3I56Z

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56Z00
1M901 1M902 3OW2Y 3OW2Z 1Q821 1VQL1 1Q822 1VQ8Z 3CXCY 3CXCZ 3I56Z 1VQM1 3CCU1 1VQ4Z 3CCJ1 1Q862 1YHQZ 3CCLZ 1K9M1 1K9M2 1S721 3I55Z 1YIT1 2QA4Z 3CC41 1KD11 1KD12 1VQ61 1Q7Y1 3CD61 3CCRZ 1QVFY 1QVFZ 1K731 2OTLZ 1KC81 3CMAZ 1VQPZ 1KC82 3CCS1 3G71Z 1W2BY 1W2BZ 1VQ81 1VQ51 3CC2Z 1YIJZ 3I561 3G4S1 1YJ9Z 1JJ2Y 1JJ2Z 3CC71 1VQ41 1Q811 1Q812 1YHQ1 1Q861 1VQOZ 3I551 2QA41 3CCVZ 3CCR1 2OTJZ 3CC7Z 3CCEZ 1VQ7Z 3CCQZ 3CMA1 1VQKZ 1K8A2 1YJWZ 3G711 2QEXZ 3CC21 1NJI1 3G6EZ 1NJI2 1YJ91 3CMEZ 1VQ9Z 1KQSY 1KQSZ 3CCL1 1VQO1 1YITZ 3CCMZ 3CPWY 1VQ6Z 3CPWZ 1YJNZ 1VQNZ 1N8R1 1N8R2 2OTJ1 3CCE1 1YI2Z 1VQ71 3CCQ1 2OTL1 1VQK1 3CCSZ 1VQP1 1YJW1 1K8A1 2QEX1 1VQLZ 1VQ5Z 3G4SZ 3G6E1 1YIJ1 3CME1 1VQMZ 3CCUZ 1VQ91 3CCJZ 1S72Z 1M1K1 3CCM1 1M1K2 1YJN1 1VQN1 3CC4Z 1QVGY 1Q7Y2 1QVGZ 3CCV1 3CD6Z 1K732 1YI21
chains in the Genus database with same CATH superfamily
4NBBA 3PO3S 4E33A 3FKII 1M901 3OW2Y 4QTTA 4NB9A 4BY1I 1VQL1 1VQ8Z 3CXCZ 2NVTI 1USPA 2E2HI 1ZB8A 3NDIA 3EERA 1Z01A 2JR6A 5IP7I 2HU9A 1JWHC 1NUIA 2F4MA 3GTLI 3CC41 3P5JB 3GTMI 2V8JA 4MRIA 2V8KA 5FLXf 1K731 4RVHA 3CQZI 3EEDA 1KC82 3KIFA 1RLYA 2K5RA 1P9NA 2OZKA 1RNIA 4MONA 1JJ2Z 1Q811 1Q861 1QYPA 3JAMb 2JIOA 1QXFA 2H85A 3GTJI 4NBAA 2W03A 3J81f 5CM2M 2GTIA 5A2Qf 1SFOI 3CCR1 2R7ZI 3PO3I 2VPWA 3I4NI 2E2JI 2V3VA 1K8A2 5C44I 1YJWZ 1FDIA 3KIHA 4Y52I 2F4OA 3CC21 4NOZA 4A3KI 4RV9A 1YJ91 3CMEZ 5AN9F 5C4XI 1VQ9Z 3S16I 1AA6A 3VTNA 4NH1C 3RZDI 2Q51A 4XX2A 3CCL1 1S7MA 3CPWY 3TDHB 1VQ6Z 1YJNZ 4BXXI 1VQNZ 4MXUA 1N8R2 1ZH1A 1VQ71 3CCQ1 2OTL1 1VQK1 1VQ5Z 1ML8A 3K7AI 1I6HI 3S2HI 3CCUZ 3HOVI 4A93I 3LUSA 1PFTA 4BBSI 1S72Z 4MD8A 3HOXI 1QVGZ 3CCV1 2QLVB 4RVFA 3GTPI 2JNYA 3S1MI 3CC71 4DK1A 2EGTA 4MH4A 3OW2Z 1Q822 4MD9A 2K3RA 2E9HA 4QTUA 3IR7A 1NP6A 1VQ4Z 4HGYA 1YHQZ 2V8IA 1K9M2 3I07A 5D1OB 2QA4Z 1KD12 5IT9b 3CD61 2OOXB 2LEXA 1YUAA 4A3JI 2R93I 1KC81 1VQPZ 3CCS1 4NBGA 3H3VJ 1VQ81 3NFZA 1YIJZ 3JAMf 2BJOA 5T6BA 2LIYA 2P3YA 4NB8A 2KI7B 2V45A 4MD7A 3GTKI 2QRDB 2IZ3A 2M48A 2E7ZA 4NBHA 3MONA 3MZLB 3MZKB 3T4NB 3HKZA 2JIMA 2QEXZ 