2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
b'KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
5GT0B 2PYOD 4KUDB 4NBCA 3V9RB 5CPJD 4J8UA 2F4OA 2E2II 3VMGA 1BH9B 1P34A 3CCSZ 3AV1A 4A3JI 3MVDA 2NZDA 1YITZ 5GT0A 3AZKA 1AOIC 1TZYC 2QR1B 5CHLB 2LY8A 1TWFI 3LZ0B 1Y1VS 5AV8B 3D6WA 4J8UC 3F3PC 1M1AD 1F66C 1Z03A 3J81b 3MVDC 2G5IC 4DK1A 3NH8A 3UT9B 5GT0C 3WA9A 3C1BB 4KUDC 3LZ0A 5T6BA 1NJI2 5B1MD 3I56Z 4J8XC 1ZLAD 3B0BA 3AZID 2V8IA 2JIOA 1YI21 1K732 1T3UA 4G91B 1KRLA 3UT9A 1EQZB 3C1BA 3IF8A 3LZ0C 5AV8C 1QXFA 5BNXB 4J8UD 3K7AI 2Y2JA 1YHQ1 3NH4A 1P34D 4XZQC 2GTHA 1EQZA 3D2LA 2ZY3A 5B2JB 3AV1D 4JJNB 2G5HC 3MVDD 3UT9C 3C1BC 3X1VB 2NZDD 3J80f 4Z5TA 5GT0D 1P3LC 3AZKD 3FKII 5AY8B 4UUZB 3CCUZ 5AV5A 4J8VB 1M902 1VQKZ 2F8NH 1RO0A 4E2YA 2OTJZ 4YS3B 1Y1WI 4JJNA 2Q4ZA 4CSRB 3X1VA 5B32A 4WU9C 1P3MA 1YJW1 4Y52I 2JE5A 4UUZA 3WA9D 4J8VA 3LZ0D 2HF1A 3G6EZ 3CCEZ 3CQZI 3IFUA 5B2JC 3J7A4 4A3GI 3AN2A 3TU4A 4LD9B 3X1VC 5T67A 4A3BI 3UT9D 1NUIA 2P28A 3NH5A 3C1BD 3G711 2K3RA 1S7MA 3CCJZ 1VQN1 5AY8C 2JA6I 4J8VC 1P9NA 3CC21 1VQ41 1W2BY 3RZDI 4YS3C 3QWUA 2L5AA 1VQM1 4LD9A 2AKLA 4X23B 2E9HA 1EQZD 3CME1 4EO5B 2AROB 3GCFA 4X6AI 1FDOA 4Z5TD 3MNNB 3B0CT 5AV5D 5DNMB 1P3AA 1QVFY 2F8NB 4X23A 3LZ1C 3KXBB 2KI7B 4LD9C 5DNNB 3S2HI 1TAFB 2KPIA 2AROA 2UWXA 4JJND 3X1VD 3F3FC 5B32D 3WAAA 3GTOI 1P3MD 1WWIA 5C3EI 3MNNA 3GKQA 2O4HA 4H9QB 2OZKA 5C4JI 2F8NA 1KC81 3O62B 4S1TA 1N1JB 4KGCB 3KXBA 1R4VA 5GT3B 5DNNA 5B33B 2FFFB 4X23C 3CCL1 5AV9B 1RNIA 2R7ZI 1DL6A 4EO5C 2AROC 3AN2D 3TU4D 2OOXB 2QRDB 3WKJC 4H9QA 2QKDA 3MNNC 3KWQB 2FJ7C 2Y0SA 2I3CA 4RV9A 1N1JA 5DNMC 5B31G 4KGCA 1JJ2Y 5GT3A 3A6NA 2Y2NA 4XUJA 5AV9A 3J81f 1S72Z 4E30A 3CCS1 3GTMS 4LD9D 1P3GB 1USPA 2Y2GA 2PYOB 3KWQA 2Y2LA 4H9OB 4MRIA 2RT9A 3O62C 1TWCI 1BH8B 3EPJA 5B33C 5GT3C 1P3AD 4KHAA 3CCQ1 2YU9I 1PFTA 3D9XA 4X23D 1P3GA 4MONA 3GTKI 2P3YA 3REIA 2AROD 4H9OA 5B0ZB 3CMAZ 3S1NI 3WAAD 2JR6A 2W03A 1A7WA 1VQ51 3MNND 4MD7A 3CC4Z 1VLAA 3X1UA 1Q821 2GTIA 2F8ND 3LJAA 3Q87A 1W2EA 3KXBD 5DNND 1P3GC 5B0ZA 2YADA 3AZMA 2PYOC 4NBAA 3NQUB 4BY1I 5B1MB 3CCRZ 3AZHA 1ZLAB 2JCHA 3AZIB 1WIIA 4A93I 2YFVB 5JRGA 3RELB 5GT3D 3AZFA 3A6ND 1P3KB 4XUJD 3W99A 5AV9D 1WCMI 3KSYA 5CP6A 1ZLAA 1QYPA 1M1K1 3MGQB 3KWQD 5LL6f 2OTJ1 3RELA 1P3KA 4NFRA 2QA4Z 4NE6A 3W97B 2J6AA 1P34B 3CXCY 1VQ6Z 1QVGY 3AZLA 3NDIA 5AV6D 3AV1B 1P3GD 2IZ4A 2NZDB 5BS7A 2NVXI 2JSSA 3VH5W 3FDDA 3HOUI 5B1MC 3MGQA 3REID 3AZKB 1ZLAC 2VQRA 3CPWZ 3AZGB 3AZIC 1N8R1 3CCE1 3W97A 1VQ8Z 4Z2MH 3X1UD 3OW2Z 4A3EI 3LJAD 3MGRA 3REKB 5FLMI 1YJ9Z 2HU9A 5B0ZD 3AZMD 3WA9B 2QEXZ 3MGQC 3AZGA 1YJNZ 3AZJD 3CCVZ 5E5AA 3AZHD 2LIYA 1KQSZ 3W97C 1HQ3A 1P34C 2XD5A 1ID3A 1Q812 3REKA 3W99D 5JRGD 3AV1C 3AZFD 2ZY2A 1WJ2A 1H3OB 2NZDC 1X3WA 3HOVI 3EERA 3AZKC 5B0YB 3AZGC 5CP6D 4BXXI 3AZEA 1M19B 4ZBJB 1VQL1 1NP6A 3RELD 3UTAB 1P3KD 4NFTA 4G92B 1H3OA 3REKC 3AZLD 3FQQA 5B24B 4E2ZA 1YIJZ 3WA9C 5B0YA 4TNUA 3VB9A 3G4S1 4Z5TB 3MGQD 1M19A 2QREB 3EPKA 4NBBA 3CC7Z 5GXQB 5AV5B 3UTAA 2DE6A 2V8KA 2VUGA 3W97D 5B24A 3U50C 1L1OC 3MGRD 3A1IA 4Z66B 5B32B 5IT9b 1Q811 1P3MB 3S16I 1YUAA 2JMOA 1SIWA 5B40B 5GXQA 4ZBJC 3UTBA 3AZGD 1M19C 4E32A 2JA7I 5E5AD 3S15I 1S721 1KD11 1HQ3D 4G91C 5T64A 1ID3D 1EQZC 3REKD 2NVTI 4Z66A 2ZAEB 3AN2B 3TU4B 4Z5TC 5B40A 4E44A 1S32A 1VQO1 1X3ZA 5GXQC 5AV5C 4E45A 3AZED 2O53A 1RO2A 3VH6W 4BY7I 4M6BA 4JJNC 4E2XA 4YM6A 3S1QI 5B32C 3JAMb 1KC82 1P3MC 1VQP1 1F1EA 3PO2I 3T4NB 2NAPA 5B0YD 5B40C 3AZNA 3X1SA 3HOYI 1M19D 3CC41 1P3AB 3UTAD 4R8PB 2M6NA 2VPYA 3AN2C 5B31A 5B24D 3TU4C 5BNVB 1X0TA 3RZOI 3WAAB 2VPWA 3S1RI 3W96B 2ZY5A 3AFAA 2GU2A 5GXQD 3I551 3UTBD 4R8PA 3VTNA 4EWCA 2RIQA 4A3II 5BNVA 2BYMB 3KIHA 2IO5B 4Z66D 4WZSB 2J8PA 3MGSB 3B6GC 4J8WA 2WB1A 3NQJA 3W96A 5B40D 1S32D 1LQLA 4E2WA 1P3AC 3S17I 1VQ61 4R8PC 3A6NB 4XUJB 3REJD 4BBRI 2BYMA 4HGZA 3GTGI 2HUEB 3MGSA 4YM6D 1Q822 1USPB 3WAAC 2ZM5A 2Y2KA 5D1OA 1VQ7Z 3W96C 4A3LI 3LUSA 3I4MI 3AZND 2BJOA 2VPXA 3X1SD 3B6GA 1VQ81 3CPWY 4E33A 3HOXI 3KXBC 4RVHA 5DNNC 4KHAB 5AV6B 2F4MA 1YIT1 1YJ91 2IO5C 3EPLA 1P3ID 3OW2Y 5BO0B 5B31D 2DE7A 5A2Qb 3REIB 2E2HI 2B63I 1YJN1 1M18D 2JIQA 2QRCB 4KGCC 3BG0B 3AFAD 3X1UB 3A6NC 3W98D 4XUJC 5AV6A 5AV9C 1Z01A 4R8PD 1P3BB 3GTQI 2HUEC 3LJAB 1M1K2 1KQSY 5BO0A 1TWGI 4CAYB 3AZMB 3KWQC 2Q51A 1B67A 4J8WD 1RLYA 3AZJB 3W96D 3I561 3AZHB 5IT9f 1R9TI 3LELA 2JA8I 1KX3A 3CCMZ 1P3BA 3R45B 5AVBB 5JRGB 3H0RC 5AV6C 3AZFB 3W99B 2NQBB 4CAYA 2PMZA 4NB8A 1N8R2 3MGSD 1KU5A 3REIC 2RBLA 3PO3I 1ML8A 3MGPB 3AZJA 1YJWZ 5CP6B 1Q861 2NVQI 3CC71 3R45A 3X1UC 5AVBA 1P3FB 1FDIA 2NQBA 1P3BC 3B6GD 3LJAC 2F2AC 3X1TA 2F8NK 1TWHI 2R93I 5F99A 3WTPD 3AZLB 5B0ZC 3CD6Z 4NE5A 3MGPA 3AZMC 4RVGA 1P3OA 3AZJC 2F8NG 3G71Z 3AZHC 5B1LB 3B6FB 3MZLB 3CCU1 1VQK1 1P3FA 4A3MI 2YFWA 1W2BZ 5B2IA 3W99C 5JRGC 1P3PA 3AZFC 2NQBC 3CC2Z 5C3IB 3JAMf 3MGRB 3VH5A 1VQ9Z 1WZNA 