2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly [ADP-ribose] polymerase 1
publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
3A1IA 4G92B 2V8JA 4BBSI 4MONA 5D1OB 1M18B 2CV5C 1FDIA 1ZB9A 3PO3I 5F99C 2HU9A 1RLYA 1I50I 3NDJA 1TWAI 3B6GC 4A3EI 1TZYA 3B0BA 3AZLA 1P3GD 1P3OA 2NZDC 3W97B 3CCR1 3UTBC 4EO5C 1N1JA 3AZFB 4WU9B 3CC41 3CCLZ 3W99C 4J8UC 4Z2MG 5G49A 4HGAB 1P3BD 3AFAC 2Y2GA 1YJW1 3S16I 5B2JD 4A3KI 5D1PA 4WV4B 3LZ0D 4MXUA 3AZHB 1VQ7Z 4NBEA 3EG5B 1RO4A 2O4HA 3IF8A 5BT1C 4JJND 2Y0SA 4KHAA 5CPKB 3NH4A 4XZQB 5CM2M 2Y2OA 3MGSB 3I561 2DE7A 3CCEZ 3CCQZ 2HIOC 4J8WB 1WWIA 5CPJC 1ZLAB 4NBAA 5E5AC 4YM6D 5LL6f 2PYOB 4A3MI 1VQMZ 5FUGB 2GTHA 4QLCB 2JIMA 3AZJC 3LJAA 4XUJD 4NFTA 3WKJD 5B31A 3KIFA 3X1UB 4YS3B 1S32A 3MGRA 3C1BB 5B32D 3AYWC 1P3AB 1M18A 2QKDA 3LUSA 4ZUXB 1EQZC 1YITZ 5B2IC 2Y2HA 5AV8D 3OW2Z 3CMEZ 3CXCZ 2F2AC 5B32G 3MGQD 2F8NG 1VQLZ 5A2Qb 5IT9b 3MNNC 3OW2Y 5B1LC 3W97A 2RHBA 3CXCY 4WU9A 3MGPC 1P3MD 5DNMD 1H3OB 5GXQD 1X3ZA 4RVFA 3KWQD 3AZKD 3GCFA 1Y8CA 4RS4A 3REKC 4KUDC 4KGCC 1Q16A 5B40D 2V8KA 3G4SZ 2R7ZI 4J8VA 2JR6A 5AV9C 3KUYB 1VQK1 3EPLA 1P3LC 1M902 4G91B 1P3ID 2AROB 4XZQA 2QRCB 3VMIA 3MGSA 1KX5B 2V45A 1X0TA 4H9SC 1P3KB 1AA6A 3GTMI 5B0ZD 4Z5TB 1ZLAA 2Y2JA 2PYOA 3TU4A 3EPJA 2F8NK 1TAFA 4QLCA 5JRGC 1P34C 1ML8A 1NUIA 5GSUC 1TWHI 3X1UA 4YS3A 1P3AA 3C1BA 4DRBA 4WU8A 4E33A 5GT3A 4ZUXA 1P9NA 4A3GI 2YFVB 1KX4C 3H3VJ 2NQBB 1TZYD 2IO5C 5B0YC 3AZLD 1P3OD 1VQ81 5D1OA 4E31A 5DNNB 4E2XA 3AV1C 3AN2A 3IX0A 2YFWA 3A1KA 3W96D 1H3OA 1M1AC 2I3CA 3TDHB 5B33C 1Q811 3R45A 3WTPC 5AV5B 1K731 1L1OC 3X1VD 3NH8A 5CP6C 1VQ8Z 2VPYA 1HQ3C 3KUYA 3KFUG 3RELC 5C3IC 1YJWZ 3AZEC 3CCE1 2AROA 3W98C 3WA9C 5AVCB 1KX5A 2RBLA 1R9TI 1U35B 3AV2A 1P3KA 2R6MA 2W04A 2XD1A 2PM9A 1VQM1 3M3YI 3AZGC 3MVDB 3I551 3UTBA 3LJAD 3HOZI 5B31D 3C1CC 1S32D 1M18D 5B0ZB 2JA8I 3MZKB 3REIC 3AZIB 1TWFI 3AL0C 3X1SC 1QVGZ 2Y2KA 2YFVA 2NQBA 1P3FB 2JS4A 1Q7Y1 5CPIC 3CD61 4NBDA 2BG1A 3W97D 2VUGA 1QVGY 4WU9D 4E44A 3B6FB 4MD7A 5DNNA 5AY8B 2JNYA 1T3UA 2HIOA 3V9RB 1AOIB 5C4JI 5B24C 5IT9f 2QA4Z 3H0RC 5B1MB 3REHB 3X1TB 1X3WA 1KQSY 3S17I 1WZNA 5AV5A 5BS7C 5G49B 4NE5A 4XZQD 5GT0B 3MGSD 3AYWA 2PK7A 2Q51A 3S14I 5AVCA 2JA6I 3UT9B 1U35A 5BO0B 1ZLAD 1VQKZ 2PYOD 4LD9C 3TU4D 2JMOA 3EERA 3AZHC 3I55Z 1Q9CA 4R8PB 3MVDA 5B1LA 3LELC 3FQQA 4QLCD 3UTAB 1KX3C 3GKQA 3HOUI 5CPKC 4TNUA 3X1UD 4YS3D 4X23C 1WWSA 3C1BD 1P3AD 2F4MA 3QWUA 4J8WC 5T67A 5GT3D 4ZUXD 3AZIA 2RVQD 1ID3C 2GTIA 2QEX1 1F66C 1KD12 1VQ61 1HTAA 3WTPE 5B31B 1P3FA 1S32B 5AV9A 4Z66C 3MGRB 1K8A1 3BG1B 3B6FA 3AN2D 3MZLB 5AY8A 3AZMB 1Q7Y2 1Q821 3GTQI 2YU9I 1Z2CB 1K9M1 3V9RA 3KXBB 1AOIA 4RVDA 1VQ5Z 3B0DC 5B1MA 3REHA 3X1TA 3CQZI 3AZNB 1P34A 3VMHA 3KUYD 4NBBA 4WZSB 3I4MI 3REJB 2AROD 3GTKI 5GT0A 4H9NA 1KX5D 3GTPI 3S1QI 1P3KD 3AV2D 5JA4B 3UT9A 4Z5TD 1P3GC 2J6AA 5BO0A 2BYKB 5AV6C 4J8VB 2AYDA 3G71Z 1N8R1 3S1NI 5IP9I 3WAAB 2VQRA 4R8PA 3UTBD 3EPHA 3UTAA 3F3PC 1P3BC 3M4OI 4MD9A 5B2JC 4DK1A 3TU4B 2RIQA 3LZ0C 4A3CI 1TAFB 4CSRB 1M19B 2NQBD 4JJNC 4WNNA 4E2YA 1RQFA 4A3FI 1M1K1 5BNXB 4WU8B 5DNND 1LQLA 5GT3B 3AZEA 2JCHA 4YM6C 3AZMA 2GU2A 3HOXI 2QRDB 3H0LC 1S72Z 3H0GI 4NFRA 3KXBA 3CD6Z 2QA41 3AZGA 1ULYA 4XUJC 5AV5D 4AWLB 3WKJC 3U50C 3AZNA 3AN2B 2O53A 1NJI1 4UUZB 2HUEC 2FFFB 2YFWB 4DRAA 5B32C 2LFUA 3C1CA 2JA7I 5AV8C 1F1EA 3REIA 3REJA 1P3PB 5C3EI 3MGQC 3R45B 5AVCD 1PFTA 5AVBB 1U35D 5T64A 5JA4A 2JA5I 1PZRA 3O62A 2BYKA 3S2HI 3D9XA 3MVDD 4DQYB 2ZY2A 1P3MC 3WAAA 2RT9A 5DNMC 3ESWA 5F99B 2Y2MA 5GXQC 2E7ZA 3KWQC 3AZKC 3AV2B 3B6GB 4A3DI 1B67A 3H0MC 1ZH1A 3J7A4 3AZID 2IV2X 2NZDB 5B40C 3NH5A 3UTBB 4EO5B 1B6WA 4CSRA 3A6NA 1M19A 2JIQA 3VMGA 3LZ1C 4J8XA 5AV9D 4J8UB 1P3IC 1P3FD 3W99B 2WB1A 1VQO1 4BXXI 5BNXA 3B6FD 3GTJI 1K83I 5AY8D 2QEXZ 2KPIA 2JIPA 1Y1VS 2WAQA 1VQ6Z 3HOVI 2E2II 1AOID 2FJ7C 5B1MD 3X1TD 3REHD 4LD9A 4H9OA 3KIHA 4NB8A 1VQ51 2AKLA 4A93I 4UUZA 2HIOB 5CPJB 2ZY4A 4H9RB 3NFZA 1KRLA 4Y7NI 5E5AB 1NP6A 5GT0D 1YHQ1 1P3PA 4RVHA 1TZYC 3AZLC 3UT9D 1P3OC 1F66A 5AVBA 2Q4ZA 1YIJZ 2M48A 1TFIA 3G711 4NBGA 1Y1VI 4R8PD 4Z66A 2CV5A 1JFIA 3AYWB 1WCMI 3NQUB 3UTAD 3W96C 5F99A 4E30A 5B2IB 4MH4A 3CPWZ 1TWCI 3B6GA 5FLMI 4DGLA 4XX2A 3MNNB 2NZDA 3CPWY 1KC81 5B1LB 3X1VC 3MGPB 2Y2PA 4ZBJC 2F8NB 4J8UA 3W99A 3MGRD 2QR1B 1SFOI 3AFAA 5B31G 3FKII 3AZMD 3REKB 4KUDB 4KGCB 2Y2QA 3VH5W 5AN9F 3KXBD 5AV6A 5AV9B 1BFMA 3EPKA 3AZGD 3LJAC 1P3LB 4G92C 1QVFY 5B31C 2K5RA 3AZND 1S32C 1M18C 1KU5A 2R92I 1KQSZ 1DL6A 3C1CD 5CPJA 3NQJA 4H9RA 3FQMA 3REID 3REJD 5E5AA 2M6NA 4E45A 4UPKA 1Q861 3J81f 3O62D 3GTLI 3W97C 5JRGB 4J8VD 3AZFC 4WU9C 3AZJA 1P34B 3VH5T 2V3VA 5GSUB 3CC2Z 3WAAD 3EEDA 1Q812 3K7AI 4Z2MH 4HGAC 3NQUA 4H9NB 1K732 1EQZA 5B2IA 4YM6A 1KX4B 2VUMI 1S7MA 2IO5B 5B0YB 4CAYA 3MNNA 2G5IC 1BH9A 5KDMA 3A6ND 1M19D 3WKJA 3MGPA 4J8XD 1Y1WI 4XZQC 2F8NA 1W2EA 3MGSC 1M1AB 4NBHA 4WU8D 1ZLAC 