3I561

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56100
3CC21 3CMEZ 3CD61 1YITZ 1VQ71 1VQ61 3I56Z 1QVGZ 3CCS1 1VQ9Z 3CMA1 2OTJ1 1VQ5Z 3CC71 1KQSZ 1Q861 3CC2Z 1YIT1 1VQ6Z 1YI21 1Q811 3G71Z 3CPWZ 1VQOZ 1YJ9Z 1K9M1 1N8R1 1K731 3CCVZ 1N8R2 1VQLZ 1YJNZ 1M1K2 3CCJZ 1YI2Z 1W2BZ 3CD6Z 3I551 3CXCY 2QA4Z 3CCQ1 3CCSZ 1S721 3CCV1 2OTJZ 1VQPZ 1Q862 1VQ51 3OW2Z 3CCUZ 2OTLZ 1KC82 3CCJ1 1Q821 1S72Z 1K732 1VQN1 3CCU1 1KD12 1VQ8Z 1NJI2 3CC4Z 2QEX1 1VQ41 1Q822 1W2BY 3G6EZ 3OW2Y 1VQMZ 3I561 3G4SZ 1K8A1 1YJW1 3CMAZ 1VQ91 3I55Z 3CC7Z 3CPWY 3G6E1 3CCL1 1VQM1 1K8A2 1JJ2Z 3CCR1 1KQSY 1YIJ1 1YHQZ 1KD11 1VQ81 1VQL1 3CCLZ 3CCE1 3CCM1 1KC81 1Q7Y2 1M902 2QA41 1QVFY 3CCQZ 3G4S1 1QVFZ 1YJWZ 1VQKZ 1QVGY 1VQP1 1VQ4Z 2OTL1 3CCEZ 3CCMZ 1JJ2Y 1M901 1Q7Y1 3CXCZ 3CME1 1K9M2 3G711 1VQ7Z 1VQO1 1YJ91 1VQK1 3CCRZ 1M1K1 1NJI1 1VQNZ 1YJN1 1YIJZ 3CC41 1Q812 2QEXZ 1YHQ1
chains in the Genus database with same CATH superfamily
2JIRA 3CD61 1P9NA 5IT9b 4Y52I 1QVGZ 3CCS1 1FDIA 2HF1A 2LIYA 3RZDI 2OTJ1 3CC71 1RO0A 5C4JI 2DE7A 1YUKA 2PK7A 2K5RA 2GTHA 3G71Z 2JIPA 1X3ZA 1WJ2A 3S1NI 1VQLZ 4MRIA 3CCJZ 1KRLA 1YI2Z 2R7ZI 2YADA 3CD6Z 3NH8A 3CCSZ 3VMHA 2QKDA 2IZ4A 3CCJ1 4A3EI 4DQYB 3IF8A 2VUGA 3QWUA 1TWHI 3K7AI 4A3II 3H3VJ 1VQN1 4E30A 5IP7I 2J6AA 2QEX1 1Q822 2V8JA 3HOYI 3LUSA 2IV2X 3OW2Y 1VQMZ 3Q87A 4BXXI 1K8A1 1YJW1 1USPB 2V8IA 5AN9F 2GTIA 3CPWY 4E2XA 3RZOI 4E2YA 1TWCI 3IFUA 4E32A 3EEDA 1JJ2Z 2G2KA 2QLVB 4MXUA 4A3GI 3U50C 2JIQA 2Q51A 1SFOI 1YHQZ 2F4OA 1VQ81 1VQL1 3CCLZ 1RNIA 3CCE1 1WW9A 5T64A 4EWCA 2QRCB 1M902 2QA41 4DGLA 1QVFY 3CCQZ 1QVFZ 1YJWZ 1VQKZ 4NB9A 4RVFA 3GTJI 4X6AI 2OTL1 2I3CA 3CCEZ 1NUIA 3JAMb 3D9XA 4HH4A 2O53A 2M48A 1VQ7Z 1VQO1 3I4MI 3M4OI 1VQK1 1SIWA 3S2HI 3CCRZ 1M1K1 1I3QI 1YIJZ 1VQ4Z 2NVTI 2VUMI 1VQ61 3GCFA 1VQ9Z 4E2WA 3S15I 2V8KA 3HKZA 1YIT1 2O4HA 1VQ6Z 3MONA 1Q811 3HOWI 2RT9A 