4NBEA 5B1LA 5CP6C 5CPIA 3B6FA 4NB9A 1YUKA 4QTTA 2JNYA 3G6E1 4RS4A 5E5AB 3RELC 1P3KC 3M4OI 3LELD 1KX3D 1HQ3B 1ULYA 4MD8A 1P3BD 1ID3B 3AZLC 5AVCA 3HKZA 4HGAB 4UPKA 5BS7C 5CPKB 4H9RA 3CCJ1 3I4NI 2Y2HA 3WTPE 3B6FC 2E7ZA 1TFIA 2V45A 3I07A 1I50I 3AZEB 2JIRA 5AVBD 2RPRA 5C3IC 1F66B 2NQBD 3MGRC 2VF1A 4ZUXB 3X1TD 5CPKA 1RQFA 4A3CI 5F99D 4WJ3C 1AA6A 1I6HI 2R92I 3MGPD 1KD12 1AOIA 1TZYA 3EG5B 3VH5T 2DQNC 3A1KA 5E5AC 5KDMB 3AYWB 1P3OD 2FJ7A 2V8JA 3M3YI 1HQ3C 1P3FD 1F66A 4J8XB 5JA4B 1ID3C 5B2ID 4ZUXA 1P3PD 1KX4B 4HGAC 1Q7Y1 5CPKC 2PM9A 3IX0A 3TE5B 4BBSI 5BT1C 5KDMA 3AYWA 4KUDA 5B1LD 3V9RA 5CPID 3B6FD 3AZEC 4AYBA 4NBFA 5IP7I 3UTBB 4J8XA 5JA4A 1BH9A 1BFMA 1KX4A 4MXUA 4RVFA 4ZUXC 4Y7NI 3CCQZ 4DRBA 5A2Qf 3GTMI 5AVCD 4XZQB 4A3FI 5B0YC 2OTLZ 4QLCB 3F6TA 1VQ71 1K9M1 1S32B 3AYWC 2DE5A 3HOWI 2G2KA 5AV8A 1K8A1 3UTAC 1P3LB 4G92C 4KGCD 1VQ5Z 1B6WA 3REJB 2R6MA 4MD9A 1KX4C 5B24C 4XZQA 2WAQA 4YM6B 5CPKD 4QLCA 2H85A 5BT1D 4WU9B 3MONA 3REHB 3AZNB 1P3LA 3UTBC 1TZYD 1AOID 3X1SB 3REJA 1U35B 1WWSA 3VH6A 3TDHB 5D1PA 1F66D 4ZUXD 4Z66C 1P3IB 1QF8A 2RHBA 5B31B 3CMA1 3PO3S 4WU9A 4QLCC 3FQMA 3REHA 4NBDA 1S32C 1M18B 4KUDD 3AYWD 1U35A 4HGYA 5BNXA 3AFAB 2CV5B 3W98B 3CXCZ 3REJC 4J8XD 1Q16A 3CCM1 1QVGZ 1P3IA 2ZY4A 5FLXb 1KX4D 1NJI1 4YM6C 5B2JA 3H0GI 1M18A 4MH4A 2E2JI 4J8WB 3REHC 3NQJB 3AZNC 3ESWA 4QTUA 2W04A 1K731 3X1SC 5AY8A 2CV5A 3B0CW 3W98A 1U35C 5AV8D 3NDJA 5C4XI 4YS3A 1Q9CA 4WU8B 1P3IC 3GTJI 4HH4A 3VH6T 5B31C 4CSRA 3LZ1B 4XZQD 1ZB9A 4NBHA 1KX5B 3EEDA 3CD61 3GTLI 4QLCD 1M18C 2LFUA 5D1OB 3AFAC 2CV5C 2CWEA 4H9NB 4AWLB 1P3LD 3W98C 3B6GB 3KIFA 2QA41 4WU8A 3AV2B 3LZ1A 3H0MC 3WTPB 2Y2MA 5CM2M 1KX5A 1M901 2VPZA 4WV4B 2HIOB 1VQ91 4J8WC 4WU9D 3REHD 3S2DI 4H9NA 2Y2OA 4Z2MG 3WKJB 3EPHA 5GSUB 1U35D 1Y1VI 2IV2X 3S14I 3AV2A 2W8SA 5B32G 5FUGB 3WTPA 4WU8C 2FJ7B 3P5JB 3KUYB 1YI2Z 4CL1A 1VQLZ 3MGSC 2HIOA 1Q862 1KX5C 2JA5I 2EGTA 5B2JD 5C44I 2QEX1 4NBGA 3WKJA 3CCV1 3G4SZ 5GSUA 2NVYI 4AWLC 2CV5D 5AY8D 3LELB 5FUGA 3C1CB 5DNMA 4J8VD 1KX3B 3KUYA 3AV2C 3AL0C 3CCR1 1YHQZ 3WTPC 2Y2QA 4YS3D 1TAFA 2HIOC 3H3VJ 2JUBA 4DQYB 1N2FA 3C1CA 1Z2CB 1JFIB 5GSUC 3H0LC 3O62A 4DGLA 5B33A 2BG1A 3KUYC 4WU8D 3X1TB 1YIJ1 3LZ1D 5F99B 1Z02A 1KX5D 1P3OB 1JFIA 3J80b 2Y2PA 1VQOZ 3LELC 3C1CC 5CPJB 1KX3C 2OOYB 3HOZI 2YFWB 2PK7A 3NFZA 4A3DI 2QLVB 5B2IB 4RVDA 4WNNB 3AV2D 1P3PB 2IZ3A 1JJ2Z 1ZB8A 2HIOD 2OTL1 2PYOA 2AYDA 1VQPZ 5CPIB 5CPJA 2DF4C 1VQNZ 2BYKB 3WKJD 2K5RA 2JIPA 5GSUD 1BH8A 5AVBC 4WNNA 3B0DB 1M1AB 2FJ7D 1ZH1A 1VQ4Z 5DNMD 4NH1C 3X1TC 3KUYD 2RVQC 2JIMA 3VMHA 5F99C 2LEXA 1VQMZ 5AVCB 3MGPC 3CMEZ 1P3OC 4H9RB 3KFUG 2BYKA 1JWHC 3S1MI 5CPJC 1QVFZ 1P3FC 1Q7Y2 1M1AA 3C1CD 4H9PB 5B2IC 2VUMI 3I55Z 1P3PC 1WW9A 1PZRA 3O62D 3MZKB 5FLXf 5B33D 1I3QI 4H9SA 3IP4C 5B1LC 5CPIC 1HTAA 3NQUA 5B1MA 1AOIB 1K83I 1TZYB 4H9PA 5G49B 4DRAA 2M48A 3BG1B 5IP9I 3AZIA 3B0DC 2Y2IA 1M1AC 3VMIA 1Y8CA 4J8UB 2YFVA 2JS4A 5AN9F 3IR7A 1SFOI 3CCLZ 1K9M2 4E31A 5AVCC 2RVQD 4NOZA 3GTPI 2XD1A 4NE3A 4XX2A 4A3KI 1K8A2 1TWAI 3MVDB 4H9SC 1RO4A 2V3VA 5G49A
chains in the Genus database with same CATH topology
5GT0B 2PYOD 4KUDB 4NBCA 3V9RB 5CPJD 4J8UA 2F4OA 2E2II 3VMGA 1BH9B 1P34A 3CCSZ 3AV1A 4A3JI 3MVDA 2NZDA 1YITZ 5GT0A 3AZKA 1AOIC 1TZYC 2QR1B 5CHLB 2LY8A 1TWFI 3LZ0B 1Y1VS 5AV8B 3D6WA 4J8UC 3F3PC 1M1AD 1F66C 1Z03A 3J81b 3MVDC 2G5IC 4DK1A 3NH8A 3UT9B 5GT0C 3WA9A 3C1BB 4KUDC 3LZ0A 5T6BA 1NJI2 5B1MD 3I56Z 4J8XC 1ZLAD 3B0BA 3AZID 2V8IA 1YI21 1K732 1T3UA 4G91B 1KRLA 3UT9A 1EQZB 3C1BA 3IF8A 3LZ0C 5AV8C 5BNXB 4J8UD 3K7AI 2Y2JA 1YHQ1 3NH4A 1P34D 4XZQC 2GTHA 1EQZA 2ZY3A 5B2JB 3AV1D 4JJNB 2G5HC 3MVDD 3UT9C 3C1BC 3X1VB 2NZDD 3J80f 4Z5TA 5GT0D 1P3LC 3AZKD 3FKII 5AY8B 4UUZB 3CCUZ 5AV5A 4J8VB 1M902 1VQKZ 2F8NH 1RO0A 4E2YA 2OTJZ 4YS3B 1Y1WI 4JJNA 2Q4ZA 4CSRB 3X1VA 5B32A 4WU9C 1P3MA 1YJW1 4Y52I 2JE5A 4UUZA 3WA9D 4J8VA 3LZ0D 2HF1A 3G6EZ 3CCEZ 3CQZI 3IFUA 5B2JC 3J7A4 4A3GI 3AN2A 3TU4A 4LD9B 3X1VC 5T67A 4A3BI 3UT9D 1NUIA 2P28A 3NH5A 3C1BD 3G711 2K3RA 1S7MA 3CCJZ 1VQN1 5AY8C 2JA6I 4J8VC 1P9NA 3CC21 1VQ41 1W2BY 3RZDI 4YS3C 3QWUA 2L5AA 1VQM1 4LD9A 2AKLA 4X23B 2E9HA 1EQZD 3CME1 4EO5B 2AROB 3GCFA 4X6AI 4Z5TD 3MNNB 3B0CT 5AV5D 5DNMB 1P3AA 1QVFY 2F8NB 4X23A 3LZ1C 3KXBB 2KI7B 4LD9C 5DNNB 3S2HI 1TAFB 2KPIA 2AROA 2UWXA 4JJND 3X1VD 3F3FC 5B32D 3WAAA 3GTOI 1P3MD 1WWIA 5C3EI 3MNNA 3GKQA 2O4HA 4H9QB 2OZKA 5C4JI 2F8NA 1KC81 3O62B 4S1TA 1N1JB 4KGCB 3KXBA 1R4VA 5GT3B 5DNNA 5B33B 2FFFB 4X23C 3CCL1 5AV9B 1RNIA 2R7ZI 1DL6A 4EO5C 2AROC 3AN2D 3TU4D 2OOXB 2QRDB 3WKJC 4H9QA 2QKDA 3MNNC 3KWQB 2FJ7C 2Y0SA 2I3CA 4RV9A 1N1JA 5DNMC 5B31G 4KGCA 1JJ2Y 5GT3A 3A6NA 2Y2NA 4XUJA 5AV9A 3J81f 1S72Z 4E30A 3CCS1 3GTMS 4LD9D 1P3GB 1USPA 2Y2GA 2PYOB 3KWQA 2Y2LA 4H9OB 4MRIA 2RT9A 3O62C 1TWCI 1BH8B 3EPJA 5B33C 5GT3C 1P3AD 4KHAA 3CCQ1 2YU9I 1PFTA 3D9XA 4X23D 1P3GA 4MONA 3GTKI 2P3YA 