5B33B 3WTPB 3REKA 2PYOC 4KUDA 4KGCA 2BJOA 1VQPZ 1YI21 1VQOZ 4WNNB 4LD9D 4QLCC 1HQ3B 3RELB 5C3IB 1P3LA 1QXFA 2JIOA 5DNMA 3X1UC 4YS3C 3AZEB 3C1BC 1P3AC 3W98B 1A7WA 3WA9B 1RO2A 4H9SA 5GT3C 4ZUXC 3CCU1 2RVQC 1P3PD 2QLVB 2F8NH 2H85A 3AZGB 3G6E1 5AVBD 3F6TA 2ZAEB 1Z01A 2E2JI 5JRGA 1YIJ1 3LZ1A 3C1CB 4Z66D 5GSUA 2CV5D 1YUKA 2NVTI 2JSSA 3RZOI 3REIB 1Q862 5F99D 1YHQZ 5T6BA 2IZ4A 4E2ZA 3X1SB 3B6GD 2DE6A 2VPWA 1KX4A 3O62B 2L5AA 1VLAA 2FJ7A 2NZDD 5B0YA 5CPIB 4NE3A 4A3BI 3VH6W 3KUYC 3IFUA 5BNVB 3AV1A 3HKZA 4G91C 3W99D 4J8UD 2OTJ1 4RV9A 2AROC 2ZM5A 1KX5C 1M1AA 3AFAD 1P3KC 5B24B 3AV2C 1VQ91 2PMZA 4Z5TC 2RPRA 5B33A 3WTPA 3A6NB 3CCV1 3S1MI 5AV6D 4J8XB 5CP6A 3TE5B 2ZY3A 5BT1D 1HQ3A 2NVXI 3RELA 3KSYA 3HOWI 3VH6T 3W96A 3WA9A 2HIOD 5CPJD 3W98A 1K8A2 1M901 3I4NI 5E5AD 3S15I 4LD9B 2B63I 4H9OB 2NQBC 2NVQI 1Q822 3LELB 3X1VA 3J81b 1KX3B 1K9M2 3AZJD 5DNNC 3CC21 1VQN1 4X23B 3AYWD 2V8IA 1EQZD 5B2ID 1ID3B 1F66B 3X1SA 2EGTA 3CCJ1 5AV5C 3MNND 4Z66B 5CPIA 5B1LD 2CV5B 1JFIB 4A3II 1WW9A 2VPZA 3MGPD 3F3FC 5BNVA 1N8R2 1BH8B 4H9QB 2F8ND 3CC7Z 1YJ9Z 2BYMB 5AVCC 1U35C 4H9PB 5B24A 2DQNC 3B0DB 2DE5A 3REKD 5CHLB 4KUDD 4KGCD 1I3QI 3MONA 3IR7A 3GTMS 2Y2LA 5BS7A 3MVDC 1YJNZ 1I6HI 3AZFA 3JAMb 4NE6A 2QREB 1P3LD 2JUBA 2LIYA 4M6BA 3AFAB 4MD8A 1VQ41 5B0ZC 3AZIC 3GTOI 1M1K2 1P3GB 1YI2Z 2E9HA 5AV6B 3D6WA 3VTNA 1USPB 4WJ3C 4BBRI 2LEXA 3AZHA 3CMA1 1ZB8A 1P3FC 3LELA 3BG0B 5FLXf 5JRGD 1P34D 1KX3A 1P3BB 3LZ1D 3CCUZ 3B6FC 5C4XI 5GSUD 5AY8C 3NQJB 5CPKA 4Y52I 5B2JB 2Y2NA 4X23A 4J8WA 3G6EZ 3LZ0B 1NJI2 1QYPA 1ID3A 1AOIC 2OZKA 1KX4D 5B1MC 3X1TC 3REHC 3CCM1 3VB9A 4JJNB 5FUGA 5B0YD 3AZJB 2FJ7D 3CCS1 2OTLZ 3S1RI 3Q87A 3AV1D 1EQZB 1BH8A 4H9QA 4YM6B 5GT0C 1M1AD 4E2WA 2NVYI 2BYMA 3PO2I 3UT9C 4NBFA 4CAYB 4NB9A 4H9PA 5B33D 3J80f 1BH9B 2Y2IA 3WTPD 5KDMB 4XUJB 3WKJB 5IP7I 2OTJZ 1VQP1 4R8PC 5CP6D 2HUEB 5B32B 4S1TA 1JWHC 1HQ3D 3UTAC 2VPXA 3RELD 2W8SA 1N2FA 5AV8B 3CCL1 4QTTA 3RZDI 3AZED 3VH5A 1VQ9Z 4A3LI 3MGQB 3W98D 3WA9D 4BY7I 1QVFZ 1TWGI 4HGYA 3CCRZ 3CCVZ 1P3GA 4CL1A 4EWCA 3CC4Z 1USPA 1P3MB 1VQ71 5DNMB 3B0CW 2JIRA 5GXQB 3MGRC 1R4VA 2G5HC 2DF4C 3KWQB 3AZKB 1P3BA 2KI7B 3D2LA 4HGZA 4MRIA 4NOZA 3CCQ1 1YJ91 1W2BZ 3AZMC 5B2JA 5B40B 3LZ0A 4Z5TA 3X1SD 1W2BY 3KXBC 1JJ2Z 4BY1I 3J80b 2F4OA 3LZ1B 4JJNA 3I56Z 3AZNC 5CPID 1P3IB 1KD11 1VQNZ 3GTGI 2W03A 1JJ2Y 5FLXb 2JE5A 3B0CT 3CC71 3REJC 1WJ2A 1YIT1 1S721 2G2KA 4RVGA 3CCJZ 2FJ7B 5B24D 3CME1 3O62C 2HF1A 1VQL1 4J8VC 4XUJA 1YUAA 3AV1B 3WAAC 2NAPA 3AZFD 1SIWA 1YJN1 4E32A 5B32A 3IP4C 1KC82 3S2DI 5AV8A 2ZY5A 1Z03A 3MGQA 1QF8A 1TZYB 2LY8A 3AZLB 1P3OB 3TU4C 4QTUA 5A2Qf 4AYBA 4X6AI 1N1JB 5CP6B 3NDIA 3T4NB 4NBCA 3JAMf 1M19C 3A6NC 3AZHD 2E2HI 4J8XC 3LELD 2UWXA 1P3MA 4HH4A 3G4S1 1VQ4Z 1KX3D 3W96B 5GXQA 3KWQA 4WU8C 3AZKA 5CPKD 1RO0A 4X23D 2P28A 3P5JB 2VF1A 4J8WD 1FDOA 5C44I 3CMAZ 3I07A 2IZ3A 1ID3D 4NH1C 5B40A 3X1VB 1F66D 3PO3S 2CWEA 3FDDA 1Z02A 4KHAB 4ZBJB 4AWLC 2OTL1 3AN2C 1P3IA 2K3RA 2OOXB 2J8PA 5B0ZA 4A3JI 2XD5A 2R93I 1P3PC 3CCMZ 2YADA 2OOYB 3VH6A 2P3YA 1WIIA 3CCSZ 5AVBC 3HOYI 1RNIA 3LJAB
chains in the Genus database with same CATH topology
3A1IA 4G92B 2V8JA 4BBSI 4MONA 5D1OB 1M18B 2CV5C 1ZB9A 3PO3I 5F99C 2HU9A 1RLYA 1I50I 3NDJA 1TWAI 3B6GC 4A3EI 1TZYA 3B0BA 3AZLA 1P3GD 1P3OA 2NZDC 3W97B 3CCR1 3UTBC 4EO5C 1N1JA 3AZFB 4WU9B 3CC41 3CCLZ 3W99C 4J8UC 4Z2MG 5G49A 4HGAB 1P3BD 3AFAC 2Y2GA 1YJW1 3S16I 5B2JD 4A3KI 5D1PA 4WV4B 3LZ0D 4MXUA 3AZHB 1VQ7Z 4NBEA 3EG5B 1RO4A 2O4HA 3IF8A 5BT1C 4JJND 2Y0SA 4KHAA 5CPKB 3NH4A 4XZQB 5CM2M 2Y2OA 3MGSB 3I561 2DE7A 3CCEZ 3CCQZ 2HIOC 4J8WB 1WWIA 5CPJC 1ZLAB 4NBAA 5E5AC 4YM6D 5LL6f 2PYOB 4A3MI 1VQMZ 5FUGB 2GTHA 4QLCB 3AZJC 3LJAA 4XUJD 4NFTA 3WKJD 5B31A 3KIFA 3X1UB 4YS3B 1S32A 3MGRA 3C1BB 5B32D 3AYWC 1P3AB 1M18A 2QKDA 3LUSA 4ZUXB 1EQZC 1YITZ 5B2IC 2Y2HA 5AV8D 3OW2Z 3CMEZ 3CXCZ 2F2AC 5B32G 3MGQD 2F8NG 1VQLZ 5A2Qb 5IT9b 3MNNC 3OW2Y 5B1LC 3W97A 2RHBA 3CXCY 4WU9A 3MGPC 1P3MD 5DNMD 1H3OB 5GXQD 1X3ZA 4RVFA 3KWQD 3AZKD 3GCFA 4RS4A 3REKC 4KUDC 4KGCC 5B40D 2V8KA 3G4SZ 2R7ZI 4J8VA 2JR6A 5AV9C 3KUYB 1VQK1 3EPLA 1P3LC 1M902 4G91B 1P3ID 2AROB 4XZQA 2QRCB 3VMIA 3MGSA 1KX5B 2NVXI 1X0TA 4H9SC 1P3KB 3GTMI 5B0ZD 4Z5TB 1ZLAA 2Y2JA 2PYOA 3TU4A 3EPJA 2F8NK 1TAFA 4QLCA 5JRGC 1P34C 1ML8A 1NUIA 5GSUC 1TWHI 3X1UA 4YS3A 1P3AA 3C1BA 4DRBA 4WU8A 4E33A 5GT3A 4ZUXA 1P9NA 4A3GI 2YFVB 1KX4C 3H3VJ 2NQBB 1TZYD 2IO5C 5B0YC 3AZLD 1P3OD 1VQ81 5D1OA 4E31A 5DNNB 4E2XA 3AV1C 3AN2A 3IX0A 2YFWA 3A1KA 3W96D 1H3OA 1M1AC 2I3CA 3TDHB 5B33C 1Q811 3R45A 3WTPC 5AV5B 1K731 1L1OC 3X1VD 3NH8A 5CP6C 1VQ8Z 1HQ3C 3KUYA 3KFUG 3RELC 5C3IC 1YJWZ 3AZEC 3CCE1 2AROA 3W98C 3WA9C 5AVCB 1KX5A 2RBLA 1R9TI 1U35B 3AV2A 1P3KA 2R6MA 2W04A 2XD1A 2PM9A 1VQM1 3M3YI 3AZGC 3MVDB 3I551 3UTBA 3LJAD 3HOZI 5B31D 3C1CC 1S32D 1M18D 5B0ZB 2JA8I 3MZKB 3REIC 3AZIB 1TWFI 3AL0C 3X1SC 1QVGZ 