3NH5A 2JA6I 4A3LI 2PMZA 4BY7I 3G6EZ 1NJI2 1Z02A 5IP9I 2PK7A 4A3II 3IFUA 2R92I 3VMHA 1KQSY 4E2ZA 3BG1B 3Q87A 3NH4A 5T64A 2JA8I 3CPWZ 1RO4A 3FQMA 2JIRA 1N8R1 3M4OI 3S1NI 4NFRA 1YI2Z 5D1PA 4A3DI 2VPYA 1LQLA 1YJW1 4E32A 4A3FI 2B63I 3CME1 1VQMZ 2QKDA 1VQ91 2M6NA 3S17I 3CCJZ 1WJ2A 1DL6A 2O53A 2JMOA 3F3FC 2NVYI 1YJN1 1VQN1 3RZOI 1Y8CA 1K732 2VUGA 1I3QI 4AYBA 1K83I 3S15I 1TFIA 1Q821 5FLXb 3IF8A 3HOZI 3I56Z 1WZNA 1WW9A 3CCU1 1Q862 5IT9f 3CCLZ 4NBCA 1K9M1 1S721 3I55Z 1RO2A 3NDJA 3HOUI 1YIT1 2JUBA 2JS4A 1KD11 1TWCI 1Q7Y1 1QVFY 2OTLZ 4DGLA 3CMAZ 2VPZA 1WIIA 2LFUA 3G71Z 1W2BY 1USPB 1TWFI 3G4S1 5T67A 2YU9I 1VQ41 1SIWA 1YHQ1 4HGZA 1VQOZ 4Y7NI 3VMIA 2QA41 5C3EI 3CCVZ 2JIPA 3GTOI 3J7A4 2OTJZ 3CC7Z 2I3CA 2ZAEB 3CCEZ 2WAQA 3D9XA 3S1RI 1Y1VS 2W04A 4A3GI 3VMGA 1L1OC 1NJI1 2RPRA 3GKQA 4NBDA 1RO0A 2WB1A 2GU2A 1KQSZ 1Q16A 2JA5I 4TNUA 3CCMZ 3GTQI 4NBFA 2E2II 1TWAI 3CCSZ 1RQFA 1K8A1 1I50I 2QEX1 2RBLA 1VQLZ 3VB9A 2VUMI 3M3YI 1FDOA 2GTHA 5C4JI 3G6E1 2KPIA 5LL6f 2VPXA 2IV2X 3HOYI 4RVDA 1M1K2 3J80b 5D1OA 3CC4Z 2IZ4A 1YI21 1Y1VI 2OOYB 1M902 3S2DI 4NBEA 3CXCY 4E30A 4S1TA 3I4MI 1VQM1 4RVGA 3CCJ1 3ESWA 2AKLA 3IX0A 1ZB9A 4RS4A 2HF1A 1VQ61 3F3PC 4HH4A 4A3EI 3CCRZ 3S14I 1QVFZ 3HOWI 4A3MI 2RT9A 2RHBA 2Y0SA 2DE7A 2PM9A 2O4HA 2VF1A 1W2BZ 1VQ51 3CC2Z 2QREB 3I561 2NAPA 1TWGI 1YJ9Z 3H0GI 4BBRI 1JJ2Y 1YUKA 1N2FA 1Q812 1Z03A 3I551 2RIQA 2QR1B 2J6AA 2JA7I 3PO2I 2R6MA 4E31A 4X6AI 3J81b 2QRCB 2Q4ZA 3CCQZ 1VQ7Z 3GTGI 3CMA1 1VQKZ 5A2Qb 1WCMI 2YADA 3D2LA 4E2WA 4DQYB 1KRLA 3G711 1X3WA 1VLAA 4EWCA 2AYDA 3NH8A 3U50C 5FLMI 1VQO1 1YITZ 2P28A 3S1QI 4A3CI 1TWHI 3BG0B 3GTMS 2OTJ1 3CCE1 2G2KA 1X3ZA 3QWUA 1VQP1 4E2XA 2JIQA 3G4SZ 1X0TA 1QF8A 1YIJ1 3FQQA 3J80f 3D6WA 2NVXI 4CL1A 1R9TI 4E2YA 2DE6A 1M1K1 3CCM1 1QVGY 1Q7Y2 1Y1WI 3CD6Z 3GCFA 3TE5B 2DE5A 4A3BI 2NVQI
chains in the Genus database with same CATH topology