3REIA 2AROD 4H9OA 5B0ZB 3CMAZ 3S1NI 3WAAD 2JR6A 2W03A 1A7WA 1VQ51 3MNND 4MD7A 3CC4Z 1VLAA 3X1UA 1Q821 2GTIA 2F8ND 3LJAA 3Q87A 1W2EA 3KXBD 5DNND 1P3GC 5B0ZA 2YADA 3AZMA 2PYOC 4NBAA 3NQUB 4BY1I 5B1MB 3AZHA 1ZLAB 2JCHA 3AZIB 1WIIA 4A93I 2YFVB 5JRGA 3RELB 5GT3D 3AZFA 3A6ND 1P3KB 4XUJD 3W99A 5AV9D 1WCMI 3KSYA 5CP6A 1ZLAA 1QYPA 1M1K1 3MGQB 3KWQD 5LL6f 2OTJ1 3RELA 1P3KA 4NFRA 2QA4Z 4NE6A 3W97B 2J6AA 1P34B 3CXCY 1VQ6Z 1QVGY 3AZLA 3NDIA 5AV6D 3AV1B 1P3GD 2IZ4A 2NZDB 5BS7A 2NVXI 2JSSA 3VH5W 3FDDA 3HOUI 5B1MC 3MGQA 3REID 3AZKB 1ZLAC 2VQRA 3CPWZ 3AZGB 3AZIC 1N8R1 3CCE1 3W97A 1VQ8Z 4Z2MH 3X1UD 3OW2Z 4A3EI 3LJAD 3MGRA 3REKB 5FLMI 1YJ9Z 2HU9A 5B0ZD 3AZMD 3WA9B 2QEXZ 3MGQC 3AZGA 1YJNZ 3AZJD 3CCVZ 5E5AA 3AZHD 2LIYA 1KQSZ 3W97C 1HQ3A 1P34C 2XD5A 1ID3A 1Q812 3REKA 3W99D 5JRGD 3AV1C 3AZFD 2ZY2A 3CCRZ 1H3OB 2NZDC 1X3WA 3HOVI 3EERA 3AZKC 5B0YB 3AZGC 5CP6D 4BXXI 3AZEA 1M19B 4ZBJB 1VQL1 1NP6A 3RELD 3UTAB 1P3KD 4NFTA 4G92B 1H3OA 3REKC 3AZLD 3FQQA 5B24B 4E2ZA 1YIJZ 3WA9C 5B0YA 4TNUA 3VB9A 3G4S1 4Z5TB 3MGQD 1M19A 2QREB 3EPKA 4NBBA 3CC7Z 5GXQB 5AV5B 3UTAA 2DE6A 2V8KA 2VUGA 3W97D 5B24A 3U50C 1L1OC 3MGRD 3A1IA 4Z66B 5B32B 5IT9b 1Q811 1P3MB 3S16I 1YUAA 2JMOA 4E32A 5B40B 5GXQA 4ZBJC 3UTBA 3AZGD 1M19C 2JA7I 5E5AD 3S15I 1S721 1KD11 1HQ3D 4G91C 5T64A 1ID3D 1EQZC 3REKD 2NVTI 4Z66A 2ZAEB 3AN2B 3TU4B 4Z5TC 5B40A 4E44A 1S32A 1VQO1 1X3ZA 5GXQC 5AV5C 4E45A 3AZED 2O53A 1RO2A 3VH6W 4BY7I 4M6BA 4JJNC 4E2XA 4YM6A 3S1QI 5B32C 3JAMb 1KC82 1P3MC 1VQP1 1F1EA 3PO2I 3T4NB 5B0YD 5B40C 3AZNA 3X1SA 3HOYI 1M19D 3CC41 1P3AB 3UTAD 4R8PB 2M6NA 3AN2C 5B31A 5B24D 3TU4C 5BNVB 1X0TA 3RZOI 3WAAB 3S1RI 3W96B 2ZY5A 3AFAA 2GU2A 5GXQD 3I551 3UTBD 4R8PA 3VTNA 4EWCA 2RIQA 4A3II 5BNVA 2BYMB 2IO5B 4Z66D 4WZSB 2J8PA 3MGSB 3B6GC 4J8WA 2WB1A 3NQJA 3W96A 5B40D 1S32D 1LQLA 4E2WA 1P3AC 3S17I 1VQ61 4R8PC 3A6NB 4XUJB 3REJD 4BBRI 2BYMA 4HGZA 3GTGI 2HUEB 3MGSA 4YM6D 1Q822 1USPB 3WAAC 2ZM5A 2Y2KA 5D1OA 1VQ7Z 3W96C 4A3LI 3LUSA 3I4MI 3AZND 2BJOA 3X1SD 3B6GA 1VQ81 3CPWY 4E33A 3HOXI 3KXBC 4RVHA 5DNNC 4KHAB 5AV6B 2F4MA 1YIT1 1YJ91 2IO5C 3EPLA 1P3ID 3OW2Y 5BO0B 5B31D 2DE7A 5A2Qb 3REIB 2E2HI 2B63I 1YJN1 1M18D 2QRCB 4KGCC 3BG0B 3AFAD 3X1UB 3A6NC 3W98D 4XUJC 5AV6A 5AV9C 1Z01A 4R8PD 1P3BB 3GTQI 2HUEC 3LJAB 1M1K2 1KQSY 5BO0A 1TWGI 4CAYB 3AZMB 3KWQC 2Q51A 1B67A 4J8WD 1RLYA 3AZJB 3W96D 3I561 3AZHB 5IT9f 1R9TI 3LELA 2JA8I 1KX3A 3CCMZ 1P3BA 3R45B 5AVBB 5JRGB 3H0RC 5AV6C 3AZFB 3W99B 2NQBB 4CAYA 2PMZA 4NB8A 1N8R2 3MGSD 1KU5A 3REIC 2RBLA 3PO3I 1ML8A 3MGPB 3AZJA 1YJWZ 5CP6B 1Q861 2NVQI 3CC71 3R45A 3X1UC 5AVBA 1P3FB 2NQBA 1P3BC 3B6GD 3LJAC 2F2AC 3X1TA 2F8NK 1TWHI 2R93I 5F99A 3WTPD 3AZLB 5B0ZC 3CD6Z 4NE5A 3MGPA 3AZMC 4RVGA 1P3OA 3AZJC 2F8NG 3G71Z 3AZHC 5B1LB 3B6FB 3MZLB 3CCU1 1VQK1 1P3FA 4A3MI 2YFWA 1W2BZ 5B2IA 3W99C 5JRGC 1P3PA 3AZFC 2NQBC 3CC2Z 5C3IB 3JAMf 3MGRB 3VH5A 1VQ9Z 4NBEA 5B1LA 5CP6C 5CPIA 3B6FA 4NB9A 1YUKA 4QTTA 2JNYA 3G6E1 4RS4A 5E5AB 3RELC 1P3KC 3M4OI 3LELD 1KX3D 1HQ3B 1ULYA 4MD8A 1P3BD 1ID3B 3AZLC 5AVCA 3HKZA 4HGAB 4UPKA 5BS7C 5CPKB 4H9RA 3CCJ1 3I4NI 2Y2HA 3WTPE 3B6FC 3I07A 1TFIA 1I50I 3AZEB 5AVBD 2RPRA 5C3IC 1F66B 2NQBD 3MGRC 2VF1A 4ZUXB 3X1TD 5CPKA 1RQFA 4A3CI 5F99D 4WJ3C 2R92I 1I6HI 3MGPD 1KD12 1AOIA 1TZYA 3EG5B 3VH5T 2DQNC 3A1KA 5E5AC 5KDMB 3AYWB 1P3OD 2FJ7A 2V8JA 3M3YI 1HQ3C 1P3FD 1F66A 4J8XB 5JA4B 1ID3C 5B2ID 4ZUXA 1P3PD 1KX4B 4HGAC 1Q7Y1 5CPKC 2PM9A 3IX0A 3TE5B 4BBSI 5BT1C 5KDMA 3AYWA 4KUDA 5B1LD 3V9RA 5CPID 3B6FD 3AZEC 4AYBA 4NBFA 5IP7I 3UTBB 4J8XA 5JA4A 1BH9A 1BFMA 1KX4A 4MXUA 4RVFA 4ZUXC 4Y7NI 3CCQZ 4DRBA 5A2Qf 3GTMI 5AVCD 4XZQB 4A3FI 5B0YC 2OTLZ 4QLCB 3F6TA 1VQ71 1K9M1 1S32B 3AYWC 2DE5A 3HOWI 2G2KA 5AV8A 1K8A1 3UTAC 1P3LB 4G92C 4KGCD 1VQ5Z 1B6WA 3REJB 2R6MA 4MD9A 1KX4C 5B24C 4XZQA 2WAQA 4YM6B 5CPKD 4QLCA 2H85A 5BT1D 4WU9B 3MONA 3REHB 3AZNB 1P3LA 3UTBC 1TZYD 1AOID 3X1SB 3REJA 1U35B 1WWSA 3VH6A 3TDHB 5D1PA 1F66D 4ZUXD 4Z66C 1P3IB 1QF8A 2RHBA 5B31B 3CMA1 3PO3S 4WU9A 4QLCC 3FQMA 3REHA 4NBDA 1S32C 1M18B 4KUDD 3AYWD 1U35A 4HGYA 5BNXA 3AFAB 2CV5B 3W98B 3CXCZ 3REJC 4J8XD 3CCM1 1QVGZ 1P3IA 2ZY4A 5FLXb 1KX4D 1NJI1 4YM6C 5B2JA 3H0GI 1M18A 4MH4A 2E2JI 4J8WB 3REHC 3NQJB 3AZNC 3ESWA 4QTUA 2W04A 1K731 3X1SC 5AY8A 2CV5A 3B0CW 3W98A 1U35C 5AV8D 3NDJA 5C4XI 4YS3A 1Q9CA 4WU8B 1P3IC 3GTJI 4HH4A 3VH6T 5B31C 4CSRA 3LZ1B 4XZQD 1ZB9A 4NBHA 1KX5B 3EEDA 3CD61 3GTLI 4QLCD 1M18C 2LFUA 5D1OB 3AFAC 2CV5C 2CWEA 4H9NB 4AWLB 1P3LD 3W98C 3B6GB 3KIFA 2QA41 4WU8A 3AV2B 3LZ1A 3H0MC 3WTPB 2Y2MA 5CM2M 1KX5A 1M901 4WV4B 2HIOB 1VQ91 4J8WC 4WU9D 3REHD 3S2DI 4H9NA 2Y2OA 4Z2MG 3WKJB 3EPHA 5GSUB 1U35D 1Y1VI 3S14I 3AV2A 2W8SA 5B32G 5FUGB 3WTPA 4WU8C 2FJ7B 3P5JB 3KUYB 1YI2Z 4CL1A 1VQLZ 3MGSC 2HIOA 1Q862 1KX5C 2JA5I 2EGTA 5B2JD 5C44I 2QEX1 4NBGA 3WKJA 3CCV1 3G4SZ 5GSUA 2NVYI 4AWLC 2CV5D 5AY8D 3LELB 5FUGA 