3I56Z

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56Z00
1YJWZ 1KC82 1YHQZ 3CC2Z 3CC41 1Q862 3CCU1 3CCJ1 1JJ2Z 1VQN1 3I56Z 3CD61 3CCVZ 3CCM1 3G4S1 3CCSZ 1QVFZ 3CCL1 3CCEZ 1VQM1 3I561 3CCV1 3I551 1W2BY 1VQO1 1YI21 1M901 3CCE1 1KQSZ 1VQ61 2QA4Z 1VQL1 1VQ5Z 1M1K1 3CPWZ 1VQ4Z 1K731 3G6EZ 1YITZ 2QA41 2OTJZ 1YJW1 1YHQ1 1NJI1 3CC21 1N8R1 3G6E1 2QEXZ 3CCRZ 3CXCZ 2OTJ1 3CCS1 3CMAZ 1YIJZ 1K732 1Q811 1QVGZ 1VQ8Z 1JJ2Y 1VQ9Z 1NJI2 1N8R2 3OW2Z 1YIJ1 3CCQZ 1QVFY 1YJNZ 1YJ9Z 1VQ91 1M902 1S72Z 1VQ7Z 1Q812 1KC81 3G71Z 1VQ51 1QVGY 1VQPZ 1VQ41 1YIT1 1KQSY 1K8A1 1M1K2 2OTLZ 3G711 1VQP1 1W2BZ 3CPWY 2QEX1 3G4SZ 1K9M1 3CCR1 1VQKZ 3CC7Z 1KD11 3CCLZ 2OTL1 3CMA1 1VQMZ 1VQ81 3CMEZ 3I55Z 1K8A2 1VQK1 1Q7Y1 3CC71 1VQOZ 1YI2Z 3CXCY 1Q821 3CCQ1 1K9M2 1YJN1 3CME1 1KD12 1YJ91 1VQ6Z 1Q861 1S721 1VQLZ 1VQ71 3OW2Y 1Q7Y2 3CC4Z 3CCUZ 3CCJZ 1VQNZ 3CD6Z 1Q822 3CCMZ
chains in the Genus database with same CATH superfamily
1YJWZ 3GTOI 4NB9A 4A3EI 3CCU1 3CCJ1 1YUKA 2E2II 3TE5B 2JUBA 2JA7I 2RIQA 4MRIA 2VUMI 1QVFZ 4EWCA 2NVTI 3J80b 3CCEZ 3H3VJ 2RPRA 3I561 3CCV1 3I551 3CQZI 5T64A 3S2HI 3BG0B 3IR7A 1X0TA 2F4OA 1KQSZ 2QA4Z 2QLVB 1ZB8A 2M48A 5IP9I 3S14I 4E33A 1M1K1 3P5JB 3CPWZ 2QRCB 2NVXI 1Z01A 2W03A 3NH4A 3FQQA 1YJW1 1R9TI 3PO3S 2NVYI 2LFUA 1YIJZ 1QVGZ 1VQ8Z 5FLXf 4NB8A 2JIQA 3M4OI 2V8JA 4E2ZA 2P28A 2NAPA 1I3QI 1YJ9Z 2JMOA 1DL6A 2VPYA 1S72Z 1VQ7Z 4MONA 1KC81 1QVGY 2QKDA 3GTKI 1VQPZ 2VPWA 1K8A1 1VQKZ 3VTNA 3G4SZ 3CC7Z 3CCLZ 4NFRA 4HGZA 1VQMZ 1VQ81 3CMEZ 1VQOZ 1YI2Z 2E7ZA 3CXCY 1TWHI 4HGYA 3VMGA 2PM9A 1K9M2 2JIMA 2JA8I 3F3FC 1KD12 1RO2A 5T6BA 1YJ91 4XX2A 3S1RI 1VQ6Z 1S721 2NVQI 1VQ71 3FKII 2QREB 1WJ2A 3CCUZ 4HH4A 3CCJZ 1N2FA 1Q822 1RLYA 2G2KA 1JJ2Z 3I56Z 1WIIA 3CCVZ 3JAMb 3G4S1 5IT9b 3CCSZ 3GCFA 3CCL1 1SIWA 2PK7A 1VQM1 2JS4A 3EEDA 1VQO1 3T4NB 1YI21 1M901 1ZH1A 1Y1VS 2Y0SA 2VUGA 2R93I 3Q87A 3J7A4 4S1TA 1VQ61 1USPA 3U50C 1WW9A 2RHBA 1VQ4Z 1K731 2KPIA 1RO4A 4E2WA 1N8R1 4MH4A 3HOWI 1RO0A 1LQLA 1YUAA 2OZKA 3ESWA 3CCRZ 4MD8A 3EERA 1TFIA 2OTJ1 5AN9F 3CCS1 1Q811 2IZ4A 4RVFA 5D1PA 2IV2X 3NFZA 2E9HA 5FLMI 3GTGI 1TWGI 3TDHB 4A3FI 