D;  5AY8 B;  1BH9 B;  3AZF B;  3X1V C;  4KUD B;  3W98 A;  2R6M A;  1VQ8 1;  2ARO D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...