3C1CB 5DNMA 4J8VD 1KX3B 3KUYA 3AV2C 3AL0C 3CCR1 1YHQZ 3WTPC 2Y2QA 4YS3D 1TAFA 2HIOC 3H3VJ 2JUBA 4DQYB 1N2FA 3C1CA 1Z2CB 1JFIB 5GSUC 3H0LC 3O62A 4DGLA 5B33A 2BG1A 3KUYC 4WU8D 3X1TB 1YIJ1 3LZ1D 5F99B 1Z02A 1KX5D 1P3OB 1JFIA 3J80b 2Y2PA 1VQOZ 3LELC 3C1CC 5CPJB 1KX3C 2OOYB 3HOZI 2YFWB 2PK7A 3NFZA 4A3DI 2QLVB 5B2IB 4RVDA 4WNNB 3AV2D 1P3PB 2IZ3A 1JJ2Z 1ZB8A 2HIOD 2OTL1 2PYOA 1VQNZ 1VQPZ 5CPIB 5CPJA 2DF4C 2BYKB 3WKJD 2K5RA 5GSUD 1BH8A 5AVBC 4WNNA 3B0DB 1M1AB 2FJ7D 1ZH1A 1VQ4Z 5DNMD 4NH1C 3X1TC 3KUYD 2RVQC 3VMHA 1VQMZ 5F99C 5AVCB 3MGPC 3CMEZ 1P3OC 4H9RB 3KFUG 2BYKA 1JWHC 3S1MI 5CPJC 1QVFZ 1P3FC 1Q7Y2 1M1AA 3C1CD 4H9PB 5B2IC 2VUMI 3I55Z 1P3PC 1WW9A 1PZRA 3O62D 3MZKB 5FLXf 5B33D 1I3QI 4H9SA 3IP4C 5B1LC 5CPIC 1HTAA 3NQUA 5B1MA 1AOIB 1K83I 1TZYB 4H9PA 5G49B 4DRAA 2M48A 3BG1B 5IP9I 3AZIA 3B0DC 2Y2IA 1M1AC 3VMIA 1SFOI 4J8UB 2YFVA 2JS4A 5AN9F 3CCLZ 1K9M2 4E31A 5AVCC 2RVQD 4NOZA 3GTPI 2XD1A 4NE3A 4XX2A 4A3KI 1K8A2 1TWAI 3MVDB 4H9SC 1RO4A 3KIHA 5G49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 5GT0 B;  2PYO D;  4KUD B;  4NBC A;  3V9R B;  5CPJ D;  4J8U A;  2F4O A;  2E2I I;  3VMG A;  1BH9 B;  1P34 A;  3CCS Z;  3AV1 A;  4A3J I;  3MVD A;  2NZD A;  1YIT Z;  5GT0 A;  3AZK A;  1AOI C;  1TZY C;  2QR1 B;  5CHL B;  2LY8 A;  1TWF I;  3LZ0 B;  1Y1V S;  5AV8 B;  3D6W A;  4J8U C;  3F3P C;  1M1A D;  1F66 C;  1Z03 A;  3J81 b;  3MVD C;  2G5I C;  4DK1 A;  3NH8 A;  3UT9 B;  5GT0 C;  3WA9 A;  3C1B B;  4KUD C;  3LZ0 A;  5T6B A;  1NJI 2;  5B1M D;  3I56 Z;  4J8X C;  1ZLA D;  3B0B A;  3AZI D;  2V8I A;  2JIO A;  1YI2 1;  1K73 2;  1T3U A;  4G91 B;  1KRL A;  3UT9 A;  1EQZ B;  3C1B A;  3IF8 A;  3LZ0 C;  5AV8 C;  1QXF A;  5BNX B;  4J8U D;  3K7A I;  2Y2J A;  1YHQ 1;  3NH4 A;  1P34 D;  4XZQ C;  2GTH A;  1EQZ A;  3D2L A;  2ZY3 A;  5B2J B;  3AV1 D;  4JJN B;  2G5H C;  3MVD D;  3UT9 C;  3C1B C;  3X1V B;  2NZD D;  3J80 f;  4Z5T A;  5GT0 D;  1P3L C;  3AZK D;  3FKI I;  5AY8 B;  4UUZ B;  3CCU Z;  5AV5 A;  4J8V B;  1M90 2;  1VQK Z;  2F8N H;  1RO0 A;  4E2Y A;  2OTJ Z;  4YS3 B;  1Y1W I;  4JJN A;  2Q4Z A;  4CSR B;  3X1V A;  5B32 A;  4WU9 C;  1P3M A;  1YJW 1;  4Y52 I;  2JE5 A;  4UUZ A;  3WA9 D;  4J8V A;  3LZ0 D;  2HF1 A;  3G6E Z;  3CCE Z;  3CQZ I;  3IFU A;  5B2J C;  3J7A 4;  4A3G I;  3AN2 A;  3TU4 A;  4LD9 B;  3X1V C;  5T67 A;  4A3B I;  3UT9 D;  1NUI A;  2P28 A;  3NH5 A;  3C1B D;  3G71 1;  2K3R A;  1S7M A;  3CCJ Z;  1VQN 1;  5AY8 C;  2JA6 I;  4J8V C;  1P9N A;  3CC2 1;  1VQ4 1;  1W2B Y;  3RZD I;  4YS3 C;  3QWU A;  2L5A A;  1VQM 1;  4LD9 A;  2AKL A;  4X23 B;  2E9H A;  1EQZ D;  3CME 1;  4EO5 B;  2ARO B;  3GCF A;  4X6A I;  1FDO A;  4Z5T D;  3MNN B;  3B0C T;  5AV5 D;  5DNM B;  1P3A A;  1QVF Y;  2F8N B;  4X23 A;  3LZ1 C;  3KXB B;  2KI7 B;  4LD9 C;  5DNN B;  3S2H I;  1TAF B;  2KPI A;  2ARO A;  2UWX A;  4JJN D;  3X1V D;  3F3F C;  5B32 D;  3WAA A;  3GTO I;  1P3M D;  1WWI A;  5C3E I;  3MNN A;  3GKQ A;  2O4H A;  4H9Q B;  2OZK A;  5C4J I;  2F8N A;  1KC8 1;  3O62 B;  4S1T A;  1N1J B;  4KGC B;  3KXB A;  1R4V A;  5GT3 B;  5DNN A;  5B33 B;  2FFF B;  4X23 C;  3CCL 1;  5AV9 B;  1RNI A;  2R7Z I;  1DL6 A;  4EO5 C;  2ARO C;  3AN2 D;  3TU4 D;  2OOX B;  2QRD B;  3WKJ C;  4H9Q A;  2QKD A;  3MNN C;  3KWQ B;  2FJ7 C;  2Y0S A;  2I3C A;  4RV9 A;  1N1J A;  5DNM C;  5B31 G;  4KGC A;  1JJ2 Y;  5GT3 A;  3A6N A;  2Y2N A;  4XUJ A;  5AV9 A;  3J81 f;  1S72 Z;  4E30 A;  3CCS 1;  3GTM S;  4LD9 D;  1P3G B;  1USP A;  2Y2G A;  2PYO B;  3KWQ A;  2Y2L A;  4H9O B;  4MRI A;  2RT9 A;  3O62 C;  1TWC I;  1BH8 B;  3EPJ A;  5B33 C;  5GT3 C;  1P3A D;  4KHA A;  3CCQ 1;  2YU9 I;  1PFT A;  3D9X A;  4X23 D;  1P3G A;  4MON A;  3GTK I;  2P3Y A;  3REI A;  2ARO D;  4H9O A;  5B0Z B;  3CMA Z;  3S1N I;  3WAA D;  2JR6 A;  2W03 A;  1A7W A;  1VQ5 1;  3MNN D;  4MD7 A;  3CC4 Z;  1VLA A;  3X1U A;  1Q82 1;  2GTI A;  2F8N D;  3LJA A;  3Q87 A;  1W2E A;  3KXB D;  5DNN D;  1P3G C;  5B0Z A;  2YAD A;  3AZM A;  2PYO C;  4NBA A;  3NQU B;  4BY1 I;  5B1M B;  3CCR Z;  3AZH A;  1ZLA B;  2JCH A;  3AZI B;  1WII A;  4A93 I;  2YFV B;  5JRG A;  3REL B;  5GT3 D;  3AZF A;  3A6N D;  1P3K B;  4XUJ D;  3W99 A;  5AV9 D;  1WCM I;  3KSY A;  5CP6 A;  1ZLA A;  1QYP A;  1M1K 1;  3MGQ B;  3KWQ D;  5LL6 f;  2OTJ 1;  3REL A;  1P3K A;  4NFR A;  2QA4 Z;  4NE6 A;  3W97 B;  2J6A A;  1P34 B;  3CXC Y;  1VQ6 Z;  1QVG Y;  3AZL A;  3NDI A;  5AV6 D;  3AV1 B;  1P3G D;  2IZ4 A;  2NZD B;  5BS7 A;  2NVX I;  2JSS A;  3VH5 W;  3FDD A;  3HOU I;  5B1M C;  3MGQ A;  3REI D;  3AZK B;  1ZLA C;  2VQR A;  3CPW Z;  3AZG B;  3AZI C;  1N8R 1;  3CCE 1;  3W97 A;  1VQ8 Z;  4Z2M H;  3X1U D;  3OW2 Z;  4A3E I;  3LJA D;  3MGR A;  3REK B;  5FLM I;  1YJ9 Z;  2HU9 A;  5B0Z D;  3AZM D;  3WA9 B;  2QEX Z;  3MGQ C;  3AZG A;  1YJN Z;  3AZJ D;  3CCV Z;  5E5A A;  3AZH D;  