2Y2KA 2YFVA 2NQBA 1P3FB 2JS4A 1Q7Y1 5CPIC 3CD61 4NBDA 2BG1A 3W97D 2VUGA 1QVGY 4WU9D 4E44A 3B6FB 4MD7A 5DNNA 5AY8B 2JNYA 1T3UA 2HIOA 3V9RB 1AOIB 5C4JI 5B24C 5IT9f 2QA4Z 3H0RC 5B1MB 3REHB 3X1TB 1X3WA 1KQSY 3S17I 5AV5A 5BS7C 5G49B 4NE5A 4XZQD 5GT0B 3MGSD 3AYWA 2PK7A 2Q51A 3S14I 5AVCA 2JA6I 3UT9B 1U35A 5BO0B 1ZLAD 1VQKZ 2PYOD 4LD9C 3TU4D 2JMOA 3EERA 3AZHC 3I55Z 1Q9CA 4R8PB 3MVDA 5B1LA 3LELC 3FQQA 4QLCD 3UTAB 1KX3C 3GKQA 3HOUI 5CPKC 4TNUA 3X1UD 4YS3D 4X23C 1WWSA 3C1BD 1P3AD 2F4MA 3QWUA 4J8WC 5T67A 5GT3D 4ZUXD 3AZIA 2RVQD 1ID3C 2GTIA 2QEX1 1F66C 1KD12 1VQ61 1HTAA 3WTPE 5B31B 1P3FA 1S32B 5AV9A 4Z66C 3MGRB 1K8A1 3BG1B 3B6FA 3AN2D 3MZLB 5AY8A 3AZMB 1Q7Y2 1Q821 3GTQI 2YU9I 1Z2CB 1K9M1 3V9RA 3KXBB 1AOIA 4RVDA 1VQ5Z 3B0DC 5B1MA 3REHA 3X1TA 3CQZI 3AZNB 1P34A 3VMHA 3KUYD 4NBBA 4WZSB 3I4MI 3REJB 2AROD 3GTKI 5GT0A 4H9NA 1KX5D 3GTPI 3S1QI 1P3KD 3AV2D 5JA4B 3UT9A 4Z5TD 1P3GC 2J6AA 5BO0A 2BYKB 5AV6C 4J8VB 3G71Z 1N8R1 3S1NI 5IP9I 3WAAB 2VQRA 4R8PA 3UTBD 3EPHA 3UTAA 3F3PC 1P3BC 3M4OI 4MD9A 5B2JC 4DK1A 3TU4B 2RIQA 3LZ0C 4A3CI 1TAFB 4CSRB 1M19B 2NQBD 4JJNC 4WNNA 4E2YA 1RQFA 4A3FI 1M1K1 5BNXB 4WU8B 5DNND 1LQLA 5GT3B 3AZEA 2JCHA 4YM6C 3AZMA 2GU2A 3HOXI 2QRDB 3H0LC 1S72Z 3H0GI 4NFRA 3KXBA 3CD6Z 2QA41 3AZGA 1ULYA 4XUJC 5AV5D 4AWLB 3WKJC 3U50C 3AZNA 3AN2B 2O53A 1NJI1 4UUZB 2HUEC 2FFFB 2YFWB 4DRAA 5B32C 2LFUA 3C1CA 2JA7I 5AV8C 1F1EA 3REIA 3REJA 1P3PB 5C3EI 3MGQC 3R45B 5AVCD 1PFTA 5AVBB 1U35D 5T64A 5JA4A 2JA5I 1PZRA 3O62A 2BYKA 3S2HI 3D9XA 3MVDD 4DQYB 2ZY2A 1P3MC 3WAAA 2RT9A 5DNMC 3ESWA 5F99B 2Y2MA 5GXQC 3KWQC 3AZKC 3AV2B 3B6GB 4A3DI 1B67A 3H0MC 1ZH1A 3J7A4 3AZID 2NZDB 5B40C 3NH5A 3UTBB 4EO5B 1B6WA 4CSRA 3A6NA 1M19A 3VMGA 3LZ1C 4J8XA 5AV9D 4J8UB 1P3IC 1P3FD 3W99B 2WB1A 1VQO1 4BXXI 5BNXA 3B6FD 3GTJI 1K83I 5AY8D 2QEXZ 2KPIA 1Y1VS 2WAQA 1VQ6Z 3HOVI 2E2II 1AOID 2FJ7C 5B1MD 3X1TD 3REHD 4LD9A 4H9OA 3KIHA 4NB8A 1VQ51 2AKLA 4A93I 4UUZA 2HIOB 5CPJB 2ZY4A 4H9RB 3NFZA 1KRLA 4Y7NI 5E5AB 1NP6A 5GT0D 1YHQ1 1P3PA 4RVHA 1TZYC 3AZLC 3UT9D 1P3OC 1F66A 5AVBA 2Q4ZA 1YIJZ 2M48A 1TFIA 3G711 4NBGA 1Y1VI 4R8PD 4Z66A 2CV5A 1JFIA 3AYWB 1WCMI 3NQUB 3UTAD 3W96C 5F99A 4E30A 5B2IB 4MH4A 3CPWZ 1TWCI 3B6GA 5FLMI 4DGLA 4XX2A 3MNNB 2NZDA 3CPWY 1KC81 5B1LB 3X1VC 3MGPB 2Y2PA 4ZBJC 2F8NB 4J8UA 3W99A 3MGRD 2QR1B 1SFOI 3AFAA 5B31G 3FKII 3AZMD 3REKB 4KUDB 4KGCB 2Y2QA 3VH5W 5AN9F 3KXBD 5AV6A 5AV9B 1BFMA 3EPKA 3AZGD 3LJAC 1P3LB 4G92C 1QVFY 5B31C 2K5RA 3AZND 1S32C 1M18C 1KU5A 2R92I 1KQSZ 1DL6A 3C1CD 5CPJA 3NQJA 4H9RA 3FQMA 3REID 3REJD 5E5AA 2M6NA 4E45A 4UPKA 1Q861 3J81f 3O62D 3GTLI 3W97C 5JRGB 4J8VD 3AZFC 4WU9C 3AZJA 1P34B 3VH5T 3CC2Z 5GSUB 3WAAD 3EEDA 1Q812 3K7AI 4Z2MH 4HGAC 3NQUA 4H9NB 1K732 1EQZA 5B2IA 4YM6A 1KX4B 2VUMI 1S7MA 2IO5B 5B0YB 4CAYA 3MNNA 2G5IC 1BH9A 5KDMA 3A6ND 1M19D 3WKJA 3MGPA 4J8XD 1Y1WI 4XZQC 2F8NA 1W2EA 3MGSC 1M1AB 4NBHA 4WU8D 1ZLAC 5B33B 3WTPB 3REKA 2PYOC 4KUDA 4KGCA 2BJOA 1VQPZ 1YI21 1VQOZ 4WNNB 4LD9D 4QLCC 1HQ3B 3RELB 5C3IB 1P3LA 5DNMA 3X1UC 4YS3C 3AZEB 3C1BC 1P3AC 3W98B 1A7WA 3WA9B 1RO2A 4H9SA 5GT3C 4ZUXC 3CCU1 2RVQC 1P3PD 2F8NH 2H85A 3AZGB 3G6E1 5AVBD 3F6TA 2ZAEB 1Z01A 2E2JI 5JRGA 1YIJ1 3LZ1A 3C1CB 4Z66D 5GSUA 2CV5D 1YUKA 2NVTI 2JSSA 3RZOI 3REIB 1Q862 5F99D 1YHQZ 5T6BA 2IZ4A 4E2ZA 3X1SB 3B6GD 2DE6A 1KX4A 3O62B 2L5AA 1VLAA 2FJ7A 2NZDD 5B0YA 5CPIB 4NE3A 4A3BI 3VH6W 3KUYC 3IFUA 5BNVB 3AV1A 3HKZA 4G91C 3W99D 4J8UD 2OTJ1 4RV9A 2AROC 2ZM5A 1KX5C 1M1AA 3AFAD 1P3KC 5B24B 3AV2C 1VQ91 2PMZA 4Z5TC 2RPRA 5B33A 3WTPA 3A6NB 3CCV1 3S1MI 5AV6D 4J8XB 5CP6A 3TE5B 2ZY3A 5BT1D 1HQ3A 3RELA 3KSYA 3HOWI 3VH6T 3W96A 3WA9A 2HIOD 5CPJD 3W98A 1K8A2 1M901 3I4NI 5E5AD 3S15I 4LD9B 2B63I 4H9OB 2NQBC 2NVQI 1Q822 3LELB 3X1VA 3J81b 1KX3B 1K9M2 3AZJD 5DNNC 3CC21 1VQN1 4X23B 3AYWD 2V8IA 1EQZD 5B2ID 1ID3B 1F66B 3X1SA 2EGTA 3CCJ1 5AV5C 3MNND 4Z66B 5CPIA 5B1LD 2CV5B 1JFIB 4A3II 1WW9A 3MGPD 3F3FC 5BNVA 1N8R2 1BH8B 4H9QB 2F8ND 3CC7Z 1YJ9Z 2BYMB 5AVCC 1U35C 4H9PB 5B24A 2DQNC 3B0DB 2DE5A 3REKD 5CHLB 4KUDD 4KGCD 1I3QI 3MONA 3GTMS 2Y2LA 5BS7A 3MVDC 1YJNZ 1I6HI 3AZFA 3JAMb 4NE6A 2QREB 1P3LD 2JUBA 2LIYA 4M6BA 3AFAB 4MD8A 1VQ41 5B0ZC 3AZIC 3GTOI 1M1K2 1P3GB 1YI2Z 2E9HA 5AV6B 3D6WA 3VTNA 1USPB 4WJ3C 4BBRI 3CMA1 3AZHA 1ZB8A 1P3FC 3LELA 3BG0B 5FLXf 5JRGD 1P34D 1KX3A 1P3BB 3LZ1D 3CCUZ 3B6FC 5C4XI 5GSUD 5AY8C 3NQJB 5CPKA 4Y52I 5B2JB 2Y2NA 4X23A 4J8WA 3G6EZ 3LZ0B 1NJI2 1QYPA 1ID3A 1AOIC 2OZKA 1KX4D 5B1MC 3X1TC 3REHC 3CCM1 3VB9A 4JJNB 5FUGA 5B0YD 3AZJB 2FJ7D 3CCS1 2OTLZ 3S1RI 3Q87A 3AV1D 1EQZB 1BH8A 4H9QA 4YM6B 5GT0C 1M1AD 4E2WA 2NVYI 2BYMA 3PO2I 3UT9C 4NBFA 4CAYB 4NB9A 4H9PA 5B33D 3J80f 1BH9B 2Y2IA 3WTPD 5KDMB 4XUJB 3WKJB 5IP7I 2OTJZ 1VQP1 4R8PC 5CP6D 2HUEB 5B32B 4S1TA 1JWHC 1HQ3D 3UTAC 3RELD 2W8SA 1N2FA 5AV8B 3CCL1 4QTTA 3RZDI 3AZED 3VH5A 1VQ9Z 4A3LI 3MGQB 3W98D 3WA9D 4BY7I 1QVFZ 