3I56Z

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56Z00
1VQN1 3CCS1 1W2BY 1VQ61 3CCJ1 2OTLZ 3CC71 3CPWZ 3CXCZ 1KQSY 1VQLZ 1VQ71 1YJ9Z 1N8R1 1YITZ 1VQ9Z 3CCL1 1KC81 1YIJ1 1VQK1 1QVGZ 3CCQ1 1Q862 1VQ7Z 1KC82 2QEXZ 1Q7Y2 3CMAZ 1VQP1 1K8A2 1VQKZ 2QA4Z 1JJ2Z 1K732 1YI21 3CME1 1M902 3CCE1 3G711 3OW2Z 1QVFZ 1Q861 3CCVZ 1VQO1 1Q812 1VQNZ 3CCSZ 1YHQ1 1Q7Y1 1K8A1 1M1K1 3CCJZ 1VQ6Z 3CC41 3CC21 1K731 3CC7Z 1YJW1 1NJI1 1Q821 1VQM1 3I551 3CCLZ 1M901 1YIJZ 1M1K2 3CCQZ 3CCM1 1YJN1 1NJI2 1QVGY 1Q822 1VQ81 3CCR1 1Q811 3I55Z 1VQ51 1S721 3G6E1 3CCU1 3I561 1VQPZ 1VQ41 1YI2Z 3CMEZ 2OTJ1 1VQ8Z 1W2BZ 3G4S1 1VQ5Z 3CCEZ 3G71Z 1KQSZ 2OTL1 1KD12 1VQOZ 3OW2Y 1K9M2 3CXCY 3CPWY 1YJ91 1YHQZ 1YIT1 1VQ91 3CC4Z 3CC2Z 1YJWZ 1VQMZ 2QEX1 3CMA1 2QA41 3CCMZ 1YJNZ 1KD11 3CD61 1JJ2Y 3CCRZ 1K9M1 1S72Z 1N8R2 3G6EZ 3CCUZ 3I56Z 1VQ4Z 2OTJZ 3CD6Z 1QVFY 3CCV1 1VQL1 3G4SZ
chains in the Genus database with same CATH superfamily
1VQN1 4E31A 2W03A 1VQ61 3CCJ1 1Z01A 2JIMA 3CC71 2E2II 3J7A4 4BY7I 2G2KA 4HGYA 4E2YA 3GTMI 1YITZ 5IP7I 4NB9A 1NUIA 4E2XA 2OZKA 3KIHA 1SIWA 5C4XI 4NOZA 2QEXZ 4RVDA 3CMAZ 1VQP1 1R9TI 1JJ2Z 4HH4A 4A3EI 2AKLA 3ESWA 3M4OI 4A3KI 1ML8A 5FLMI 1DL6A 2B63I 2OOXB 1Q812 3CQZI 1YHQ1 1Q7Y1 2JA7I 2O53A 1M1K1 4DGLA 3CC41 3CC21 3F3PC 2F4OA 1X0TA 3CCLZ 3GTLI 1M1K2 2OOYB 3CCQZ 2VPXA 3VMIA 4A3DI 5T6BA 2AYDA 1VQ51 4NBEA 2VPZA 2E7ZA 3CCU1 3EEDA 1YI2Z 2OTJ1 1VQ8Z 1QYPA 2QKDA 3G4S1 3NH8A 2K3RA 4RVHA 4XX2A 3GTMS 2P3YA 1YIT1 1NP6A 4E32A 2KPIA 1USPA 5AN9F 2R92I 5A2Qb 3RZOI 2QEX1 3GKQA 2GU2A 2R6MA 3CMA1 1KD11 3CD61 3M3YI 3S1MI 3GTPI 2E2JI 1S72Z 1N8R2 3G6EZ 2VUGA 3IFUA 3MZLB 2JS4A 1QVFY 1VQL1 3IX0A 2QRDB 3BG0B 2JIPA 2YU9I 2V8IA 3NFZA 1LQLA 5LL6f 3CPWZ 2J6AA 2JIRA 3HOXI 1VQ71 1YJ9Z 5IP9I 3CCL1 2V45A 3IR7A 5A2Qf 1QVGZ 3D2LA 1X3ZA 3S17I 4NBAA 3CCQ1 2GTIA 2QREB 4NBGA 1ZB9A 2P28A 1ZB8A 1Z03A 3MZKB 2QLVB 1VQKZ 3S16I 1YI21 4E2WA 2WAQA 2PM9A 2LIYA 1SFOI 2QRCB 4RVFA 2V8JA 2Y0SA 2NAPA 1RO4A 1TWFI 3GCFA 3GTKI 3HOUI 3F3FC 2IZ4A 2JIOA 5T67A 3I551 3JAMb 3MONA 3GTQI 1YIJZ 2VPYA 2V3VA 4NBCA 1QVGY 1L1OC 1Q811 1RO0A 1S721 3J80b 3G6E1 2JNYA 