2LIY A;  1KQS Z;  3W97 C;  1HQ3 A;  1P34 C;  2XD5 A;  1ID3 A;  1Q81 2;  3REK A;  3W99 D;  5JRG D;  3AV1 C;  3AZF D;  2ZY2 A;  1WJ2 A;  1H3O B;  2NZD C;  1X3W A;  3HOV I;  3EER A;  3AZK C;  5B0Y B;  3AZG C;  5CP6 D;  4BXX I;  3AZE A;  1M19 B;  4ZBJ B;  1VQL 1;  1NP6 A;  3REL D;  3UTA B;  1P3K D;  4NFT A;  4G92 B;  1H3O A;  3REK C;  3AZL D;  3FQQ A;  5B24 B;  4E2Z A;  1YIJ Z;  3WA9 C;  5B0Y A;  4TNU A;  3VB9 A;  3G4S 1;  4Z5T B;  3MGQ D;  1M19 A;  2QRE B;  3EPK A;  4NBB A;  3CC7 Z;  5GXQ B;  5AV5 B;  3UTA A;  2DE6 A;  2V8K A;  2VUG A;  3W97 D;  5B24 A;  3U50 C;  1L1O C;  3MGR D;  3A1I A;  4Z66 B;  5B32 B;  5IT9 b;  1Q81 1;  1P3M B;  3S16 I;  1YUA A;  2JMO A;  1SIW A;  5B40 B;  5GXQ A;  4ZBJ C;  3UTB A;  3AZG D;  1M19 C;  4E32 A;  2JA7 I;  5E5A D;  3S15 I;  1S72 1;  1KD1 1;  1HQ3 D;  4G91 C;  5T64 A;  1ID3 D;  1EQZ C;  3REK D;  2NVT I;  4Z66 A;  2ZAE B;  3AN2 B;  3TU4 B;  4Z5T C;  5B40 A;  4E44 A;  1S32 A;  1VQO 1;  1X3Z A;  5GXQ C;  5AV5 C;  4E45 A;  3AZE D;  2O53 A;  1RO2 A;  3VH6 W;  4BY7 I;  4M6B A;  4JJN C;  4E2X A;  4YM6 A;  3S1Q I;  5B32 C;  3JAM b;  1KC8 2;  1P3M C;  1VQP 1;  1F1E A;  3PO2 I;  3T4N B;  2NAP A;  5B0Y D;  5B40 C;  3AZN A;  3X1S A;  3HOY I;  1M19 D;  3CC4 1;  1P3A B;  3UTA D;  4R8P B;  2M6N A;  2VPY A;  3AN2 C;  5B31 A;  5B24 D;  3TU4 C;  5BNV B;  1X0T A;  3RZO I;  3WAA B;  2VPW A;  3S1R I;  3W96 B;  2ZY5 A;  3AFA A;  2GU2 A;  5GXQ D;  3I55 1;  3UTB D;  4R8P A;  3VTN A;  4EWC A;  2RIQ A;  4A3I I;  5BNV A;  2BYM B;  3KIH A;  2IO5 B;  4Z66 D;  4WZS B;  2J8P A;  3MGS B;  3B6G C;  4J8W A;  2WB1 A;  3NQJ A;  3W96 A;  5B40 D;  1S32 D;  1LQL A;  4E2W A;  1P3A C;  3S17 I;  1VQ6 1;  4R8P C;  3A6N B;  4XUJ B;  3REJ D;  4BBR I;  2BYM A;  4HGZ A;  3GTG I;  2HUE B;  3MGS A;  4YM6 D;  1Q82 2;  1USP B;  3WAA C;  2ZM5 A;  2Y2K A;  5D1O A;  1VQ7 Z;  3W96 C;  4A3L I;  3LUS A;  3I4M I;  3AZN D;  2BJO A;  2VPX A;  3X1S D;  3B6G A;  1VQ8 1;  3CPW Y;  4E33 A;  3HOX I;  3KXB C;  4RVH A;  5DNN C;  4KHA B;  5AV6 B;  2F4M A;  1YIT 1;  1YJ9 1;  2IO5 C;  3EPL A;  1P3I D;  3OW2 Y;  5BO0 B;  5B31 D;  2DE7 A;  5A2Q b;  3REI B;  2E2H I;  2B63 I;  1YJN 1;  1M18 D;  2JIQ A;  2QRC B;  4KGC C;  3BG0 B;  3AFA D;  3X1U B;  3A6N C;  3W98 D;  4XUJ C;  5AV6 A;  5AV9 C;  1Z01 A;  4R8P D;  1P3B B;  3GTQ I;  2HUE C;  3LJA B;  1M1K 2;  1KQS Y;  5BO0 A;  1TWG I;  4CAY B;  3AZM B;  3KWQ C;  2Q51 A;  1B67 A;  4J8W D;  1RLY A;  3AZJ B;  3W96 D;  3I56 1;  3AZH B;  5IT9 f;  1R9T I;  3LEL A;  2JA8 I;  1KX3 A;  3CCM Z;  1P3B A;  3R45 B;  5AVB B;  5JRG B;  3H0R C;  5AV6 C;  3AZF B;  3W99 B;  2NQB B;  4CAY A;  2PMZ A;  4NB8 A;  1N8R 2;  3MGS D;  1KU5 A;  3REI C;  2RBL A;  3PO3 I;  1ML8 A;  3MGP B;  3AZJ A;  1YJW Z;  5CP6 B;  1Q86 1;  2NVQ I;  3CC7 1;  3R45 A;  3X1U C;  5AVB A;  1P3F B;  1FDI A;  2NQB A;  1P3B C;  3B6G D;  3LJA C;  2F2A C;  3X1T A;  2F8N K;  1TWH I;  2R93 I;  5F99 A;  3WTP D;  3AZL B;  5B0Z C;  3CD6 Z;  4NE5 A;  3MGP A;  3AZM C;  4RVG A;  1P3O A;  3AZJ C;  2F8N G;  3G71 Z;  3AZH C;  5B1L B;  3B6F B;  3MZL B;  3CCU 1;  1VQK 1;  1P3F A;  4A3M I;  2YFW A;  1W2B Z;  5B2I A;  3W99 C;  5JRG C;  1P3P A;  3AZF C;  2NQB C;  3CC2 Z;  5C3I B;  3JAM f;  3MGR B;  3VH5 A;  1VQ9 Z;  1WZN A;  4NBE A;  5B1L A;  5CP6 C;  5CPI A;  3B6F A;  4NB9 A;  1YUK A;  4QTT A;  2JNY A;  3G6E 1;  4RS4 A;  5E5A B;  3REL C;  1P3K C;  3M4O I;  3LEL D;  1KX3 D;  1HQ3 B;  1ULY A;  4MD8 A;  1P3B D;  1ID3 B;  3AZL C;  5AVC A;  3HKZ A;  4HGA B;  4UPK A;  5BS7 C;  5CPK B;  4H9R A;  3CCJ 1;  3I4N I;  2Y2H A;  3WTP E;  3B6F C;  2E7Z A;  1TFI A;  2V45 A;  3I07 A;  1I50 I;  3AZE B;  2JIR A;  5AVB D;  2RPR A;  5C3I C;  1F66 B;  2NQB D;  3MGR C;  2VF1 A;  4ZUX B;  3X1T D;  5CPK A;  1RQF A;  4A3C I;  5F99 D;  4WJ3 C;  1AA6 A;  1I6H I;  2R92 I;  3MGP D;  1KD1 2;  1AOI A;  1TZY A;  3EG5 B;  3VH5 T;  2DQN C;  3A1K A;  5E5A C;  5KDM B;  3AYW B;  1P3O D;  2FJ7 A;  2V8J A;  3M3Y I;  1HQ3 C;  1P3F D;  1F66 A;  4J8X B;  5JA4 B;  1ID3 C;  5B2I D;  4ZUX A;  1P3P D;  1KX4 B;  4HGA C;  1Q7Y 1;  5CPK C;  2PM9 A;  3IX0 A;  3TE5 B;  4BBS I;  5BT1 C;  5KDM A;  3AYW A;  4KUD A;  5B1L D;  3V9R A;  5CPI D;  3B6F D;  3AZE C;  4AYB A;  4NBF A;  5IP7 I;  3UTB B;  4J8X A;  5JA4 A;  1BH9 A;  1BFM A;  1KX4 A;  4MXU A;  4RVF A;  4ZUX C;  4Y7N I;  3CCQ Z;  4DRB A;  5A2Q f;  3GTM I;  5AVC D;  4XZQ B;  4A3F I;  5B0Y C;  2OTL Z;  4QLC B;  3F6T A;  1VQ7 1;  1K9M 1;  1S32 B;  3AYW C;  2DE5 A;  3HOW I;  2G2K A;  5AV8 A;  1K8A 1;  3UTA C;  1P3L B;  4G92 C;  4KGC D;  1VQ5 Z;  1B6W A;  3REJ B;  2R6M A;  4MD9 A;  1KX4 C;  5B24 C;  4XZQ A;  2WAQ A;  4YM6 B;  5CPK D;  4QLC A;  2H85 A;  5BT1 D;  4WU9 B;  3MON A;  3REH B;  3AZN B;  1P3L A;  3UTB C;  1TZY D;  1AOI D;  3X1S B;  3REJ A;  