4NBHA 1WCMI 3OW2Z 1QVFY 1RQFA 2BJOA 1QXFA 4AYBA 1VQ91 2PMZA 3RZDI 3MONA 2O53A 3KIHA 1I50I 3S2DI 3GTQI 1X3WA 3GTMS 1VQ41 2E2HI 4X6AI 2LIYA 1X3ZA 2E2JI 1KQSY 2B63I 1W2BZ 3CPWY 3KIFA 3CCR1 2O4HA 2OTL1 1FDOA 1USPB 1Y1VI 1Y8CA 1K8A2 1I6HI 2JA5I 4DGLA 4BXXI 1VLAA 3BG1B 5FLXb 4E32A 4NBCA 1Q861 2JA6I 5CM2M 2JIPA 3HOUI 1L1OC 1NUIA 4A3II 4RVGA 1QYPA 2WAQA 3K7AI 3CC2Z 3CC41 1Z02A 4NBBA 5C44I 2DE7A 2H85A 3CD61 1TWAI 3FQMA 4DQYB 1ML8A 1S7MA 5D1OB 3H0GI 4MD7A 3IFUA 2GTHA 4NBFA 3S1QI 2Q51A 2RT9A 3PO3I 2Q4ZA 3IF8A 4BBRI 1VQ5Z 1Z03A 4A3KI 2DE6A 1YITZ 4TNUA 4E2XA 2OTJZ 1TWFI 2WB1A 3I07A 1NJI1 3HOXI 4NOZA 3CC21 2GTIA 3QWUA 3G6E1 1K83I 4NBDA 5A2Qf 3HOZI 1K732 1SFOI 3J81f 4NH1C 1JJ2Y 2V8IA 5C4JI 1VQ9Z 1N8R2 2QRDB 4A3LI 3HOVI 3D6WA 4RVHA 1Q812 2V45A 3S1NI 4A93I 2I3CA 4A3DI 1FDIA 1VQ51 5C4XI 4A3CI 3MZKB 1YIT1 2GU2A 4A3JI 1M1K2 2OTLZ 3G711 4NBAA 3J80f 3MZLB 2JIRA 4NBGA 1QF8A 4BY7I 4A3MI 2V3VA 2K3RA 1Q7Y1 5D1OA 1P9NA 4Y52I 1KRLA 3PO2I 1VQLZ 3I4MI 3OW2Y 3CC4Z 1RNIA 2AYDA 2JR6A 3CD6Z 4DK1A 2OOXB 1KC82 1YHQZ 5LL6f 4E30A 3VMHA 1Q862 1VQN1 2LEXA 2QR1B 3CCM1 2HF1A 1JWHC 2EGTA 2YADA 4BY1I 1W2BY 4RVDA 3S17I 1WZNA 4RV9A 4A3GI 3CCE1 3VMIA 2JNYA 1TWCI 3S15I 4RS4A 3D2LA 1VQL1 1Q16A 3NDJA 4MXUA 2HU9A 1ZB9A 3G6EZ 3VB9A 2QA41 3GTPI 1AA6A 1YHQ1 2F4MA 1PFTA 3I4NI 3S16I 2IZ3A 2QEXZ 3CXCZ 3CMAZ 3LUSA 2M6NA 3GTMI 1NJI2 2R7ZI 2JIOA 2P3YA 1YIJ1 3GKQA 3NDIA 3CCQZ 2RBLA 3D9XA 1YJNZ 3HOYI 2OOYB 5IP7I 3HKZA 1M902 2KI7B 2K5RA 2W04A 3NH8A 3G71Z 4QTTA 2VPXA 5T67A 3S1MI 3M3YI 3JAMf 2R6MA 4A3BI 2ZAEB 5IT9f 3RZOI 2DE5A 4BBSI 1VQP1 2R92I 2QEX1 1K9M1 3GTLI 4E2YA 1KD11 3IX0A 2VPZA 3CMA1 5C3EI 4CL1A 3F3PC 3I55Z 1VQK1 2VF1A 1NP6A 2AKLA 3CC71 5A2Qb 1Q821 2V8KA 4MD9A 2J6AA 3CCQ1 4NBEA 3J81b 2YU9I 1YJN1 3CME1 1Y1WI 3GTJI 3NH5A 1Q7Y2 4QTUA 1VQNZ 4Y7NI 4E31A 3CCMZ
chains in the Genus database with same CATH topology
