3I561

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome/antibiotic
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56100
2OTJZ 3CCQZ 1YJWZ 1N8R1 3G6E1 1Q812 1YIJZ 1VQOZ 1VQL1 3G4SZ 3CCE1 1VQ41 2QEXZ 3CME1 3CCLZ 1VQKZ 1VQ6Z 3CC41 1YIT1 3CPWY 1VQ91 1YHQZ 1VQ7Z 1M1K2 1KQSY 3CCS1 1QVFY 2OTLZ 1YJ9Z 3CC71 1K732 3CC2Z 3CXCY 1VQPZ 1K9M1 3CCUZ 1VQ8Z 1YJW1 3CCRZ 3CCJ1 3CMAZ 2QA41 1YJN1 1Q862 3CCVZ 1K8A2 1VQO1 1QVGZ 3G4S1 1YI2Z 2QEX1 1M902 3CCMZ 1S72Z 1VQK1 1VQ61 3I561 3OW2Y 1YHQ1 3CD6Z 1VQ71 1NJI1 1W2BZ 2OTL1 1YJ91 3G711 1Q821 3I55Z 3CC21 1JJ2Y 1VQNZ 3CCU1 1Q7Y2 1KC81 2OTJ1 1M1K1 3CCQ1 1VQ4Z 1K731 1YIJ1 1VQ5Z 3CMEZ 1KD11 1VQMZ 3CCL1 3CC4Z 1S721 1YITZ 1KQSZ 1K8A1 1QVFZ 3CCSZ 1Q811 1N8R2 1M901 3CXCZ 3CC7Z 3I551 1VQN1 1VQP1 3CCJZ 1VQ81 2QA4Z 1YJNZ 3CCR1 3G6EZ 3CMA1 1NJI2 3CCV1 1VQLZ 1VQ51 3CCEZ 1YI21 1Q822 1VQM1 1Q7Y1 1QVGY 3OW2Z 3I56Z 3CCM1 3CPWZ 1K9M2 1KC82 1VQ9Z 1Q861 3CD61 1JJ2Z 3G71Z 1KD12 1W2BY
chains in the Genus database with same CATH superfamily
1PFTA 5CM2M 3CCQZ 1YJWZ 2K5RA 2DE6A 3HKZA 2GTIA 5T64A 2QEXZ 3JAMf 1VQKZ 1YIT1 2GU2A 5FLXb 1VQ7Z 3Q87A 2OOXB 2B63I 4HGZA 1TFIA 1YJ9Z 3CC2Z 3CXCY 1VQPZ 1YJN1 2PMZA 2VPXA 3CCVZ 4MD8A 2ZAEB 4E33A 1VQO1 3G4S1 3ESWA 4XX2A 4A3II 1M902 2QRDB 2RHBA 3FQQA 3H3VJ 5D1PA 4NBDA 2JIRA 3OW2Y 3J7A4 3CD6Z 4RVHA 1TWFI 4NB8A 2OTL1 2I3CA 3GTQI 3MZKB 4E2ZA 1JJ2Y 3CCU1 4MXUA 1KC81 2RIQA 4E2WA 4RS4A 3KIFA 3HOUI 1Y1VI 2VPWA 2R6MA 1FDOA 1YIJ1 5A2Qf 1WJ2A 2VPYA 1KD11 3CCL1 3J80b 3BG0B 1YITZ 4A3BI 4A3MI 3S2HI 1QVFZ 2JIOA 3S16I 3IX0A 1M901 4MH4A 3QWUA 1USPB 5IT9b 3FQMA 1TWGI 1YJNZ 3S15I 3CCR1 1QF8A 1VLAA 5IP7I 2Y0SA 3NH8A 2JIMA 1VQ51 1YI21 1VQM1 1QVGY 1ZB8A 1SFOI 4BY1I 5C3EI 2QREB 4NOZA 1X0TA 2NAPA 3GTMS 2LIYA 2P3YA 3NDIA 2OOYB 2W04A 3G6E1 1Q812 4RVDA 3TE5B 5T6BA 1YIJZ 2O4HA 3CCE1 2RT9A 4A3KI 3EEDA 4HGYA 3CCLZ 3S14I 1Y1WI 1VQ6Z 4RV9A 5C4JI 3M4OI 3CPWY 3J80f 1VQ91 2R7ZI 3IR7A 1I6HI 4MD7A 1X3WA 3VTNA 3CCRZ 4A3DI 3CCJ1 1TWAI 2QA41 2Q51A 1K8A2 2JMOA 1YI2Z 3NDJA 5D1OA 3HOVI 1ML8A 1Z03A 2E2JI 3TDHB 3GTPI 1YHQ1 3J81b 2YU9I 1NJI1 2BJOA 1W2BZ 2JA6I 2AYDA 1Q821 1VQNZ 1WCMI 