2RIQA

Crystal structure of the third zinc-binding domain of human parp-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
135
Chain Sequence
KKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 1
total genus 41
structure length 135
sequence length 135
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08063 PADR1 PADR1 (NUC008) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.130 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2riqA01
2.20.25.630 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2riqA02
4DQYB 2RIQA
chains in the Genus database with same CATH superfamily
3CPWY 1P34D 4J8VA 1P3PA 5GSUB 3IFUA 1K9M1 1VLAA 2RHBA 3CCEZ 1M19B 3JAMf 3AV2C 2ZM5A 2VUGA 3GTLI 4NB9A 1P3BC 1WCMI 5AV8B 4E44A 2OOYB 5A2Qf 4MRIA 4A3CI 1Q861 2AROD 2ZY3A 5CP6B 2Y2MA 5AVCA 3LJAA 1P3PB 3W98C 4LD9C 4TNUA 3X1UB 4NBEA 5KDMB 4J8VB 3AZIB 3EEDA 5FLMI 3CCV1 5GT0C 3A6NA 3I4NI 3UTBB 3KSYA 1WW9A 3KXBB 2E7ZA 2IZ4A 3MGQC 3CCVZ 1M1AC 4H9RB 2AKLA 3HOZI 3H0GI 4A93I 2V8IA 2AROC 3W98D 5B1MA 3B6FB 3B0DC 1Z02A 3F3FC 1N8R2 5JRGA 1KX5C 3H0RC 3MGRD 5C44I 5JA4B 5B1LB 5BT1C 1P34C 1ZLAA 3X1SD 5GT3C 3AZJD 5CPIC 3AZGB 3W96B 4JJNA 2FJ7D 4YS3D 3CCM1 2E2HI 2B63I 2JA6I 3GTOI 3AV2D 2F8NB 3AZNB 2VQRA 1AOIC 3WTPA 3HOXI 3UTAC 1P3MB 3MVDB 1M901 2BYMB 3W99C 3WTPD 3C1CA 4MD8A 3CCR1 2QR1B 4QLCB 3MGSA 1H3OA 2CWEA 5C3IB 2HUEC 4WZSB 3AZED 5GT0D 2F8NG 5BO0B 5FUGB 2NQBB 3B0BA 3KWQD 1Z2CB 5B33A 2YU9I 3TE5B 4Z5TD 1SFOI 5B24B 1U35C 3CC21 5B40D 5AVBB 4Z2MH 1RO0A 4S1TA 4Y7NI 3AV1B 4A3MI 1YJN1 5CPJA 1Q862 2E2II 4WU8C 3D2LA 4A3LI 1B67A 1VQPZ 3VH5W 2NVYI 5B31D 5F99C 4X23B 1VQ41 3CQZI 4KUDD 1YIJ1 2Y2QA 4KHAB 3RELC 3AZKA 1P3KC 3MNNC 3UT9A 3EPLA 5GXQD 4Y52I 4R8PB 3WAAD 1Y1WI 1M1K2 3AN2B 3AN2A 5CPKA 5GXQA 3W96C 3AZGC 1ID3D 1F66C 3WKJA 3WKJB 4E32A 3TU4C 4Z66C 3B6GC 3T4NB 2JIRA 5B1LC 2OTL1 4ZBJC 4X23A 3AZID 4CAYB 4J8XB 2AYDA 1VQ81 4J8VD 2FJ7A 3W97C 5CPJB 4BBRI 4EO5B 1HQ3D 3AFAA 4E2XA 1ID3C 5B24A 3CCL1 2DE5A 2JS4A 2F8NK 2YFWA 4Z5TA 5B2JB 3REJD 5B24D 2DF4C 5AV6C 5AV9A 1KX4A 3CCSZ 5C4XI 3UTAB 1P3MC 2LEXA 2NQBA 3REID 2W04A 3CCQZ 1Q822 2JUBA 4M6BA 3CCJZ 4ZUXA 3G4SZ 1W2BZ 2XD1A 4QLCA 5B33B 4MD7A 1YIT1 5E5AA 3AZFC 3CCS1 2HF1A 4NBGA 3AZNA 5B32A 3AV2B 2GTIA 5G49A 4YS3B 4YM6A 3AN2D 3WKJD 4NE3A 1P3MD 3R45B 2F8ND 1VQ61 3WTPB 3TU4D 4XUJA 3CCU1 5JA4A 5JRGD 1EQZC 3AZKD 5AV5D 1A7WA 1R4VA 2CV5D 5IP7I 3MGPD 2VPZA 3J80f 3AZHD 1I3QI 2YADA 3KUYA 5B0ZC 2VPWA 4NB8A 2JA8I 2O4HA 2PMZA 5CPID 4BBSI 2PYOC 1RNIA 1P3AB 3EERA 4NFRA 4DK1A 3MZKB 3KXBA 3AV1D 5CP6C 2W8SA 3W98B 1AA6A 5B40B 5AVBD 4KGCC 4A3DI 3UTAD 3OW2Y 3HOYI 4A3EI 3X1UA 1KX3A 5DNNC 3GTQI 3M4OI 1YI21 3FQMA 3H3VJ 2AROA 3AZEA 4RVFA 2Y2NA 3B0CT 4CSRB 5AV8A 4CAYA 4J8XA 2PYOD 4J8UC 3FKII 2IV2X 3AZND 3I56Z 5AVCB 3LJAB 1USPB 4XZQD 3CME1 3CPWZ 1YUAA 3S14I 1P3GA 1M19A 3REKC 1P9NA 3NDIA 3AZLD 3WA9B 1P3GD 1PZRA 3X1TC 3KIHA 4NBCA 3CMEZ 1BH8B 4NE5A 1VQO1 1P3FD 4E2ZA 3CMA1 4EO5C 3X1VC 3AZKB 1VQM1 2RPRA 4NBBA 2CV5C 3MGPB 5GSUA 2RVQC 1N8R1 1QVFY 1F1EA 3C1CC 1P3KD 4H9QB 4XZQC 3VH6W 3D6WA 2NVXI 1NJI1 3WTPE 3AV1A 4E30A 3A1KA 1Q7Y2 5AVBA 1Z03A 4UUZA 1F66B 5AV6B 1P3FC 4KGCD 3LZ0D 1P3BD 2YFVA 5B31B 4X23D 4NBFA 5D1OA 4A3II 3RZDI 5BO0A 3VMIA 2RVQD 3P5JB 2V3VA 5AY8C 3EPJA 4WU8A 3PO3S 5B31C 1Y1VI 3VH6T 1ZB9A 1YHQ1 2LY8A 4WU8B 1VQNZ 3LZ1A 1Q7Y1 1K8A1 1VQ4Z 3AZMC 3REJC 3Q87A 3LZ0C 2IO5B 5B32D 1Q811 3REIC 1VQKZ 1S32D 1W2BY 3S2HI 4JJNB 3AZHB 1F66A 2G5IC 2BG1A 5E5AD 5CPJD 5B2IA 3AZMB 2CV5B 4RV9A 1ZLAB 1KC82 1K8A2 4HH4A 2F4MA 1YJW1 1P3AD 2K5RA 1S72Z 2E9HA 3X1SC 3FDDA 1KQSZ 3W97D 1M18C 2JNYA 2FJ7C 1P3LA 2UWXA 5B31G 1QF8A 1FDOA 2ZAEB 1YJWZ 3LELD 3X1TB 1KD11 4H9QA 5B24C 4Z2MG 3EG5B 1U35B 3HKZA 3MGRB 3PO2I 5AV9C 5CHLB 1N2FA 4J8WA 3MGPC 5AVCC 3LJAC 3AZJB 5KDMA 3AZIA 5C3IC 4WU9C 2NZDA 3MNND 1QYPA 4WNNA 4XZQB 2JA5I 4BY1I 3TDHB 1Q812 3WA9A 4CSRA 1K731 1QVGZ 1P3GB 2AROB 5CP6D 5AV8D 3BG1B 3LELC 1USPA 4H9NA 1AOIB 2RT9A 5B32C 3AYWA 3CC41 3X1UD 3W99B 1Q16A 3NQUB 1VQ9Z 1RQFA 3C1BB 3REKB 1KX3D 3VMGA 5CPIB 3NH8A 3MZLB 5GT0B 5JRGC 3W98A 4LD9A 1VQL1 4BXXI 1P3AA 3CCUZ 1HQ3C 5B0YA 4J8UD 2M48A 2R6MA 4NBAA 1QXFA 3VMHA 5B40A 2F8NH 4A3GI 5AV6D 4KGCB 5DNNB 4H9PB 1P34B 1P3BB 2KPIA 4AYBA 4A3FI 3V9RA 1F66D 4G91B 3X1TD 3LELB 1M1AB 1WJ2A 3S1MI 5B1LD 1BH9A 2NVQI 3EPKA 1TWGI 3MGRC 3NQJA 4CL1A 2QREB 3C1CD 4R8PD 4XUJB 4WU9D 3AZJC 1EQZB 1RLYA 1Y8CA 1Q821 1N1JA 4WV4B 1P3PC 3AZLB 5GT3A 3O62D 4YM6D 3WA9D 1K83I 1TWHI 3QWUA 4HGZA 3J80b 4YS3A 3PO3I 5B32B 3AV2A 5FLXb 1AOID 2JA7I 2I3CA 4ZUXB 2NQBD 1P3BA 1R9TI 3UTBD 1ZLAD 3W99D 3WTPC 3KWQB 4G92B 4HGAB 5E5AB 3CD6Z 3AZHC 4Z5TB 3AFAD 2OTLZ 4H9SC 1X3ZA 5GT0A 1KX4D 5AV9B 3REHA 3REJB 2QKDA 3NH4A 5D1PA 3C1BA 2YFWB 1VQMZ 1I6HI 1WZNA 3REIB 1U35D 4ZBJB 5B33C 3AN2C 3WKJC 3AYWB 3MGQA 4WJ3C 3F3PC 2Y2IA 3G711 1P3IA 4Z66B 3B6GB 3I551 1M902 2FJ7B 1S7MA 5CPJC 4NFTA 5B2JC 3CCRZ 5AV5A 3VH5A 5GXQB 1ID3B 2NAPA 2BYKB 