3HOYI 3S15I 2KI7B 3J81b 1S7MA 1W2BZ 4NFRA 3G71Z 5IT9b 2I3CA 1K83I 5CM2M 3IF8A 1VQOZ 1YJ91 2F4MA 1YUAA 2O4HA 3JAMf 4MH4A 4BBSI 1PFTA 1USPB 1TWGI 2H85A 2EGTA 4S1TA 4NBFA 4RV9A 3J80f 3S1RI 2NVTI 3PO3I 3CCMZ 1JJ2Y 3CCRZ 3NDJA 3D9XA 1QF8A 2VF1A 3HOVI 3I56Z 2VUMI 1VQ4Z 5IT9f 4Y7NI 3RZDI 2E2HI 1N2FA 2JA6I 1W2BY 3TE5B 2OTLZ 3S2DI 3CXCZ 4NBHA 2RT9A 1WIIA 1N8R1 3H0GI 3S1QI 3BG1B 1YUKA 4BBRI 1YIJ1 1Q862 3HOZI 1TWAI 2NVYI 3FQMA 3KIFA 1K8A2 2QA4Z 1K732 4MRIA 2V8KA 2M48A 2IV2X 5D1PA 1VLAA 4MXUA 1M902 5D1OA 3G711 3S1NI 3Q87A 5C3EI 3CCVZ 1VQO1 3P5JB 3VMGA 2JUBA 4MONA 1RLYA 3CCSZ 2NVXI 1QXFA 2JA5I 4TNUA 2PMZA 4A3LI 1WW9A 1NJI1 4E33A 4A3GI 1TWCI 3PO3S 3NH5A 1NJI2 3CCM1 4BXXI 3EERA 1VQ81 3CCR1 2RHBA 1I6HI 3I561 3GTGI 1VQ41 3CMEZ 4DK1A 3S14I 4MD9A 3FQQA 5FLXb 1VQ5Z 4EWCA 3K7AI 3CCEZ 2WB1A 2R7ZI 1RNIA 1KQSZ 2OTL1 3QWUA 1Y8CA 2LFUA 1K9M2 3CPWY 3VMHA 4NB8A 2IZ3A 1YJWZ 2BJOA 1VQMZ 2HU9A 2JR6A 4E30A 1ZH1A 5C44I 2QA41 1YJNZ 2NVQI 3NH4A 1TFIA 2JMOA 3U50C 5FLXf 2M6NA 3S2HI 2Q4ZA 2ZAEB 3CD6Z 3CCV1 3CCS1 4A3MI 4QTUA 3H3VJ 1FDOA 1KQSY 1VQLZ 3I4NI 1RO2A 1Y1VI 1VQ9Z 1KC81 3I4MI 3I07A 3NDIA 2PK7A 3D6WA 1VQK1 3LUSA 2HF1A 3J81f 3T4NB 2RBLA 1VQ7Z 4E2ZA 3VB9A 4A3BI 4Y52I 1KC82 2VPWA 1Q7Y2 3CME1 4A93I 4HGZA 5D1OB 3CCE1 3OW2Z 3FKII 4MD7A 1Q861 1QVFZ 4A3JI 2DE6A 2Q51A 3PO2I 3HOWI 1VQNZ 1I50I 1K8A1 1VQ6Z 3CCJZ 4RS4A 4A3CI 1K731 3CC7Z 1YJW1 1I3QI 1Q821 4DQYB 4A3FI 1VQM1 4NBBA 2RIQA 1M901 4BY1I 2RPRA 1Y1WI 4CL1A 1YJN1 1Q822 2K5RA 1WCMI 4NH1C 3I55Z 3HKZA 1X3WA 1VQPZ 4RVGA 1Q16A 2JA8I 1Z02A 1RQFA 4NBDA 3GTJI 1KD12 3OW2Y 1TWHI 3CXCY 1Y1VS 1YHQZ 2W04A 2LEXA 1VQ91 5C4JI 3CC4Z 3CC2Z 1AA6A 2DE7A 2R93I 3VTNA 1JWHC 2YADA 3GTOI 4X6AI 2DE5A 4QTTA 1WJ2A 4AYBA 4A3II 1K9M1 3TDHB 1KRLA 5T64A 3CCUZ 4MD8A 1P9NA 1WZNA 2OTJZ 1FDIA 2QR1B 2GTHA 2JIQA 3G4SZ 2E9HA
chains in the Genus database with same CATH topology