1WCMI 3NFZA 4NFRA 1VLAA 3TE5B 1ML8A 2PMZA 4QTUA 3JAMf 3CPWZ 1VQOZ 1K9M1 2R92I 3CCVZ 1N8R2 2JMOA 1YJNZ 5D1OA 1M1K2 1FDOA 3HOZI 4MONA 4AYBA 2K3RA 2RPRA 1ZB8A 1W2BZ 2OOXB 3GTOI 3I551 3H0GI 3CXCY 2R93I 3CCQ1 3CCV1 3GTGI 1VQ51 1KC82 1K83I 4RV9A 1Q821 2JS4A 4E2ZA 1Y8CA 1R9TI 4A93I 3BG0B 1NP6A 5CM2M 2VPZA 1NJI2 4HGYA 3T4NB 1Q16A 3I561 2BJOA 5LL6f 3CMAZ 3CC7Z 3KIFA 3S2DI 3GKQA 3G6E1 2DE5A 2H85A 3S1RI 2LFUA 3PO2I 1LQLA 1ZH1A 2RIQA 5FLMI 3GTQI 4E33A 2JIMA 4QTTA 1RO4A 2VF1A 1I6HI 3F3PC 5A2Qb 1TWAI 1Q7Y2 4NBHA 3GTLI 2JUBA 3CCMZ 3I07A 1JJ2Y 3VMIA 1PFTA 5FLXb 3CXCZ 1YUAA 4MH4A 2JA5I 2EGTA 1I50I 1Q812 3VTNA 4A3CI 1RO2A 3HOVI 2V45A 3J81b 3CMEZ 3GTPI 2ZAEB 3I56Z 2PM9A 2Y0SA 3CMA1 2E2JI 2NVXI 2AYDA 1KQSZ 4A3LI 3S14I 1Q861 5C44I 1TWGI 3NDIA 2E9HA 1X0TA 4BY1I 1WZNA 2B63I 3ESWA 1WIIA 1N8R1 5FLXf 3IX0A 2JA7I 4Y7NI 4A3DI 1RLYA 4A3KI 2V3VA 2KPIA 4NBFA 4BBRI 2F4MA 1Y1WI 3MZKB 2OTJZ 1VQPZ 1Y1VI 5D1OB 3OW2Z 1QF8A 2W03A 2WB1A 1KD12 1VQ8Z 5T67A 2OOYB 4NBCA 4A3JI 1W2BY 3J7A4 2E2II 2GU2A 2NVYI 4E31A 3PO3I 1VQ91 2DE6A 2Q4ZA 5D1PA 3EERA 4NBEA 3I4NI 2NAPA 1TWFI 1VQM1 1TFIA 3GTMS 2R6MA 3NH5A 3KIHA 5C4XI 3CCR1 1JWHC 3HOXI 1KQSY 1YIJ1 3S17I 5C3EI 1X3WA 2AKLA 1QXFA 2P28A 3S1MI 2LEXA 2WAQA 1S7MA 1QVGY 3BG1B 4RVHA 3MZLB 4CL1A 2QR1B 4S1TA 1Q7Y1 3D2LA 3IR7A 2YU9I 4MD7A 1YJ91 1VQNZ 1YJN1 3CC41 4NOZA 1YHQ1 2JA8I 4NBGA 3CC21 3S1QI 1L1OC 4NH1C 1YITZ 1VQ71 1VQ5Z 4NBBA 1N2FA 2JNYA 4A3MI 2QRDB 3CC2Z 4NBAA 2KI7B 1YI21 2VPWA 1YJ9Z 2VPYA 3J80b 3D6WA 3J80f 1K731 1QYPA 3NDJA 5IT9f 2QA4Z 4NBDA 3GTKI 2JIOA 3VB9A 1S721 1Q862 1Z01A 3CCUZ 2OTLZ 2E2HI 2VPXA 1Z02A 3P5JB 4XX2A 5T6BA 3FQMA 3J81f 1S72Z 5A2Qf 2M6NA 3FQQA 3NH4A 1K732 3CCU1 4A3FI 2P3YA 3CC4Z 1VQ41 3G6EZ 3FKII 4RVDA 4MD8A 3GTMI 3VMGA 2RBLA 3G4SZ 2NVQI 3CQZI 3F3FC 3S16I 3I55Z 2JR6A 2QREB 2E7ZA 2W04A 4RS4A 3CCL1 4RVGA 4TNUA 1K8A2 1ZB9A 2IZ3A 2JA6I 3M3YI 4BBSI 4DK1A 4NB8A 5IP9I 2HU9A 1KD11 1Z03A 3CCM1 3HOUI 1KC81 4HGZA 3G4S1 3TDHB 2OZKA 1VQP1 4A3BI 1M901 1RQFA 3CME1 1K9M2 4MD9A 3G711 1Y1VS 2RHBA 4BY7I 1USPA 1DL6A 1NJI1 3PO3S 2QEXZ 1AA6A