4WNNB 3MNNB 1FDIA 1TZYC 4R8PA 2VF1A 2WB1A 3MONA 2VUMI 1TAFA 1TAFB 1JJ2Z 3UT9D 3GTMS 1RO4A 3HOUI 3WAAA 1KU5A 4DRBA 3TU4B 1ID3A 2V8JA 5CPKD 2M6NA 4NH1C 3AZMD 2PM9A 2DE6A 4Z66A 3B6GA 2NQBC 4KUDA 1VQN1 3LZ0A 1S32C 3G4S1 1PFTA 5E5AC 2JIPA 3NDJA 1VQK1 4UPKA 2NVTI 3M3YI 5F99B 3I561 1VQLZ 1H3OB 5B33D 3AYWD 3GCFA 3AZLC 2DE7A 1P3MA 4XUJC 1WIIA 3LZ1B 2JMOA 2IZ3A 3MGSD 4NBDA 3VB9A 2FFFB 4QLCC 2HIOA 2BYMA 3C1CB 1BFMA 1HTAA 5BT1D 3KWQC 2HIOD 2HUEB 3KUYC 4G92C 3RELA 4J8WC 3IX0A 1RO2A 4E45A 4WU9A 1M1AA 4RVGA 4ZUXD 5D1OB 3B0DB 1VQ51 3W96A 3AZGA 4H9PA 5B32G 5B1MB 3I07A 5BS7A 5B1LA 3LELA 4MONA 2QLVB 2VPXA 4H9RA 4J8UB 2K3RA 5FLXf 2JSSA 5DNNA 4LD9B 3CXCZ 5B0ZD 3S2DI 5AY8D 5CPIA 3W97A 1P3OB 3B6FC 3A6NB 5B0ZA 3O62C 2P3YA 3GTGI 3LUSA 1KX5B 1BH8A 4Z66D 3B6GD 4X6AI 1M19C 3KXBC 3CC7Z 5B40C 1K9M2 3UTBC 1W2EA 3VH6A 2HU9A 5AVCD 3LJAD 2PYOB 1TWFI 2JIMA 4J8VC 4H9NB 2R92I 2WAQA 5T6BA 5C4JI 4QTUA 1T3UA 5AV8C 3H0LC 2LFUA 1U35A 4A3JI 1TWCI 4HGYA 3VH5T 3MGQD 4YM6C 5DNMC 2JE5A 5B1MC 1P3GC 1ML8A 1P3LB 3CCQ1 3NFZA 2QA41 2OTJZ 1KX5A 1VQ71 4G91C 1ZLAC 1NUIA 4RS4A 3I4MI 2J8PA 3J7A4 1P3OA 3W97B 1P3KA 3S1NI 3KUYB 3A6NC 2R93I 5GSUC 1P3OD 1JWHC 3B6FD 2F4OA 4A3KI 5LL6f 2QRCB 1S721 3LZ1C 4RVDA 3HOWI 3RELB 3D9XA 2Y2GA 3REHC 1M18B 4X23C 2PK7A 2G2KA 1YITZ 5G49B 2G5HC 2QRDB 3GTPI 3S16I 1KX3C 3G71Z 2Q51A 2HIOB 3MVDD 2ZY5A 4JJNC 3AZEC 2VPYA 3S17I 4J8XC 2YFVB 5B31A 4E2YA 2IO5C 5BNXB 1S32B 5AV6A 3IF8A 1TWAI 5DNMD 3UTAA 1ULYA 4DRAA 4LD9D 1YUKA 1Z01A 5F99A 3MGSC 4AWLB 5AY8B 3KIFA 4NBHA 4E31A 3VTNA 3X1VA 3MVDC 5F99D 3H0MC 5B2IC 3MGPA 1WWSA 3CCMZ 3KUYD 3AZNC 3A6ND 2J6AA 5GXQC 3X1SB 2V45A 3CC2Z 5IP9I 4KUDB 3TU4A 1M1AD 2EGTA 4NOZA 3AZGD 3W96D 3AV1C 1Q9CA 3FQQA 5CM2M 1P3FA 3AYWC 1KQSY 3WAAB 1VQOZ 2Y2OA 1DL6A 1B6WA 1VQ91 2RBLA 3CD61 2NZDD 5BNVA 5GT3D 1JFIA 2BYKA 3A1IA 3MNNA 3AFAC 4QLCD 3UT9C 1P3IB 2PYOA 4JJND 2L5AA 3MGQB 1YJ9Z 3S15I 1KX4C 5CPKC 4A3BI 2HIOC 1WWIA 3C1BD 3AZEB 3EPHA 3J81f 2JIQA 5A2Qb 4DGLA 4BY7I 3REHB 1HQ3B 3REJA 5DNMB 3REKD 4ZUXC 1KX3B 2O53A 1NJI2 3X1UC 3REIA 1TFIA 1VQ8Z 5B0ZB 1YIJZ 3S1RI 2R7ZI 3HOVI 5B2JD 5FUGA 3X1VD 2BJOA 5IT9b 3F6TA 5BS7C 5B2ID 4J8UA 1KX5D 5B0YD 1TZYD 4DQYB 1NP6A 3AL0C 1KD12 4Z5TC 2XD5A 2DQNC 1P3LC 4HGAC 4YS3C 2Y2LA 1N1JB 3O62A 4XUJD 4WU9B 1EQZA 4MD9A 2F2AC 5T64A 1ZB8A 1VQP1 1I50I 3O62B 1EQZD 1X3WA 2Q4ZA 3AZFB 3AZFA 3R45A 2OTJ1 3IP4C 1SIWA 4YM6B 1K732 3CCE1 3NQJB 1P3PD 1VQ6Z 5JRGB 3GTKI 1BH9B 4KGCA 2GTHA 3C1BC 3REHD 2E2JI 1P34A 3AFAB 5AV9D 5AN9F 5DNMA 2JIOA 3I55Z 5DNND 2RIQA 5B2JA 1KX4B 3NQUA 3IR7A 3JAMb 2QA4Z 3LZ0B 1P3AC 1HQ3A 5B0YC 1AOIA 3RELD 1L1OC 3REKA 5CP6A 3CCLZ 5GSUD 2ZY2A 1P3OC 1M19D 1M18D 1JFIB 3W99A 3WAAC 1KRLA 3OW2Z 1KC81 2H85A 5T67A 4E2WA 3CCJ1 3CC4Z 5BNVB 2NZDB 3GTJI 3S1QI 3UT9B 1P3IC 4KHAA 3AZFD 1ZH1A 2GU2A 5CPKB 4AWLC 3U50C 4XZQA 3MGRA 1P3FB 3KFUG 3X1SA 5AV5B 2QEX1 1YJNZ 4J8WB 3AZJA 3RZOI 4QTTA 2OZKA 5B1MD 3GTMI 2Y2KA 2QEXZ 3X1TA 3KXBD 1YI2Z 1QVFZ 2ZY4A 2JR6A 3AZKC 3X1VB 3J81b 3K7AI 4H9OA 5AY8A 5B2IB 2CV5A 4KUDC 2NZDC 1X0TA 1TZYB 3AZHA 1JJ2Y 1S32A 4RVHA 2Y2JA 4E33A 3G6E1 3WA9C 4H9SA 2KI7B 3ESWA 2LIYA 3KWQA 3AZMA 4MH4A 3LZ1D 3MVDA 5C3EI 5BNXA 5AVBC 5IT9f 3MGSB 1YJ91 1LQLA 3G6EZ 3CMAZ 2F8NA 1M1K1 2V8KA 3CXCY 4NE6A 5GT3B 3AZLA 4WU8D 1Y1VS 1P3ID 1VQ5Z 1VQ7Z 5AV5C 1YHQZ 1M18A 4J8XD 1TZYA 4R8PC 4UUZB 2W03A 4J8WD 3B6FA 2Y0SA 3GKQA 4H9OB 1P3KB 2Y2HA 3B0CW 1P3LD 3NH5A 4MXUA 3V9RB 2P28A 4EWCA 1QVGY 2Y2PA 2OOXB 3BG0B 3UTBA 3CC71 3AZIC 4XX2A 5B0YB 2JCHA
chains in the Genus database with same CATH topology
3CPWY 1P34D 4J8VA 1P3PA 5GSUB 3IFUA 1K9M1 1VLAA 2RHBA 3CCEZ 1M19B 3JAMf 3AV2C 2ZM5A 2VUGA 3GTLI 4NB9A 1P3BC 1WCMI 5AV8B 4E44A 2OOYB 5A2Qf 4MRIA 4A3CI 1Q861 2AROD 2ZY3A 5CP6B 2Y2MA 5AVCA 3LJAA 1P3PB 3W98C 4LD9C 4TNUA 3X1UB 4NBEA 5KDMB 4J8VB 3AZIB 3EEDA 5FLMI 3CCV1 5GT0C 3A6NA 3I4NI 3UTBB 3KSYA 1WW9A 3KXBB 2IZ4A 3CCVZ 3MGQC 1M1AC 4H9RB 2AKLA 3HOZI 3H0GI 4A93I 2V8IA 2AROC 3W98D 5B1MA 3B6FB 3B0DC 1Z02A 3F3FC 1N8R2 5JRGA 1KX5C 3H0RC 3MGRD 5C44I 5JA4B 5B1LB 5BT1C 1P34C 1ZLAA 3X1SD 5GT3C 3AZJD 5CPIC 3AZGB 3W96B 4JJNA 2FJ7D 4YS3D 3CCM1 2E2HI 2B63I 2JA6I 3GTOI 3AV2D 2F8NB 3AZNB 2VQRA 1AOIC 3WTPA 3HOXI 3UTAC 1P3MB 3MVDB 1M901 2BYMB 3W99C 3WTPD 3C1CA 4MD8A 3CCR1 2QR1B 4QLCB 3MGSA 1H3OA 2CWEA 5C3IB 2HUEC 4WZSB 3AZED 5GT0D 2F8NG 5BO0B 5FUGB 2NQBB 3B0BA 3KWQD 1Z2CB 5B33A 2YU9I 3TE5B 4Z5TD 1SFOI 5B24B 1U35C 3CC21 5B40D 5AVBB 4Z2MH 1RO0A 4S1TA 4Y7NI 3AV1B 4A3MI 1YJN1 5CPJA 1Q862 2E2II 4WU8C 4A3LI 1B67A 1VQPZ 3VH5W 2NVYI 5B31D 5F99C 4X23B 1VQ41 3CQZI 4KUDD 1YIJ1 2Y2QA 4KHAB 3RELC 3AZKA 1P3KC 3MNNC 3UT9A 3EPLA 5GXQD 4Y52I 4R8PB 3WAAD 1Y1WI 1M1K2 3AN2B 3AN2A 5CPKA 5GXQA 3W96C 3AZGC 1ID3D 1F66C 3WKJA 3WKJB 4E32A 3TU4C 4Z66C 3B6GC 3T4NB 5B1LC 2OTL1 4ZBJC 4X23A 3AZID 4CAYB 4J8XB 1VQ81 4J8VD 2FJ7A 3W97C 5CPJB 4BBRI 4EO5B 1HQ3D 3AFAA 4E2XA 1ID3C 5B24A 3CCL1 2DE5A 2JS4A 2F8NK 2YFWA 4Z5TA 5B2JB 3REJD 