1VQN1 4E31A 2W03A 1VQ61 3CCJ1 1Z01A 3CC71 2E2II 3J7A4 4BY7I 2G2KA 4HGYA 4E2YA 3GTMI 1YITZ 5IP7I 4NB9A 1NUIA 4E2XA 2OZKA 3KIHA 5C4XI 4NOZA 2QEXZ 4RVDA 3CMAZ 1VQP1 1R9TI 1JJ2Z 4HH4A 4A3EI 2AKLA 3ESWA 3M4OI 4A3KI 1ML8A 5FLMI 1DL6A 2B63I 2OOXB 1Q812 3CQZI 1YHQ1 1Q7Y1 2JA7I 2O53A 1M1K1 4DGLA 3CC41 3CC21 3F3PC 2F4OA 1X0TA 3CCLZ 3GTLI 1M1K2 2OOYB 3CCQZ 3VMIA 4A3DI 5T6BA 1VQ51 4NBEA 3CCU1 3EEDA 1YI2Z 2OTJ1 1VQ8Z 1QYPA 2QKDA 3G4S1 3NH8A 2K3RA 4RVHA 4XX2A 3GTMS 2P3YA 1YIT1 1NP6A 4E32A 2KPIA 1USPA 5AN9F 2R92I 5A2Qb 3RZOI 2QEX1 3GKQA 2GU2A 2R6MA 3CMA1 1KD11 3CD61 3M3YI 3S1MI 3GTPI 2E2JI 1S72Z 1N8R2 3G6EZ 2VUGA 3IFUA 3MZLB 2JS4A 1QVFY 1VQL1 3IX0A 2QRDB 3BG0B 2YU9I 2V8IA 3NFZA 1LQLA 5LL6f 3CPWZ 2J6AA 3HOXI 1VQ71 1YJ9Z 5IP9I 3CCL1 5A2Qf 1QVGZ 1X3ZA 3S17I 4NBAA 3CCQ1 2GTIA 2QREB 4NBGA 1ZB9A 2P28A 1ZB8A 1Z03A 3MZKB 2QLVB 1VQKZ 3S16I 1YI21 4E2WA 2WAQA 2PM9A 2LIYA 1SFOI 2QRCB 4RVFA 2V8JA 2Y0SA 1RO4A 1TWFI 3GCFA 3GTKI 3HOUI 3F3FC 2IZ4A 5T67A 3I551 3JAMb 3MONA 3GTQI 1YIJZ 4NBCA 1QVGY 1L1OC 1Q811 1RO0A 1S721 3J80b 3G6E1 2JNYA 3HOYI 3S15I 2KI7B 3J81b 1S7MA 1W2BZ 4NFRA 3G71Z 5IT9b 2I3CA 1K83I 5CM2M 3IF8A 1VQOZ 1YJ91 2F4MA 1YUAA 2O4HA 3JAMf 4MH4A 4BBSI 1PFTA 1USPB 1TWGI 2H85A 2EGTA 4S1TA 4NBFA 4RV9A 3J80f 3S1RI 2NVTI 3PO3I 3CCMZ 1JJ2Y 3CCRZ 3NDJA 3D9XA 1QF8A 2VF1A 3HOVI 3I56Z 2VUMI 1VQ4Z 5IT9f 4Y7NI 3RZDI 2E2HI 1N2FA 2JA6I 1W2BY 3TE5B 2OTLZ 3S2DI 3CXCZ 4NBHA 2RT9A 1WIIA 1N8R1 3H0GI 3S1QI 3BG1B 1YUKA 4BBRI 1YIJ1 1Q862 3HOZI 1TWAI 2NVYI 3FQMA 3KIFA 1K8A2 2QA4Z 1K732 4MRIA 2V8KA 2M48A 5D1PA 1VLAA 4MXUA 1M902 5D1OA 3G711 3S1NI 3Q87A 5C3EI 3CCVZ 1VQO1 3P5JB 3VMGA 2JUBA 4MONA 1RLYA 3CCSZ 2NVXI 2JA5I 4TNUA 2PMZA 4A3LI 1WW9A 1NJI1 4E33A 4A3GI 1TWCI 3PO3S 3NH5A 1NJI2 3CCM1 4BXXI 3EERA 1VQ81 3CCR1 2RHBA 1I6HI 3I561 3GTGI 1VQ41 3CMEZ 4DK1A 3S14I 4MD9A 3FQQA 5FLXb 1VQ5Z 4EWCA 3K7AI 3CCEZ 2WB1A 2R7ZI 1RNIA 1KQSZ 2OTL1 3QWUA 2LFUA 1K9M2 3CPWY 3VMHA 4NB8A 2IZ3A 1YJWZ 2BJOA 1VQMZ 2HU9A 2JR6A 4E30A 1ZH1A 5C44I 2QA41 1YJNZ 2NVQI 3NH4A 1TFIA 2JMOA 3U50C 5FLXf 2M6NA 3S2HI 2Q4ZA 2ZAEB 3CD6Z 3CCV1 3CCS1 4A3MI 4QTUA 3H3VJ 1KQSY 1VQLZ 3I4NI 1RO2A 1Y1VI 1VQ9Z 1KC81 3I4MI 3I07A 3NDIA 2PK7A 3D6WA 1VQK1 3LUSA 2HF1A 3J81f 3T4NB 2RBLA 1VQ7Z 4E2ZA 3VB9A 4A3BI 4Y52I 1KC82 1Q7Y2 3CME1 4A93I 4HGZA 5D1OB 3CCE1 3OW2Z 3FKII 4MD7A 1Q861 1QVFZ 4A3JI 2DE6A 2Q51A 3PO2I 3HOWI 