2OTJ1 4DQYB 3S1MI 3S17I 2RPRA 2W03A 2IV2X 2OZKA 4MONA 1S721 4DGLA 1N2FA 3I4NI 1K8A1 2E9HA 4BBSI 2GTHA 4NBGA 2DE5A 3CXCZ 2WB1A 2QLVB 3I551 1RQFA 1Z02A 4A93I 4CL1A 1TWCI 3CCJZ 1VQ81 2QA4Z 3F3FC 3LUSA 3CMA1 2JR6A 4E30A 1L1OC 1RO4A 1Y8CA 1I3QI 4BXXI 3I4MI 3OW2Z 5LL6f 2V3VA 4E2YA 3PO3S 4BBRI 1X3ZA 1JJ2Z 4EWCA 5FLXf 1QXFA 3K7AI 2OTJZ 4MRIA 3BG1B 3U50C 2NVQI 1NUIA 4NBAA 1VQOZ 3HOZI 1VQL1 3G4SZ 3CME1 2V8KA 2E2HI 2KI7B 2NVYI 3HOXI 1Q16A 1QYPA 2H85A 1M1K2 1KQSY 1KRLA 2DE7A 4DK1A 2OTLZ 3M3YI 3CC71 3S1NI 1WZNA 1ZH1A 3CCUZ 3GTLI 1USPA 1VQ8Z 1YJW1 4A3JI 5AN9F 1YUKA 3EERA 3CMAZ 1Q862 2QR1B 3GCFA 1QVGZ 3JAMb 3NH5A 2QEX1 3GTKI 2JIPA 3F3PC 3IF8A 3GTGI 1VQK1 3I561 2R92I 1VQ71 2R93I 3I07A 4NFRA 4MD9A 3P5JB 3G711 1YJ91 3D2LA 3NH4A 3CC21 2O53A 1RO0A 5T67A 4RVGA 1M1K1 2VPZA 2NVXI 5IT9f 2E2II 1VQ5Z 3PO2I 2JIQA 3CMEZ 1VQMZ 4NB9A 2LEXA 3S2DI 2JUBA 4A3CI 5C4XI 3MZLB 1Q811 1N8R2 3CQZI 3GKQA 3IFUA 4A3LI 3CC7Z 2IZ3A 5A2Qb 3G6EZ 3H0GI 2QKDA 3CCEZ 2PK7A 3I56Z 3CCM1 1K9M2 1SIWA 1KC82 1AA6A 1VQ9Z 2IZ4A 3VMHA 3G71Z 4NBFA 3KIHA 1YUAA 2F4OA 4NH1C 1P9NA 1KD12 4BY7I 4E32A 2V8IA 2JA7I 3VMGA 4X6AI 1N8R1 2PM9A 3RZDI 5C44I 2NVTI 3GTMI 2M6NA 1VQ41 3HOYI 4QTUA 3VB9A 1Z01A 3CC41 3GTJI 1S7MA 4NBHA 4NBBA 1YHQZ 1WIIA 3CCS1 1QVFY 3J81f 1K732 1FDIA 3D6WA 2HU9A 1K9M1 1TWHI 1LQLA 1NP6A 4A3FI 2JNYA 1JWHC 1ZB9A 2Q4ZA 1K83I 2JA5I 2HF1A 3S1QI 2V8JA 2JS4A 5IP9I 3S1RI 2E7ZA 3CCMZ 1S72Z 1VQ61 4HH4A 2P28A 2RBLA 1RLYA 4Y52I 2V45A 1RO2A 3I55Z 1RNIA 4E31A 1Q7Y2 2K3RA 2JA8I 4NBEA 2F4MA 2VUGA 3FKII 3CCQ1 4TNUA 4E2XA 1WW9A 2VF1A 5FLMI 1VQ4Z 3RZOI 1K731 2M48A 3NFZA 2G2KA 4QTTA 3GTOI 4AYBA 3CC4Z 2KPIA 1KQSZ 3CCSZ 1Y1VS 1DL6A 1VQN1 1VQP1 4S1TA 4NBCA 3T4NB 1NJI2 3CCV1 1VQLZ 3VMIA 5D1OB 4RVFA 1Q822 1Q7Y1 2AKLA 4Y7NI 4A3EI 3CPWZ 2LFUA 2EGTA 1R9TI 2YADA 1Q861 3HOWI 2VUMI 3MONA 2WAQA 3CD61 1I50I 4A3GI 3D9XA 1W2BY 2QRCB 3PO3I 2J6AA
chains in the Genus database with same CATH topology