5B24D 2DF4C 5AV6C 5AV9A 1KX4A 3CCSZ 5C4XI 3UTAB 1P3MC 2NQBA 3REID 2W04A 3CCQZ 1Q822 2JUBA 4M6BA 3CCJZ 4ZUXA 3G4SZ 1W2BZ 2XD1A 4QLCA 5B33B 4MD7A 1YIT1 5E5AA 3AZFC 3CCS1 2HF1A 4NBGA 3AZNA 5B32A 3AV2B 2GTIA 5G49A 4YS3B 4YM6A 3AN2D 3WKJD 4NE3A 1P3MD 3R45B 2F8ND 1VQ61 3WTPB 3TU4D 4XUJA 3CCU1 5JA4A 5JRGD 1EQZC 3AZKD 5AV5D 1A7WA 1R4VA 2CV5D 5IP7I 3MGPD 3J80f 3AZHD 1I3QI 2YADA 3KUYA 5B0ZC 4NB8A 2JA8I 2O4HA 2PMZA 5CPID 4BBSI 2PYOC 1RNIA 1P3AB 3EERA 4NFRA 4DK1A 3MZKB 3KXBA 3AV1D 5CP6C 2W8SA 3W98B 5B40B 5AVBD 4KGCC 4A3DI 3UTAD 3OW2Y 3HOYI 4A3EI 3X1UA 1KX3A 5DNNC 3GTQI 3M4OI 1YI21 3FQMA 3H3VJ 2AROA 3AZEA 4RVFA 2Y2NA 3B0CT 4CSRB 5AV8A 4CAYA 4J8XA 2PYOD 4J8UC 3FKII 3CME1 3AZND 3I56Z 5AVCB 3LJAB 1USPB 4XZQD 3CPWZ 3S14I 1YUAA 1P3GA 1M19A 3REKC 1P9NA 3NDIA 3AZLD 3WA9B 1P3GD 1PZRA 3X1TC 3KIHA 4NBCA 3CMEZ 1BH8B 4NE5A 1VQO1 1P3FD 4E2ZA 3CMA1 4EO5C 3X1VC 3AZKB 1VQM1 2RPRA 4NBBA 2CV5C 3MGPB 5GSUA 2RVQC 1N8R1 1QVFY 1F1EA 3C1CC 1P3KD 4H9QB 4XZQC 3VH6W 3D6WA 2NVXI 1NJI1 3WTPE 3AV1A 4E30A 3A1KA 1Q7Y2 5AVBA 1Z03A 4UUZA 1F66B 5AV6B 1P3FC 4KGCD 3LZ0D 1P3BD 2YFVA 5B31B 4X23D 4NBFA 5D1OA 4A3II 3RZDI 5BO0A 3VMIA 2RVQD 3P5JB 5AY8C 3EPJA 4WU8A 3PO3S 5B31C 1Y1VI 3VH6T 1ZB9A 1YHQ1 2LY8A 4WU8B 1VQNZ 3LZ1A 1Q7Y1 1K8A1 1VQ4Z 3AZMC 3REJC 3Q87A 3LZ0C 2IO5B 5B32D 1Q811 3REIC 1VQKZ 1S32D 1W2BY 3S2HI 4JJNB 3AZHB 1F66A 2G5IC 2BG1A 5E5AD 5CPJD 5B2IA 3AZMB 2CV5B 4RV9A 1ZLAB 1KC82 1K8A2 4HH4A 2F4MA 1YJW1 1P3AD 2K5RA 1S72Z 2E9HA 3X1SC 3FDDA 1KQSZ 3W97D 1M18C 2JNYA 2FJ7C 1P3LA 2UWXA 5B31G 1QF8A 2ZAEB 1YJWZ 3LELD 3X1TB 1KD11 4H9QA 5B24C 4Z2MG 3EG5B 1U35B 3HKZA 3MGRB 3PO2I 5AV9C 5CHLB 1N2FA 4J8WA 3MGPC 5AVCC 3LJAC 3AZJB 5KDMA 3AZIA 5C3IC 4WU9C 2NZDA 3MNND 1QYPA 4WNNA 4XZQB 2JA5I 4BY1I 3TDHB 1Q812 3WA9A 4CSRA 1K731 1QVGZ 1P3GB 2AROB 5CP6D 5AV8D 3BG1B 3LELC 1USPA 4H9NA 1AOIB 2RT9A 5B32C 3AYWA 3CC41 3X1UD 3W99B 1VQ9Z 3NQUB 1RQFA 3C1BB 3REKB 1KX3D 3VMGA 5CPIB 3NH8A 3MZLB 5GT0B 5JRGC 3W98A 4LD9A 1VQL1 4BXXI 1P3AA 3CCUZ 1HQ3C 5B0YA 4J8UD 2M48A 2R6MA 4NBAA 3VMHA 5B40A 2F8NH 4A3GI 5AV6D 4KGCB 5DNNB 4H9PB 1P34B 1P3BB 2KPIA 4AYBA 4A3FI 3V9RA 1F66D 4G91B 3X1TD 3LELB 1M1AB 3S1MI 5B1LD 1BH9A 2NVQI 3EPKA 1TWGI 3MGRC 3NQJA 4CL1A 2QREB 3C1CD 4R8PD 4XUJB 4WU9D 3AZJC 1EQZB 1RLYA 1Q821 1VQ5Z 1N1JA 4WV4B 1P3PC 3AZLB 5GT3A 3O62D 4YM6D 3WA9D 1K83I 1TWHI 3QWUA 4HGZA 3J80b 4YS3A 3PO3I 5B32B 3AV2A 5FLXb 1AOID 2JA7I 2I3CA 4ZUXB 2NQBD 1P3BA 1R9TI 3UTBD 1ZLAD 3W99D 3WTPC 3KWQB 4G92B 4HGAB 5E5AB 3CD6Z 3AZHC 4Z5TB 3AFAD 2OTLZ 4H9SC 1X3ZA 5GT0A 1KX4D 5AV9B 3REHA 3REJB 2QKDA 3NH4A 5D1PA 3C1BA 2YFWB 1VQMZ 1I6HI 3REIB 1U35D 4ZBJB 5B33C 3AN2C 3WKJC 3AYWB 3MGQA 4WJ3C 3F3PC 2Y2IA 3G711 1P3IA 4Z66B 3B6GB 3I551 1M902 2FJ7B 1S7MA 5CPJC 4NFTA 5B2JC 3CCRZ 5AV5A 3VH5A 5GXQB 1ID3B 2BYKB 4WNNB 3MNNB 2VF1A 1TZYC 4R8PA 2WB1A 3MONA 2VUMI 1TAFA 1TAFB 1JJ2Z 3UT9D 3GTMS 1RO4A 3HOUI 3WAAA 1KU5A 4DRBA 3TU4B 1ID3A 2V8JA 5CPKD 2M6NA 4NH1C 3AZMD 2PM9A 2DE6A 4Z66A 3B6GA 2NQBC 4KUDA 1VQN1 3LZ0A 1S32C 3G4S1 1PFTA 5E5AC 1VQK1 3NDJA 4UPKA 2NVTI 3M3YI 5F99B 3I561 1VQLZ 1H3OB 5B33D 3AYWD 3GCFA 3AZLC 2DE7A 1P3MA 4XUJC 1WIIA 3LZ1B 2JMOA 2IZ3A 3MGSD 4NBDA 3VB9A 2FFFB 4QLCC 2HIOA 2BYMA 3C1CB 1BFMA 1HTAA 5BT1D 3KWQC 2HIOD 2HUEB 3KUYC 4G92C 3RELA 4J8WC 3IX0A 1RO2A 4E45A 4WU9A 1M1AA 4RVGA 4ZUXD 5D1OB 3B0DB 1VQ51 3W96A 3AZGA 4H9PA 5B32G 5B1MB 3I07A 5BS7A 5B1LA 3LELA 4MONA 2QLVB 4H9RA 4J8UB 2K3RA 5FLXf 2JSSA 5DNNA 4LD9B 3CXCZ 5B0ZD 3S2DI 5AY8D 5CPIA 3W97A 1P3OB 3B6FC 3A6NB 5B0ZA 3O62C 2P3YA 3GTGI 3LUSA 1KX5B 1BH8A 4Z66D 3B6GD 4X6AI 1M19C 3KXBC 3CC7Z 5B40C 1K9M2 3UTBC 1W2EA 3VH6A 2HU9A 5AVCD 3LJAD 2PYOB 1TWFI 2R92I 4J8VC 4H9NB 2WAQA 5T6BA 5C4JI 4QTUA 1T3UA 5AV8C 3H0LC 2LFUA 1U35A 4A3JI 1TWCI 4HGYA 3VH5T 3MGQD 4YM6C 5DNMC 2JE5A 5B1MC 1P3GC 1ML8A 1P3LB 3CCQ1 3NFZA 2QA41 2OTJZ 1KX5A 1VQ71 4G91C 1ZLAC 1NUIA 4RS4A 3I4MI 2J8PA 3J7A4 1P3OA 3W97B 1P3KA 3S1NI 3KUYB 3A6NC 2R93I 5GSUC 1P3OD 1JWHC 3B6FD 2F4OA 4A3KI 5LL6f 2QRCB 1S721 3LZ1C 4RVDA 3HOWI 3RELB 3D9XA 2Y2GA 3REHC 1M18B 4X23C 2PK7A 2G2KA 1YITZ 5G49B 2G5HC 2QRDB 3GTPI 3S16I 1KX3C 3G71Z 2Q51A 2HIOB 3MVDD 2ZY5A 4JJNC 3AZEC 3S17I 4J8XC 2YFVB 5B31A 4E2YA 2IO5C 5BNXB 1S32B 5AV6A 3IF8A 1TWAI 5DNMD 3UTAA 1ULYA 4DRAA 4LD9D 1YUKA 1Z01A 5F99A 3MGSC 4AWLB 5AY8B 3KIFA 4NBHA 4E31A 3VTNA 3X1VA 3MVDC 5F99D 3H0MC 5B2IC 3MGPA 1WWSA 3CCMZ 3KUYD 3AZNC 3A6ND 2J6AA 5GXQC 3X1SB 3CC2Z 5IP9I 4KUDB 3TU4A 1M1AD 2EGTA 4NOZA 3AZGD 3W96D 3AV1C 1Q9CA 3FQQA 5CM2M 1P3FA 3AYWC 1KQSY 3WAAB 1VQOZ 2Y2OA 1DL6A 1B6WA 1VQ91 2RBLA 3CD61 2NZDD 5BNVA 5GT3D 1JFIA 2BYKA 3A1IA 3MNNA 3AFAC 4QLCD 3UT9C 1P3IB 2PYOA 4JJND 2L5AA 3MGQB 1YJ9Z 3S15I 1KX4C 5CPKC 4A3BI 2HIOC 1WWIA 3C1BD 3AZEB 3EPHA 3J81f 5A2Qb 4DGLA 4BY7I 3REHB 1HQ3B 3REJA 5DNMB 3REKD 4ZUXC 1KX3B 2O53A 1NJI2 3X1UC 3REIA 1TFIA 1VQ8Z 5B0ZB 1YIJZ 3S1RI 2R7ZI 3HOVI 5B2JD 5FUGA 3X1VD 2BJOA 5IT9b 3F6TA 5BS7C 5B2ID 