4NBBA 3PO3S 4E33A 3FKII 1M901 3OW2Y 4QTTA 4NB9A 4BY1I 1VQL1 1VQ8Z 3CXCZ 2NVTI 1USPA 2E2HI 1ZB8A 3NDIA 3EERA 1Z01A 2JR6A 5IP7I 2HU9A 1JWHC 1NUIA 2F4MA 3GTLI 3CC41 3P5JB 3GTMI 2V8JA 4MRIA 2V8KA 5FLXf 1K731 4RVHA 3CQZI 3EEDA 1KC82 3KIFA 1RLYA 2K5RA 1P9NA 2OZKA 1RNIA 4MONA 1JJ2Z 1Q811 1Q861 1QYPA 3JAMb 2H85A 3GTJI 4NBAA 2W03A 3J81f 5CM2M 2GTIA 5A2Qf 1SFOI 3CCR1 2R7ZI 3PO3I 3I4NI 2E2JI 1K8A2 5C44I 1YJWZ 3KIHA 4Y52I 2F4OA 3CC21 4NOZA 4A3KI 4RV9A 1YJ91 3CMEZ 5AN9F 5C4XI 1VQ9Z 3S16I 3VTNA 4NH1C 3RZDI 2Q51A 4XX2A 3CCL1 1S7MA 3CPWY 3TDHB 1VQ6Z 1YJNZ 4BXXI 1VQNZ 4MXUA 1N8R2 1ZH1A 1VQ71 3CCQ1 2OTL1 1VQK1 1VQ5Z 1ML8A 3K7AI 1I6HI 3S2HI 3CCUZ 3HOVI 4A93I 3LUSA 1PFTA 4BBSI 1S72Z 4MD8A 3HOXI 1QVGZ 3CCV1 2QLVB 4RVFA 3GTPI 2JNYA 3S1MI 3CC71 4DK1A 2EGTA 4MH4A 3OW2Z 1Q822 4MD9A 2K3RA 2E9HA 4QTUA 1VQ4Z 1NP6A 4HGYA 1YHQZ 2V8IA 1K9M2 3I07A 5D1OB 2QA4Z 1KD12 5IT9b 3CD61 2OOXB 1YUAA 4A3JI 2R93I 1KC81 1VQPZ 3CCS1 4NBGA 3H3VJ 1VQ81 3NFZA 1YIJZ 3JAMf 2BJOA 5T6BA 2LIYA 2P3YA 4NB8A 2KI7B 4MD7A 3GTKI 2QRDB 2IZ3A 2M48A 4NBHA 3MONA 3MZLB 3MZKB 3T4NB 3HKZA 2QEXZ 3NH5A 2JA6I 4A3LI 2PMZA 4BY7I 3G6EZ 1NJI2 1Z02A 5IP9I 2PK7A 4A3II 3IFUA 2R92I 3VMHA 1KQSY 4E2ZA 3BG1B 3Q87A 3NH4A 5T64A 2JA8I 3CPWZ 1RO4A 3FQMA 1N8R1 3M4OI 3S1NI 4NFRA 1YI2Z 5D1PA 4A3DI 1LQLA 1YJW1 4E32A 4A3FI 2B63I 3CME1 1VQMZ 2QKDA 1VQ91 2M6NA 3S17I 3CCJZ 1DL6A 2O53A 2JMOA 3F3FC 2NVYI 1YJN1 1VQN1 3RZOI 1K732 2VUGA 1I3QI 4AYBA 1K83I 3S15I 1TFIA 1Q821 5FLXb 3IF8A 3HOZI 3I56Z 1WW9A 3CCU1 1Q862 5IT9f 3CCLZ 4NBCA 1K9M1 1S721 3I55Z 1RO2A 3NDJA 3HOUI 1YIT1 2JUBA 2JS4A 1KD11 1TWCI 1Q7Y1 1QVFY 2OTLZ 4DGLA 3CMAZ 1WIIA 2LFUA 3G71Z 1W2BY 1USPB 1TWFI 3G4S1 5T67A 2YU9I 1VQ41 1YHQ1 4HGZA 1VQOZ 4Y7NI 3VMIA 2QA41 5C3EI 3CCVZ 3GTOI 3J7A4 2OTJZ 3CC7Z 2I3CA 2ZAEB 3CCEZ 2WAQA 3D9XA 3S1RI 1Y1VS 2W04A 4A3GI 3VMGA 1L1OC 1NJI1 2RPRA 3GKQA 4NBDA 1RO0A 2WB1A 2GU2A 1KQSZ 2JA5I 4TNUA 3CCMZ 3GTQI 4NBFA 2E2II 1TWAI 3CCSZ 1RQFA 1K8A1 1I50I 2QEX1 2RBLA 1VQLZ 3VB9A 2VUMI 3M3YI 2GTHA 5C4JI 3G6E1 2KPIA 5LL6f 3HOYI 4RVDA 1M1K2 3J80b 5D1OA 3CC4Z 2IZ4A 1YI21 1Y1VI 2OOYB 1M902 3S2DI 4NBEA 3CXCY 4E30A 4S1TA 3I4MI 1VQM1 4RVGA 3CCJ1 3ESWA 2AKLA 3IX0A 1ZB9A 4RS4A 2HF1A 1VQ61 3F3PC 4HH4A 4A3EI 3CCRZ 3S14I 1QVFZ 3HOWI 4A3MI 2RT9A 2RHBA 2Y0SA 2DE7A 2PM9A 2O4HA 2VF1A 1W2BZ 1VQ51 3CC2Z 2QREB 3I561 1TWGI 1YJ9Z 3H0GI 4BBRI 1JJ2Y 1YUKA 