1YJWZ 3GTOI 4NB9A 4A3EI 3CCU1 3CCJ1 1YUKA 2E2II 3TE5B 2JUBA 2JA7I 2RIQA 4MRIA 2VUMI 1QVFZ 4EWCA 2NVTI 3J80b 3CCEZ 3H3VJ 2RPRA 3I561 3CCV1 3I551 3CQZI 5T64A 3S2HI 3BG0B 1X0TA 2F4OA 1KQSZ 2QA4Z 2QLVB 1ZB8A 2M48A 5IP9I 3S14I 4E33A 1M1K1 3P5JB 3CPWZ 2QRCB 2NVXI 1Z01A 2W03A 3NH4A 3FQQA 1YJW1 1R9TI 3PO3S 2NVYI 2LFUA 1YIJZ 1QVGZ 1VQ8Z 5FLXf 4NB8A 3M4OI 2V8JA 4E2ZA 2P28A 1I3QI 1YJ9Z 2JMOA 1DL6A 1S72Z 1VQ7Z 4MONA 1KC81 1QVGY 2QKDA 3GTKI 1VQPZ 1K8A1 1VQKZ 3VTNA 3G4SZ 3CC7Z 3CCLZ 4NFRA 4HGZA 1VQMZ 1VQ81 3CMEZ 1VQOZ 1YI2Z 3CXCY 1TWHI 4HGYA 3VMGA 2PM9A 1K9M2 2JA8I 3F3FC 1KD12 1RO2A 5T6BA 1YJ91 4XX2A 3S1RI 1VQ6Z 1S721 2NVQI 1VQ71 3FKII 2QREB 3CCUZ 4HH4A 3CCJZ 1N2FA 1Q822 1RLYA 2G2KA 1JJ2Z 3I56Z 1WIIA 3CCVZ 3JAMb 3G4S1 5IT9b 3CCSZ 3GCFA 3CCL1 2PK7A 1VQM1 2JS4A 3EEDA 1VQO1 3T4NB 1YI21 1M901 1ZH1A 1Y1VS 2Y0SA 2VUGA 2R93I 3Q87A 3J7A4 4S1TA 1VQ61 1USPA 3U50C 1WW9A 2RHBA 1VQ4Z 1K731 2KPIA 1RO4A 4E2WA 1N8R1 4MH4A 3HOWI 1RO0A 1LQLA 1YUAA 2OZKA 3ESWA 3CCRZ 4MD8A 3EERA 1TFIA 2OTJ1 5AN9F 3CCS1 1Q811 2IZ4A 4RVFA 5D1PA 3NFZA 2E9HA 5FLMI 3GTGI 1TWGI 3TDHB 4A3FI 4NBHA 1WCMI 3OW2Z 1QVFY 1RQFA 2BJOA 4AYBA 1VQ91 2PMZA 3RZDI 3MONA 2O53A 3KIHA 1I50I 3S2DI 3GTQI 1X3WA 3GTMS 1VQ41 2E2HI 4X6AI 2LIYA 1X3ZA 2E2JI 1KQSY 2B63I 1W2BZ 3CPWY 3KIFA 3CCR1 2O4HA 2OTL1 1USPB 1Y1VI 1K8A2 1I6HI 2JA5I 4DGLA 4BXXI 1VLAA 3BG1B 5FLXb 4E32A 4NBCA 1Q861 2JA6I 5CM2M 3HOUI 1L1OC 1NUIA 4A3II 4RVGA 1QYPA 2WAQA 3K7AI 3CC2Z 3CC41 1Z02A 4NBBA 5C44I 2DE7A 2H85A 3CD61 1TWAI 3FQMA 4DQYB 1ML8A 1S7MA 5D1OB 3H0GI 4MD7A 3IFUA 2GTHA 4NBFA 3S1QI 2Q51A 2RT9A 3PO3I 2Q4ZA 3IF8A 4BBRI 1VQ5Z 1Z03A 4A3KI 2DE6A 1YITZ 4TNUA 4E2XA 2OTJZ 1TWFI 2WB1A 3I07A 1NJI1 3HOXI 4NOZA 3CC21 2GTIA 3QWUA 3G6E1 1K83I 4NBDA 5A2Qf 3HOZI 1K732 1SFOI 3J81f 4NH1C 1JJ2Y 2V8IA 5C4JI 1VQ9Z 1N8R2 2QRDB 4A3LI 3HOVI 3D6WA 4RVHA 1Q812 3S1NI 4A93I 2I3CA 4A3DI 1VQ51 5C4XI 4A3CI 3MZKB 1YIT1 2GU2A 4A3JI 1M1K2 2OTLZ 3G711 4NBAA 3J80f 3MZLB 4NBGA 1QF8A 4BY7I 4A3MI 2K3RA 1Q7Y1 5D1OA 1P9NA 4Y52I 1KRLA 3PO2I 1VQLZ 3I4MI 3OW2Y 3CC4Z 1RNIA 2JR6A 3CD6Z 4DK1A 2OOXB 1KC82 1YHQZ 5LL6f 4E30A 3VMHA 1Q862 1VQN1 2QR1B 3CCM1 2HF1A 1JWHC 2EGTA 2YADA 4BY1I 1W2BY 4RVDA 3S17I 4RV9A 4A3GI 3CCE1 3VMIA 2JNYA 1TWCI 3S15I 4RS4A 1VQL1 3NDJA 4MXUA 2HU9A 1ZB9A 3G6EZ 3VB9A 2QA41 3GTPI 1YHQ1 2F4MA 1PFTA 3I4NI 3S16I 2IZ3A 2QEXZ 3CXCZ 3CMAZ 3LUSA 2M6NA 