1VQNZ 1I50I 1K8A1 1VQ6Z 3CCJZ 4RS4A 4A3CI 1K731 3CC7Z 1YJW1 1I3QI 1Q821 4DQYB 4A3FI 1VQM1 4NBBA 2RIQA 1M901 4BY1I 2RPRA 1Y1WI 4CL1A 1YJN1 1Q822 2K5RA 1WCMI 4NH1C 3I55Z 3HKZA 1X3WA 1VQPZ 4RVGA 2JA8I 1Z02A 1RQFA 4NBDA 3GTJI 1KD12 3OW2Y 1TWHI 3CXCY 1Y1VS 1YHQZ 2W04A 1VQ91 5C4JI 3CC4Z 3CC2Z 2DE7A 2R93I 3VTNA 1JWHC 2YADA 3GTOI 4X6AI 2DE5A 4QTTA 4AYBA 4A3II 1K9M1 3TDHB 1KRLA 5T64A 3CCUZ 4MD8A 1P9NA 2OTJZ 2QR1B 2GTHA 3G4SZ 2E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN 1;  3CCS 1;  1W2B Y;  1VQ6 1;  3CCJ 1;  2OTL Z;  3CC7 1;  3CPW Z;  3CXC Z;  1KQS Y;  1VQL Z;  1VQ7 1;  1YJ9 Z;  1N8R 1;  1YIT Z;  1VQ9 Z;  3CCL 1;  1KC8 1;  1YIJ 1;  1VQK 1;  1QVG Z;  3CCQ 1;  1Q86 2;  1VQ7 Z;  1KC8 2;  2QEX Z;  1Q7Y 2;  3CMA Z;  1VQP 1;  1K8A 2;  1VQK Z;  2QA4 Z;  1JJ2 Z;  1K73 2;  1YI2 1;  3CME 1;  1M90 2;  3CCE 1;  3G71 1;  3OW2 Z;  1QVF Z;  1Q86 1;  3CCV Z;  1VQO 1;  1Q81 2;  1VQN Z;  3CCS Z;  1YHQ 1;  1Q7Y 1;  1K8A 1;  1M1K 1;  3CCJ Z;  1VQ6 Z;  3CC4 1;  3CC2 1;  1K73 1;  3CC7 Z;  1YJW 1;  1NJI 1;  1Q82 1;  1VQM 1;  3I55 1;  3CCL Z;  1M90 1;  1YIJ Z;  1M1K 2;  3CCQ Z;  3CCM 1;  1YJN 1;  1NJI 2;  1QVG Y;  1Q82 2;  1VQ8 1;  3CCR 1;  1Q81 1;  3I55 Z;  1VQ5 1;  1S72 1;  3G6E 1;  3CCU 1;  3I56 1;  1VQP Z;  1VQ4 1;  1YI2 Z;  3CME Z;  2OTJ 1;  1VQ8 Z;  1W2B Z;  3G4S 1;  1VQ5 Z;  3CCE Z;  3G71 Z;  1KQS Z;  2OTL 1;  1KD1 2;  1VQO Z;  3OW2 Y;  1K9M 2;  3CXC Y;  3CPW Y;  1YJ9 1;  1YHQ Z;  1YIT 1;  1VQ9 1;  3CC4 Z;  3CC2 Z;  1YJW Z;  1VQM Z;  2QEX 1;  3CMA 1;  2QA4 1;  3CCM Z;  1YJN Z;  1KD1 1;  3CD6 1;  1JJ2 Y;  3CCR Z;  1K9M 1;  1S72 Z;  1N8R 2;  3G6E Z;  3CCU Z;  3I56 Z;  1VQ4 Z;  2OTJ Z;  3CD6 Z;  1QVF Y;  3CCV 1;  1VQL 1;  3G4S Z; 
#chains in the Genus database with same CATH topology
 1VQN 1;  4E31 A;  2W03 A;  1VQ6 1;  3CCJ 1;  1Z01 A;  2JIM A;  3CC7 1;  2E2I I;  3J7A 4;  4BY7 I;  2G2K A;  4HGY A;  4E2Y A;  3GTM I;  1YIT Z;  5IP7 I;  4NB9 A;  1NUI A;  4E2X A;  2OZK A;  3KIH A;  1SIW A;  5C4X I;  4NOZ A;  2QEX Z;  4RVD A;  3CMA Z;  1VQP 1;  1R9T I;  1JJ2 Z;  4HH4 A;  4A3E I;  2AKL A;  3ESW A;  