1N2FA 1Q812 1Z03A 3I551 2RIQA 2QR1B 2J6AA 2JA7I 3PO2I 2R6MA 4E31A 4X6AI 3J81b 2QRCB 2Q4ZA 3CCQZ 1VQ7Z 3GTGI 3CMA1 1VQKZ 5A2Qb 1WCMI 2YADA 4E2WA 4DQYB 1KRLA 3G711 1X3WA 1VLAA 4EWCA 3NH8A 3U50C 5FLMI 1VQO1 1YITZ 2P28A 3S1QI 4A3CI 1TWHI 3BG0B 3GTMS 2OTJ1 3CCE1 2G2KA 1X3ZA 3QWUA 1VQP1 4E2XA 3G4SZ 1X0TA 1QF8A 1YIJ1 3FQQA 3J80f 3D6WA 2NVXI 4CL1A 1R9TI 4E2YA 2DE6A 1M1K1 3CCM1 1QVGY 1Q7Y2 1Y1WI 3CD6Z 3GCFA 3TE5B 2DE5A 4A3BI 2NVQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 1;  1M90 2;  3OW2 Y;  3OW2 Z;  1Q82 1;  1VQL 1;  1Q82 2;  1VQ8 Z;  3CXC Y;  3CXC Z;  3I56 Z;  1VQM 1;  3CCU 1;  1VQ4 Z;  3CCJ 1;  1Q86 2;  1YHQ Z;  3CCL Z;  1K9M 1;  1K9M 2;  1S72 1;  3I55 Z;  1YIT 1;  2QA4 Z;  3CC4 1;  1KD1 1;  1KD1 2;  1VQ6 1;  1Q7Y 1;  3CD6 1;  3CCR Z;  1QVF Y;  1QVF Z;  1K73 1;  2OTL Z;  1KC8 1;  3CMA Z;  1VQP Z;  1KC8 2;  3CCS 1;  3G71 Z;  1W2B Y;  1W2B Z;  1VQ8 1;  1VQ5 1;  3CC2 Z;  1YIJ Z;  3I56 1;  3G4S 1;  1YJ9 Z;  1JJ2 Y;  1JJ2 Z;  3CC7 1;  1VQ4 1;  1Q81 1;  1Q81 2;  1YHQ 1;  1Q86 1;  1VQO Z;  3I55 1;  2QA4 1;  3CCV Z;  3CCR 1;  2OTJ Z;  3CC7 Z;  3CCE Z;  1VQ7 Z;  3CCQ Z;  3CMA 1;  1VQK Z;  1K8A 2;  1YJW Z;  3G71 1;  2QEX Z;  3CC2 1;  1NJI 1;  3G6E Z;  1NJI 2;  1YJ9 1;  3CME Z;  1VQ9 Z;  1KQS Y;  1KQS Z;  3CCL 1;  1VQO 1;  1YIT Z;  3CCM Z;  3CPW Y;  1VQ6 Z;  3CPW Z;  1YJN Z;  1VQN Z;  1N8R 1;  1N8R 2;  2OTJ 1;  3CCE 1;  1YI2 Z;  1VQ7 1;  3CCQ 1;  2OTL 1;  1VQK 1;  3CCS Z;  1VQP 1;  1YJW 1;  1K8A 1;  2QEX 1;  1VQL Z;  1VQ5 Z;  3G4S Z;  3G6E 1;  1YIJ 1;  3CME 1;  1VQM Z;  3CCU Z;  1VQ9 1;  3CCJ Z;  1S72 Z;  1M1K 1;  3CCM 1;  1M1K 2;  1YJN 1;  1VQN 1;  3CC4 Z;  1QVG Y;  1Q7Y 2;  1QVG Z;  3CCV 1;  3CD6 Z;  1K73 2;  1YI2 1; 
#chains in the Genus database with same CATH topology
 4NBB A;  3PO3 S;  4E33 A;  3FKI I;  1M90 1;  3OW2 Y;  4QTT A;  4NB9 A;  4BY1 I;  1VQL 1;  1VQ8 Z;  3CXC Z;  2NVT I;  1USP A;  2E2H I;  1ZB8 A;  3NDI A;  3EER A;  1Z01 A;  2JR6 A;  5IP7 I;  2HU9 A;  1JWH C;  1NUI A;  2F4M A;  3GTL I;  3CC4 1;  3P5J B;  3GTM I;  2V8J A;  4MRI A;  2V8K A;  5FLX f;  1K73 1;  4RVH A;  3CQZ I;  3EED A;  1KC8 2;  3KIF A;  1RLY A;  2K5R A;  1P9N A;  2OZK A;  1RNI A;  4MON A;  1JJ2 Z;  1Q81 1;  1Q86 1;  1QYP A;  3JAM b;  2JIO A;  1QXF A;  2H85 A;  3GTJ I;  4NBA A;  2W03 A;  3J81 f;  5CM2 M;  2GTI A;  5A2Q f;  1SFO I;  3CCR 1;  2R7Z I;  3PO3 I;  2VPW A;  3I4N I;  2E2J I;  2V3V A;  1K8A 2;  5C44 I;  1YJW Z;  1FDI A;  3KIH A;  4Y52 I;  2F4O A;  3CC2 1;  4NOZ A;  4A3K I;  4RV9 A;  1YJ9 1;  3CME Z;  5AN9 F;  5C4X I;  1VQ9 Z;  3S16 I;  1AA6 A;  3VTN A;  4NH1 C;  3RZD I;  2Q51 A;  4XX2 A;  3CCL 1;  1S7M A;  3CPW Y;  3TDH B;  1VQ6 Z;  1YJN Z;  4BXX I;  1VQN Z;  4MXU A;  1N8R 2;  1ZH1 A;  1VQ7 1;  3CCQ 1;  2OTL 1;  1VQK 1;  1VQ5 Z;  1ML8 A;  3K7A I;  1I6H I;  3S2H I;  3CCU Z;  3HOV I;  4A93 I;  3LUS A;  1PFT A;  4BBS I;  1S72 Z;  4MD8 A;  3HOX I;  1QVG Z;  3CCV 1;  2QLV B;  4RVF A;  3GTP I;  2JNY A;  3S1M I;  3CC7 1;  4DK1 A;  2EGT A;  4MH4 A;  3OW2 Z;  1Q82 2;  4MD9 A;  2K3R A;  2E9H A;  4QTU A;  3IR7 A;  1NP6 A;  1VQ4 Z;  4HGY A;  1YHQ Z;  2V8I A;  1K9M 2;  3I07 A;  5D1O B;  2QA4 Z;  1KD1 2;  5IT9 b;  3CD6 1;  2OOX B;  2LEX A;  1YUA A;  4A3J I;  2R93 I;  1KC8 1;  1VQP Z;  3CCS 1;  4NBG A;  3H3V J;  1VQ8 1;  3NFZ A;  1YIJ Z;  3JAM f;  2BJO A;  5T6B A;  2LIY A;  2P3Y A;  4NB8 A;  2KI7 B;  2V45 A;  4MD7 A;  3GTK I;  2QRD B;  2IZ3 A;  2M48 A;  2E7Z A;  4NBH A;  3MON A;  3MZL B;  3MZK B;  3T4N B;  3HKZ A;  2JIM A;  2QEX Z;  3NH5 A;  2JA6 I;  4A3L I;  2PMZ A;  4BY7 I;  3G6E Z;  1NJI 2;  1Z02 A;  5IP9 I;  2PK7 A;  4A3I I;  3IFU A;  2R92 I;  3VMH A;  1KQS Y;  4E2Z A;  3BG1 B;  3Q87 A;  3NH4 A;  5T64 A;  2JA8 I;  3CPW Z;  1RO4 A;  3FQM A;  2JIR A;  1N8R 1;  3M4O I;  3S1N I;  4NFR A;  1YI2 Z;  5D1P A;  4A3D I;  2VPY A;  1LQL A;  1YJW 1;  4E32 A;  4A3F I;  2B63 I;  3CME 1;  1VQM Z;  2QKD A;  1VQ9 1;  2M6N A;  3S17 I;  3CCJ Z;  1WJ2 A;  1DL6 A;  2O53 A;  2JMO A;  3F3F C;  2NVY I;  1YJN 1;  1VQN 1;  3RZO I;  1Y8C A;  1K73 2;  2VUG A;  1I3Q I;  4AYB A;  1K83 I;  3S15 I;  1TFI A;  1Q82 1;  5FLX b;  3IF8 A;  3HOZ I;  3I56 Z;  1WZN A;  1WW9 A;  3CCU 1;  1Q86 2;  5IT9 f;  3CCL Z;  4NBC A;  