3GTMI 1NJI2 2R7ZI 2P3YA 1YIJ1 3GKQA 3NDIA 3CCQZ 2RBLA 3D9XA 1YJNZ 3HOYI 2OOYB 5IP7I 3HKZA 1M902 2KI7B 2K5RA 2W04A 3NH8A 3G71Z 4QTTA 5T67A 3S1MI 3M3YI 3JAMf 2R6MA 4A3BI 2ZAEB 5IT9f 3RZOI 2DE5A 4BBSI 1VQP1 2R92I 2QEX1 1K9M1 3GTLI 4E2YA 1KD11 3IX0A 3CMA1 5C3EI 4CL1A 3F3PC 3I55Z 1VQK1 2VF1A 1NP6A 2AKLA 3CC71 5A2Qb 1Q821 2V8KA 4MD9A 2J6AA 3J81b 4NBEA 3CCQ1 2YU9I 1YJN1 3CME1 1Y1WI 3GTJI 3NH5A 1Q7Y2 4QTUA 1VQNZ 4Y7NI 4E31A 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Z;  1KC8 2;  1YHQ Z;  3CC2 Z;  3CC4 1;  1Q86 2;  3CCU 1;  3CCJ 1;  1JJ2 Z;  1VQN 1;  3I56 Z;  3CD6 1;  3CCV Z;  3CCM 1;  3G4S 1;  3CCS Z;  1QVF Z;  3CCL 1;  3CCE Z;  1VQM 1;  3I56 1;  3CCV 1;  3I55 1;  1W2B Y;  1VQO 1;  1YI2 1;  1M90 1;  3CCE 1;  1KQS Z;  1VQ6 1;  2QA4 Z;  1VQL 1;  1VQ5 Z;  1M1K 1;  3CPW Z;  1VQ4 Z;  1K73 1;  3G6E Z;  1YIT Z;  2QA4 1;  2OTJ Z;  1YJW 1;  1YHQ 1;  1NJI 1;  3CC2 1;  1N8R 1;  3G6E 1;  2QEX Z;  3CCR Z;  3CXC Z;  2OTJ 1;  3CCS 1;  3CMA Z;  1YIJ Z;  1K73 2;  1Q81 1;  1QVG Z;  1VQ8 Z;  1JJ2 Y;  1VQ9 Z;  1NJI 2;  1N8R 2;  3OW2 Z;  1YIJ 1;  3CCQ Z;  1QVF Y;  1YJN Z;  1YJ9 Z;  1VQ9 1;  1M90 2;  1S72 Z;  1VQ7 Z;  1Q81 2;  1KC8 1;  3G71 Z;  1VQ5 1;  1QVG Y;  1VQP Z;  1VQ4 1;  1YIT 1;  1KQS Y;  1K8A 1;  1M1K 2;  2OTL Z;  3G71 1;  1VQP 1;  1W2B Z;  3CPW Y;  2QEX 1;  3G4S Z;  1K9M 1;  3CCR 1;  1VQK Z;  3CC7 Z;  1KD1 1;  3CCL Z;  2OTL 1;  3CMA 1;  1VQM Z;  1VQ8 1;  3CME Z;  3I55 Z;  1K8A 2;  1VQK 1;  1Q7Y 1;  3CC7 1;  1VQO Z;  1YI2 Z;  3CXC Y;  1Q82 1;  3CCQ 1;  1K9M 2;  1YJN 1;  3CME 1;  1KD1 2;  1YJ9 1;  1VQ6 Z;  1Q86 1;  1S72 1;  1VQL Z;  1VQ7 1;  3OW2 Y;  1Q7Y 2;  3CC4 Z;  3CCU Z;  3CCJ Z;  1VQN Z;  3CD6 Z;  1Q82 2;  3CCM Z; 
#chains in the Genus database with same CATH topology
 1YJW Z;  3GTO I;  4NB9 A;  4A3E I;  3CCU 1;  3CCJ 1;  1YUK A;  2E2I I;  3TE5 B;  2JUB A;  2JA7 I;  2RIQ A;  4MRI A;  2VUM I;  1QVF Z;  4EWC A;  2NVT I;  3J80 b;  3CCE Z;  3H3V J;  2RPR A;  3I56 1;  3CCV 1;  3I55 1;  3CQZ I;  5T64 A;  3S2H I;  3BG0 B;  3IR7 A;  1X0T A;  2F4O A;  1KQS Z;  2QA4 Z;  2QLV B;  1ZB8 A;  