1TWGI 4HGYA 3CCRZ 3CCVZ 1P3GA 4CL1A 4EWCA 3CC4Z 1USPA 1P3MB 1VQ71 5DNMB 3B0CW 2QLVB 5GXQB 3MGRC 1R4VA 2G5HC 2DF4C 3KWQB 3AZKB 1P3BA 2KI7B 4HGZA 4MRIA 4NOZA 3CCQ1 1YJ91 1W2BZ 3AZMC 5B2JA 5B40B 3LZ0A 4Z5TA 3X1SD 1W2BY 3KXBC 1JJ2Z 4BY1I 3J80b 2F4OA 3LZ1B 4JJNA 3I56Z 3AZNC 5CPID 1P3IB 1KD11 1VQNZ 3GTGI 2W03A 1JJ2Y 5FLXb 2JE5A 3B0CT 3CC71 3REJC 1S721 1YIT1 2G2KA 4RVGA 3CCJZ 2FJ7B 5B24D 3CME1 3O62C 2HF1A 1VQL1 4J8VC 4XUJA 1YUAA 3AV1B 3WAAC 3AZFD 1YJN1 4E32A 5B32A 3IP4C 1KC82 3S2DI 5AV8A 2ZY5A 1Z03A 3MGQA 1QF8A 1TZYB 2LY8A 3AZLB 1P3OB 3TU4C 4QTUA 5A2Qf 4AYBA 4X6AI 1N1JB 5CP6B 3NDIA 3T4NB 4NBCA 3JAMf 1M19C 3A6NC 3AZHD 2E2HI 4J8XC 3LELD 2UWXA 1P3MA 4HH4A 3G4S1 1VQ4Z 1KX3D 3W96B 5GXQA 3KWQA 4WU8C 3AZKA 5CPKD 1RO0A 4X23D 2P28A 3P5JB 2VF1A 4J8WD 5C44I 3CMAZ 3I07A 2IZ3A 1ID3D 4NH1C 5B40A 3X1VB 1F66D 3PO3S 2CWEA 3FDDA 1Z02A 4KHAB 4ZBJB 4AWLC 2OTL1 3AN2C 1P3IA 2K3RA 2OOXB 2J8PA 5B0ZA 4A3JI 2XD5A 2R93I 1P3PC 3CCMZ 2YADA 2OOYB 3VH6A 2P3YA 1WIIA 3CCSZ 5AVBC 3HOYI 1RNIA 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 3A1I A;  4G92 B;  2V8J A;  4BBS I;  4MON A;  5D1O B;  1M18 B;  2CV5 C;  1FDI A;  1ZB9 A;  3PO3 I;  5F99 C;  2HU9 A;  1RLY A;  1I50 I;  3NDJ A;  1TWA I;  3B6G C;  4A3E I;  1TZY A;  3B0B A;  3AZL A;  1P3G D;  1P3O A;  2NZD C;  3W97 B;  3CCR 1;  3UTB C;  4EO5 C;  1N1J A;  3AZF B;  4WU9 B;  3CC4 1;  3CCL Z;  3W99 C;  4J8U C;  4Z2M G;  5G49 A;  4HGA B;  1P3B D;  3AFA C;  2Y2G A;  1YJW 1;  3S16 I;  5B2J D;  4A3K I;  5D1P A;  4WV4 B;  3LZ0 D;  4MXU A;  3AZH B;  1VQ7 Z;  4NBE A;  3EG5 B;  1RO4 A;  2O4H A;  3IF8 A;  5BT1 C;  4JJN D;  2Y0S A;  4KHA A;  5CPK B;  3NH4 A;  4XZQ B;  5CM2 M;  2Y2O A;  3MGS B;  3I56 1;  2DE7 A;  3CCE Z;  3CCQ Z;  2HIO C;  4J8W B;  1WWI A;  5CPJ C;  1ZLA B;  4NBA A;  5E5A C;  4YM6 D;  5LL6 f;  2PYO B;  4A3M I;  1VQM Z;  5FUG B;  2GTH A;  4QLC B;  2JIM A;  3AZJ C;  3LJA A;  4XUJ D;  4NFT A;  3WKJ D;  5B31 A;  3KIF A;  3X1U B;  4YS3 B;  1S32 A;  3MGR A;  3C1B B;  5B32 D;  3AYW C;  1P3A B;  1M18 A;  2QKD A;  3LUS A;  4ZUX B;  1EQZ C;  1YIT Z;  5B2I C;  2Y2H A;  5AV8 D;  3OW2 Z;  3CME Z;  3CXC Z;  2F2A C;  5B32 G;  3MGQ D;  2F8N G;  1VQL Z;  5A2Q b;  5IT9 b;  3MNN C;  3OW2 Y;  5B1L C;  3W97 A;  2RHB A;  3CXC Y;  4WU9 A;  3MGP C;  1P3M D;  5DNM D;  1H3O B;  5GXQ D;  1X3Z A;  4RVF A;  3KWQ D;  3AZK D;  3GCF A;  1Y8C A;  4RS4 A;  3REK C;  4KUD C;  4KGC C;  1Q16 A;  5B40 D;  2V8K A;  3G4S Z;  2R7Z I;  4J8V A;  2JR6 A;  5AV9 C;  3KUY B;  1VQK 1;  3EPL A;  1P3L C;  1M90 2;  4G91 B;  1P3I D;  2ARO B;  4XZQ A;  2QRC B;  3VMI A;  3MGS A;  1KX5 B;  2V45 A;  1X0T A;  4H9S C;  1P3K B;  1AA6 A;  3GTM I;  5B0Z D;  4Z5T B;  1ZLA A;  2Y2J A;  2PYO A;  3TU4 A;  3EPJ A;  2F8N K;  1TAF A;  4QLC A;  5JRG C;  1P34 C;  1ML8 A;  1NUI A;  5GSU C;  1TWH I;  3X1U A;  4YS3 A;  1P3A A;  3C1B A;  4DRB A;  4WU8 A;  4E33 A;  5GT3 A;  4ZUX A;  1P9N A;  4A3G I;  2YFV B;  1KX4 C;  3H3V J;  2NQB B;  1TZY D;  2IO5 C;  5B0Y C;  3AZL D;  1P3O D;  1VQ8 1;  5D1O A;  4E31 A;  5DNN B;  4E2X A;  3AV1 C;  3AN2 A;  3IX0 A;  2YFW A;  3A1K A;  3W96 D;  1H3O A;  1M1A C;  2I3C A;  3TDH B;  5B33 C;  1Q81 1;  3R45 A;  3WTP C;  5AV5 B;  1K73 1;  1L1O C;  3X1V D;  3NH8 A;  5CP6 C;  1VQ8 Z;  2VPY A;  1HQ3 C;  3KUY A;  3KFU G;  3REL C;  5C3I C;  1YJW Z;  3AZE C;  3CCE 1;  2ARO A;  3W98 C;  3WA9 C;  5AVC B;  1KX5 A;  2RBL A;  1R9T I;  1U35 B;  3AV2 A;  1P3K A;  2R6M A;  2W04 A;  2XD1 A;  2PM9 A;  1VQM 1;  3M3Y I;  3AZG C;  3MVD B;  3I55 1;  3UTB A;  3LJA D;  3HOZ I;  5B31 D;  3C1C C;  1S32 D;  1M18 D;  5B0Z B;  2JA8 I;  3MZK B;  3REI C;  3AZI B;  1TWF I;  3AL0 C;  3X1S C;  1QVG Z;  2Y2K A;  2YFV A;  2NQB A;  1P3F B;  2JS4 A;  1Q7Y 1;  5CPI C;  3CD6 1;  4NBD A;  2BG1 A;  3W97 D;  2VUG A;  1QVG Y;  4WU9 D;  4E44 A;  3B6F B;  4MD7 A;  5DNN A;  5AY8 B;  2JNY A;  1T3U A;  2HIO A;  3V9R B;  1AOI B;  5C4J I;  5B24 C;  5IT9 f;  2QA4 Z;  3H0R C;  5B1M B;  3REH B;  3X1T B;  1X3W A;  1KQS Y;  3S17 I;  1WZN A;  5AV5 A;  5BS7 C;  5G49 B;  4NE5 A;  4XZQ D;  5GT0 B;  3MGS D;  3AYW A;  2PK7 A;  2Q51 A;  3S14 I;  5AVC A;  2JA6 I;  3UT9 B;  1U35 A;  5BO0 B;  1ZLA D;  1VQK Z;  2PYO D;  4LD9 C;  3TU4 D;  2JMO A;  3EER A;  3AZH C;  3I55 Z;  1Q9C A;  4R8P B;  3MVD A;  5B1L A;  3LEL C;  3FQQ A;  4QLC D;  3UTA B;  1KX3 C;  3GKQ A;  3HOU I;  5CPK C;  4TNU A;  3X1U D;  4YS3 D;  4X23 C;  1WWS A;  3C1B D;  1P3A D;  2F4M A;  3QWU A;  4J8W C;  5T67 A;  5GT3 D;  4ZUX D;  3AZI A;  2RVQ D;  1ID3 C;  2GTI A;  2QEX 1;  1F66 C;  1KD1 2;  1VQ6 1;  1HTA A;  3WTP E;  5B31 B;  1P3F A;  1S32 B;  5AV9 A;  4Z66 C;  3MGR B;  1K8A 1;  3BG1 B;  3B6F A;  3AN2 D;  3MZL B;  5AY8 A;  3AZM B;  1Q7Y 2;  1Q82 1;  3GTQ I;  2YU9 I;  1Z2C B;  1K9M 1;  3V9R A;  3KXB B;  1AOI A;  4RVD A;  1VQ5 Z;  3B0D C;  5B1M A;  3REH A;  3X1T A;  3CQZ I;  3AZN B;  1P34 A;  3VMH A;  3KUY D;  4NBB A;  4WZS B;  3I4M I;  3REJ B;  2ARO D;  3GTK I;  5GT0 A;  4H9N A;  1KX5 D;  3GTP I;  3S1Q I;  1P3K D;  3AV2 D;  5JA4 B;  3UT9 A;  4Z5T D;  1P3G C;  2J6A A;  5BO0 A;  2BYK B;  5AV6 C;  4J8V B;  2AYD A;  3G71 Z;  1N8R 1;  3S1N I;  5IP9 I;  3WAA B;  2VQR A;  4R8P A;  3UTB D;  3EPH A;  3UTA A;  3F3P C;  1P3B C;  3M4O I;  4MD9 A;  5B2J C;  4DK1 A;  3TU4 B;  2RIQ A;  3LZ0 C;  4A3C I;  1TAF B;  4CSR B;  1M19 B;  2NQB D;  4JJN C;  4WNN A;  4E2Y A;  1RQF A;  4A3F I;  1M1K 1;  5BNX B;  4WU8 B;  5DNN D;  1LQL A;  5GT3 B;  3AZE A;  2JCH A;  4YM6 C;  3AZM A;  2GU2 A;  3HOX I;  2QRD B;  3H0L C;  1S72 Z;  3H0G I;  4NFR A;  3KXB A;  3CD6 Z;  2QA4 1;  3AZG A;  1ULY A;  4XUJ C;  5AV5 D;  4AWL B;  3WKJ C;  3U50 C;  3AZN A;  3AN2 B;  2O53 A;  1NJI 1;  4UUZ B;  2HUE C;  2FFF B;  2YFW B;  4DRA A;  5B32 C;  2LFU A;  3C1C A;  2JA7 I;  5AV8 C;  1F1E A;  3REI A;  3REJ A;  1P3P B;  5C3E I;  3MGQ C;  3R45 B;  5AVC D;  1PFT A;  5AVB B;  1U35 D;  5T64 A;  5JA4 A;  2JA5 I;  1PZR A;  3O62 A;  2BYK A;  3S2H I;  3D9X A;  3MVD D;  4DQY B;  2ZY2 A;  1P3M C;  3WAA A;  2RT9 A;  5DNM C;  3ESW A;  5F99 B;  2Y2M A;  5GXQ C;  2E7Z A;  3KWQ C;  3AZK C;  3AV2 B;  3B6G B;  4A3D I;  1B67 A;  3H0M C;  1ZH1 A;  3J7A 4;  3AZI D;  2IV2 X;  2NZD B;  5B40 C;  3NH5 A;  3UTB B;  4EO5 B;  1B6W A;  4CSR A;  3A6N A;  1M19 A;  2JIQ A;  3VMG A;  3LZ1 C;  4J8X A;  5AV9 D;  4J8U B;  1P3I C;  1P3F D;  3W99 B;  2WB1 A;  1VQO 1;  4BXX I;  5BNX A;  3B6F D;  3GTJ I;  1K83 I;  5AY8 D;  2QEX Z;  2KPI A;  2JIP A;  1Y1V S;  2WAQ A;  1VQ6 Z;  3HOV I;  2E2I I;  1AOI D;  2FJ7 C;  5B1M D;  3X1T D;  3REH D;  4LD9 A;  4H9O A;  3KIH A;  4NB8 A;  1VQ5 1;  2AKL A;  4A93 I;  4UUZ A;  2HIO B;  5CPJ B;  2ZY4 A;  4H9R B;  3NFZ A;  1KRL A;  4Y7N I;  5E5A B;  1NP6 A;  5GT0 D;  1YHQ 1;  1P3P A;  4RVH A;  1TZY C;  3AZL C;  3UT9 D;  1P3O C;  1F66 A;  5AVB A;  2Q4Z A;  1YIJ Z;  2M48 A;  1TFI A;  3G71 1;  4NBG A;  1Y1V I;  4R8P D;  4Z66 A;  2CV5 A;  1JFI A;  3AYW B;  1WCM I;  3NQU B;  3UTA D;  3W96 C;  5F99 A;  4E30 A;  5B2I B;  4MH4 A;  3CPW Z;  1TWC I;  3B6G A;  5FLM I;  4DGL A;  4XX2 A;  3MNN B;  2NZD A;  3CPW Y;  1KC8 1;  5B1L B;  3X1V C;  3MGP B;  2Y2P A;  4ZBJ C;  2F8N B;  4J8U A;  3W99 A;  3MGR D;  2QR1 B;  1SFO I;  3AFA A;  5B31 G;  3FKI I;  3AZM D;  3REK B;  4KUD B;  4KGC B;  2Y2Q A;  3VH5 W;  5AN9 F;  3KXB D;  5AV6 A;  5AV9 B;  1BFM A;  3EPK A;  3AZG D;  3LJA C;  1P3L B;  4G92 C;  1QVF Y;  5B31 C;  2K5R A;  3AZN D;  1S32 C;  1M18 C;  1KU5 A;  2R92 I;  1KQS Z;  1DL6 A;  3C1C D;  5CPJ A;  3NQJ A;  4H9R A;  3FQM A;  3REI D;  3REJ D;  5E5A A;  2M6N A;  4E45 A;  4UPK A;  1Q86 1;  3J81 f;  3O62 D;  3GTL I;  3W97 C;  5JRG B;  4J8V D;  3AZF C;  4WU9 C;  3AZJ A;  1P34 B;  3VH5 T;  2V3V A;  5GSU B;  3CC2 Z;  3WAA D;  3EED A;  1Q81 2;  3K7A I;  4Z2M H;  4HGA C;  3NQU A;  4H9N B;  1K73 2;  1EQZ A;  5B2I A;  4YM6 A;  1KX4 B;  2VUM I;  1S7M A;  2IO5 B;  5B0Y B;  4CAY A;  3MNN A;  2G5I C;  1BH9 A;  5KDM A;  3A6N D;  1M19 D;  3WKJ A;  3MGP A;  4J8X D;  1Y1W I;  4XZQ C;  2F8N A;  1W2E A;  3MGS C;  1M1A B;  4NBH A;  4WU8 D;  1ZLA C;  5B33 B;  3WTP B;  3REK A;  2PYO C;  4KUD A;  4KGC A;  2BJO A;  1VQP Z;  1YI2 1;  1VQO Z;  4WNN B;  4LD9 D;  4QLC C;  1HQ3 B;  3REL B;  5C3I B;  1P3L A;  1QXF A;  2JIO A;  5DNM A;  3X1U C;  4YS3 C;  3AZE B;  3C1B C;  1P3A C;  3W98 B;  1A7W A;  3WA9 B;  1RO2 A;  4H9S A;  5GT3 C;  4ZUX C;  3CCU 1;  2RVQ C;  1P3P D;  2QLV B;  2F8N H;  2H85 A;  3AZG B;  3G6E 1;  5AVB D;  3F6T A;  2ZAE B;  1Z01 A;  2E2J I;  5JRG A;  1YIJ 1;  3LZ1 A;  3C1C B;  4Z66 D;  5GSU A;  2CV5 D;  1YUK A;  2NVT I;  2JSS A;  3RZO I;  3REI B;  1Q86 2;  5F99 D;  1YHQ Z;  5T6B A;  2IZ4 A;  4E2Z A;  3X1S B;  3B6G D;  2DE6 A;  2VPW A;  1KX4 A;  3O62 B;  2L5A A;  1VLA A;  2FJ7 A;  2NZD D;  5B0Y A;  5CPI B;  4NE3 A;  4A3B I;  3VH6 W;  3KUY C;  3IFU A;  5BNV B;  3AV1 A;  3HKZ A;  4G91 C;  3W99 D;  4J8U D;  2OTJ 1;  4RV9 A;  2ARO C;  2ZM5 A;  1KX5 C;  1M1A A;  3AFA D;  1P3K C;  5B24 B;  3AV2 C;  1VQ9 1;  2PMZ A;  4Z5T C;  2RPR A;  5B33 A;  3WTP A;  3A6N B;  3CCV 1;  3S1M I;  5AV6 D;  4J8X B;  5CP6 A;  3TE5 B;  2ZY3 A;  5BT1 D;  1HQ3 A;  2NVX I;  3REL A;  3KSY A;  3HOW I;  3VH6 T;  3W96 A;  3WA9 A;  2HIO D;  5CPJ D;  3W98 A;  1K8A 2;  1M90 1;  3I4N I;  5E5A D;  3S15 I;  4LD9 B;  2B63 I;  4H9O B;  2NQB C;  2NVQ I;  1Q82 2;  3LEL B;  3X1V A;  3J81 b;  1KX3 B;  1K9M 2;  3AZJ D;  5DNN C;  3CC2 1;  1VQN 1;  4X23 B;  3AYW D;  2V8I A;  1EQZ D;  5B2I D;  1ID3 B;  1F66 B;  3X1S A;  2EGT A;  3CCJ 1;  5AV5 C;  3MNN D;  4Z66 B;  5CPI A;  5B1L D;  2CV5 B;  1JFI B;  4A3I I;  1WW9 A;  2VPZ A;  3MGP D;  3F3F C;  5BNV A;  1N8R 2;  1BH8 B;  4H9Q B;  2F8N D;  3CC7 Z;  1YJ9 Z;  2BYM B;  5AVC C;  1U35 C;  4H9P B;  5B24 A;  2DQN C;  3B0D B;  2DE5 A;  3REK D;  5CHL B;  4KUD D;  4KGC D;  1I3Q I;  3MON A;  3IR7 A;  3GTM S;  2Y2L A;  5BS7 A;  3MVD C;  1YJN Z;  1I6H I;  3AZF A;  3JAM b;  4NE6 A;  2QRE B;  1P3L D;  2JUB A;  2LIY A;  4M6B A;  3AFA B;  4MD8 A;  1VQ4 1;  5B0Z C;  3AZI C;  3GTO I;  1M1K 2;  1P3G B;  1YI2 Z;  2E9H A;  5AV6 B;  3D6W A;  3VTN A;  1USP B;  4WJ3 C;  4BBR I;  2LEX A;  3AZH A;  3CMA 1;  1ZB8 A;  1P3F C;  3LEL A;  3BG0 B;  5FLX f;  5JRG D;  1P34 D;  1KX3 A;  1P3B B;  3LZ1 D;  3CCU Z;  3B6F C;  5C4X I;  5GSU D;  5AY8 C;  3NQJ B;  5CPK A;  4Y52 I;  5B2J B;  2Y2N A;  4X23 A;  4J8W A;  3G6E Z;  3LZ0 B;  1NJI 2;  1QYP A;  1ID3 A;  1AOI C;  2OZK A;  1KX4 D;  5B1M C;  3X1T C;  3REH C;  3CCM 1;  3VB9 A;  4JJN B;  5FUG A;  5B0Y D;  3AZJ B;  2FJ7 D;  3CCS 1;  2OTL Z;  3S1R I;  3Q87 A;  3AV1 D;  1EQZ B;  1BH8 A;  4H9Q A;  4YM6 B;  5GT0 C;  1M1A D;  4E2W A;  2NVY I;  2BYM A;  3PO2 I;  3UT9 C;  4NBF A;  4CAY B;  4NB9 A;  4H9P A;  5B33 D;  3J80 f;  1BH9 B;  2Y2I A;  3WTP D;  5KDM B;  4XUJ B;  3WKJ B;  5IP7 I;  2OTJ Z;  1VQP 1;  4R8P C;  5CP6 D;  2HUE B;  5B32 B;  4S1T A;  1JWH C;  1HQ3 D;  3UTA C;  2VPX A;  3REL D;  2W8S A;  1N2F A;  5AV8 B;  3CCL 1;  4QTT A;  3RZD I;  3AZE D;  3VH5 A;  1VQ9 Z;  4A3L I;  3MGQ B;  3W98 D;  3WA9 D;  4BY7 I;  1QVF Z;  1TWG I;  4HGY A;  3CCR Z;  3CCV Z;  1P3G A;  4CL1 A;  4EWC A;  3CC4 Z;  1USP A;  1P3M B;  1VQ7 1;  5DNM B;  3B0C W;  2JIR A;  5GXQ B;  3MGR C;  1R4V A;  2G5H C;  2DF4 C;  3KWQ B;  3AZK B;  1P3B A;  2KI7 B;  3D2L A;  4HGZ A;  4MRI A;  4NOZ A;  3CCQ 1;  1YJ9 1;  1W2B Z;  3AZM C;  5B2J A;  5B40 B;  3LZ0 A;  4Z5T A;  3X1S D;  1W2B Y;  3KXB C;  1JJ2 Z;  4BY1 I;  3J80 b;  2F4O A;  3LZ1 B;  4JJN A;  3I56 Z;  3AZN C;  5CPI D;  1P3I B;  1KD1 1;  1VQN Z;  3GTG I;  2W03 A;  1JJ2 Y;  5FLX b;  2JE5 A;  3B0C T;  3CC7 1;  3REJ C;  1WJ2 A;  1YIT 1;  1S72 1;  2G2K A;  4RVG A;  3CCJ Z;  2FJ7 B;  5B24 D;  3CME 1;  3O62 C;  2HF1 A;  1VQL 1;  4J8V C;  4XUJ A;  1YUA A;  3AV1 B;  3WAA C;  2NAP A;  3AZF D;  1SIW A;  1YJN 1;  4E32 A;  5B32 A;  3IP4 C;  1KC8 2;  3S2D I;  5AV8 A;  2ZY5 A;  1Z03 A;  3MGQ A;  1QF8 A;  1TZY B;  2LY8 A;  3AZL B;  1P3O B;  3TU4 C;  4QTU A;  5A2Q f;  4AYB A;  4X6A I;  1N1J B;  5CP6 B;  3NDI A;  3T4N B;  4NBC A;  3JAM f;  1M19 C;  3A6N C;  3AZH D;  2E2H I;  4J8X C;  3LEL D;  2UWX A;  1P3M A;  4HH4 A;  3G4S 1;  1VQ4 Z;  1KX3 D;  3W96 B;  5GXQ A;  3KWQ A;  4WU8 C;  3AZK A;  5CPK D;  1RO0 A;  4X23 D;  2P28 A;  3P5J B;  2VF1 A;  4J8W D;  1FDO A;  5C44 I;  3CMA Z;  3I07 A;  2IZ3 A;  1ID3 D;  4NH1 C;  5B40 A;  3X1V B;  1F66 D;  3PO3 S;  2CWE A;  3FDD A;  1Z02 A;  4KHA B;  4ZBJ B;  4AWL C;  2OTL 1;  3AN2 C;  1P3I A;  2K3R A;  2OOX B;  2J8P A;  5B0Z A;  4A3J I;  2XD5 A;  2R93 I;  1P3P C;  3CCM Z;  2YAD A;  2OOY B;  3VH6 A;  2P3Y A;  1WII A;  3CCS Z;  5AVB C;  3HOY I;  1RNI A;  3LJA B; 
#chains in the Genus database with same CATH homology
 3A1I A;  4G92 B;  2V8J A;  4BBS I;  4MON A;  5D1O B;  1M18 B;  2CV5 C;  1ZB9 A;  3PO3 I;  5F99 C;  2HU9 A;  1RLY A;  1I50 I;  3NDJ A;  1TWA I;  3B6G C;  4A3E I;  1TZY A;  3B0B A;  3AZL A;  1P3G D;  1P3O A;  2NZD C;  3W97 B;  3CCR 1;  3UTB C;  4EO5 C;  1N1J A;  3AZF B;  4WU9 B;  3CC4 1;  3CCL Z;  3W99 C;  4J8U C;  4Z2M G;  5G49 A;  4HGA B;  1P3B D;  3AFA C;  2Y2G A;  1YJW 1;  3S16 I;  5B2J D;  4A3K I;  5D1P A;  4WV4 B;  3LZ0 D;  4MXU A;  3AZH B;  1VQ7 Z;  4NBE A;  3EG5 B;  1RO4 A;  2O4H A;  3IF8 A;  5BT1 C;  4JJN D;  2Y0S A;  4KHA A;  5CPK B;  3NH4 A;  4XZQ B;  5CM2 M;  2Y2O A;  3MGS B;  3I56 1;  2DE7 A;  3CCE Z;  3CCQ Z;  2HIO C;  4J8W B;  1WWI A;  5CPJ C;  1ZLA B;  4NBA A;  5E5A C;  4YM6 D;  5LL6 f;  2PYO B;  4A3M I;  1VQM Z;  5FUG B;  2GTH A;  4QLC B;  3AZJ C;  3LJA A;  4XUJ D;  4NFT A;  3WKJ D;  5B31 A;  3KIF A;  3X1U B;  4YS3 B;  1S32 A;  3MGR A;  3C1B B;  5B32 D;  3AYW C;  1P3A B;  1M18 A;  2QKD A;  3LUS A;  4ZUX B;  1EQZ C;  1YIT Z;  5B2I C;  2Y2H A;  5AV8 D;  3OW2 Z;  3CME Z;  3CXC Z;  2F2A C;  5B32 G;  3MGQ D;  2F8N G;  1VQL Z;  5A2Q b;  5IT9 b;  3MNN C;  3OW2 Y;  5B1L C;  3W97 A;  2RHB A;  3CXC Y;  4WU9 A;  3MGP C;  1P3M D;  5DNM D;  1H3O B;  5GXQ D;  1X3Z A;  4RVF A;  3KWQ D;  3AZK D;  3GCF A;  4RS4 A;  3REK C;  4KUD C;  4KGC C;  5B40 D;  2V8K A;  3G4S Z;  2R7Z I;  4J8V A;  2JR6 A;  5AV9 C;  3KUY B;  1VQK 1;  3EPL A;  1P3L C;  1M90 2;  4G91 B;  1P3I D;  2ARO B;  4XZQ A;  2QRC B;  3VMI A;  3MGS A;  1KX5 B;  2NVX I;  1X0T A;  4H9S C;  1P3K B;  3GTM I;  5B0Z D;  4Z5T B;  1ZLA A;  2Y2J A;  2PYO A;  3TU4 A;  3EPJ A;  2F8N K;  1TAF A;  4QLC A;  5JRG C;  1P34 C;  1ML8 A;  1NUI A;  5GSU C;  1TWH I;  3X1U A;  4YS3 A;  