3M4O I;  4A3K I;  1ML8 A;  5FLM I;  1DL6 A;  2B63 I;  2OOX B;  1Q81 2;  3CQZ I;  1YHQ 1;  1Q7Y 1;  2JA7 I;  2O53 A;  1M1K 1;  4DGL A;  3CC4 1;  3CC2 1;  3F3P C;  2F4O A;  1X0T A;  3CCL Z;  3GTL I;  1M1K 2;  2OOY B;  3CCQ Z;  2VPX A;  3VMI A;  4A3D I;  5T6B A;  2AYD A;  1VQ5 1;  4NBE A;  2VPZ A;  2E7Z A;  3CCU 1;  3EED A;  1YI2 Z;  2OTJ 1;  1VQ8 Z;  1QYP A;  2QKD A;  3G4S 1;  3NH8 A;  2K3R A;  4RVH A;  4XX2 A;  3GTM S;  2P3Y A;  1YIT 1;  1NP6 A;  4E32 A;  2KPI A;  1USP A;  5AN9 F;  2R92 I;  5A2Q b;  3RZO I;  2QEX 1;  3GKQ A;  2GU2 A;  2R6M A;  3CMA 1;  1KD1 1;  3CD6 1;  3M3Y I;  3S1M I;  3GTP I;  2E2J I;  1S72 Z;  1N8R 2;  3G6E Z;  2VUG A;  3IFU A;  3MZL B;  2JS4 A;  1QVF Y;  1VQL 1;  3IX0 A;  2QRD B;  3BG0 B;  2JIP A;  2YU9 I;  2V8I A;  3NFZ A;  1LQL A;  5LL6 f;  3CPW Z;  2J6A A;  2JIR A;  3HOX I;  1VQ7 1;  1YJ9 Z;  5IP9 I;  3CCL 1;  2V45 A;  3IR7 A;  5A2Q f;  1QVG Z;  3D2L A;  1X3Z A;  3S17 I;  4NBA A;  3CCQ 1;  2GTI A;  2QRE B;  4NBG A;  1ZB9 A;  2P28 A;  1ZB8 A;  1Z03 A;  3MZK B;  2QLV B;  1VQK Z;  3S16 I;  1YI2 1;  4E2W A;  2WAQ A;  2PM9 A;  2LIY A;  1SFO I;  2QRC B;  4RVF A;  2V8J A;  2Y0S A;  2NAP A;  1RO4 A;  1TWF I;  3GCF A;  3GTK I;  3HOU I;  3F3F C;  2IZ4 A;  2JIO A;  5T67 A;  3I55 1;  3JAM b;  3MON A;  3GTQ I;  1YIJ Z;  2VPY A;  2V3V A;  4NBC A;  1QVG Y;  1L1O C;  1Q81 1;  1RO0 A;  1S72 1;  3J80 b;  3G6E 1;  2JNY A;  3HOY I;  3S15 I;  2KI7 B;  3J81 b;  1S7M A;  1W2B Z;  4NFR A;  3G71 Z;  5IT9 b;  2I3C A;  1K83 I;  5CM2 M;  3IF8 A;  1VQO Z;  1YJ9 1;  2F4M A;  1YUA A;  2O4H A;  3JAM f;  4MH4 A;  4BBS I;  1PFT A;  1USP B;  1TWG I;  2H85 A;  2EGT A;  4S1T A;  4NBF A;  4RV9 A;  3J80 f;  3S1R I;  2NVT I;  3PO3 I;  3CCM Z;  1JJ2 Y;  3CCR Z;  3NDJ A;  3D9X A;  1QF8 A;  2VF1 A;  3HOV I;  3I56 Z;  2VUM I;  1VQ4 Z;  5IT9 f;  4Y7N I;  3RZD I;  2E2H I;  1N2F A;  2JA6 I;  1W2B Y;  3TE5 B;  2OTL Z;  3S2D I;  3CXC Z;  4NBH A;  2RT9 A;  1WII A;  1N8R 1;  3H0G I;  3S1Q I;  3BG1 B;  1YUK A;  4BBR I;  1YIJ 1;  1Q86 2;  3HOZ I;  1TWA I;  2NVY I;  3FQM A;  3KIF A;  1K8A 2;  2QA4 Z;  1K73 2;  