1PFTA 5CM2M 3CCQZ 1YJWZ 2K5RA 2DE6A 3HKZA 2GTIA 5T64A 2QEXZ 3JAMf 1VQKZ 1YIT1 2GU2A 5FLXb 1VQ7Z 3Q87A 2OOXB 2B63I 4HGZA 1TFIA 1YJ9Z 3CC2Z 3CXCY 1VQPZ 1YJN1 2PMZA 3CCVZ 4MD8A 1VQO1 2ZAEB 4E33A 3G4S1 3ESWA 4XX2A 4A3II 1M902 2QRDB 2RHBA 3FQQA 3H3VJ 5D1PA 4NBDA 3OW2Y 3J7A4 3CD6Z 4RVHA 1TWFI 4NB8A 2OTL1 2I3CA 3GTQI 3MZKB 4E2ZA 1JJ2Y 3CCU1 4MXUA 1KC81 2RIQA 4E2WA 4RS4A 3KIFA 3HOUI 1Y1VI 2R6MA 1YIJ1 5A2Qf 1KD11 3CCL1 3J80b 3BG0B 1YITZ 4A3BI 4A3MI 3S2HI 1QVFZ 3S16I 3IX0A 1M901 4MH4A 3QWUA 1USPB 5IT9b 3FQMA 1TWGI 1YJNZ 3S15I 3CCR1 1QF8A 1VLAA 5IP7I 2Y0SA 3NH8A 1VQ51 1YI21 1VQM1 1QVGY 1ZB8A 1SFOI 4BY1I 5C3EI 2QREB 4NOZA 1X0TA 3GTMS 2LIYA 2P3YA 3NDIA 2OOYB 2W04A 3G6E1 1Q812 4RVDA 3TE5B 5T6BA 1YIJZ 2O4HA 3CCE1 2RT9A 4A3KI 3EEDA 4HGYA 3CCLZ 3S14I 1Y1WI 1VQ6Z 4RV9A 5C4JI 3M4OI 3CPWY 3J80f 1VQ91 2R7ZI 1I6HI 4MD7A 1X3WA 3VTNA 3CCRZ 4A3DI 3CCJ1 1TWAI 2QA41 2Q51A 1K8A2 2JMOA 1YI2Z 3NDJA 5D1OA 3HOVI 1ML8A 1Z03A 2E2JI 3TDHB 3GTPI 1YHQ1 3J81b 2YU9I 1NJI1 2BJOA 1W2BZ 2JA6I 1Q821 1VQNZ 1WCMI 2OTJ1 4DQYB 3S1MI 3S17I 2RPRA 2W03A 2OZKA 4MONA 1S721 4DGLA 1N2FA 3I4NI 1K8A1 2E9HA 4BBSI 2GTHA 4NBGA 2DE5A 3CXCZ 2WB1A 2QLVB 3I551 1RQFA 1Z02A 4A93I 4CL1A 1TWCI 3CCJZ 1VQ81 2QA4Z 3F3FC 3LUSA 3CMA1 2JR6A 4E30A 1L1OC 1RO4A 1I3QI 4BXXI 3I4MI 3OW2Z 5LL6f 4E2YA 3PO3S 4BBRI 1X3ZA 1JJ2Z 4EWCA 5FLXf 3K7AI 2OTJZ 4MRIA 3BG1B 3U50C 2NVQI 1NUIA 4NBAA 1VQOZ 3HOZI 1VQL1 3G4SZ 3CME1 2V8KA 2E2HI 2KI7B 2NVYI 3HOXI 1QYPA 2H85A 1M1K2 1KQSY 1KRLA 2DE7A 4DK1A 2OTLZ 3M3YI 3CC71 3S1NI 1ZH1A 3CCUZ 3GTLI 1USPA 1VQ8Z 1YJW1 4A3JI 5AN9F 1YUKA 3EERA 3CMAZ 1Q862 2QR1B 3GCFA 1QVGZ 3JAMb 3NH5A 2QEX1 3GTKI 3F3PC 3IF8A 3GTGI 1VQK1 3I561 2R92I 1VQ71 2R93I 3I07A 4NFRA 4MD9A 3P5JB 3G711 1YJ91 3NH4A 3CC21 2O53A 1RO0A 5T67A 4RVGA 1M1K1 2NVXI 5IT9f 2E2II 1VQ5Z 3PO2I 3CMEZ 1VQMZ 4NB9A 3S2DI 2JUBA 4A3CI 5C4XI 3MZLB 1Q811 1N8R2 3CQZI 3GKQA 3IFUA 4A3LI 3CC7Z 2IZ3A 5A2Qb 3G6EZ 3H0GI 2QKDA 3CCEZ 2PK7A 3I56Z 3CCM1 1K9M2 1KC82 1VQ9Z 2IZ4A 3VMHA 3G71Z 4NBFA 3KIHA 1YUAA 2F4OA 4NH1C 1P9NA 1KD12 4BY7I 4E32A 2V8IA 2JA7I 3VMGA 4X6AI 1N8R1 2PM9A 3RZDI 5C44I 2NVTI 3GTMI 2M6NA 1VQ41 3HOYI 4QTUA 3VB9A 1Z01A 3CC41 3GTJI 1S7MA 4NBHA 4NBBA 1YHQZ 1WIIA 3CCS1 1QVFY 3J81f 1K732 3D6WA 2HU9A 1K9M1 1TWHI 1LQLA 1NP6A 4A3FI 2JNYA 1JWHC 1ZB9A 2Q4ZA 1K83I 2JA5I 2HF1A 3S1QI 