4J8UA 1KX5D 5B0YD 1TZYD 4DQYB 1NP6A 3AL0C 1KD12 4Z5TC 2XD5A 2DQNC 1P3LC 4HGAC 4YS3C 2Y2LA 1N1JB 3O62A 4XUJD 4WU9B 1EQZA 4MD9A 2F2AC 5T64A 1ZB8A 1VQP1 1I50I 3O62B 1EQZD 1X3WA 2Q4ZA 3AZFB 3AZFA 3R45A 2OTJ1 3IP4C 1K732 4YM6B 3CCE1 3NQJB 1P3PD 1VQ6Z 5JRGB 3GTKI 1BH9B 4KGCA 2GTHA 3C1BC 3REHD 2E2JI 1P34A 3AFAB 5AV9D 5AN9F 5DNMA 3I55Z 5DNND 2RIQA 5B2JA 1KX4B 3NQUA 3JAMb 2QA4Z 3LZ0B 1P3AC 1HQ3A 5B0YC 1AOIA 3RELD 1L1OC 3REKA 5CP6A 3CCLZ 5GSUD 2ZY2A 1P3OC 1M19D 1M18D 1JFIB 3W99A 3WAAC 1KRLA 3OW2Z 1KC81 2H85A 5T67A 4E2WA 3CCJ1 3CC4Z 5BNVB 2NZDB 3GTJI 3S1QI 3UT9B 1P3IC 4KHAA 3AZFD 1ZH1A 2GU2A 5CPKB 4AWLC 3U50C 4XZQA 3MGRA 1P3FB 3KFUG 3X1SA 5AV5B 2QEX1 1YJNZ 4J8WB 3AZJA 3RZOI 4QTTA 2OZKA 5B1MD 3GTMI 2Y2KA 2QEXZ 3X1TA 3KXBD 1YI2Z 1QVFZ 2ZY4A 2JR6A 3AZKC 3X1VB 3J81b 3K7AI 4H9OA 5AY8A 5B2IB 2CV5A 4KUDC 2NZDC 1X0TA 1TZYB 3AZHA 1JJ2Y 1S32A 4RVHA 2Y2JA 4E33A 3G6E1 3WA9C 4H9SA 2KI7B 3ESWA 2LIYA 3KWQA 3AZMA 4MH4A 3LZ1D 3MVDA 5C3EI 5BNXA 5AVBC 5IT9f 3MGSB 1YJ91 1LQLA 3G6EZ 3CMAZ 2F8NA 1M1K1 2V8KA 3CXCY 4NE6A 5GT3B 3AZLA 4WU8D 1Y1VS 1P3ID 1VQ7Z 5AV5C 1YHQZ 1M18A 4J8XD 1TZYA 4R8PC 4UUZB 2W03A 4J8WD 3B6FA 2Y0SA 3GKQA 4H9OB 1P3KB 2Y2HA 3B0CW 1P3LD 3NH5A 4MXUA 3V9RB 2P28A 4EWCA 1QVGY 2Y2PA 2OOXB 3BG0B 3UTBA 3CC71 3AZIC 4XX2A 5B0YB 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQY B;  2RIQ A; 
#chains in the Genus database with same CATH topology
 3CPW Y;  1P34 D;  4J8V A;  1P3P A;  5GSU B;  3IFU A;  1K9M 1;  1VLA A;  2RHB A;  3CCE Z;  1M19 B;  3JAM f;  3AV2 C;  2ZM5 A;  2VUG A;  3GTL I;  4NB9 A;  1P3B C;  1WCM I;  5AV8 B;  4E44 A;  2OOY B;  5A2Q f;  4MRI A;  4A3C I;  1Q86 1;  2ARO D;  2ZY3 A;  5CP6 B;  2Y2M A;  5AVC A;  3LJA A;  1P3P B;  3W98 C;  4LD9 C;  4TNU A;  3X1U B;  4NBE A;  5KDM B;  4J8V B;  3AZI B;  3EED A;  5FLM I;  3CCV 1;  5GT0 C;  3A6N A;  3I4N I;  3UTB B;  3KSY A;  1WW9 A;  3KXB B;  2E7Z A;  2IZ4 A;  3MGQ C;  3CCV Z;  1M1A C;  4H9R B;  2AKL A;  3HOZ I;  3H0G I;  4A93 I;  2V8I A;  2ARO C;  3W98 D;  5B1M A;  3B6F B;  3B0D C;  1Z02 A;  3F3F C;  1N8R 2;  5JRG A;  1KX5 C;  3H0R C;  3MGR D;  5C44 I;  5JA4 B;  5B1L B;  5BT1 C;  1P34 C;  1ZLA A;  3X1S D;  5GT3 C;  3AZJ D;  5CPI C;  3AZG B;  3W96 B;  4JJN A;  2FJ7 D;  4YS3 D;  3CCM 1;  2E2H I;  2B63 I;  2JA6 I;  3GTO I;  3AV2 D;  2F8N B;  3AZN B;  2VQR A;  1AOI C;  3WTP A;  3HOX I;  3UTA C;  1P3M B;  3MVD B;  1M90 1;  2BYM B;  3W99 C;  3WTP D;  3C1C A;  4MD8 A;  3CCR 1;  2QR1 B;  4QLC B;  3MGS A;  1H3O A;  2CWE A;  5C3I B;  2HUE C;  4WZS B;  3AZE D;  5GT0 D;  2F8N G;  5BO0 B;  5FUG B;  2NQB B;  3B0B A;  3KWQ D;  1Z2C B;  5B33 A;  2YU9 I;  3TE5 B;  4Z5T D;  1SFO I;  5B24 B;  1U35 C;  3CC2 1;  5B40 D;  5AVB B;  4Z2M H;  1RO0 A;  4S1T A;  4Y7N I;  3AV1 B;  4A3M I;  1YJN 1;  5CPJ A;  1Q86 2;  2E2I I;  4WU8 C;  3D2L A;  4A3L I;  1B67 A;  1VQP Z;  3VH5 W;  2NVY I;  5B31 D;  5F99 C;  4X23 B;  1VQ4 1;  3CQZ I;  4KUD D;  1YIJ 1;  2Y2Q A;  4KHA B;  3REL C;  3AZK A;  1P3K C;  3MNN C;  3UT9 A;  3EPL A;  5GXQ D;  4Y52 I;  4R8P B;  3WAA D;  1Y1W I;  1M1K 2;  3AN2 B;  3AN2 A;  5CPK A;  5GXQ A;  3W96 C;  3AZG C;  1ID3 D;  1F66 C;  3WKJ A;  3WKJ B;  4E32 A;  3TU4 C;  4Z66 C;  3B6G C;  3T4N B;  2JIR A;  5B1L C;  2OTL 1;  4ZBJ C;  4X23 A;  3AZI D;  4CAY B;  4J8X B;  2AYD A;  1VQ8 1;  4J8V D;  2FJ7 A;  3W97 C;  5CPJ B;  4BBR I;  4EO5 B;  1HQ3 D;  3AFA A;  4E2X A;  1ID3 C;  5B24 A;  3CCL 1;  2DE5 A;  2JS4 A;  2F8N K;  2YFW A;  4Z5T A;  5B2J B;  3REJ D;  5B24 D;  2DF4 C;  5AV6 C;  5AV9 A;  1KX4 A;  3CCS Z;  5C4X I;  3UTA B;  1P3M C;  2LEX A;  2NQB A;  3REI D;  2W04 A;  3CCQ Z;  1Q82 2;  2JUB A;  4M6B A;  3CCJ Z;  4ZUX A;  3G4S Z;  1W2B Z;  2XD1 A;  4QLC A;  5B33 B;  4MD7 A;  1YIT 1;  5E5A A;  3AZF C;  3CCS 1;  2HF1 A;  4NBG A;  3AZN A;  5B32 A;  3AV2 B;  2GTI A;  5G49 A;  4YS3 B;  4YM6 A;  3AN2 D;  3WKJ D;  4NE3 A;  1P3M D;  3R45 B;  2F8N D;  1VQ6 1;  3WTP B;  3TU4 D;  4XUJ A;  3CCU 1;  5JA4 A;  5JRG D;  1EQZ C;  3AZK D;  5AV5 D;  1A7W A;  1R4V A;  2CV5 D;  5IP7 I;  3MGP D;  2VPZ A;  3J80 f;  3AZH D;  1I3Q I;  2YAD A;  3KUY A;  5B0Z C;  2VPW A;  4NB8 A;  2JA8 I;  2O4H A;  2PMZ A;  5CPI D;  4BBS I;  2PYO C;  1RNI A;  1P3A B;  3EER A;  4NFR A;  4DK1 A;  3MZK B;  3KXB A;  3AV1 D;  5CP6 C;  2W8S A;  3W98 B;  1AA6 A;  5B40 B;  5AVB D;  4KGC C;  4A3D I;  3UTA D;  3OW2 Y;  3HOY I;  4A3E I;  3X1U A;  1KX3 A;  5DNN C;  3GTQ I;  3M4O I;  1YI2 1;  3FQM A;  3H3V J;  2ARO A;  3AZE A;  4RVF A;  2Y2N A;  3B0C T;  4CSR B;  5AV8 A;  4CAY A;  4J8X A;  2PYO D;  4J8U C;  3FKI I;  2IV2 X;  3AZN D;  3I56 Z;  5AVC B;  3LJA B;  1USP B;  4XZQ D;  3CME 1;  3CPW Z;  1YUA A;  3S14 I;  1P3G A;  1M19 A;  3REK C;  1P9N A;  3NDI A;  3AZL D;  3WA9 B;  1P3G D;  1PZR A;  3X1T C;  3KIH A;  4NBC A;  3CME Z;  1BH8 B;  4NE5 A;  1VQO 1;  1P3F D;  4E2Z A;  3CMA 1;  4EO5 C;  