2M48 A;  5IP9 I;  3S14 I;  4E33 A;  1M1K 1;  3P5J B;  3CPW Z;  2QRC B;  2NVX I;  1Z01 A;  2W03 A;  3NH4 A;  3FQQ A;  1YJW 1;  1R9T I;  3PO3 S;  2NVY I;  2LFU A;  1YIJ Z;  1QVG Z;  1VQ8 Z;  5FLX f;  4NB8 A;  2JIQ A;  3M4O I;  2V8J A;  4E2Z A;  2P28 A;  2NAP A;  1I3Q I;  1YJ9 Z;  2JMO A;  1DL6 A;  2VPY A;  1S72 Z;  1VQ7 Z;  4MON A;  1KC8 1;  1QVG Y;  2QKD A;  3GTK I;  1VQP Z;  2VPW A;  1K8A 1;  1VQK Z;  3VTN A;  3G4S Z;  3CC7 Z;  3CCL Z;  4NFR A;  4HGZ A;  1VQM Z;  1VQ8 1;  3CME Z;  1VQO Z;  1YI2 Z;  2E7Z A;  3CXC Y;  1TWH I;  4HGY A;  3VMG A;  2PM9 A;  1K9M 2;  2JIM A;  2JA8 I;  3F3F C;  1KD1 2;  1RO2 A;  5T6B A;  1YJ9 1;  4XX2 A;  3S1R I;  1VQ6 Z;  1S72 1;  2NVQ I;  1VQ7 1;  3FKI I;  2QRE B;  1WJ2 A;  3CCU Z;  4HH4 A;  3CCJ Z;  1N2F A;  1Q82 2;  1RLY A;  2G2K A;  1JJ2 Z;  3I56 Z;  1WII A;  3CCV Z;  3JAM b;  3G4S 1;  5IT9 b;  3CCS Z;  3GCF A;  3CCL 1;  1SIW A;  2PK7 A;  1VQM 1;  2JS4 A;  3EED A;  1VQO 1;  3T4N B;  1YI2 1;  1M90 1;  1ZH1 A;  1Y1V S;  2Y0S A;  2VUG A;  2R93 I;  3Q87 A;  3J7A 4;  4S1T A;  1VQ6 1;  1USP A;  3U50 C;  1WW9 A;  2RHB A;  1VQ4 Z;  1K73 1;  2KPI A;  1RO4 A;  4E2W A;  1N8R 1;  4MH4 A;  3HOW I;  1RO0 A;  1LQL A;  1YUA A;  2OZK A;  3ESW A;  3CCR Z;  4MD8 A;  3EER A;  1TFI A;  2OTJ 1;  5AN9 F;  3CCS 1;  1Q81 1;  2IZ4 A;  4RVF A;  5D1P A;  2IV2 X;  3NFZ A;  2E9H A;  5FLM I;  3GTG I;  1TWG I;  3TDH B;  4A3F I;  4NBH A;  1WCM I;  3OW2 Z;  1QVF Y;  1RQF A;  2BJO A;  1QXF A;  4AYB A;  1VQ9 1;  2PMZ A;  3RZD I;  3MON A;  2O53 A;  3KIH A;  1I50 I;  3S2D I;  3GTQ I;  1X3W A;  3GTM S;  1VQ4 1;  2E2H I;  4X6A I;  2LIY A;  1X3Z A;  2E2J I;  1KQS Y;  2B63 I;  1W2B Z;  3CPW Y;  3KIF A;  3CCR 1;  2O4H A;  2OTL 1;  1FDO A;  1USP B;  1Y1V I;  1Y8C A;  1K8A 2;  1I6H I;  2JA5 I;  4DGL A;  4BXX I;  1VLA A;  3BG1 B;  5FLX b;  4E32 A;  4NBC A;  1Q86 1;  2JA6 I;  5CM2 M;  2JIP A;  3HOU I;  1L1O C;  1NUI A;  4A3I I;  4RVG A;  1QYP A;  2WAQ A;  3K7A I;  3CC2 Z;  3CC4 1;  1Z02 A;  4NBB A;  5C44 I;  2DE7 A;  2H85 A;  3CD6 1;  1TWA I;  3FQM A;  4DQY B;  1ML8 A;  1S7M A;  5D1O B;  3H0G I;  