1K9M 1;  1S72 1;  3I55 Z;  1RO2 A;  3NDJ A;  3HOU I;  1YIT 1;  2JUB A;  2JS4 A;  1KD1 1;  1TWC I;  1Q7Y 1;  1QVF Y;  2OTL Z;  4DGL A;  3CMA Z;  2VPZ A;  1WII A;  2LFU A;  3G71 Z;  1W2B Y;  1USP B;  1TWF I;  3G4S 1;  5T67 A;  2YU9 I;  1VQ4 1;  1SIW A;  1YHQ 1;  4HGZ A;  1VQO Z;  4Y7N I;  3VMI A;  2QA4 1;  5C3E I;  3CCV Z;  2JIP A;  3GTO I;  3J7A 4;  2OTJ Z;  3CC7 Z;  2I3C A;  2ZAE B;  3CCE Z;  2WAQ A;  3D9X A;  3S1R I;  1Y1V S;  2W04 A;  4A3G I;  3VMG A;  1L1O C;  1NJI 1;  2RPR A;  3GKQ A;  4NBD A;  1RO0 A;  2WB1 A;  2GU2 A;  1KQS Z;  1Q16 A;  2JA5 I;  4TNU A;  3CCM Z;  3GTQ I;  4NBF A;  2E2I I;  1TWA I;  3CCS Z;  1RQF A;  1K8A 1;  1I50 I;  2QEX 1;  2RBL A;  1VQL Z;  3VB9 A;  2VUM I;  3M3Y I;  1FDO A;  2GTH A;  5C4J I;  3G6E 1;  2KPI A;  5LL6 f;  2VPX A;  2IV2 X;  3HOY I;  4RVD A;  1M1K 2;  3J80 b;  5D1O A;  3CC4 Z;  2IZ4 A;  1YI2 1;  1Y1V I;  2OOY B;  1M90 2;  3S2D I;  4NBE A;  3CXC Y;  4E30 A;  4S1T A;  3I4M I;  1VQM 1;  4RVG A;  3CCJ 1;  3ESW A;  2AKL A;  3IX0 A;  1ZB9 A;  4RS4 A;  2HF1 A;  1VQ6 1;  3F3P C;  4HH4 A;  4A3E I;  3CCR Z;  3S14 I;  1QVF Z;  3HOW I;  4A3M I;  2RT9 A;  2RHB A;  2Y0S A;  2DE7 A;  2PM9 A;  2O4H A;  2VF1 A;  1W2B Z;  1VQ5 1;  3CC2 Z;  2QRE B;  3I56 1;  2NAP A;  1TWG I;  1YJ9 Z;  3H0G I;  4BBR I;  1JJ2 Y;  1YUK A;  1N2F A;  1Q81 2;  1Z03 A;  3I55 1;  2RIQ A;  2QR1 B;  2J6A A;  2JA7 I;  3PO2 I;  2R6M A;  4E31 A;  4X6A I;  3J81 b;  2QRC B;  2Q4Z A;  3CCQ Z;  1VQ7 Z;  3GTG I;  3CMA 1;  1VQK Z;  5A2Q b;  1WCM I;  2YAD A;  3D2L A;  4E2W A;  4DQY B;  1KRL A;  3G71 1;  1X3W A;  1VLA A;  4EWC A;  2AYD A;  3NH8 A;  3U50 C;  5FLM I;  1VQO 1;  1YIT Z;  2P28 A;  3S1Q I;  4A3C I;  1TWH I;  3BG0 B;  3GTM S;  2OTJ 1;  3CCE 1;  2G2K A;  1X3Z A;  3QWU A;  1VQP 1;  4E2X A;  2JIQ A;  3G4S Z;  1X0T A;  1QF8 A;  1YIJ 1;  3FQQ A;  3J80 f;  3D6W A;  2NVX I;  4CL1 A;  1R9T I;  4E2Y A;  2DE6 A;  1M1K 1;  3CCM 1;  1QVG Y;  1Q7Y 2;  1Y1W I;  3CD6 Z;  3GCF A;  3TE5 B;  2DE5 A;  4A3B I;  2NVQ I; 
#chains in the Genus database with same CATH homology