1U35 B;  1WWS A;  3VH6 A;  3TDH B;  5D1P A;  1F66 D;  4ZUX D;  4Z66 C;  1P3I B;  1QF8 A;  2RHB A;  5B31 B;  3CMA 1;  3PO3 S;  4WU9 A;  4QLC C;  3FQM A;  3REH A;  4NBD A;  1S32 C;  1M18 B;  4KUD D;  3AYW D;  1U35 A;  4HGY A;  5BNX A;  3AFA B;  2CV5 B;  3W98 B;  3CXC Z;  3REJ C;  4J8X D;  1Q16 A;  3CCM 1;  1QVG Z;  1P3I A;  2ZY4 A;  5FLX b;  1KX4 D;  1NJI 1;  4YM6 C;  5B2J A;  3H0G I;  1M18 A;  4MH4 A;  2E2J I;  4J8W B;  3REH C;  3NQJ B;  3AZN C;  3ESW A;  4QTU A;  2W04 A;  1K73 1;  3X1S C;  5AY8 A;  2CV5 A;  3B0C W;  3W98 A;  1U35 C;  5AV8 D;  3NDJ A;  5C4X I;  4YS3 A;  1Q9C A;  4WU8 B;  1P3I C;  3GTJ I;  4HH4 A;  3VH6 T;  5B31 C;  4CSR A;  3LZ1 B;  4XZQ D;  1ZB9 A;  4NBH A;  1KX5 B;  3EED A;  3CD6 1;  3GTL I;  4QLC D;  1M18 C;  2LFU A;  5D1O B;  3AFA C;  2CV5 C;  2CWE A;  4H9N B;  4AWL B;  1P3L D;  3W98 C;  3B6G B;  3KIF A;  2QA4 1;  4WU8 A;  3AV2 B;  3LZ1 A;  3H0M C;  3WTP B;  2Y2M A;  5CM2 M;  1KX5 A;  1M90 1;  2VPZ A;  4WV4 B;  2HIO B;  1VQ9 1;  4J8W C;  4WU9 D;  3REH D;  3S2D I;  4H9N A;  2Y2O A;  4Z2M G;  3WKJ B;  3EPH A;  5GSU B;  1U35 D;  1Y1V I;  2IV2 X;  3S14 I;  3AV2 A;  2W8S A;  5B32 G;  5FUG B;  3WTP A;  4WU8 C;  2FJ7 B;  3P5J B;  3KUY B;  1YI2 Z;  4CL1 A;  1VQL Z;  3MGS C;  2HIO A;  1Q86 2;  1KX5 C;  2JA5 I;  2EGT A;  5B2J D;  5C44 I;  2QEX 1;  4NBG A;  3WKJ A;  3CCV 1;  3G4S Z;  5GSU A;  2NVY I;  4AWL C;  2CV5 D;  5AY8 D;  3LEL B;  5FUG A;  3C1C B;  5DNM A;  4J8V D;  1KX3 B;  3KUY A;  3AV2 C;  3AL0 C;  3CCR 1;  1YHQ Z;  3WTP C;  2Y2Q A;  4YS3 D;  1TAF A;  2HIO C;  3H3V J;  2JUB A;  4DQY B;  1N2F A;  3C1C A;  1Z2C B;  1JFI B;  5GSU C;  3H0L C;  3O62 A;  4DGL A;  5B33 A;  2BG1 A;  3KUY C;  4WU8 D;  3X1T B;  1YIJ 1;  3LZ1 D;  5F99 B;  1Z02 A;  1KX5 D;  1P3O B;  1JFI A;  3J80 b;  2Y2P A;  1VQO Z;  3LEL C;  3C1C C;  5CPJ B;  1KX3 C;  2OOY B;  3HOZ I;  2YFW B;  2PK7 A;  3NFZ A;  4A3D I;  2QLV B;  5B2I B;  4RVD A;  4WNN B;  3AV2 D;  1P3P B;  2IZ3 A;  1JJ2 Z;  1ZB8 A;  2HIO D;  2OTL 1;  2PYO A;  2AYD A;  1VQP Z;  5CPI B;  5CPJ A;  2DF4 C;  1VQN Z;  2BYK B;  3WKJ D;  2K5R A;  2JIP A;  5GSU D;  1BH8 A;  5AVB C;  4WNN A;  3B0D B;  1M1A B;  2FJ7 D;  1ZH1 A;  1VQ4 Z;  5DNM D;  4NH1 C;  3X1T C;  3KUY D;  2RVQ C;  2JIM A;  3VMH A;  5F99 C;  2LEX A;  1VQM Z;  5AVC B;  3MGP C;  3CME Z;  1P3O C;  4H9R B;  3KFU G;  2BYK A;  1JWH C;  3S1M I;  5CPJ C;  1QVF Z;  1P3F C;  1Q7Y 2;  1M1A A;  3C1C D;  4H9P B;  5B2I C;  2VUM I;  3I55 Z;  1P3P C;  1WW9 A;  1PZR A;  3O62 D;  3MZK B;  5FLX f;  5B33 D;  1I3Q I;  4H9S A;  3IP4 C;  5B1L C;  5CPI C;  1HTA A;  3NQU A;  5B1M A;  1AOI B;  1K83 I;  1TZY B;  4H9P A;  5G49 B;  4DRA A;  2M48 A;  3BG1 B;  5IP9 I;  3AZI A;  3B0D C;  2Y2I A;  1M1A C;  3VMI A;  1Y8C A;  4J8U B;  2YFV A;  2JS4 A;  5AN9 F;  3IR7 A;  1SFO I;  3CCL Z;  1K9M 2;  4E31 A;  5AVC C;  2RVQ D;  4NOZ A;  3GTP I;  2XD1 A;  4NE3 A;  4XX2 A;  4A3K I;  1K8A 2;  1TWA I;  3MVD B;  4H9S C;  1RO4 A;  2V3V A;  5G49 A; 
#chains in the Genus database with same CATH homology
 5GT0 B;  2PYO D;  4KUD B;  4NBC A;  3V9R B;  5CPJ D;  4J8U A;  2F4O A;  2E2I I;  3VMG A;  1BH9 B;  1P34 A;  3CCS Z;  3AV1 A;  4A3J I;  3MVD A;  2NZD A;  1YIT Z;  5GT0 A;  3AZK A;  1AOI C;  1TZY C;  2QR1 B;  5CHL B;  2LY8 A;  1TWF I;  3LZ0 B;  1Y1V S;  5AV8 B;  3D6W A;  4J8U C;  3F3P C;  1M1A D;  1F66 C;  1Z03 A;  3J81 b;  3MVD C;  2G5I C;  4DK1 A;  3NH8 A;  3UT9 B;  5GT0 C;  3WA9 A;  3C1B B;  4KUD C;  3LZ0 A;  5T6B A;  1NJI 2;  5B1M D;  3I56 Z;  4J8X C;  1ZLA D;  3B0B A;  3AZI D;  2V8I A;  1YI2 1;  1K73 2;  1T3U A;  4G91 B;  1KRL A;  3UT9 A;  1EQZ B;  3C1B A;  3IF8 A;  3LZ0 C;  5AV8 C;  5BNX B;  4J8U D;  3K7A I;  2Y2J A;  1YHQ 1;  3NH4 A;  1P34 D;  4XZQ C;  2GTH A;  1EQZ A;  2ZY3 A;  5B2J B;  3AV1 D;  4JJN B;  2G5H C;  3MVD D;  3UT9 C;  3C1B C;  3X1V B;  2NZD D;  3J80 f;  4Z5T A;  5GT0 D;  1P3L C;  3AZK D;  3FKI I;  5AY8 B;  4UUZ B;  3CCU Z;  5AV5 A;  4J8V B;  1M90 2;  1VQK Z;  2F8N H;  1RO0 A;  4E2Y A;  2OTJ Z;  4YS3 B;  1Y1W I;  4JJN A;  2Q4Z A;  4CSR B;  3X1V A;  5B32 A;  4WU9 C;  1P3M A;  1YJW 1;  4Y52 I;  2JE5 A;  4UUZ A;  3WA9 D;  4J8V A;  3LZ0 D;  2HF1 A;  3G6E Z;  3CCE Z;  3CQZ I;  3IFU A;  5B2J C;  3J7A 4;  4A3G I;  3AN2 A;  3TU4 A;  4LD9 B;  3X1V C;  5T67 A;  4A3B I;  3UT9 D;  1NUI A;  2P28 A;  3NH5 A;  3C1B D;  3G71 1;  2K3R A;  1S7M A;  3CCJ Z;  1VQN 1;  5AY8 C;  2JA6 I;  4J8V C;  1P9N A;  3CC2 1;  1VQ4 1;  1W2B Y;  3RZD I;  4YS3 C;  3QWU A;  2L5A A;  1VQM 1;  4LD9 A;  2AKL A;  4X23 B;  2E9H A;  1EQZ D;  3CME 1;  4EO5 B;  2ARO B;  3GCF A;  4X6A I;  4Z5T D;  3MNN B;  3B0C T;  5AV5 D;  5DNM B;  1P3A A;  1QVF Y;  2F8N B;  4X23 A;  3LZ1 C;  3KXB B;  2KI7 B;  4LD9 C;  5DNN B;  3S2H I;  1TAF B;  2KPI A;  2ARO A;  2UWX A;  