4MD7 A;  3IFU A;  2GTH A;  4NBF A;  3S1Q I;  2Q51 A;  2RT9 A;  3PO3 I;  2Q4Z A;  3IF8 A;  4BBR I;  1VQ5 Z;  1Z03 A;  4A3K I;  2DE6 A;  1YIT Z;  4TNU A;  4E2X A;  2OTJ Z;  1TWF I;  2WB1 A;  3I07 A;  1NJI 1;  3HOX I;  4NOZ A;  3CC2 1;  2GTI A;  3QWU A;  3G6E 1;  1K83 I;  4NBD A;  5A2Q f;  3HOZ I;  1K73 2;  1SFO I;  3J81 f;  4NH1 C;  1JJ2 Y;  2V8I A;  5C4J I;  1VQ9 Z;  1N8R 2;  2QRD B;  4A3L I;  3HOV I;  3D6W A;  4RVH A;  1Q81 2;  2V45 A;  3S1N I;  4A93 I;  2I3C A;  4A3D I;  1FDI A;  1VQ5 1;  5C4X I;  4A3C I;  3MZK B;  1YIT 1;  2GU2 A;  4A3J I;  1M1K 2;  2OTL Z;  3G71 1;  4NBA A;  3J80 f;  3MZL B;  2JIR A;  4NBG A;  1QF8 A;  4BY7 I;  4A3M I;  2V3V A;  2K3R A;  1Q7Y 1;  5D1O A;  1P9N A;  4Y52 I;  1KRL A;  3PO2 I;  1VQL Z;  3I4M I;  3OW2 Y;  3CC4 Z;  1RNI A;  2AYD A;  2JR6 A;  3CD6 Z;  4DK1 A;  2OOX B;  1KC8 2;  1YHQ Z;  5LL6 f;  4E30 A;  3VMH A;  1Q86 2;  1VQN 1;  2LEX A;  2QR1 B;  3CCM 1;  2HF1 A;  1JWH C;  2EGT A;  2YAD A;  4BY1 I;  1W2B Y;  4RVD A;  3S17 I;  1WZN A;  4RV9 A;  4A3G I;  3CCE 1;  3VMI A;  2JNY A;  1TWC I;  3S15 I;  4RS4 A;  3D2L A;  1VQL 1;  1Q16 A;  3NDJ A;  4MXU A;  2HU9 A;  1ZB9 A;  3G6E Z;  3VB9 A;  2QA4 1;  3GTP I;  1AA6 A;  1YHQ 1;  2F4M A;  1PFT A;  3I4N I;  3S16 I;  2IZ3 A;  2QEX Z;  3CXC Z;  3CMA Z;  3LUS A;  2M6N A;  3GTM I;  1NJI 2;  2R7Z I;  2JIO A;  2P3Y A;  1YIJ 1;  3GKQ A;  3NDI A;  3CCQ Z;  2RBL A;  3D9X A;  1YJN Z;  3HOY I;  2OOY B;  5IP7 I;  3HKZ A;  1M90 2;  2KI7 B;  2K5R A;  2W04 A;  3NH8 A;  3G71 Z;  4QTT A;  2VPX A;  5T67 A;  3S1M I;  3M3Y I;  3JAM f;  2R6M A;  4A3B I;  2ZAE B;  5IT9 f;  3RZO I;  2DE5 A;  4BBS I;  1VQP 1;  2R92 I;  2QEX 1;  1K9M 1;  3GTL I;  4E2Y A;  1KD1 1;  3IX0 A;  2VPZ A;  3CMA 1;  5C3E I;  4CL1 A;  3F3P C;  3I55 Z;  1VQK 1;  2VF1 A;  1NP6 A;  2AKL A;  3CC7 1;  5A2Q b;  1Q82 1;  2V8K A;  4MD9 A;  2J6A A;  3CCQ 1;  4NBE A;  3J81 b;  2YU9 I;  1YJN 1;  3CME 1;  1Y1W I;  3GTJ I;  3NH5 A;  1Q7Y 2;  4QTU A;  1VQN Z;  4Y7N I;  4E31 A;  3CCM Z; 
#chains in the Genus database with same CATH homology