2V8JA 2JS4A 5IP9I 3S1RI 3CCMZ 1S72Z 1VQ61 4HH4A 2P28A 2RBLA 1RLYA 4Y52I 1RO2A 3I55Z 1RNIA 4E31A 1Q7Y2 2K3RA 2JA8I 4NBEA 2F4MA 2VUGA 3FKII 3CCQ1 4TNUA 4E2XA 1WW9A 2VF1A 5FLMI 1VQ4Z 3RZOI 1K731 2M48A 3NFZA 2G2KA 4QTTA 3GTOI 4AYBA 3CC4Z 2KPIA 1KQSZ 3CCSZ 1Y1VS 1DL6A 1VQN1 1VQP1 4S1TA 4NBCA 3T4NB 1NJI2 3CCV1 1VQLZ 3VMIA 5D1OB 4RVFA 1Q822 1Q7Y1 2AKLA 4Y7NI 4A3EI 3CPWZ 2LFUA 2EGTA 1R9TI 2YADA 1Q861 3HOWI 2VUMI 3MONA 2WAQA 3CD61 1I50I 4A3GI 3D9XA 1W2BY 2QRCB 3PO3I 2J6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Z;  3CCQ Z;  1YJW Z;  1N8R 1;  3G6E 1;  1Q81 2;  1YIJ Z;  1VQO Z;  1VQL 1;  3G4S Z;  3CCE 1;  1VQ4 1;  2QEX Z;  3CME 1;  3CCL Z;  1VQK Z;  1VQ6 Z;  3CC4 1;  1YIT 1;  3CPW Y;  1VQ9 1;  1YHQ Z;  1VQ7 Z;  1M1K 2;  1KQS Y;  3CCS 1;  1QVF Y;  2OTL Z;  1YJ9 Z;  3CC7 1;  1K73 2;  3CC2 Z;  3CXC Y;  1VQP Z;  1K9M 1;  3CCU Z;  1VQ8 Z;  1YJW 1;  3CCR Z;  3CCJ 1;  3CMA Z;  2QA4 1;  1YJN 1;  1Q86 2;  3CCV Z;  1K8A 2;  1VQO 1;  1QVG Z;  3G4S 1;  1YI2 Z;  2QEX 1;  1M90 2;  3CCM Z;  1S72 Z;  1VQK 1;  1VQ6 1;  3I56 1;  3OW2 Y;  1YHQ 1;  3CD6 Z;  1VQ7 1;  1NJI 1;  1W2B Z;  2OTL 1;  1YJ9 1;  3G71 1;  1Q82 1;  3I55 Z;  3CC2 1;  1JJ2 Y;  1VQN Z;  3CCU 1;  1Q7Y 2;  1KC8 1;  2OTJ 1;  1M1K 1;  3CCQ 1;  1VQ4 Z;  1K73 1;  1YIJ 1;  1VQ5 Z;  3CME Z;  1KD1 1;  1VQM Z;  3CCL 1;  3CC4 Z;  1S72 1;  1YIT Z;  1KQS Z;  1K8A 1;  1QVF Z;  3CCS Z;  1Q81 1;  1N8R 2;  1M90 1;  3CXC Z;  3CC7 Z;  3I55 1;  1VQN 1;  1VQP 1;  3CCJ Z;  1VQ8 1;  2QA4 Z;  1YJN Z;  3CCR 1;  3G6E Z;  3CMA 1;  1NJI 2;  3CCV 1;  1VQL Z;  1VQ5 1;  3CCE Z;  1YI2 1;  1Q82 2;  1VQM 1;  1Q7Y 1;  1QVG Y;  3OW2 Z;  3I56 Z;  3CCM 1;  3CPW Z;  1K9M 2;  1KC8 2;  1VQ9 Z;  1Q86 1;  3CD6 1;  1JJ2 Z;  3G71 Z;  1KD1 2;  1W2B Y; 
#chains in the Genus database with same CATH topology