3X1V C;  3AZK B;  1VQM 1;  2RPR A;  4NBB A;  2CV5 C;  3MGP B;  5GSU A;  2RVQ C;  1N8R 1;  1QVF Y;  1F1E A;  3C1C C;  1P3K D;  4H9Q B;  4XZQ C;  3VH6 W;  3D6W A;  2NVX I;  1NJI 1;  3WTP E;  3AV1 A;  4E30 A;  3A1K A;  1Q7Y 2;  5AVB A;  1Z03 A;  4UUZ A;  1F66 B;  5AV6 B;  1P3F C;  4KGC D;  3LZ0 D;  1P3B D;  2YFV A;  5B31 B;  4X23 D;  4NBF A;  5D1O A;  4A3I I;  3RZD I;  5BO0 A;  3VMI A;  2RVQ D;  3P5J B;  2V3V A;  5AY8 C;  3EPJ A;  4WU8 A;  3PO3 S;  5B31 C;  1Y1V I;  3VH6 T;  1ZB9 A;  1YHQ 1;  2LY8 A;  4WU8 B;  1VQN Z;  3LZ1 A;  1Q7Y 1;  1K8A 1;  1VQ4 Z;  3AZM C;  3REJ C;  3Q87 A;  3LZ0 C;  2IO5 B;  5B32 D;  1Q81 1;  3REI C;  1VQK Z;  1S32 D;  1W2B Y;  3S2H I;  4JJN B;  3AZH B;  1F66 A;  2G5I C;  2BG1 A;  5E5A D;  5CPJ D;  5B2I A;  3AZM B;  2CV5 B;  4RV9 A;  1ZLA B;  1KC8 2;  1K8A 2;  4HH4 A;  2F4M A;  1YJW 1;  1P3A D;  2K5R A;  1S72 Z;  2E9H A;  3X1S C;  3FDD A;  1KQS Z;  3W97 D;  1M18 C;  2JNY A;  2FJ7 C;  1P3L A;  2UWX A;  5B31 G;  1QF8 A;  1FDO A;  2ZAE B;  1YJW Z;  3LEL D;  3X1T B;  1KD1 1;  4H9Q A;  5B24 C;  4Z2M G;  3EG5 B;  1U35 B;  3HKZ A;  3MGR B;  3PO2 I;  5AV9 C;  5CHL B;  1N2F A;  4J8W A;  3MGP C;  5AVC C;  3LJA C;  3AZJ B;  5KDM A;  3AZI A;  5C3I C;  4WU9 C;  2NZD A;  3MNN D;  1QYP A;  4WNN A;  4XZQ B;  2JA5 I;  4BY1 I;  3TDH B;  1Q81 2;  3WA9 A;  4CSR A;  1K73 1;  1QVG Z;  1P3G B;  2ARO B;  5CP6 D;  5AV8 D;  3BG1 B;  3LEL C;  1USP A;  4H9N A;  1AOI B;  2RT9 A;  5B32 C;  3AYW A;  3CC4 1;  3X1U D;  3W99 B;  1Q16 A;  3NQU B;  1VQ9 Z;  1RQF A;  3C1B B;  3REK B;  1KX3 D;  3VMG A;  5CPI B;  3NH8 A;  3MZL B;  5GT0 B;  5JRG C;  3W98 A;  4LD9 A;  1VQL 1;  4BXX I;  1P3A A;  3CCU Z;  1HQ3 C;  5B0Y A;  4J8U D;  2M48 A;  2R6M A;  4NBA A;  1QXF A;  3VMH A;  5B40 A;  2F8N H;  4A3G I;  5AV6 D;  4KGC B;  5DNN B;  4H9P B;  1P34 B;  1P3B B;  2KPI A;  4AYB A;  4A3F I;  3V9R A;  1F66 D;  4G91 B;  3X1T D;  3LEL B;  1M1A B;  1WJ2 A;  3S1M I;  5B1L D;  1BH9 A;  2NVQ I;  3EPK A;  1TWG I;  3MGR C;  3NQJ A;  4CL1 A;  2QRE B;  3C1C D;  4R8P D;  4XUJ B;  4WU9 D;  3AZJ C;  1EQZ B;  1RLY A;  1Y8C A;  1Q82 1;  1N1J A;  4WV4 B;  1P3P C;  3AZL B;  5GT3 A;  3O62 D;  4YM6 D;  3WA9 D;  1K83 I;  1TWH I;  3QWU A;  4HGZ A;  3J80 b;  4YS3 A;  3PO3 I;  5B32 B;  3AV2 A;  5FLX b;  1AOI D;  2JA7 I;  2I3C A;  4ZUX B;  2NQB D;  1P3B A;  1R9T I;  3UTB D;  1ZLA D;  3W99 D;  3WTP C;  3KWQ B;  4G92 B;  4HGA B;  5E5A B;  3CD6 Z;  3AZH C;  4Z5T B;  3AFA D;  2OTL Z;  4H9S C;  1X3Z A;  5GT0 A;  1KX4 D;  5AV9 B;  3REH A;  3REJ B;  2QKD A;  3NH4 A;  5D1P A;  3C1B A;  2YFW B;  1VQM Z;  1I6H I;  1WZN A;  3REI B;  1U35 D;  4ZBJ B;  5B33 C;  3AN2 C;  3WKJ C;  3AYW B;  3MGQ A;  4WJ3 C;  3F3P C;  2Y2I A;  3G71 1;  1P3I A;  4Z66 B;  3B6G B;  3I55 1;  1M90 2;  2FJ7 B;  1S7M A;  5CPJ C;  4NFT A;  5B2J C;  3CCR Z;  5AV5 A;  3VH5 A;  5GXQ B;  1ID3 B;  2NAP A;  2BYK B;  4WNN B;  3MNN B;  1FDI A;  1TZY C;  4R8P A;  2VF1 A;  2WB1 A;  3MON A;  2VUM I;  1TAF A;  1TAF B;  1JJ2 Z;  3UT9 D;  3GTM S;  1RO4 A;  3HOU I;  3WAA A;  1KU5 A;  4DRB A;  3TU4 B;  1ID3 A;  2V8J A;  5CPK D;  2M6N A;  4NH1 C;  3AZM D;  2PM9 A;  2DE6 A;  4Z66 A;  3B6G A;  2NQB C;  4KUD A;  1VQN 1;  3LZ0 A;  1S32 C;  3G4S 1;  1PFT A;  5E5A C;  2JIP A;  3NDJ A;  1VQK 1;  4UPK A;  2NVT I;  3M3Y I;  5F99 B;  3I56 1;  1VQL Z;  1H3O B;  5B33 D;  3AYW D;  3GCF A;  3AZL C;  2DE7 A;  1P3M A;  4XUJ C;  1WII A;  3LZ1 B;  2JMO A;  2IZ3 A;  3MGS D;  4NBD A;  3VB9 A;  2FFF B;  4QLC C;  2HIO A;  2BYM A;  3C1C B;  1BFM A;  1HTA A;  5BT1 D;  3KWQ C;  2HIO D;  2HUE B;  3KUY C;  4G92 C;  3REL A;  4J8W C;  3IX0 A;  1RO2 A;  4E45 A;  4WU9 A;  1M1A A;  4RVG A;  4ZUX D;  5D1O B;  3B0D B;  1VQ5 1;  3W96 A;  3AZG A;  4H9P A;  5B32 G;  5B1M B;  3I07 A;  5BS7 A;  5B1L A;  3LEL A;  4MON A;  2QLV B;  2VPX A;  4H9R A;  4J8U B;  2K3R A;  5FLX f;  2JSS A;  5DNN A;  4LD9 B;  3CXC Z;  5B0Z D;  3S2D I;  5AY8 D;  5CPI A;  3W97 A;  1P3O B;  3B6F C;  3A6N B;  5B0Z A;  3O62 C;  2P3Y A;  3GTG I;  3LUS A;  1KX5 B;  1BH8 A;  4Z66 D;  3B6G D;  4X6A I;  1M19 C;  3KXB C;  3CC7 Z;  5B40 C;  1K9M 2;  3UTB C;  1W2E A;  3VH6 A;  2HU9 A;  5AVC D;  3LJA D;  2PYO B;  1TWF I;  2JIM A;  4J8V C;  4H9N B;  2R92 I;  2WAQ A;  5T6B A;  5C4J I;  4QTU A;  1T3U A;  5AV8 C;  3H0L C;  2LFU A;  1U35 A;  4A3J I;  1TWC I;  4HGY A;  3VH5 T;  3MGQ D;  4YM6 C;  5DNM C;  2JE5 A;  5B1M C;  1P3G C;  1ML8 A;  1P3L B;  3CCQ 1;  3NFZ A;  2QA4 1;  2OTJ Z;  1KX5 A;  1VQ7 1;  4G91 C;  1ZLA C;  1NUI A;  4RS4 A;  3I4M I;  2J8P A;  3J7A 4;  1P3O A;  3W97 B;  1P3K A;  3S1N I;  3KUY B;  3A6N C;  2R93 I;  5GSU C;  1P3O D;  1JWH C;  3B6F D;  2F4O A;  4A3K I;  5LL6 f;  2QRC B;  1S72 1;  3LZ1 C;  4RVD A;  3HOW I;  3REL B;  3D9X A;  2Y2G A;  3REH C;  1M18 B;  4X23 C;  2PK7 A;  2G2K A;  1YIT Z;  5G49 B;  2G5H C;  2QRD B;  3GTP