 1YJW Z;  3GTO I;  4NB9 A;  4A3E I;  3CCU 1;  3CCJ 1;  1YUK A;  2E2I I;  3TE5 B;  2JUB A;  2JA7 I;  2RIQ A;  4MRI A;  2VUM I;  1QVF Z;  4EWC A;  2NVT I;  3J80 b;  3CCE Z;  3H3V J;  2RPR A;  3I56 1;  3CCV 1;  3I55 1;  3CQZ I;  5T64 A;  3S2H I;  3BG0 B;  1X0T A;  2F4O A;  1KQS Z;  2QA4 Z;  2QLV B;  1ZB8 A;  2M48 A;  5IP9 I;  3S14 I;  4E33 A;  1M1K 1;  3P5J B;  3CPW Z;  2QRC B;  2NVX I;  1Z01 A;  2W03 A;  3NH4 A;  3FQQ A;  1YJW 1;  1R9T I;  3PO3 S;  2NVY I;  2LFU A;  1YIJ Z;  1QVG Z;  1VQ8 Z;  5FLX f;  4NB8 A;  3M4O I;  2V8J A;  4E2Z A;  2P28 A;  1I3Q I;  1YJ9 Z;  2JMO A;  1DL6 A;  1S72 Z;  1VQ7 Z;  4MON A;  1KC8 1;  1QVG Y;  2QKD A;  3GTK I;  1VQP Z;  1K8A 1;  1VQK Z;  3VTN A;  3G4S Z;  3CC7 Z;  3CCL Z;  4NFR A;  4HGZ A;  1VQM Z;  1VQ8 1;  3CME Z;  1VQO Z;  1YI2 Z;  3CXC Y;  1TWH I;  4HGY A;  3VMG A;  2PM9 A;  1K9M 2;  2JA8 I;  3F3F C;  1KD1 2;  1RO2 A;  5T6B A;  1YJ9 1;  4XX2 A;  3S1R I;  1VQ6 Z;  1S72 1;  2NVQ I;  1VQ7 1;  3FKI I;  2QRE B;  3CCU Z;  4HH4 A;  3CCJ Z;  1N2F A;  1Q82 2;  1RLY A;  2G2K A;  1JJ2 Z;  3I56 Z;  1WII A;  3CCV Z;  3JAM b;  3G4S 1;  5IT9 b;  3CCS Z;  3GCF A;  3CCL 1;  2PK7 A;  1VQM 1;  2JS4 A;  3EED A;  1VQO 1;  3T4N B;  1YI2 1;  1M90 1;  1ZH1 A;  1Y1V S;  2Y0S A;  2VUG A;  2R93 I;  3Q87 A;  3J7A 4;  4S1T A;  1VQ6 1;  1USP A;  3U50 C;  1WW9 A;  2RHB A;  1VQ4 Z;  1K73 1;  2KPI A;  1RO4 A;  4E2W A;  1N8R 1;  4MH4 A;  3HOW I;  1RO0 A;  1LQL A;  1YUA A;  2OZK A;  3ESW A;  3CCR Z;  4MD8 A;  3EER A;  1TFI A;  2OTJ 1;  5AN9 F;  3CCS 1;  1Q81 1;  2IZ4 A;  4RVF A;  5D1P A;  3NFZ A;  2E9H A;  5FLM I;  3GTG I;  1TWG I;  3TDH B;  4A3F I;  4NBH A;  1WCM I;  3OW2 Z;  1QVF Y;  1RQF A;  2BJO A;  4AYB A;  1VQ9 1;  2PMZ A;  3RZD I;  3MON A;  2O53 A;  3KIH A;  1I50 I;  3S2D I;  3GTQ I;  1X3W A;  3GTM S;  1VQ4 1;  2E2H I;  4X6A I;  2LIY A;  1X3Z A;  2E2J I;  1KQS Y;  2B63 I;  1W2B Z;  3CPW Y;  3KIF A;  3CCR 1;  2O4H A;  2OTL 1;  1USP B;  1Y1V I;  1K8A 2;  1I6H I;  2JA5 I;  4DGL A;  4BXX I;  1VLA A;  3BG1 B;  5FLX b;  4E32 A;  4NBC A;  1Q86 1;  2JA6 I;  5CM2 M;  3HOU I;  1L1O C;  1NUI A;  4A3I I;  4RVG A;  1QYP