 1PFT A;  5CM2 M;  3CCQ Z;  1YJW Z;  2K5R A;  2DE6 A;  3HKZ A;  2GTI A;  5T64 A;  2QEX Z;  3JAM f;  1VQK Z;  1YIT 1;  2GU2 A;  5FLX b;  1VQ7 Z;  3Q87 A;  2OOX B;  2B63 I;  4HGZ A;  1TFI A;  1YJ9 Z;  3CC2 Z;  3CXC Y;  1VQP Z;  1YJN 1;  2PMZ A;  2VPX A;  3CCV Z;  4MD8 A;  2ZAE B;  4E33 A;  1VQO 1;  3G4S 1;  3ESW A;  4XX2 A;  4A3I I;  1M90 2;  2QRD B;  2RHB A;  3FQQ A;  3H3V J;  5D1P A;  4NBD A;  2JIR A;  3OW2 Y;  3J7A 4;  3CD6 Z;  4RVH A;  1TWF I;  4NB8 A;  2OTL 1;  2I3C A;  3GTQ I;  3MZK B;  4E2Z A;  1JJ2 Y;  3CCU 1;  4MXU A;  1KC8 1;  2RIQ A;  4E2W A;  4RS4 A;  3KIF A;  3HOU I;  1Y1V I;  2VPW A;  2R6M A;  1FDO A;  1YIJ 1;  5A2Q f;  1WJ2 A;  2VPY A;  1KD1 1;  3CCL 1;  3J80 b;  3BG0 B;  1YIT Z;  4A3B I;  4A3M I;  3S2H I;  1QVF Z;  2JIO A;  3S16 I;  3IX0 A;  1M90 1;  4MH4 A;  3QWU A;  1USP B;  5IT9 b;  3FQM A;  1TWG I;  1YJN Z;  3S15 I;  3CCR 1;  1QF8 A;  1VLA A;  5IP7 I;  2Y0S A;  3NH8 A;  2JIM A;  1VQ5 1;  1YI2 1;  1VQM 1;  1QVG Y;  1ZB8 A;  1SFO I;  4BY1 I;  5C3E I;  2QRE B;  4NOZ A;  1X0T A;  2NAP A;  3GTM S;  2LIY A;  2P3Y A;  3NDI A;  2OOY B;  2W04 A;  3G6E 1;  1Q81 2;  4RVD A;  3TE5 B;  5T6B A;  1YIJ Z;  2O4H A;  3CCE 1;  2RT9 A;  4A3K I;  3EED A;  4HGY A;  3CCL Z;  3S14 I;  1Y1W I;  1VQ6 Z;  4RV9 A;  5C4J I;  3M4O I;  3CPW Y;  3J80 f;  1VQ9 1;  2R7Z I;  3IR7 A;  1I6H I;  4MD7 A;  1X3W A;  3VTN A;  3CCR Z;  4A3D I;  3CCJ 1;  1TWA I;  2QA4 1;  2Q51 A;  1K8A 2;  2JMO A;  1YI2 Z;  3NDJ A;  5D1O A;  3HOV I;  1ML8 A;  1Z03 A;  2E2J I;  3TDH B;  3GTP I;  1YHQ 1;  3J81 b;  2YU9 I;  1NJI 1;  2BJO A;  1W2B Z;  2JA6 I;  2AYD A;  1Q82 1;  1VQN Z;  1WCM I;  2OTJ 1;  4DQY B;  3S1M I;  3S17 I;  2RPR A;  2W03 A;  2IV2 X;  2OZK A;  4MON A;  1S72 1;  4DGL A;  1N2F A;  3I4N I;  1K8A 1;  2E9H A;  4BBS I;  2GTH A;  4NBG A;  2DE5 A;  3CXC Z;  2WB1 A;  2QLV B;  3I55 1;  1RQF A;  1Z02 A;  4A93 I;  4CL1 A;  1TWC I;  3CCJ Z;  1VQ8 1;  2QA4 Z;  3F3F C;  3LUS A;  3CMA 1;  2JR6 A;  4E30 A;  1L1O C;  1RO4 A;  1Y8C A;  1I3Q I;  4BXX I;  3I4M I;  3OW2 Z;  5LL6 f;  2V3V A;  4E2Y A;  3PO3 S;  4BBR I;  1X3Z A;  1JJ2 Z;  4EWC A;  5FLX f;  1QXF A;  3K7A I;  2OTJ Z;  4MRI A;  3BG1 B;  3U50 C;  2NVQ I;  1NUI A;  4NBA A;  1VQO Z;  3HOZ I;  1VQL 1;  3G4S Z;  3CME 1;  2V8K A;  2E2H I;  2KI7 B;  2NVY I;  3HOX I;  1Q16 A;  1QYP A;  2H85 A;  1M1K 2;  1KQS Y;  1KRL A;  2DE7 A;  4DK1 A;  2OTL Z;  3M3Y I;  3CC7 