I;  3S16 I;  1KX3 C;  3G71 Z;  2Q51 A;  2HIO B;  3MVD D;  2ZY5 A;  4JJN C;  3AZE C;  2VPY A;  3S17 I;  4J8X C;  2YFV B;  5B31 A;  4E2Y A;  2IO5 C;  5BNX B;  1S32 B;  5AV6 A;  3IF8 A;  1TWA I;  5DNM D;  3UTA A;  1ULY A;  4DRA A;  4LD9 D;  1YUK A;  1Z01 A;  5F99 A;  3MGS C;  4AWL B;  5AY8 B;  3KIF A;  4NBH A;  4E31 A;  3VTN A;  3X1V A;  3MVD C;  5F99 D;  3H0M C;  5B2I C;  3MGP A;  1WWS A;  3CCM Z;  3KUY D;  3AZN C;  3A6N D;  2J6A A;  5GXQ C;  3X1S B;  2V45 A;  3CC2 Z;  5IP9 I;  4KUD B;  3TU4 A;  1M1A D;  2EGT A;  4NOZ A;  3AZG D;  3W96 D;  3AV1 C;  1Q9C A;  3FQQ A;  5CM2 M;  1P3F A;  3AYW C;  1KQS Y;  3WAA B;  1VQO Z;  2Y2O A;  1DL6 A;  1B6W A;  1VQ9 1;  2RBL A;  3CD6 1;  2NZD D;  5BNV A;  5GT3 D;  1JFI A;  2BYK A;  3A1I A;  3MNN A;  3AFA C;  4QLC D;  3UT9 C;  1P3I B;  2PYO A;  4JJN D;  2L5A A;  3MGQ B;  1YJ9 Z;  3S15 I;  1KX4 C;  5CPK C;  4A3B I;  2HIO C;  1WWI A;  3C1B D;  3AZE B;  3EPH A;  3J81 f;  2JIQ A;  5A2Q b;  4DGL A;  4BY7 I;  3REH B;  1HQ3 B;  3REJ A;  5DNM B;  3REK D;  4ZUX C;  1KX3 B;  2O53 A;  1NJI 2;  3X1U C;  3REI A;  1TFI A;  1VQ8 Z;  5B0Z B;  1YIJ Z;  3S1R I;  2R7Z I;  3HOV I;  5B2J D;  5FUG A;  3X1V D;  2BJO A;  5IT9 b;  3F6T A;  5BS7 C;  5B2I D;  4J8U A;  1KX5 D;  5B0Y D;  1TZY D;  4DQY B;  1NP6 A;  3AL0 C;  1KD1 2;  4Z5T C;  2XD5 A;  2DQN C;  1P3L C;  4HGA C;  4YS3 C;  2Y2L A;  1N1J B;  3O62 A;  4XUJ D;  4WU9 B;  1EQZ A;  4MD9 A;  2F2A C;  5T64 A;  1ZB8 A;  1VQP 1;  1I50 I;  3O62 B;  1EQZ D;  1X3W A;  2Q4Z A;  3AZF B;  3AZF A;  3R45 A;  2OTJ 1;  3IP4 C;  1SIW A;  4YM6 B;  1K73 2;  3CCE 1;  3NQJ B;  1P3P D;  1VQ6 Z;  5JRG B;  3GTK I;  1BH9 B;  4KGC A;  2GTH A;  3C1B C;  3REH D;  2E2J I;  1P34 A;  3AFA B;  5AV9 D;  5AN9 F;  5DNM A;  2JIO A;  3I55 Z;  5DNN D;  2RIQ A;  5B2J A;  1KX4 B;  3NQU A;  3IR7 A;  3JAM b;  2QA4 Z;  3LZ0 B;  1P3A C;  1HQ3 A;  5B0Y C;  1AOI A;  3REL D;  1L1O C;  3REK A;  5CP6 A;  3CCL Z;  5GSU D;  2ZY2 A;  1P3O C;  1M19 D;  1M18 D;  1JFI B;  3W99 A;  3WAA C;  1KRL A;  3OW2 Z;  1KC8 1;  2H85 A;  5T67 A;  4E2W A;  3CCJ 1;  3CC4 Z;  5BNV B;  2NZD B;  3GTJ I;  3S1Q I;  3UT9 B;  1P3I C;  4KHA A;  3AZF D;  1ZH1 A;  2GU2 A;  5CPK B;  4AWL C;  3U50 C;  4XZQ A;  3MGR A;  1P3F B;  3KFU G;  3X1S A;  5AV5 B;  2QEX 1;  1YJN Z;  4J8W B;  3AZJ A;  3RZO I;  4QTT A;  2OZK A;  5B1M D;  3GTM I;  2Y2K A;  2QEX Z;  3X1T A;  3KXB D;  1YI2 Z;  1QVF Z;  2ZY4 A;  2JR6 A;  3AZK C;  3X1V B;  3J81 b;  3K7A I;  4H9O A;  5AY8 A;  5B2I B;  2CV5 A;  4KUD C;  2NZD C;  1X0T A;  1TZY B;  3AZH A;  1JJ2 Y;  1S32 A;  4RVH A;  2Y2J A;  4E33 A;  3G6E 1;  3WA9 C;  4H9S A;  2KI7 B;  3ESW A;  2LIY A;  3KWQ A;  3AZM A;  4MH4 A;  3LZ1 D;  3MVD A;  5C3E I;  5BNX A;  5AVB C;  5IT9 f;  3MGS B;  1YJ9 1;  1LQL A;  3G6E Z;  3CMA Z;  2F8N A;  1M1K 1;  2V8K A;  3CXC Y;  4NE6 A;  5GT3 B;  3AZL A;  4WU8 D;  1Y1V S;  1P3I D;  1VQ5 Z;  1VQ7 Z;  5AV5 C;  1YHQ Z;  1M18 A;  4J8X D;  1TZY A;  4R8P C;  4UUZ B;  2W03 A;  4J8W D;  3B6F A;  2Y0S A;  3GKQ A;  4H9O B;  1P3K B;  2Y2H A;  3B0C W;  1P3L D;  3NH5 A;  4MXU A;  3V9R B;  2P28 A;  4EWC A;  1QVG Y;  2Y2P A;  2OOX B;  3BG0 B;  3UTB A;  3CC7 1;  3AZI C;  4XX2 A;  5B0Y B;  2JCH A; 
#chains in the Genus database with same CATH homology
 3CPW Y;  1P34 D;  4J8V A;  1P3P A;  5GSU B;  3IFU A;  1K9M 1;  1VLA A;  2RHB A;  3CCE Z;  1M19 B;  3JAM f;  3AV2 C;  2ZM5 A;  2VUG A;  3GTL I;  4NB9 A;  1P3B C;  1WCM I;  5AV8 B;  4E44 A;  2OOY B;  5A2Q f;  4MRI A;  4A3C I;  1Q86 1;  2ARO D;  2ZY3 A;  5CP6 B;  2Y2M A;  5AVC A;  3LJA A;  1P3P B;  3W98 C;  4LD9 C;  4TNU A;  3X1U B;  4NBE A;  5KDM B;  4J8V B;  3AZI B;  3EED A;  5FLM I;  3CCV 1;  5GT0 C;  3A6N A;  3I4N I;  3UTB B;  3KSY A;  1WW9 A;  3KXB B;  2IZ4 A;  3CCV Z;  3MGQ C;  1M1A C;  4H9R B;  2AKL A;  3HOZ I;  3H0G I;  4A93 I;  2V8I A;  2ARO C;  3W98 D;  5B1M A;  3B6F B;  3B0D C;  1Z02 A;  3F3F C;  1N8R 2;  5JRG A;  1KX5 C;  3H0R C;  3MGR D;  5C44 I;  5JA4 B;  5B1L B;  5BT1 C;  1P34 C;  1ZLA A;  3X1S D;  5GT3 C;  3AZJ D;  5CPI C;  3AZG B;  3W96 B;  4JJN A;  2FJ7 D;  4YS3 D;  3CCM 1;  2E2H I;  2B63 I;  2JA6 I;  3GTO I;  3AV2 D;  2F8N B;  3AZN B;  2VQR A;  1AOI C;  3WTP A;  3HOX I;  3UTA C;  1P3M B;  3MVD B;  1M90 1;  2BYM B;  3W99 C;  3WTP D;  3C1C A;  4MD8 A;  3CCR 1;  2QR1 B;  4QLC B;  3MGS A;  1H3O A;  2CWE A;  5C3I B;  2HUE C;  4WZS B;  3AZE D;  5GT0 D;  2F8N G;  5BO0 B;  5FUG B;  2NQB B;  3B0B A;  3KWQ D;  1Z2C B;  5B33 A;  2YU9 I;  3TE5 B;  4Z5T D;  1SFO I;  5B24 B;  1U35 C;  3CC2 1;  5B40 D;  5AVB B;  4Z2M H;  1RO0 A;  4S1T A;  4Y7N I;  3AV1 B;  4A3M I;  1YJN 1;  5CPJ A;  1Q86 2;  2E2I I;  4WU8 C;  4A3L I;  1B67 A;  1VQP Z;  3VH5 W;  2NVY I;  5B31 D;  5F99 C;  4X23 B;  1VQ4 1;  3CQZ I;  4KUD D;  1YIJ 1;  2Y2Q A;  4KHA B;  3REL C;  3AZK A;  1P3K C;  3MNN C;  3UT9 A;  3EPL A;  5GXQ D;  4Y52 I;  4R8P B;  3WAA D;  1Y1W I;  1M1K 2;  3AN2 B;  3AN2 A;  5CPK A;  5GXQ A;  3W96 C;  3AZG C;  1ID3 D;  1F66 C;  3WKJ A;  3WKJ B;  4E32 A;  3TU4 C;  4Z66 C;  3B6G C;  3T4N B;  5B1L C;  2OTL 1;  4ZBJ C;  4X23 A;  3AZI D;  4CAY B;  4J8X B;  1VQ8 1;  4J8V D;  2FJ7 A;  3W97 C;  5CPJ B;  4BBR I;  4EO5 B;  1HQ3 D;  3AFA A;  4E2X A;  1ID3 C;  5B24 A;  3CCL 1;  2DE5 A;  2JS4 A;  2F8N K;  2YFW A;  4Z5T A;  5B2J B;  3REJ D;  5B24 D;  2DF4 C;  5AV6 C;  5AV9 A;  1KX4 A;  3CCS Z;  5C4X I;  3UTA B;  1P3M C;  2NQB A;  3REI D;  2W04 A;  3CCQ Z;  1Q82 2;  2JUB A;  4M6B A;  3CCJ Z;  4ZUX A;  3G4S Z;  1W2B Z;  2XD1 A;  4QLC A;  5B33 B;  4MD7 A;  1YIT 1;  5E5A A;  3AZF C;  3CCS 1;  2HF1 A;  4NBG A;  3AZN A;  5B32 A;  3AV2 B;  2GTI A;  5G49 A;  4YS3 B;  4YM6 A;  3AN2 D;  3WKJ D;  4NE3 A;  1P3M D;  3R45 B;  2F8N D;  1VQ6 1;  3WTP B;  3TU4 D;  4XUJ A;  3CCU 1;  5JA4 A;  5JRG D;  1EQZ C;  3AZK D;  5AV5 D;  1A7W A;  1R4V A;  2CV5 D;  5IP7 I;  3MGP D;  3J80 f;  3AZH D;  1I3Q I;  2YAD A;  3KUY A;  5B0Z C;  4NB8 A;  2JA8 I;  2O4H A;  2PMZ A;  5CPI D;  4BBS I;  2PYO C;  1RNI A;  1P3A B;  3EER A;  4NFR A;  4DK1 A;  3MZK B;  3KXB A;  3AV1 D;  5CP6 C;  2W8S A;  3W98 B;  5B40 B;  5AVB D;  4KGC C;  4A3D I;  3UTA D;  3OW2 Y;  3HOY I;  4A3E I;  3X1U A;  1KX3 A;  5DNN C;  3GTQ I;  3M4O I;  1YI2 1;  3FQM A;  3H3V J;  2ARO A;  3AZE A;  4RVF A;  2Y2N A;  3B0C T;  4CSR B;  5AV8 A;  4CAY A;  4J8X A;  2PYO D;  4J8U C;  3FKI I;  3CME 1;  3AZN D;  3I56 Z;  5AVC B;  3LJA B;  1USP B;  4XZQ D;  3CPW Z;  3S14 I;  1YUA A;  1P3G A;  1M19 A;  3REK C;  1P9N A;  3NDI A;  3AZL D;  3WA9 B;  1P3G D;  1PZR A;  3X1T C;  3KIH A;  4NBC A;  3CME Z;  1BH8 B;  4NE5 A;  1VQO 1;  1P3F D;  4E2Z A;  3CMA 1;  4EO5 C;  3X1V C;  3AZK B;  1VQM 1;  2RPR A;  4NBB A;  2CV5 C;  3MGP B;  5GSU A;  2RVQ C;  1N8R 1;  1QVF Y;  1F1E A;  3C1C C;  1P3K D;  4H9Q B;  4XZQ C;  3VH6 W;  3D6W A;  2NVX I;  1NJI 1;  3WTP E;  3AV1 A;  4E30 A;  3A1K A;  1Q7Y 2;  5AVB A;  1Z03 A;  4UUZ A;  1F66 B;  5AV6 B;  1P3F C;  4KGC D;  3LZ0 D;  1P3B D;  2YFV A;  5B31 B;  4X23 D;  4NBF A;  5D1O A;  4A3I I;  3RZD I;  5BO0 A;  3VMI A;  2RVQ D;  3P5J B;  5AY8 C;  3EPJ A;  4WU8 A;  3PO3 S;  5B31 C;  1Y1V I;  3VH6 T;  1ZB9 A;  1YHQ 1;  2LY8 A;  4WU8 B;  1VQN Z;  3LZ1 A;  1Q7Y 1;  1K8A 1;  1VQ4 Z;  3AZM C;  3REJ C;  3Q87 A;  3LZ0 C;  2IO5 B;  5B32 D;  1Q81 1;  3REI C;  1VQK Z;  1S32 D;  1W2B Y;  3S2H I;  4JJN B;  3AZH B;  1F66 A;  2G5I C;  2BG1 A;  5E5A D;  5CPJ D;  5B2I A;  3AZM B;  2CV5 B;  4RV9 A;  1ZLA B;  1KC8 2;  1K8A 2;  4HH4 A;  2F4M A;  1YJW 1;  1P3A D;  2K5R A;  1S72 Z;  2E9H A;  3X1S C;  3FDD A;  1KQS Z;  3W97 D;  1M18 C;  2JNY A;  2FJ7 C;  1P3L A;  2UWX A;  5B31 G;  1QF8 A;  2ZAE B;  1YJW Z;  3LEL D;  3X1T B;  1KD1 1;  4H9Q A;  5B24 C;  4Z2M G;  3EG5 B;  1U35 B;  3HKZ A;  3MGR B;  3PO2 I;  5AV9 C;  5CHL B;  1N2F A;  4J8W A;  3MGP C;  5AVC C;  3LJA C;  3AZJ B;  5KDM A;  3AZI A;  5C3I C;  4WU9 C;  2NZD A;  3MNN D;  1QYP A;  4WNN A;  4XZQ B;  2JA5 I;  4BY1 I;  3TDH B;  1Q81 2;  3WA9 A;  4CSR A;  1K73 1;  1QVG Z;  1P3G B;  2ARO B;  5CP6 D;  5AV8 D;  3BG1 B;  3LEL C;  1USP A;  4H9N A;  1AOI B;  2RT9 A;  5B32 C;  3AYW A;  3CC4 1;  3X1U D;  3W99 B;  1VQ9 Z;  3NQU B;  1RQF A;  3C1B B;  3REK B;  1KX3 D;  3VMG A;  5CPI B;  3NH8 A;  3MZL B;  5GT0 B;  5JRG C;  3W98 A;  4LD9 A;  1VQL 1;  4BXX I;  1P3A A;  3CCU Z;  1HQ3 C;  5B0Y A;  4J8U D;  2M48 A;  2R6M A;  4NBA A;  3VMH A;  5B40 A;  2F8N H;  4A3G I;  5AV6 D;  4KGC B;  5DNN B;  4H9P B;  1P34 B;  1P3B B;  2KPI A;  4AYB A;  4A3F I;  3V9R A;  1F66 D;  4G91 B;  3X1T D;  3LEL B;  1M1A B;  3S1M I;  5B1L D;  1BH9 A;  2NVQ I;  3EPK A;  1TWG I;  3MGR C;  3NQJ A;  4CL1 A;  2QRE B;  3C1C D;  4R8P D;  4XUJ B;  4WU9 D;  3AZJ C;  1EQZ B;  1RLY A;  1Q82 1;  1VQ5 Z;  1N1J A;  4WV4 B;  1P3P C;  3AZL B;  5GT3 A;  3O62 D;  4YM6 D;  3WA9 D;  1K83 I;  1TWH I;  3QWU A;  4HGZ A;  3J80 b;  4YS3 A;  3PO3 I;  5B32 B;  3AV2 A;  5FLX b;  1AOI D;  2JA7 I;  2I3C A;  4ZUX B;  2NQB D;  1P3B A;  1R9T I;  3UTB D;  1ZLA D;  3W99 D;  3WTP C;  3KWQ B;  4G92 B;  4HGA B;  5E5A B;  3CD6 Z;  3AZH C;  4Z5T B;  3AFA D;  2OTL Z;  4H9S C;  1X3Z A;  5GT0 A;  1KX4 D;  5AV9 B;  3REH A;  3REJ B;  2QKD A;  3NH4 A;  5D1P A;  3C1B A;  2YFW B;  1VQM Z;  1I6H I;  3REI B;  1U35 D;  4ZBJ B;  5B33 C;  3AN2 C;  3WKJ C;  3AYW B;  3MGQ A;  4WJ3 C;  3F3P C;  2Y2I A;  3G71 1;  1P3I A;  4Z66 B;  3B6G B;  3I55 1;  1M90 2;  2FJ7 B;  1S7M A;  5CPJ C;  4NFT A;  5B2J C;  3CCR Z;  5AV5 A;  3VH5 A;  5GXQ B;  1ID3 B;  2BYK B;  4WNN B;  3MNN B;  2VF1 A;  1TZY C;  4R8P A;  2WB1 A;  3MON A;  2VUM I;  1TAF A;  1TAF B;  1JJ2 Z;  3UT9 D;  3GTM S;  1RO4 A;  3HOU I;  3WAA A;  1KU5 A;  4DRB A;  3TU4 B;  1ID3 A;  2V8J A;  5CPK D;  2M6N A;  4NH1 C;  3AZM D;  2PM9 A;  2DE6 A;  