A;  2WAQ A;  3K7A I;  3CC2 Z;  3CC4 1;  1Z02 A;  4NBB A;  5C44 I;  2DE7 A;  2H85 A;  3CD6 1;  1TWA I;  3FQM A;  4DQY B;  1ML8 A;  1S7M A;  5D1O B;  3H0G I;  4MD7 A;  3IFU A;  2GTH A;  4NBF A;  3S1Q I;  2Q51 A;  2RT9 A;  3PO3 I;  2Q4Z A;  3IF8 A;  4BBR I;  1VQ5 Z;  1Z03 A;  4A3K I;  2DE6 A;  1YIT Z;  4TNU A;  4E2X A;  2OTJ Z;  1TWF I;  2WB1 A;  3I07 A;  1NJI 1;  3HOX I;  4NOZ A;  3CC2 1;  2GTI A;  3QWU A;  3G6E 1;  1K83 I;  4NBD A;  5A2Q f;  3HOZ I;  1K73 2;  1SFO I;  3J81 f;  4NH1 C;  1JJ2 Y;  2V8I A;  5C4J I;  1VQ9 Z;  1N8R 2;  2QRD B;  4A3L I;  3HOV I;  3D6W A;  4RVH A;  1Q81 2;  3S1N I;  4A93 I;  2I3C A;  4A3D I;  1VQ5 1;  5C4X I;  4A3C I;  3MZK B;  1YIT 1;  2GU2 A;  4A3J I;  1M1K 2;  2OTL Z;  3G71 1;  4NBA A;  3J80 f;  3MZL B;  4NBG A;  1QF8 A;  4BY7 I;  4A3M I;  2K3R A;  1Q7Y 1;  5D1O A;  1P9N A;  4Y52 I;  1KRL A;  3PO2 I;  1VQL Z;  3I4M I;  3OW2 Y;  3CC4 Z;  1RNI A;  2JR6 A;  3CD6 Z;  4DK1 A;  2OOX B;  1KC8 2;  1YHQ Z;  5LL6 f;  4E30 A;  3VMH A;  1Q86 2;  1VQN 1;  2QR1 B;  3CCM 1;  2HF1 A;  1JWH C;  2EGT A;  2YAD A;  4BY1 I;  1W2B Y;  4RVD A;  3S17 I;  4RV9 A;  4A3G I;  3CCE 1;  3VMI A;  2JNY A;  1TWC I;  3S15 I;  4RS4 A;  1VQL 1;  3NDJ A;  4MXU A;  2HU9 A;  1ZB9 A;  3G6E Z;  3VB9 A;  2QA4 1;  3GTP I;  1YHQ 1;  2F4M A;  1PFT A;  3I4N I;  3S16 I;  2IZ3 A;  2QEX Z;  3CXC Z;  3CMA Z;  3LUS A;  2M6N A;  3GTM I;  1NJI 2;  2R7Z I;  2P3Y A;  1YIJ 1;  3GKQ A;  3NDI A;  3CCQ Z;  2RBL A;  3D9X A;  1YJN Z;  3HOY I;  2OOY B;  5IP7 I;  3HKZ A;  1M90 2;  2KI7 B;  2K5R A;  2W04 A;  3NH8 A;  3G71 Z;  4QTT A;  5T67 A;  3S1M I;  3M3Y I;  3JAM f;  2R6M A;  4A3B I;  2ZAE B;  5IT9 f;  3RZO I;  2DE5 A;  4BBS I;  1VQP 1;  2R92 I;  2QEX 1;  1K9M 1;  3GTL I;  4E2Y A;  1KD1 1;  3IX0 A;  3CMA 1;  5C3E I;  4CL1 A;  3F3P C;  3I55 Z;  1VQK 1;  2VF1 A;  1NP6 A;  2AKL A;  3CC7 1;  5A2Q b;  1Q82 1;  2V8K A;  4MD9 A;  2J6A A;  3J81 b;  4NBE A;  3CCQ 1;  2YU9 I;  1YJN 1;  3CME 1;  1Y1W I;  3GTJ I;  3NH5 A;  1Q7Y 2;  4QTU A;  1VQN Z;  4Y7N I;  4E31 A;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...