 4NBB A;  3PO3 S;  4E33 A;  3FKI I;  1M90 1;  3OW2 Y;  4QTT A;  4NB9 A;  4BY1 I;  1VQL 1;  1VQ8 Z;  3CXC Z;  2NVT I;  1USP A;  2E2H I;  1ZB8 A;  3NDI A;  3EER A;  1Z01 A;  2JR6 A;  5IP7 I;  2HU9 A;  1JWH C;  1NUI A;  2F4M A;  3GTL I;  3CC4 1;  3P5J B;  3GTM I;  2V8J A;  4MRI A;  2V8K A;  5FLX f;  1K73 1;  4RVH A;  3CQZ I;  3EED A;  1KC8 2;  3KIF A;  1RLY A;  2K5R A;  1P9N A;  2OZK A;  1RNI A;  4MON A;  1JJ2 Z;  1Q81 1;  1Q86 1;  1QYP A;  3JAM b;  2H85 A;  3GTJ I;  4NBA A;  2W03 A;  3J81 f;  5CM2 M;  2GTI A;  5A2Q f;  1SFO I;  3CCR 1;  2R7Z I;  3PO3 I;  3I4N I;  2E2J I;  1K8A 2;  5C44 I;  1YJW Z;  3KIH A;  4Y52 I;  2F4O A;  3CC2 1;  4NOZ A;  4A3K I;  4RV9 A;  1YJ9 1;  3CME Z;  5AN9 F;  5C4X I;  1VQ9 Z;  3S16 I;  3VTN A;  4NH1 C;  3RZD I;  2Q51 A;  4XX2 A;  3CCL 1;  1S7M A;  3CPW Y;  3TDH B;  1VQ6 Z;  1YJN Z;  4BXX I;  1VQN Z;  4MXU A;  1N8R 2;  1ZH1 A;  1VQ7 1;  3CCQ 1;  2OTL 1;  1VQK 1;  1VQ5 Z;  1ML8 A;  3K7A I;  1I6H I;  3S2H I;  3CCU Z;  3HOV I;  4A93 I;  3LUS A;  1PFT A;  4BBS I;  1S72 Z;  4MD8 A;  3HOX I;  1QVG Z;  3CCV 1;  2QLV B;  4RVF A;  3GTP I;  2JNY A;  3S1M I;  3CC7 1;  4DK1 A;  2EGT A;  4MH4 A;  3OW2 Z;  1Q82 2;  4MD9 A;  2K3R A;  2E9H A;  4QTU A;  1VQ4 Z;  1NP6 A;  4HGY A;  1YHQ Z;  2V8I A;  1K9M 2;  3I07 A;  5D1O B;  2QA4 Z;  1KD1 2;  5IT9 b;  3CD6 1;  2OOX B;  1YUA A;  4A3J I;  2R93 I;  1KC8 1;  1VQP Z;  3CCS 1;  4NBG A;  3H3V J;  1VQ8 1;  3NFZ A;  1YIJ Z;  3JAM f;  2BJO A;  5T6B A;  2LIY A;  2P3Y A;  4NB8 A;  2KI7 B;  4MD7 A;  3GTK I;  2QRD B;  2IZ3 A;  2M48 A;  4NBH A;  3MON A;  3MZL B;  3MZK B;  3T4N B;  3HKZ A;  2QEX Z;  3NH5 A;  2JA6 I;  4A3L I;  2PMZ A;  4BY7 I;  3G6E Z;  1NJI 2;  1Z02 A;  5IP9 I;  2PK7 A;  4A3I I;  3IFU A;  2R92 I;  3VMH A;  1KQS Y;  4E2Z A;  3BG1 B;  3Q87 A;  3NH4 A;  5T64 A;  2JA8 I;  3CPW Z;  1RO4 A;  3FQM A;  1N8R 1;  3M4O I;  3S1N I;  4NFR A;  1YI2 Z;  5D1P A;  4A3D I;  1LQL A;  1YJW 1;  4E32 A;  4A3F I;  2B63 I;  3CME 1;  1VQM Z;  2QKD A;  1VQ9 1;  2M6N A;  3S17 I;  3CCJ Z;  1DL6 A;  2O53 A;  2JMO A;  3F3F C;  2NVY I;  1YJN 1;  1VQN 1;  3RZO I;  1K73 2;  2VUG A;  1I3Q I;  