1;  3S1N I;  1WZN A;  1ZH1 A;  3CCU Z;  3GTL I;  1USP A;  1VQ8 Z;  1YJW 1;  4A3J I;  5AN9 F;  1YUK A;  3EER A;  3CMA Z;  1Q86 2;  2QR1 B;  3GCF A;  1QVG Z;  3JAM b;  3NH5 A;  2QEX 1;  3GTK I;  2JIP A;  3F3P C;  3IF8 A;  3GTG I;  1VQK 1;  3I56 1;  2R92 I;  1VQ7 1;  2R93 I;  3I07 A;  4NFR A;  4MD9 A;  3P5J B;  3G71 1;  1YJ9 1;  3D2L A;  3NH4 A;  3CC2 1;  2O53 A;  1RO0 A;  5T67 A;  4RVG A;  1M1K 1;  2VPZ A;  2NVX I;  5IT9 f;  2E2I I;  1VQ5 Z;  3PO2 I;  2JIQ A;  3CME Z;  1VQM Z;  4NB9 A;  2LEX A;  3S2D I;  2JUB A;  4A3C I;  5C4X I;  3MZL B;  1Q81 1;  1N8R 2;  3CQZ I;  3GKQ A;  3IFU A;  4A3L I;  3CC7 Z;  2IZ3 A;  5A2Q b;  3G6E Z;  3H0G I;  2QKD A;  3CCE Z;  2PK7 A;  3I56 Z;  3CCM 1;  1K9M 2;  1SIW A;  1KC8 2;  1AA6 A;  1VQ9 Z;  2IZ4 A;  3VMH A;  3G71 Z;  4NBF A;  3KIH A;  1YUA A;  2F4O A;  4NH1 C;  1P9N A;  1KD1 2;  4BY7 I;  4E32 A;  2V8I A;  2JA7 I;  3VMG A;  4X6A I;  1N8R 1;  2PM9 A;  3RZD I;  5C44 I;  2NVT I;  3GTM I;  2M6N A;  1VQ4 1;  3HOY I;  4QTU A;  3VB9 A;  1Z01 A;  3CC4 1;  3GTJ I;  1S7M A;  4NBH A;  4NBB A;  1YHQ Z;  1WII A;  3CCS 1;  1QVF Y;  3J81 f;  1K73 2;  1FDI A;  3D6W A;  2HU9 A;  1K9M 1;  1TWH I;  1LQL A;  1NP6 A;  4A3F I;  2JNY A;  1JWH C;  1ZB9 A;  2Q4Z A;  1K83 I;  2JA5 I;  2HF1 A;  3S1Q I;  2V8J A;  2JS4 A;  5IP9 I;  3S1R I;  2E7Z A;  3CCM Z;  1S72 Z;  1VQ6 1;  4HH4 A;  2P28 A;  2RBL A;  1RLY A;  4Y52 I;  2V45 A;  1RO2 A;  3I55 Z;  1RNI A;  4E31 A;  1Q7Y 2;  2K3R A;  2JA8 I;  4NBE A;  2F4M A;  2VUG A;  3FKI I;  3CCQ 1;  4TNU A;  4E2X A;  1WW9 A;  2VF1 A;  5FLM I;  1VQ4 Z;  3RZO I;  1K73 1;  2M48 A;  3NFZ A;  2G2K A;  4QTT A;  3GTO I;  4AYB A;  3CC4 Z;  2KPI A;  1KQS Z;  3CCS Z;  1Y1V S;  1DL6 A;  1VQN 1;  1VQP 1;  4S1T A;  4NBC A;  3T4N B;  1NJI 2;  3CCV 1;  1VQL Z;  3VMI A;  5D1O B;  4RVF A;  1Q82 2;  1Q7Y 1;  2AKL A;  4Y7N I;  4A3E I;  3CPW Z;  2LFU A;  2EGT A;  1R9T I;  2YAD A;  1Q86 1;  3HOW I;  2VUM I;  3MON A;  2WAQ A;  3CD6 1;  1I50 I;  4A3G I;  3D9X A;  1W2B Y;  2QRC B;  3PO3 I;  2J6A A; 
#chains in the Genus database with same CATH homology