4JJN D;  3X1V D;  3F3F C;  5B32 D;  3WAA A;  3GTO I;  1P3M D;  1WWI A;  5C3E I;  3MNN A;  3GKQ A;  2O4H A;  4H9Q B;  2OZK A;  5C4J I;  2F8N A;  1KC8 1;  3O62 B;  4S1T A;  1N1J B;  4KGC B;  3KXB A;  1R4V A;  5GT3 B;  5DNN A;  5B33 B;  2FFF B;  4X23 C;  3CCL 1;  5AV9 B;  1RNI A;  2R7Z I;  1DL6 A;  4EO5 C;  2ARO C;  3AN2 D;  3TU4 D;  2OOX B;  2QRD B;  3WKJ C;  4H9Q A;  2QKD A;  3MNN C;  3KWQ B;  2FJ7 C;  2Y0S A;  2I3C A;  4RV9 A;  1N1J A;  5DNM C;  5B31 G;  4KGC A;  1JJ2 Y;  5GT3 A;  3A6N A;  2Y2N A;  4XUJ A;  5AV9 A;  3J81 f;  1S72 Z;  4E30 A;  3CCS 1;  3GTM S;  4LD9 D;  1P3G B;  1USP A;  2Y2G A;  2PYO B;  3KWQ A;  2Y2L A;  4H9O B;  4MRI A;  2RT9 A;  3O62 C;  1TWC I;  1BH8 B;  3EPJ A;  5B33 C;  5GT3 C;  1P3A D;  4KHA A;  3CCQ 1;  2YU9 I;  1PFT A;  3D9X A;  4X23 D;  1P3G A;  4MON A;  3GTK I;  2P3Y A;  3REI A;  2ARO D;  4H9O A;  5B0Z B;  3CMA Z;  3S1N I;  3WAA D;  2JR6 A;  2W03 A;  1A7W A;  1VQ5 1;  3MNN D;  4MD7 A;  3CC4 Z;  1VLA A;  3X1U A;  1Q82 1;  2GTI A;  2F8N D;  3LJA A;  3Q87 A;  1W2E A;  3KXB D;  5DNN D;  1P3G C;  5B0Z A;  2YAD A;  3AZM A;  2PYO C;  4NBA A;  3NQU B;  4BY1 I;  5B1M B;  3AZH A;  1ZLA B;  2JCH A;  3AZI B;  1WII A;  4A93 I;  2YFV B;  5JRG A;  3REL B;  5GT3 D;  3AZF A;  3A6N D;  1P3K B;  4XUJ D;  3W99 A;  5AV9 D;  1WCM I;  3KSY A;  5CP6 A;  1ZLA A;  1QYP A;  1M1K 1;  3MGQ B;  3KWQ D;  5LL6 f;  2OTJ 1;  3REL A;  1P3K A;  4NFR A;  2QA4 Z;  4NE6 A;  3W97 B;  2J6A A;  1P34 B;  3CXC Y;  1VQ6 Z;  1QVG Y;  3AZL A;  3NDI A;  5AV6 D;  3AV1 B;  1P3G D;  2IZ4 A;  2NZD B;  5BS7 A;  2NVX I;  2JSS A;  3VH5 W;  3FDD A;  3HOU I;  5B1M C;  3MGQ A;  3REI D;  3AZK B;  1ZLA C;  2VQR A;  3CPW Z;  3AZG B;  3AZI C;  1N8R 1;  3CCE 1;  3W97 A;  1VQ8 Z;  4Z2M H;  3X1U D;  3OW2 Z;  4A3E I;  3LJA D;  3MGR A;  3REK B;  5FLM I;  1YJ9 Z;  2HU9 A;  5B0Z D;  3AZM D;  3WA9 B;  2QEX Z;  3MGQ C;  3AZG A;  1YJN Z;  3AZJ D;  3CCV Z;  5E5A A;  3AZH D;  2LIY A;  1KQS Z;  3W97 C;  1HQ3 A;  1P34 C;  2XD5 A;  1ID3 A;  1Q81 2;  3REK A;  3W99 D;  5JRG D;  3AV1 C;  3AZF D;  2ZY2 A;  3CCR Z;  1H3O B;  2NZD C;  1X3W A;  3HOV I;  3EER A;  3AZK C;  5B0Y B;  3AZG C;  5CP6 D;  4BXX I;  3AZE A;  1M19 B;  4ZBJ B;  1VQL 1;  1NP6 A;  3REL D;  3UTA B;  1P3K D;  4NFT A;  4G92 B;  1H3O A;  3REK C;  3AZL D;  3FQQ A;  5B24 B;  4E2Z A;  1YIJ Z;  3WA9 C;  5B0Y A;  4TNU A;  3VB9 A;  3G4S 1;  4Z5T B;  3MGQ D;  1M19 A;  2QRE B;  3EPK A;  4NBB A;  3CC7 Z;  5GXQ B;  5AV5 B;  3UTA A;  2DE6 A;  2V8K A;  2VUG A;  3W97 D;  5B24 A;  3U50 C;  1L1O C;  3MGR D;  3A1I A;  4Z66 B;  5B32 B;  5IT9 b;  1Q81 1;  1P3M B;  3S16 I;  1YUA A;  2JMO A;  4E32 A;  5B40 B;  5GXQ A;  4ZBJ C;  3UTB A;  3AZG D;  1M19 C;  2JA7 I;  5E5A D;  3S15 I;  1S72 1;  1KD1 1;  1HQ3 D;  4G91 C;  5T64 A;  1ID3 D;  1EQZ C;  3REK D;  2NVT I;  4Z66 A;  2ZAE B;  3AN2 B;  3TU4 B;  4Z5T C;  5B40 A;  4E44 A;  1S32 A;  1VQO 1;  1X3Z A;  5GXQ C;  5AV5 C;  4E45 A;  3AZE D;  2O53 A;  1RO2 A;  3VH6 W;  4BY7 I;  4M6B A;  4JJN C;  4E2X A;  4YM6 A;  3S1Q I;  5B32 C;  3JAM b;  1KC8 2;  1P3M C;  1VQP 1;  1F1E A;  3PO2 I;  3T4N B;  5B0Y D;  5B40 C;  3AZN A;  3X1S A;  3HOY I;  1M19 D;  3CC4 1;  1P3A B;  3UTA D;  4R8P B;  2M6N A;  3AN2 C;  5B31 A;  5B24 D;  3TU4 C;  5BNV B;  1X0T A;  3RZO I;  3WAA B;  3S1R I;  3W96 B;  2ZY5 A;  3AFA A;  2GU2 A;  5GXQ D;  3I55 1;  3UTB D;  4R8P A;  3VTN A;  4EWC A;  2RIQ A;  4A3I I;  5BNV A;  2BYM B;  2IO5 B;  4Z66 D;  4WZS B;  2J8P A;  3MGS B;  3B6G C;  4J8W A;  2WB1 A;  3NQJ A;  3W96 A;  5B40 D;  1S32 D;  1LQL A;  4E2W A;  1P3A C;  3S17 I;  1VQ6 1;  4R8P C;  3A6N B;  4XUJ B;  3REJ D;  4BBR I;  2BYM A;  4HGZ A;  3GTG I;  2HUE B;  3MGS A;  4YM6 D;  1Q82 2;  1USP B;  3WAA C;  2ZM5 A;  2Y2K A;  5D1O A;  1VQ7 Z;  3W96 C;  4A3L I;  3LUS A;  3I4M I;  3AZN D;  2BJO A;  3X1S D;  3B6G A;  1VQ8 1;  3CPW Y;  4E33 A;  3HOX I;  3KXB C;  4RVH A;  5DNN C;  4KHA B;  5AV6 B;  2F4M A;  1YIT 1;  1YJ9 1;  2IO5 C;  3EPL A;  1P3I D;  3OW2 Y;  5BO0 B;  5B31 D;  2DE7 A;  5A2Q b;  3REI B;  2E2H I;  2B63 I;  1YJN 1;  1M18 D;  2QRC B;  4KGC C;  3BG0 B;  3AFA D;  3X1U B;  3A6N C;  3W98 D;  4XUJ C;  5AV6 A;  5AV9 C;  1Z01 A;  4R8P D;  1P3B B;  3GTQ I;  2HUE C;  3LJA B;  1M1K 2;  1KQS Y;  5BO0 A;  1TWG I;  4CAY B;  3AZM B;  3KWQ C;  2Q51 A;  1B67 A;  4J8W D;  1RLY A;  3AZJ B;  3W96 D;  3I56 1;  3AZH B;  5IT9 f;  1R9T I;  3LEL A;  2JA8 I;  1KX3 A;  3CCM Z;  1P3B A;  3R45 B;  5AVB B;  5JRG B;  3H0R C;  5AV6 C;  3AZF B;  3W99 B;  2NQB B;  4CAY A;  2PMZ A;  4NB8 A;  1N8R 2;  3MGS D;  1KU5 A;  3REI C;  2RBL A;  3PO3 I;  1ML8 A;  3MGP B;  3AZJ A;  1YJW Z;  5CP6 B;  1Q86 1;  2NVQ I;  3CC7 1;  3R45 A;  3X1U C;  5AVB A;  1P3F B;  2NQB A;  1P3B C;  3B6G D;  3LJA C;  2F2A C;  3X1T A;  2F8N K;  1TWH