4MRI A;  2V8K A;  2M48 A;  2IV2 X;  5D1P A;  1VLA A;  4MXU A;  1M90 2;  5D1O A;  3G71 1;  3S1N I;  3Q87 A;  5C3E I;  3CCV Z;  1VQO 1;  3P5J B;  3VMG A;  2JUB A;  4MON A;  1RLY A;  3CCS Z;  2NVX I;  1QXF A;  2JA5 I;  4TNU A;  2PMZ A;  4A3L I;  1WW9 A;  1NJI 1;  4E33 A;  4A3G I;  1TWC I;  3PO3 S;  3NH5 A;  1NJI 2;  3CCM 1;  4BXX I;  3EER A;  1VQ8 1;  3CCR 1;  2RHB A;  1I6H I;  3I56 1;  3GTG I;  1VQ4 1;  3CME Z;  4DK1 A;  3S14 I;  4MD9 A;  3FQQ A;  5FLX b;  1VQ5 Z;  4EWC A;  3K7A I;  3CCE Z;  2WB1 A;  2R7Z I;  1RNI A;  1KQS Z;  2OTL 1;  3QWU A;  1Y8C A;  2LFU A;  1K9M 2;  3CPW Y;  3VMH A;  4NB8 A;  2IZ3 A;  1YJW Z;  2BJO A;  1VQM Z;  2HU9 A;  2JR6 A;  4E30 A;  1ZH1 A;  5C44 I;  2QA4 1;  1YJN Z;  2NVQ I;  3NH4 A;  1TFI A;  2JMO A;  3U50 C;  5FLX f;  2M6N A;  3S2H I;  2Q4Z A;  2ZAE B;  3CD6 Z;  3CCV 1;  3CCS 1;  4A3M I;  4QTU A;  3H3V J;  1FDO A;  1KQS Y;  1VQL Z;  3I4N I;  1RO2 A;  1Y1V I;  1VQ9 Z;  1KC8 1;  3I4M I;  3I07 A;  3NDI A;  2PK7 A;  3D6W A;  1VQK 1;  3LUS A;  2HF1 A;  3J81 f;  3T4N B;  2RBL A;  1VQ7 Z;  4E2Z A;  3VB9 A;  4A3B I;  4Y52 I;  1KC8 2;  2VPW A;  1Q7Y 2;  3CME 1;  4A93 I;  4HGZ A;  5D1O B;  3CCE 1;  3OW2 Z;  3FKI I;  4MD7 A;  1Q86 1;  1QVF Z;  4A3J I;  2DE6 A;  2Q51 A;  3PO2 I;  3HOW I;  1VQN Z;  1I50 I;  1K8A 1;  1VQ6 Z;  3CCJ Z;  4RS4 A;  4A3C I;  1K73 1;  3CC7 Z;  1YJW 1;  1I3Q I;  1Q82 1;  4DQY B;  4A3F I;  1VQM 1;  4NBB A;  2RIQ A;  1M90 1;  4BY1 I;  2RPR A;  1Y1W I;  4CL1 A;  1YJN 1;  1Q82 2;  2K5R A;  1WCM I;  4NH1 C;  3I55 Z;  3HKZ A;  1X3W A;  1VQP Z;  4RVG A;  1Q16 A;  2JA8 I;  1Z02 A;  1RQF A;  4NBD A;  3GTJ I;  1KD1 2;  3OW2 Y;  1TWH I;  3CXC Y;  1Y1V S;  1YHQ Z;  2W04 A;  2LEX A;  1VQ9 1;  5C4J I;  3CC4 Z;  3CC2 Z;  1AA6 A;  2DE7 A;  2R93 I;  3VTN A;  1JWH C;  2YAD A;  3GTO I;  4X6A I;  2DE5 A;  4QTT A;  1WJ2 A;  4AYB A;  4A3I I;  1K9M 1;  3TDH B;  1KRL A;  5T64 A;  3CCU Z;  4MD8 A;  1P9N A;  1WZN A;  2OTJ Z;  1FDI A;  2QR1 B;  2GTH A;  2JIQ A;  3G4S Z;  2E9H A; 
#chains in the Genus database with same CATH homology