 1PFT A;  5CM2 M;  3CCQ Z;  1YJW Z;  2K5R A;  2DE6 A;  3HKZ A;  2GTI A;  5T64 A;  2QEX Z;  3JAM f;  1VQK Z;  1YIT 1;  2GU2 A;  5FLX b;  1VQ7 Z;  3Q87 A;  2OOX B;  2B63 I;  4HGZ A;  1TFI A;  1YJ9 Z;  3CC2 Z;  3CXC Y;  1VQP Z;  1YJN 1;  2PMZ A;  3CCV Z;  4MD8 A;  1VQO 1;  2ZAE B;  4E33 A;  3G4S 1;  3ESW A;  4XX2 A;  4A3I I;  1M90 2;  2QRD B;  2RHB A;  3FQQ A;  3H3V J;  5D1P A;  4NBD A;  3OW2 Y;  3J7A 4;  3CD6 Z;  4RVH A;  1TWF I;  4NB8 A;  2OTL 1;  2I3C A;  3GTQ I;  3MZK B;  4E2Z A;  1JJ2 Y;  3CCU 1;  4MXU A;  1KC8 1;  2RIQ A;  4E2W A;  4RS4 A;  3KIF A;  3HOU I;  1Y1V I;  2R6M A;  1YIJ 1;  5A2Q f;  1KD1 1;  3CCL 1;  3J80 b;  3BG0 B;  1YIT Z;  4A3B I;  4A3M I;  3S2H I;  1QVF Z;  3S16 I;  3IX0 A;  1M90 1;  4MH4 A;  3QWU A;  1USP B;  5IT9 b;  3FQM A;  1TWG I;  1YJN Z;  3S15 I;  3CCR 1;  1QF8 A;  1VLA A;  5IP7 I;  2Y0S A;  3NH8 A;  1VQ5 1;  1YI2 1;  1VQM 1;  1QVG Y;  1ZB8 A;  1SFO I;  4BY1 I;  5C3E I;  2QRE B;  4NOZ A;  1X0T A;  3GTM S;  2LIY A;  2P3Y A;  3NDI A;  2OOY B;  2W04 A;  3G6E 1;  1Q81 2;  4RVD A;  3TE5 B;  5T6B A;  1YIJ Z;  2O4H A;  3CCE 1;  2RT9 A;  4A3K I;  3EED A;  4HGY A;  3CCL Z;  3S14 I;  1Y1W I;  1VQ6 Z;  4RV9 A;  5C4J I;  3M4O I;  3CPW Y;  3J80 f;  1VQ9 1;  2R7Z I;  1I6H I;  4MD7 A;  1X3W A;  3VTN A;  3CCR Z;  4A3D I;  3CCJ 1;  1TWA I;  2QA4 1;  2Q51 A;  1K8A 2;  2JMO A;  1YI2 Z;  3NDJ A;  5D1O A;  3HOV I;  1ML8 A;  1Z03 A;  2E2J I;  3TDH B;  3GTP I;  1YHQ 1;  3J81 b;  2YU9 I;  1NJI 1;  2BJO A;  1W2B Z;  2JA6 I;  1Q82 1;  1VQN Z;  1WCM I;  2OTJ 1;  4DQY B;  3S1M I;  3S17 I;  2RPR A;  2W03 A;  2OZK A;  4MON A;  1S72 1;  4DGL A;  1N2F A;  3I4N I;  1K8A 1;  2E9H A;  4BBS I;  2GTH A;  4NBG A;  2DE5 A;  3CXC Z;  2WB1 A;  2QLV B;  3I55 1;  1RQF A;  1Z02 A;  4A93 I;  4CL1 A;  1TWC I;  3CCJ Z;  1VQ8 1;  2QA4 Z;  3F3F C;  3LUS A;  3CMA 1;  2JR6 A;  4E30 A;  1L1O C;  1RO4 A;  1I3Q I;  4BXX I;  3I4M I;  3OW2 Z;  5LL6 f;  4E2Y A;  3PO3 S;  4BBR I;  1X3Z A;  1JJ2 Z;  4EWC A;  5FLX f;  3K7A I;  2OTJ Z;  4MRI A;  3BG1 B;  3U50 C;  2NVQ I;  1NUI A;  4NBA A;  1VQO Z;  3HOZ I;  1VQL 1;  3G4S Z;  3CME 1;  2V8K A;  