I;  2R93 I;  5F99 A;  3WTP D;  3AZL B;  5B0Z C;  3CD6 Z;  4NE5 A;  3MGP A;  3AZM C;  4RVG A;  1P3O A;  3AZJ C;  2F8N G;  3G71 Z;  3AZH C;  5B1L B;  3B6F B;  3MZL B;  3CCU 1;  1VQK 1;  1P3F A;  4A3M I;  2YFW A;  1W2B Z;  5B2I A;  3W99 C;  5JRG C;  1P3P A;  3AZF C;  2NQB C;  3CC2 Z;  5C3I B;  3JAM f;  3MGR B;  3VH5 A;  1VQ9 Z;  4NBE A;  5B1L A;  5CP6 C;  5CPI A;  3B6F A;  4NB9 A;  1YUK A;  4QTT A;  2JNY A;  3G6E 1;  4RS4 A;  5E5A B;  3REL C;  1P3K C;  3M4O I;  3LEL D;  1KX3 D;  1HQ3 B;  1ULY A;  4MD8 A;  1P3B D;  1ID3 B;  3AZL C;  5AVC A;  3HKZ A;  4HGA B;  4UPK A;  5BS7 C;  5CPK B;  4H9R A;  3CCJ 1;  3I4N I;  2Y2H A;  3WTP E;  3B6F C;  3I07 A;  1TFI A;  1I50 I;  3AZE B;  5AVB D;  2RPR A;  5C3I C;  1F66 B;  2NQB D;  3MGR C;  2VF1 A;  4ZUX B;  3X1T D;  5CPK A;  1RQF A;  4A3C I;  5F99 D;  4WJ3 C;  2R92 I;  1I6H I;  3MGP D;  1KD1 2;  1AOI A;  1TZY A;  3EG5 B;  3VH5 T;  2DQN C;  3A1K A;  5E5A C;  5KDM B;  3AYW B;  1P3O D;  2FJ7 A;  2V8J A;  3M3Y I;  1HQ3 C;  1P3F D;  1F66 A;  4J8X B;  5JA4 B;  1ID3 C;  5B2I D;  4ZUX A;  1P3P D;  1KX4 B;  4HGA C;  1Q7Y 1;  5CPK C;  2PM9 A;  3IX0 A;  3TE5 B;  4BBS I;  5BT1 C;  5KDM A;  3AYW A;  4KUD A;  5B1L D;  3V9R A;  5CPI D;  3B6F D;  3AZE C;  4AYB A;  4NBF A;  5IP7 I;  3UTB B;  4J8X A;  5JA4 A;  1BH9 A;  1BFM A;  1KX4 A;  4MXU A;  4RVF A;  4ZUX C;  4Y7N I;  3CCQ Z;  4DRB A;  5A2Q f;  3GTM I;  5AVC D;  4XZQ B;  4A3F I;  5B0Y C;  2OTL Z;  4QLC B;  3F6T A;  1VQ7 1;  1K9M 1;  1S32 B;  3AYW C;  2DE5 A;  3HOW I;  2G2K A;  5AV8 A;  1K8A 1;  3UTA C;  1P3L B;  4G92 C;  4KGC D;  1VQ5 Z;  1B6W A;  3REJ B;  2R6M A;  4MD9 A;  1KX4 C;  5B24 C;  4XZQ A;  2WAQ A;  4YM6 B;  5CPK D;  4QLC A;  2H85 A;  5BT1 D;  4WU9 B;  3MON A;  3REH B;  3AZN B;  1P3L A;  3UTB C;  1TZY D;  1AOI D;  3X1S B;  3REJ A;  1U35 B;  1WWS A;  3VH6 A;  3TDH B;  5D1P A;  1F66 D;  4ZUX D;  4Z66 C;  1P3I B;  1QF8 A;  2RHB A;  5B31 B;  3CMA 1;  3PO3 S;  4WU9 A;  4QLC C;  3FQM A;  3REH A;  4NBD A;  1S32 C;  1M18 B;  4KUD D;  3AYW D;  1U35 A;  4HGY A;  5BNX A;  3AFA B;  2CV5 B;  3W98 B;  3CXC Z;  3REJ C;  4J8X D;  3CCM 1;  1QVG Z;  1P3I A;  2ZY4 A;  5FLX b;  1KX4 D;  1NJI 1;  4YM6 C;  5B2J A;  3H0G I;  1M18 A;  4MH4 A;  2E2J I;  4J8W B;  3REH C;  3NQJ B;  3AZN C;  3ESW A;  4QTU A;  2W04 A;  1K73 1;  3X1S C;  5AY8 A;  2CV5 A;  3B0C W;  3W98 A;  1U35 C;  5AV8 D;  3NDJ A;  5C4X I;  4YS3 A;  1Q9C A;  4WU8 B;  1P3I C;  3GTJ I;  4HH4 A;  3VH6 T;  5B31 C;  4CSR A;  3LZ1 B;  4XZQ D;  1ZB9 A;  4NBH A;  1KX5 B;  3EED A;  3CD6 1;  3GTL I;  4QLC D;  1M18 C;  2LFU A;  5D1O B;  3AFA C;  2CV5 C;  2CWE A;  4H9N B;  4AWL B;  1P3L D;  3W98 C;  3B6G B;  3KIF A;  2QA4 1;  4WU8 A;  3AV2 B;  3LZ1 A;  3H0M C;  3WTP B;  2Y2M A;  5CM2 M;  1KX5 A;  1M90 1;  4WV4 B;  2HIO B;  1VQ9 1;  4J8W C;  4WU9 D;  3REH D;  3S2D I;  4H9N A;  2Y2O A;  4Z2M G;  3WKJ B;  3EPH A;  5GSU B;  1U35 D;  1Y1V I;  3S14 I;  3AV2 A;  2W8S A;  5B32 G;  5FUG B;  3WTP A;  4WU8 C;  2FJ7 B;  3P5J B;  3KUY B;  1YI2 Z;  4CL1 A;  1VQL Z;  3MGS C;  2HIO A;  1Q86 2;  1KX5 C;  2JA5 I;  2EGT A;  5B2J D;  5C44 I;  2QEX 1;  4NBG A;  3WKJ A;  3CCV 1;  3G4S Z;  5GSU A;  2NVY I;  4AWL C;  2CV5 D;  5AY8 D;  3LEL B;  5FUG A;  3C1C B;  5DNM A;  4J8V D;  1KX3 B;  3KUY A;  3AV2 C;  3AL0 C;  3CCR 1;  1YHQ Z;  3WTP C;  2Y2Q A;  4YS3 D;  1TAF A;  2HIO C;  3H3V J;  2JUB A;  4DQY B;  1N2F A;  3C1C A;  1Z2C B;  1JFI B;  5GSU C;  3H0L C;  3O62 A;  4DGL A;  5B33 A;  2BG1 A;  3KUY C;  4WU8 D;  3X1T B;  1YIJ 1;  3LZ1 D;  5F99 B;  1Z02 A;  1KX5 D;  1P3O B;  1JFI A;  3J80 b;  2Y2P A;  1VQO Z;  3LEL C;  3C1C C;  5CPJ B;  1KX3 C;  2OOY B;  3HOZ I;  2YFW B;  2PK7 A;  3NFZ A;  4A3D I;  2QLV B;  5B2I B;  4RVD A;  4WNN B;  3AV2 D;  1P3P B;  2IZ3 A;  1JJ2 Z;  1ZB8 A;  2HIO D;  2OTL 1;  2PYO A;  1VQN Z;  1VQP Z;  5CPI B;  5CPJ A;  2DF4 C;  2BYK B;  3WKJ D;  2K5R A;  5GSU D;  1BH8 A;  5AVB C;  4WNN A;  3B0D B;  1M1A B;  2FJ7 D;  1ZH1 A;  1VQ4 Z;  5DNM D;  4NH1 C;  3X1T C;  3KUY D;  2RVQ C;  3VMH A;  1VQM Z;  5F99 C;  5AVC B;  3MGP C;  3CME Z;  1P3O C;  4H9R B;  3KFU G;  2BYK A;  1JWH C;  3S1M I;  5CPJ C;  1QVF Z;  1P3F C;  1Q7Y 2;  1M1A A;  3C1C D;  4H9P B;  5B2I C;  2VUM I;  3I55 Z;  1P3P C;  1WW9 A;  1PZR A;  3O62 D;  3MZK B;  5FLX f;  5B33 D;  1I3Q I;  4H9S A;  3IP4 C;  5B1L C;  5CPI C;  1HTA A;  3NQU A;  5B1M A;  1AOI B;  1K83 I;  1TZY B;  4H9P A;  5G49 B;  4DRA A;  2M48 A;  3BG1 B;  5IP9 I;  3AZI A;  3B0D C;  2Y2I A;  1M1A C;  3VMI A;  1SFO I;  4J8U B;  2YFV A;  2JS4 A;  5AN9 F;  3CCL Z;  1K9M 2;  4E31 A;  5AVC C;  2RVQ D;  4NOZ A;  3GTP I;  2XD1 A;  4NE3 A;  4XX2 A;  4A3K I;  1K8A 2;  1TWA I;  3MVD B;  4H9S C;  1RO4 A;  3KIH A;  5G49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...