 1VQN 1;  4E31 A;  2W03 A;  1VQ6 1;  3CCJ 1;  1Z01 A;  3CC7 1;  2E2I I;  3J7A 4;  4BY7 I;  2G2K A;  4HGY A;  4E2Y A;  3GTM I;  1YIT Z;  5IP7 I;  4NB9 A;  1NUI A;  4E2X A;  2OZK A;  3KIH A;  5C4X I;  4NOZ A;  2QEX Z;  4RVD A;  3CMA Z;  1VQP 1;  1R9T I;  1JJ2 Z;  4HH4 A;  4A3E I;  2AKL A;  3ESW A;  3M4O I;  4A3K I;  1ML8 A;  5FLM I;  1DL6 A;  2B63 I;  2OOX B;  1Q81 2;  3CQZ I;  1YHQ 1;  1Q7Y 1;  2JA7 I;  2O53 A;  1M1K 1;  4DGL A;  3CC4 1;  3CC2 1;  3F3P C;  2F4O A;  1X0T A;  3CCL Z;  3GTL I;  1M1K 2;  2OOY B;  3CCQ Z;  3VMI A;  4A3D I;  5T6B A;  1VQ5 1;  4NBE A;  3CCU 1;  3EED A;  1YI2 Z;  2OTJ 1;  1VQ8 Z;  1QYP A;  2QKD A;  3G4S 1;  3NH8 A;  2K3R A;  4RVH A;  4XX2 A;  3GTM S;  2P3Y A;  1YIT 1;  1NP6 A;  4E32 A;  2KPI A;  1USP A;  5AN9 F;  2R92 I;  5A2Q b;  3RZO I;  2QEX 1;  3GKQ A;  2GU2 A;  2R6M A;  3CMA 1;  1KD1 1;  3CD6 1;  3M3Y I;  3S1M I;  3GTP I;  2E2J I;  1S72 Z;  1N8R 2;  3G6E Z;  2VUG A;  3IFU A;  3MZL B;  2JS4 A;  1QVF Y;  1VQL 1;  3IX0 A;  2QRD B;  3BG0 B;  2YU9 I;  2V8I A;  3NFZ A;  1LQL A;  5LL6 f;  3CPW Z;  2J6A A;  3HOX I;  1VQ7 1;  1YJ9 Z;  5IP9 I;  3CCL 1;  5A2Q f;  1QVG Z;  1X3Z A;  3S17 I;  4NBA A;  3CCQ 1;  2GTI A;  2QRE B;  4NBG A;  1ZB9 A;  2P28 A;  1ZB8 A;  1Z03 A;  3MZK B;  2QLV B;  1VQK Z;  3S16 I;  1YI2 1;  4E2W A;  2WAQ A;  2PM9 A;  2LIY A;  1SFO I;  2QRC B;  4RVF A;  2V8J A;  2Y0S A;  1RO4 A;  1TWF I;  3GCF A;  3GTK I;  3HOU I;  3F3F C;  2IZ4 A;  5T67 A;  3I55 1;  3JAM b;  3MON A;  3GTQ I;  1YIJ Z;  4NBC A;  1QVG Y;  1L1O C;  1Q81 1;  1RO0 A;  1S72 1;  3J80 b;  3G6E 1;  2JNY A;  3HOY I;  3S15 I;  2KI7 B;  3J81 b;  1S7M A;  1W2B Z;  4NFR A;  3G71 Z;  5IT9 b;  2I3C A;  1K83 I;  5CM2 M;  3IF8 A;  1VQO Z;  1YJ9 1;  2F4M A;  1YUA A;  2O4H A;  3JAM f;  4MH4 A;  4BBS I;  1PFT A;  1USP B;  1TWG I;  2H85 A;  2EGT A;  4S1T A;  4NBF A;  4RV9 A;  3J80 f;  3S1R I;  2NVT I;  3PO3 I;  3CCM Z;  1JJ2 Y;  3CCR Z;  3NDJ A;  3D9X A;  1QF8 A;  2VF1 A;  3HOV I;  3I56 Z;  2VUM I;  1VQ4 Z;  5IT9 f;  4Y7N I;  3RZD I;  2E2H I;  1N2F A;  2JA6 I;  1W2B Y;  3TE5 B;  2OTL Z;  3S2D I;  3CXC Z;  4NBH A;  2RT9 A;  1WII