4Z66 A;  3B6G A;  2NQB C;  4KUD A;  1VQN 1;  3LZ0 A;  1S32 C;  3G4S 1;  1PFT A;  5E5A C;  1VQK 1;  3NDJ A;  4UPK A;  2NVT I;  3M3Y I;  5F99 B;  3I56 1;  1VQL Z;  1H3O B;  5B33 D;  3AYW D;  3GCF A;  3AZL C;  2DE7 A;  1P3M A;  4XUJ C;  1WII A;  3LZ1 B;  2JMO A;  2IZ3 A;  3MGS D;  4NBD A;  3VB9 A;  2FFF B;  4QLC C;  2HIO A;  2BYM A;  3C1C B;  1BFM A;  1HTA A;  5BT1 D;  3KWQ C;  2HIO D;  2HUE B;  3KUY C;  4G92 C;  3REL A;  4J8W C;  3IX0 A;  1RO2 A;  4E45 A;  4WU9 A;  1M1A A;  4RVG A;  4ZUX D;  5D1O B;  3B0D B;  1VQ5 1;  3W96 A;  3AZG A;  4H9P A;  5B32 G;  5B1M B;  3I07 A;  5BS7 A;  5B1L A;  3LEL A;  4MON A;  2QLV B;  4H9R A;  4J8U B;  2K3R A;  5FLX f;  2JSS A;  5DNN A;  4LD9 B;  3CXC Z;  5B0Z D;  3S2D I;  5AY8 D;  5CPI A;  3W97 A;  1P3O B;  3B6F C;  3A6N B;  5B0Z A;  3O62 C;  2P3Y A;  3GTG I;  3LUS A;  1KX5 B;  1BH8 A;  4Z66 D;  3B6G D;  4X6A I;  1M19 C;  3KXB C;  3CC7 Z;  5B40 C;  1K9M 2;  3UTB C;  1W2E A;  3VH6 A;  2HU9 A;  5AVC D;  3LJA D;  2PYO B;  1TWF I;  2R92 I;  4J8V C;  4H9N B;  2WAQ A;  5T6B A;  5C4J I;  4QTU A;  1T3U A;  5AV8 C;  3H0L C;  2LFU A;  1U35 A;  4A3J I;  1TWC I;  4HGY A;  3VH5 T;  3MGQ D;  4YM6 C;  5DNM C;  2JE5 A;  5B1M C;  1P3G C;  1ML8 A;  1P3L B;  3CCQ 1;  3NFZ A;  2QA4 1;  2OTJ Z;  1KX5 A;  1VQ7 1;  4G91 C;  1ZLA C;  1NUI A;  4RS4 A;  3I4M I;  2J8P A;  3J7A 4;  1P3O A;  3W97 B;  1P3K A;  3S1N I;  3KUY B;  3A6N C;  2R93 I;  5GSU C;  1P3O D;  1JWH C;  3B6F D;  2F4O A;  4A3K I;  5LL6 f;  2QRC B;  1S72 1;  3LZ1 C;  4RVD A;  3HOW I;  3REL B;  3D9X A;  2Y2G A;  3REH C;  1M18 B;  4X23 C;  2PK7 A;  2G2K A;  1YIT Z;  5G49 B;  2G5H C;  2QRD B;  3GTP I;  3S16 I;  1KX3 C;  3G71 Z;  2Q51 A;  2HIO B;  3MVD D;  2ZY5 A;  4JJN C;  3AZE C;  3S17 I;  4J8X C;  2YFV B;  5B31 A;  4E2Y A;  2IO5 C;  5BNX B;  1S32 B;  5AV6 A;  3IF8 A;  1TWA I;  5DNM D;  3UTA A;  1ULY A;  4DRA A;  4LD9 D;  1YUK A;  1Z01 A;  5F99 A;  3MGS C;  4AWL B;  5AY8 B;  3KIF A;  4NBH A;  4E31 A;  3VTN A;  3X1V A;  3MVD C;  5F99 D;  3H0M C;  5B2I C;  3MGP A;  1WWS A;  3CCM Z;  3KUY D;  3AZN C;  3A6N D;  2J6A A;  5GXQ C;  3X1S B;  3CC2 Z;  5IP9 I;  4KUD B;  3TU4 A;  1M1A D;  2EGT A;  4NOZ A;  3AZG D;  3W96 D;  3AV1 C;  1Q9C A;  3FQQ A;  5CM2 M;  1P3F A;  3AYW C;  1KQS Y;  3WAA B;  1VQO Z;  2Y2O A;  1DL6 A;  1B6W A;  1VQ9 1;  2RBL A;  3CD6 1;  2NZD D;  5BNV A;  5GT3 D;  1JFI A;  2BYK A;  3A1I A;  3MNN A;  3AFA C;  4QLC D;  3UT9 C;  1P3I B;  2PYO A;  4JJN D;  2L5A A;  3MGQ B;  1YJ9 Z;  3S15 I;  1KX4 C;  5CPK C;  4A3B I;  2HIO C;  1WWI A;  3C1B D;  3AZE B;  3EPH A;  3J81 f;  5A2Q b;  4DGL A;  4BY7 I;  3REH B;  1HQ3 B;  3REJ A;  5DNM B;  3REK D;  4ZUX C;  1KX3 B;  2O53 A;  1NJI 2;  3X1U C;  3REI A;  1TFI A;  1VQ8 Z;  5B0Z B;  1YIJ Z;  3S1R I;  2R7Z I;  3HOV I;  5B2J D;  5FUG A;  3X1V D;  2BJO A;  5IT9 b;  3F6T A;  5BS7 C;  5B2I D;  4J8U A;  1KX5 D;  5B0Y D;  1TZY D;  4DQY B;  1NP6 A;  3AL0 C;  1KD1 2;  4Z5T C;  2XD5 A;  2DQN C;  1P3L C;  4HGA C;  4YS3 C;  2Y2L A;  1N1J B;  3O62 A;  4XUJ D;  4WU9 B;  1EQZ A;  4MD9 A;  2F2A C;  5T64 A;  1ZB8 A;  1VQP 1;  1I50 I;  3O62 B;  1EQZ D;  1X3W A;  2Q4Z A;  3AZF B;  3AZF A;  3R45 A;  2OTJ 1;  3IP4 C;  1K73 2;  4YM6 B;  3CCE 1;  3NQJ B;  1P3P D;  1VQ6 Z;  5JRG B;  3GTK I;  1BH9 B;  4KGC A;  2GTH A;  3C1B C;  3REH D;  2E2J I;  1P34 A;  3AFA B;  5AV9 D;  5AN9 F;  5DNM A;  3I55 Z;  5DNN D;  2RIQ A;  5B2J A;  1KX4 B;  3NQU A;  3JAM b;  2QA4 Z;  3LZ0 B;  1P3A C;  1HQ3 A;  5B0Y C;  1AOI A;  3REL D;  1L1O C;  3REK A;  5CP6 A;  3CCL Z;  5GSU D;  2ZY2 A;  1P3O C;  1M19 D;  1M18 D;  1JFI B;  3W99 A;  3WAA C;  1KRL A;  3OW2 Z;  1KC8 1;  2H85 A;  5T67 A;  4E2W A;  3CCJ 1;  3CC4 Z;  5BNV B;  2NZD B;  3GTJ I;  3S1Q I;  3UT9 B;  1P3I C;  4KHA A;  3AZF D;  1ZH1 A;  2GU2 A;  5CPK B;  4AWL C;  3U50 C;  4XZQ A;  3MGR A;  1P3F B;  3KFU G;  3X1S A;  5AV5 B;  2QEX 1;  1YJN Z;  4J8W B;  3AZJ A;  3RZO I;  4QTT A;  2OZK A;  5B1M D;  3GTM I;  2Y2K A;  2QEX Z;  3X1T A;  3KXB D;  1YI2 Z;  1QVF Z;  2ZY4 A;  2JR6 A;  3AZK C;  3X1V B;  3J81 b;  3K7A I;  4H9O A;  5AY8 A;  5B2I B;  2CV5 A;  4KUD C;  2NZD C;  1X0T A;  1TZY B;  3AZH A;  1JJ2 Y;  1S32 A;  4RVH A;  2Y2J A;  4E33 A;  3G6E 1;  3WA9 C;  4H9S A;  2KI7 B;  3ESW A;  2LIY A;  3KWQ A;  3AZM A;  4MH4 A;  3LZ1 D;  3MVD A;  5C3E I;  5BNX A;  5AVB C;  5IT9 f;  3MGS B;  1YJ9 1;  1LQL A;  3G6E Z;  3CMA Z;  2F8N A;  1M1K 1;  2V8K A;  3CXC Y;  4NE6 A;  5GT3 B;  3AZL A;  4WU8 D;  1Y1V S;  1P3I D;  1VQ7 Z;  5AV5 C;  1YHQ Z;  1M18 A;  4J8X D;  1TZY A;  4R8P C;  4UUZ B;  2W03 A;  4J8W D;  3B6F A;  2Y0S A;  3GKQ A;  4H9O B;  1P3K B;  2Y2H A;  3B0C W;  1P3L D;  3NH5 A;  4MXU A;  3V9R B;  2P28 A;  4EWC A;  1QVG Y;  2Y2P A;  2OOX B;  3BG0 B;  3UTB A;  3CC7 1;  3AZI C;  4XX2 A;  5B0Y B;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...