4AYB A;  1K83 I;  3S15 I;  1TFI A;  1Q82 1;  5FLX b;  3IF8 A;  3HOZ I;  3I56 Z;  1WW9 A;  3CCU 1;  1Q86 2;  5IT9 f;  3CCL Z;  4NBC A;  1K9M 1;  1S72 1;  3I55 Z;  1RO2 A;  3NDJ A;  3HOU I;  1YIT 1;  2JUB A;  2JS4 A;  1KD1 1;  1TWC I;  1Q7Y 1;  1QVF Y;  2OTL Z;  4DGL A;  3CMA Z;  1WII A;  2LFU A;  3G71 Z;  1W2B Y;  1USP B;  1TWF I;  3G4S 1;  5T67 A;  2YU9 I;  1VQ4 1;  1YHQ 1;  4HGZ A;  1VQO Z;  4Y7N I;  3VMI A;  2QA4 1;  5C3E I;  3CCV Z;  3GTO I;  3J7A 4;  2OTJ Z;  3CC7 Z;  2I3C A;  2ZAE B;  3CCE Z;  2WAQ A;  3D9X A;  3S1R I;  1Y1V S;  2W04 A;  4A3G I;  3VMG A;  1L1O C;  1NJI 1;  2RPR A;  3GKQ A;  4NBD A;  1RO0 A;  2WB1 A;  2GU2 A;  1KQS Z;  2JA5 I;  4TNU A;  3CCM Z;  3GTQ I;  4NBF A;  2E2I I;  1TWA I;  3CCS Z;  1RQF A;  1K8A 1;  1I50 I;  2QEX 1;  2RBL A;  1VQL Z;  3VB9 A;  2VUM I;  3M3Y I;  2GTH A;  5C4J I;  3G6E 1;  2KPI A;  5LL6 f;  3HOY I;  4RVD A;  1M1K 2;  3J80 b;  5D1O A;  3CC4 Z;  2IZ4 A;  1YI2 1;  1Y1V I;  2OOY B;  1M90 2;  3S2D I;  4NBE A;  3CXC Y;  4E30 A;  4S1T A;  3I4M I;  1VQM 1;  4RVG A;  3CCJ 1;  3ESW A;  2AKL A;  3IX0 A;  1ZB9 A;  4RS4 A;  2HF1 A;  1VQ6 1;  3F3P C;  4HH4 A;  4A3E I;  3CCR Z;  3S14 I;  1QVF Z;  3HOW I;  4A3M I;  2RT9 A;  2RHB A;  2Y0S A;  2DE7 A;  2PM9 A;  2O4H A;  2VF1 A;  1W2B Z;  1VQ5 1;  3CC2 Z;  2QRE B;  3I56 1;  1TWG I;  1YJ9 Z;  3H0G I;  4BBR I;  1JJ2 Y;  1YUK A;  1N2F A;  1Q81 2;  1Z03 A;  3I55 1;  2RIQ A;  2QR1 B;  2J6A A;  2JA7 I;  3PO2 I;  2R6M A;  4E31 A;  4X6A I;  3J81 b;  2QRC B;  2Q4Z A;  3CCQ Z;  1VQ7 Z;  3GTG I;  3CMA 1;  1VQK Z;  5A2Q b;  1WCM I;  2YAD A;  4E2W A;  4DQY B;  1KRL A;  3G71 1;  1X3W A;  1VLA A;  4EWC A;  3NH8 A;  3U50 C;  5FLM I;  1VQO 1;  1YIT Z;  2P28 A;  3S1Q I;  4A3C I;  1TWH I;  3BG0 B;  3GTM S;  2OTJ 1;  3CCE 1;  2G2K A;  1X3Z A;  3QWU A;  1VQP 1;  4E2X A;  3G4S Z;  1X0T A;  1QF8 A;  1YIJ 1;  3FQQ A;  3J80 f;  3D6W A;  2NVX I;  4CL1 A;  1R9T I;  4E2Y A;  2DE6 A;  1M1K 1;  3CCM 1;  1QVG Y;  1Q7Y 2;  1Y1W I;  3CD6 Z;  3GCF A;  3TE5 B;  2DE5 A;  4A3B I;  2NVQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...