A;  1N8R 1;  3H0G I;  3S1Q I;  3BG1 B;  1YUK A;  4BBR I;  1YIJ 1;  1Q86 2;  3HOZ I;  1TWA I;  2NVY I;  3FQM A;  3KIF A;  1K8A 2;  2QA4 Z;  1K73 2;  4MRI A;  2V8K A;  2M48 A;  5D1P A;  1VLA A;  4MXU A;  1M90 2;  5D1O A;  3G71 1;  3S1N I;  3Q87 A;  5C3E I;  3CCV Z;  1VQO 1;  3P5J B;  3VMG A;  2JUB A;  4MON A;  1RLY A;  3CCS Z;  2NVX I;  2JA5 I;  4TNU A;  2PMZ A;  4A3L I;  1WW9 A;  1NJI 1;  4E33 A;  4A3G I;  1TWC I;  3PO3 S;  3NH5 A;  1NJI 2;  3CCM 1;  4BXX I;  3EER A;  1VQ8 1;  3CCR 1;  2RHB A;  1I6H I;  3I56 1;  3GTG I;  1VQ4 1;  3CME Z;  4DK1 A;  3S14 I;  4MD9 A;  3FQQ A;  5FLX b;  1VQ5 Z;  4EWC A;  3K7A I;  3CCE Z;  2WB1 A;  2R7Z I;  1RNI A;  1KQS Z;  2OTL 1;  3QWU A;  2LFU A;  1K9M 2;  3CPW Y;  3VMH A;  4NB8 A;  2IZ3 A;  1YJW Z;  2BJO A;  1VQM Z;  2HU9 A;  2JR6 A;  4E30 A;  1ZH1 A;  5C44 I;  2QA4 1;  1YJN Z;  2NVQ I;  3NH4 A;  1TFI A;  2JMO A;  3U50 C;  5FLX f;  2M6N A;  3S2H I;  2Q4Z A;  2ZAE B;  3CD6 Z;  3CCV 1;  3CCS 1;  4A3M I;  4QTU A;  3H3V J;  1KQS Y;  1VQL Z;  3I4N I;  1RO2 A;  1Y1V I;  1VQ9 Z;  1KC8 1;  3I4M I;  3I07 A;  3NDI A;  2PK7 A;  3D6W A;  1VQK 1;  3LUS A;  2HF1 A;  3J81 f;  3T4N B;  2RBL A;  1VQ7 Z;  4E2Z A;  3VB9 A;  4A3B I;  4Y52 I;  1KC8 2;  1Q7Y 2;  3CME 1;  4A93 I;  4HGZ A;  5D1O B;  3CCE 1;  3OW2 Z;  3FKI I;  4MD7 A;  1Q86 1;  1QVF Z;  4A3J I;  2DE6 A;  2Q51 A;  3PO2 I;  3HOW I;  1VQN Z;  1I50 I;  1K8A 1;  1VQ6 Z;  3CCJ Z;  4RS4 A;  4A3C I;  1K73 1;  3CC7 Z;  1YJW 1;  1I3Q I;  1Q82 1;  4DQY B;  4A3F I;  1VQM 1;  4NBB A;  2RIQ A;  1M90 1;  4BY1 I;  2RPR A;  1Y1W I;  4CL1 A;  1YJN 1;  1Q82 2;  2K5R A;  1WCM I;  4NH1 C;  3I55 Z;  3HKZ A;  1X3W A;  1VQP Z;  4RVG A;  2JA8 I;  1Z02 A;  1RQF A;  4NBD A;  3GTJ I;  1KD1 2;  3OW2 Y;  1TWH I;  3CXC Y;  1Y1V S;  1YHQ Z;  2W04 A;  1VQ9 1;  5C4J I;  3CC4 Z;  3CC2 Z;  2DE7 A;  2R93 I;  3VTN A;  1JWH C;  2YAD A;  3GTO I;  4X6A I;  2DE5 A;  4QTT A;  4AYB A;  4A3I I;  1K9M 1;  3TDH B;  1KRL A;  5T64 A;  3CCU Z;  4MD8 A;  1P9N A;  2OTJ Z;  2QR1 B;  2GTH A;  3G4S Z;  2E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...