1P3A A;  3C1B A;  4DRB A;  4WU8 A;  4E33 A;  5GT3 A;  4ZUX A;  1P9N A;  4A3G I;  2YFV B;  1KX4 C;  3H3V J;  2NQB B;  1TZY D;  2IO5 C;  5B0Y C;  3AZL D;  1P3O D;  1VQ8 1;  5D1O A;  4E31 A;  5DNN B;  4E2X A;  3AV1 C;  3AN2 A;  3IX0 A;  2YFW A;  3A1K A;  3W96 D;  1H3O A;  1M1A C;  2I3C A;  3TDH B;  5B33 C;  1Q81 1;  3R45 A;  3WTP C;  5AV5 B;  1K73 1;  1L1O C;  3X1V D;  3NH8 A;  5CP6 C;  1VQ8 Z;  1HQ3 C;  3KUY A;  3KFU G;  3REL C;  5C3I C;  1YJW Z;  3AZE C;  3CCE 1;  2ARO A;  3W98 C;  3WA9 C;  5AVC B;  1KX5 A;  2RBL A;  1R9T I;  1U35 B;  3AV2 A;  1P3K A;  2R6M A;  2W04 A;  2XD1 A;  2PM9 A;  1VQM 1;  3M3Y I;  3AZG C;  3MVD B;  3I55 1;  3UTB A;  3LJA D;  3HOZ I;  5B31 D;  3C1C C;  1S32 D;  1M18 D;  5B0Z B;  2JA8 I;  3MZK B;  3REI C;  3AZI B;  1TWF I;  3AL0 C;  3X1S C;  1QVG Z;  2Y2K A;  2YFV A;  2NQB A;  1P3F B;  2JS4 A;  1Q7Y 1;  5CPI C;  3CD6 1;  4NBD A;  2BG1 A;  3W97 D;  2VUG A;  1QVG Y;  4WU9 D;  4E44 A;  3B6F B;  4MD7 A;  5DNN A;  5AY8 B;  2JNY A;  1T3U A;  2HIO A;  3V9R B;  1AOI B;  5C4J I;  5B24 C;  5IT9 f;  2QA4 Z;  3H0R C;  5B1M B;  3REH B;  3X1T B;  1X3W A;  1KQS Y;  3S17 I;  5AV5 A;  5BS7 C;  5G49 B;  4NE5 A;  4XZQ D;  5GT0 B;  3MGS D;  3AYW A;  2PK7 A;  2Q51 A;  3S14 I;  5AVC A;  2JA6 I;  3UT9 B;  1U35 A;  5BO0 B;  1ZLA D;  1VQK Z;  2PYO D;  4LD9 C;  3TU4 D;  2JMO A;  3EER A;  3AZH C;  3I55 Z;  1Q9C A;  4R8P B;  3MVD A;  5B1L A;  3LEL C;  3FQQ A;  4QLC D;  3UTA B;  1KX3 C;  3GKQ A;  3HOU I;  5CPK C;  4TNU A;  3X1U D;  4YS3 D;  4X23 C;  1WWS A;  3C1B D;  1P3A D;  2F4M A;  3QWU A;  4J8W C;  5T67 A;  5GT3 D;  4ZUX D;  3AZI A;  2RVQ D;  1ID3 C;  2GTI A;  2QEX 1;  1F66 C;  1KD1 2;  1VQ6 1;  1HTA A;  3WTP E;  5B31 B;  1P3F A;  1S32 B;  5AV9 A;  4Z66 C;  3MGR B;  1K8A 1;  3BG1 B;  3B6F A;  3AN2 D;  3MZL B;  5AY8 A;  3AZM B;  1Q7Y 2;  1Q82 1;  3GTQ I;  2YU9 I;  1Z2C B;  1K9M 1;  3V9R A;  3KXB B;  1AOI A;  4RVD A;  1VQ5 Z;  3B0D C;  5B1M A;  3REH A;  3X1T A;  3CQZ I;  3AZN B;  1P34 A;  3VMH A;  3KUY D;  4NBB A;  4WZS B;  3I4M I;  3REJ B;  2ARO D;  3GTK I;  5GT0 A;  4H9N A;  1KX5 D;  3GTP I;  3S1Q I;  1P3K D;  3AV2 D;  5JA4 B;  3UT9 A;  4Z5T D;  1P3G C;  2J6A A;  5BO0 A;  2BYK B;  5AV6 C;  4J8V B;  3G71 Z;  1N8R 1;  3S1N I;  5IP9 I;  3WAA B;  2VQR A;  4R8P A;  3UTB D;  3EPH A;  3UTA A;  3F3P C;  1P3B C;  3M4O I;  4MD9 A;  5B2J C;  4DK1 A;  3TU4 B;  2RIQ A;  3LZ0 C;  4A3C I;  1TAF B;  4CSR B;  1M19 B;  2NQB D;  4JJN C;  4WNN A;  4E2Y A;  1RQF A;  4A3F I;  1M1K 1;  5BNX B;  4WU8 B;  5DNN D;  1LQL A;  5GT3 B;  3AZE A;  2JCH A;  4YM6 C;  3AZM A;  2GU2 A;  3HOX I;  2QRD B;  3H0L C;  1S72 Z;  3H0G I;  4NFR A;  3KXB A;  3CD6 Z;  2QA4 1;  3AZG A;  1ULY A;  4XUJ C;  5AV5 D;  4AWL B;  3WKJ C;  3U50 C;  3AZN A;  3AN2 B;  2O53 A;  1NJI 1;  4UUZ B;  2HUE C;  2FFF B;  2YFW B;  4DRA A;  5B32 C;  2LFU A;  3C1C A;  2JA7 I;  5AV8 C;  1F1E A;  3REI A;  3REJ A;  1P3P B;  5C3E I;  3MGQ C;  3R45 B;  5AVC D;  1PFT A;  5AVB B;  1U35 D;  5T64 A;  5JA4 A;  2JA5 I;  1PZR A;  3O62 A;  2BYK A;  3S2H I;  3D9X A;  3MVD D;  4DQY B;  2ZY2 A;  1P3M C;  3WAA A;  2RT9 A;  5DNM C;  3ESW A;  5F99 B;  2Y2M A;  5GXQ C;  3KWQ C;  3AZK C;  3AV2 B;  3B6G B;  4A3D I;  1B67 A;  3H0M C;  1ZH1 A;  3J7A 4;  3AZI D;  2NZD B;  5B40 C;  3NH5 A;  3UTB B;  4EO5 B;  1B6W A;  4CSR A;  3A6N A;  1M19 A;  3VMG A;  3LZ1 C;  4J8X A;  5AV9 D;  4J8U B;  1P3I C;  1P3F D;  3W99 B;  2WB1 A;  1VQO 1;  4BXX I;  5BNX A;  3B6F D;  3GTJ I;  1K83 I;  5AY8 D;  2QEX Z;  2KPI A;  1Y1V S;  2WAQ A;  1VQ6 Z;  3HOV I;  2E2I I;  1AOI D;  2FJ7 C;  5B1M D;  3X1T D;  3REH D;  4LD9 A;  4H9O A;  3KIH A;  4NB8 A;  1VQ5 1;  2AKL A;  4A93 I;  4UUZ A;  2HIO B;  5CPJ B;  2ZY4 A;  4H9R B;  3NFZ A;  1KRL A;  4Y7N I;  5E5A B;  1NP6 A;  5GT0 D;  1YHQ 1;  1P3P A;  4RVH A;  1TZY C;  3AZL C;  3UT9 D;  1P3O C;  1F66 A;  5AVB A;  2Q4Z A;  1YIJ Z;  2M48 A;  1TFI A;  3G71 1;  4NBG A;  1Y1V I;  4R8P D;  4Z66 A;  2CV5 A;  1JFI A;  3AYW B;  1WCM I;  3NQU B;  3UTA D;  3W96 C;  5F99 A;  4E30 A;  5B2I B;  4MH4 A;  3CPW Z;  1TWC I;  3B6G A;  5FLM I;  4DGL A;  4XX2 A;  3MNN B;  2NZD A;  3CPW Y;  1KC8 1;  5B1L B;  3X1V C;  3MGP B;  2Y2P A;  4ZBJ C;  2F8N B;  4J8U A;  3W99 A;  3MGR D;  2QR1 B;  1SFO I;  3AFA A;  5B31 G;  3FKI I;  3AZM D;  3REK B;  4KUD B;  4KGC B;  2Y2Q A;  3VH5 W;  5AN9 F;  3KXB D;  5AV6 A;  5AV9 B;  1BFM A;  3EPK A;  3AZG D;  3LJA C;  1P3L B;  4G92 C;  1QVF Y;  5B31 C;  2K5R A;  3AZN D;  1S32 C;  1M18 C;  1KU5 A;  2R92 I;  1KQS Z;  1DL6 A;  3C1C D;  5CPJ A;  3NQJ A;  4H9R A;  3FQM A;  3REI D;  3REJ D;  5E5A A;  2M6N A;  4E45 A;  4UPK A;  1Q86 1;  3J81 f;  3O62 D;  3GTL I;  3W97 C;  5JRG B;  4J8V D;  3AZF C;  4WU9 C;  3AZJ A;  1P34 B;  3VH5 T;  3CC2 Z;  5GSU B;  3WAA D;  3EED