2E2H I;  2KI7 B;  2NVY I;  3HOX I;  1QYP A;  2H85 A;  1M1K 2;  1KQS Y;  1KRL A;  2DE7 A;  4DK1 A;  2OTL Z;  3M3Y I;  3CC7 1;  3S1N I;  1ZH1 A;  3CCU Z;  3GTL I;  1USP A;  1VQ8 Z;  1YJW 1;  4A3J I;  5AN9 F;  1YUK A;  3EER A;  3CMA Z;  1Q86 2;  2QR1 B;  3GCF A;  1QVG Z;  3JAM b;  3NH5 A;  2QEX 1;  3GTK I;  3F3P C;  3IF8 A;  3GTG I;  1VQK 1;  3I56 1;  2R92 I;  1VQ7 1;  2R93 I;  3I07 A;  4NFR A;  4MD9 A;  3P5J B;  3G71 1;  1YJ9 1;  3NH4 A;  3CC2 1;  2O53 A;  1RO0 A;  5T67 A;  4RVG A;  1M1K 1;  2NVX I;  5IT9 f;  2E2I I;  1VQ5 Z;  3PO2 I;  3CME Z;  1VQM Z;  4NB9 A;  3S2D I;  2JUB A;  4A3C I;  5C4X I;  3MZL B;  1Q81 1;  1N8R 2;  3CQZ I;  3GKQ A;  3IFU A;  4A3L I;  3CC7 Z;  2IZ3 A;  5A2Q b;  3G6E Z;  3H0G I;  2QKD A;  3CCE Z;  2PK7 A;  3I56 Z;  3CCM 1;  1K9M 2;  1KC8 2;  1VQ9 Z;  2IZ4 A;  3VMH A;  3G71 Z;  4NBF A;  3KIH A;  1YUA A;  2F4O A;  4NH1 C;  1P9N A;  1KD1 2;  4BY7 I;  4E32 A;  2V8I A;  2JA7 I;  3VMG A;  4X6A I;  1N8R 1;  2PM9 A;  3RZD I;  5C44 I;  2NVT I;  3GTM I;  2M6N A;  1VQ4 1;  3HOY I;  4QTU A;  3VB9 A;  1Z01 A;  3CC4 1;  3GTJ I;  1S7M A;  4NBH A;  4NBB A;  1YHQ Z;  1WII A;  3CCS 1;  1QVF Y;  3J81 f;  1K73 2;  3D6W A;  2HU9 A;  1K9M 1;  1TWH I;  1LQL A;  1NP6 A;  4A3F I;  2JNY A;  1JWH C;  1ZB9 A;  2Q4Z A;  1K83 I;  2JA5 I;  2HF1 A;  3S1Q I;  2V8J A;  2JS4 A;  5IP9 I;  3S1R I;  3CCM Z;  1S72 Z;  1VQ6 1;  4HH4 A;  2P28 A;  2RBL A;  1RLY A;  4Y52 I;  1RO2 A;  3I55 Z;  1RNI A;  4E31 A;  1Q7Y 2;  2K3R A;  2JA8 I;  4NBE A;  2F4M A;  2VUG A;  3FKI I;  3CCQ 1;  4TNU A;  4E2X A;  1WW9 A;  2VF1 A;  5FLM I;  1VQ4 Z;  3RZO I;  1K73 1;  2M48 A;  3NFZ A;  2G2K A;  4QTT A;  3GTO I;  4AYB A;  3CC4 Z;  2KPI A;  1KQS Z;  3CCS Z;  1Y1V S;  1DL6 A;  1VQN 1;  1VQP 1;  4S1T A;  4NBC A;  3T4N B;  1NJI 2;  3CCV 1;  1VQL Z;  3VMI A;  5D1O B;  4RVF A;  1Q82 2;  1Q7Y 1;  2AKL A;  4Y7N I;  4A3E I;  3CPW Z;  2LFU A;  2EGT A;  1R9T I;  2YAD A;  1Q86 1;  3HOW I;  2VUM I;  3MON A;  2WAQ A;  3CD6 1;  1I50 I;  4A3G I;  3D9X A;  1W2B Y;  2QRC B;  3PO3 I;  2J6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...