A;  1Q81 2;  3K7A I;  4Z2M H;  4HGA C;  3NQU A;  4H9N B;  1K73 2;  1EQZ A;  5B2I A;  4YM6 A;  1KX4 B;  2VUM I;  1S7M A;  2IO5 B;  5B0Y B;  4CAY A;  3MNN A;  2G5I C;  1BH9 A;  5KDM A;  3A6N D;  1M19 D;  3WKJ A;  3MGP A;  4J8X D;  1Y1W I;  4XZQ C;  2F8N A;  1W2E A;  3MGS C;  1M1A B;  4NBH A;  4WU8 D;  1ZLA C;  5B33 B;  3WTP B;  3REK A;  2PYO C;  4KUD A;  4KGC A;  2BJO A;  1VQP Z;  1YI2 1;  1VQO Z;  4WNN B;  4LD9 D;  4QLC C;  1HQ3 B;  3REL B;  5C3I B;  1P3L A;  5DNM A;  3X1U C;  4YS3 C;  3AZE B;  3C1B C;  1P3A C;  3W98 B;  1A7W A;  3WA9 B;  1RO2 A;  4H9S A;  5GT3 C;  4ZUX C;  3CCU 1;  2RVQ C;  1P3P D;  2F8N H;  2H85 A;  3AZG B;  3G6E 1;  5AVB D;  3F6T A;  2ZAE B;  1Z01 A;  2E2J I;  5JRG A;  1YIJ 1;  3LZ1 A;  3C1C B;  4Z66 D;  5GSU A;  2CV5 D;  1YUK A;  2NVT I;  2JSS A;  3RZO I;  3REI B;  1Q86 2;  5F99 D;  1YHQ Z;  5T6B A;  2IZ4 A;  4E2Z A;  3X1S B;  3B6G D;  2DE6 A;  1KX4 A;  3O62 B;  2L5A A;  1VLA A;  2FJ7 A;  2NZD D;  5B0Y A;  5CPI B;  4NE3 A;  4A3B I;  3VH6 W;  3KUY C;  3IFU A;  5BNV B;  3AV1 A;  3HKZ A;  4G91 C;  3W99 D;  4J8U D;  2OTJ 1;  4RV9 A;  2ARO C;  2ZM5 A;  1KX5 C;  1M1A A;  3AFA D;  1P3K C;  5B24 B;  3AV2 C;  1VQ9 1;  2PMZ A;  4Z5T C;  2RPR A;  5B33 A;  3WTP A;  3A6N B;  3CCV 1;  3S1M I;  5AV6 D;  4J8X B;  5CP6 A;  3TE5 B;  2ZY3 A;  5BT1 D;  1HQ3 A;  3REL A;  3KSY A;  3HOW I;  3VH6 T;  3W96 A;  3WA9 A;  2HIO D;  5CPJ D;  3W98 A;  1K8A 2;  1M90 1;  3I4N I;  5E5A D;  3S15 I;  4LD9 B;  2B63 I;  4H9O B;  2NQB C;  2NVQ I;  1Q82 2;  3LEL B;  3X1V A;  3J81 b;  1KX3 B;  1K9M 2;  3AZJ D;  5DNN C;  3CC2 1;  1VQN 1;  4X23 B;  3AYW D;  2V8I A;  1EQZ D;  5B2I D;  1ID3 B;  1F66 B;  3X1S A;  2EGT A;  3CCJ 1;  5AV5 C;  3MNN D;  4Z66 B;  5CPI A;  5B1L D;  2CV5 B;  1JFI B;  4A3I I;  1WW9 A;  3MGP D;  3F3F C;  5BNV A;  1N8R 2;  1BH8 B;  4H9Q B;  2F8N D;  3CC7 Z;  1YJ9 Z;  2BYM B;  5AVC C;  1U35 C;  4H9P B;  5B24 A;  2DQN C;  3B0D B;  2DE5 A;  3REK D;  5CHL B;  4KUD D;  4KGC D;  1I3Q I;  3MON A;  3GTM S;  2Y2L A;  5BS7 A;  3MVD C;  1YJN Z;  1I6H I;  3AZF A;  3JAM b;  4NE6 A;  2QRE B;  1P3L D;  2JUB A;  2LIY A;  4M6B A;  3AFA B;  4MD8 A;  1VQ4 1;  5B0Z C;  3AZI C;  3GTO I;  1M1K 2;  1P3G B;  1YI2 Z;  2E9H A;  5AV6 B;  3D6W A;  3VTN A;  1USP B;  4WJ3 C;  4BBR I;  3CMA 1;  3AZH A;  1ZB8 A;  1P3F C;  3LEL A;  3BG0 B;  5FLX f;  5JRG D;  1P34 D;  1KX3 A;  1P3B B;  3LZ1 D;  3CCU Z;  3B6F C;  5C4X I;  5GSU D;  5AY8 C;  3NQJ B;  5CPK A;  4Y52 I;  5B2J B;  2Y2N A;  4X23 A;  4J8W A;  3G6E Z;  3LZ0 B;  1NJI 2;  1QYP A;  1ID3 A;  1AOI C;  2OZK A;  1KX4 D;  5B1M C;  3X1T C;  3REH C;  3CCM 1;  3VB9 A;  4JJN B;  5FUG A;  5B0Y D;  3AZJ B;  2FJ7 D;  3CCS 1;  2OTL Z;  3S1R I;  3Q87 A;  3AV1 D;  1EQZ B;  1BH8 A;  4H9Q A;  4YM6 B;  5GT0 C;  1M1A D;  4E2W A;  2NVY I;  2BYM A;  3PO2 I;  3UT9 C;  4NBF A;  4CAY B;  4NB9 A;  4H9P A;  5B33 D;  3J80 f;  1BH9 B;  2Y2I A;  3WTP D;  5KDM B;  4XUJ B;  3WKJ B;  5IP7 I;  2OTJ Z;  1VQP 1;  4R8P C;  5CP6 D;  2HUE B;  5B32 B;  4S1T A;  1JWH C;  1HQ3 D;  3UTA C;  3REL D;  2W8S A;  1N2F A;  5AV8 B;  3CCL 1;  4QTT A;  3RZD I;  3AZE D;  3VH5 A;  1VQ9 Z;  4A3L I;  3MGQ B;  3W98 D;  3WA9 D;  4BY7 I;  1QVF Z;  1TWG I;  4HGY A;  3CCR Z;  3CCV Z;  1P3G A;  4CL1 A;  4EWC A;  3CC4 Z;  1USP A;  1P3M B;  1VQ7 1;  5DNM B;  3B0C W;  2QLV B;  5GXQ B;  3MGR C;  1R4V A;  2G5H C;  2DF4 C;  3KWQ B;  3AZK B;  1P3B A;  2KI7 B;  4HGZ A;  4MRI A;  4NOZ A;  3CCQ 1;  1YJ9 1;  1W2B Z;  3AZM C;  5B2J A;  5B40 B;  3LZ0 A;  4Z5T A;  3X1S D;  1W2B Y;  3KXB C;  1JJ2 Z;  4BY1 I;  3J80 b;  2F4O A;  3LZ1 B;  4JJN A;  3I56 Z;  3AZN C;  5CPI D;  1P3I B;  1KD1 1;  1VQN Z;  3GTG I;  2W03 A;  1JJ2 Y;  5FLX b;  2JE5 A;  3B0C T;  3CC7 1;  3REJ C;  1S72 1;  1YIT 1;  2G2K A;  4RVG A;  3CCJ Z;  2FJ7 B;  5B24 D;  3CME 1;  3O62 C;  2HF1 A;  1VQL 1;  4J8V C;  4XUJ A;  1YUA A;  3AV1 B;  3WAA C;  3AZF D;  1YJN 1;  4E32 A;  5B32 A;  3IP4 C;  1KC8 2;  3S2D I;  5AV8 A;  2ZY5 A;  1Z03 A;  3MGQ A;  1QF8 A;  1TZY B;  2LY8 A;  3AZL B;  1P3O B;  3TU4 C;  4QTU A;  5A2Q f;  4AYB A;  4X6A I;  1N1J B;  5CP6 B;  3NDI A;  3T4N B;  4NBC A;  3JAM f;  1M19 C;  3A6N C;  3AZH D;  2E2H I;  4J8X C;  3LEL D;  2UWX A;  1P3M A;  4HH4 A;  3G4S 1;  1VQ4 Z;  1KX3 D;  3W96 B;  5GXQ A;  3KWQ A;  4WU8 C;  3AZK A;  5CPK D;  1RO0 A;  4X23 D;  2P28 A;  3P5J B;  2VF1 A;  4J8W D;  5C44 I;  3CMA Z;  3I07 A;  2IZ3 A;  1ID3 D;  4NH1 C;  5B40 A;  3X1V B;  1F66 D;  3PO3 S;  2CWE A;  3FDD A;  1Z02 A;  4KHA B;  4ZBJ B;  4AWL C;  2OTL 1;  3AN2 C;  1P3I A;  2K3R A;  2OOX B;  2J8P A;  5B0Z A;  4A3J I;  2XD5 A;  2R93 I;  1P3P C;  3CCM Z;  2YAD A;  2OOY B;  3VH6 A;  2P3Y A;  1WII A;  3CCS Z;  5AVB C;  3HOY I;  1RNI A;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...