chains in the Genus database with same CATH topology
3CD61 1P9NA 5IT9b 4Y52I 1QVGZ 3CCS1 2HF1A 2LIYA 3RZDI 2OTJ1 3CC71 1RO0A 5C4JI 2DE7A 1YUKA 2PK7A 2K5RA 2GTHA 3G71Z 1X3ZA 3S1NI 1VQLZ 4MRIA 3CCJZ 1KRLA 1YI2Z 2R7ZI 2YADA 3CD6Z 3NH8A 3CCSZ 3VMHA 2QKDA 2IZ4A 3CCJ1 4A3EI 4DQYB 3IF8A 2VUGA 3QWUA 1TWHI 3K7AI 4A3II 3H3VJ 1VQN1 4E30A 5IP7I 2J6AA 2QEX1 1Q822 2V8JA 3HOYI 3LUSA 3OW2Y 1VQMZ 3Q87A 4BXXI 1K8A1 1YJW1 1USPB 2V8IA 5AN9F 2GTIA 3CPWY 4E2XA 3RZOI 4E2YA 1TWCI 3IFUA 4E32A 3EEDA 1JJ2Z 2G2KA 2QLVB 4MXUA 4A3GI 3U50C 1SFOI 2Q51A 1YHQZ 2F4OA 1VQ81 1VQL1 3CCLZ 1RNIA 3CCE1 1WW9A 5T64A 4EWCA 2QRCB 1M902 2QA41 4DGLA 1QVFY 3CCQZ 1QVFZ 1YJWZ 1VQKZ 4RVFA 3GTJI 4X6AI 2OTL1 2I3CA 3CCEZ 1NUIA 3JAMb 3D9XA 4HH4A 2O53A 2M48A 1VQ7Z 1VQO1 3I4MI 3M4OI 1VQK1 3S2HI 3CCRZ 1M1K1 1I3QI 1YIJZ 1VQ4Z 2NVTI 2VUMI 1VQ61 3GCFA 1VQ9Z 4E2WA 3S15I 2V8KA 3HKZA 1YIT1 2O4HA 1VQ6Z 3MONA 1Q811 3HOWI 2RT9A 1WCMI 3NFZA 4NFRA 1VLAA 3TE5B 1ML8A 2PMZA 4QTUA 3JAMf 3CPWZ 1VQOZ 1K9M1 2R92I 3CCVZ 1N8R2 2JMOA 1YJNZ 5D1OA 1M1K2 3HOZI 4MONA 4AYBA 2K3RA 2RPRA 1ZB8A 1W2BZ 2OOXB 3GTOI 3I551 3H0GI 3CXCY 2R93I 3CCQ1 3CCV1 3GTGI 1VQ51 1KC82 1K83I 4RV9A 1Q821 2JS4A 4E2ZA 1R9TI 4A93I 3BG0B 1NP6A 5CM2M 1NJI2 4HGYA 3T4NB 3I561 2BJOA 5LL6f 3CMAZ 3CC7Z 3KIFA 3S2DI 3GKQA 3G6E1 2DE5A 2H85A 3S1RI 2LFUA 3PO2I 1LQLA 1ZH1A 2RIQA 5FLMI 3GTQI 4E33A 4QTTA 1RO4A 2VF1A 1I6HI 3F3PC 5A2Qb 1TWAI 1Q7Y2 4NBHA 3GTLI 2JUBA 3CCMZ 3I07A 1JJ2Y 3VMIA 1PFTA 5FLXb 3CXCZ 1YUAA 4MH4A 2JA5I 2EGTA 1I50I 1Q812 3VTNA 4A3CI 1RO2A 3HOVI 3J81b 3CMEZ 3GTPI 2ZAEB 3I56Z 2PM9A 2Y0SA 3CMA1 2E2JI 2NVXI 1KQSZ 4A3LI 3S14I 1Q861 5C44I 1TWGI 3NDIA 2E9HA 1X0TA 4BY1I 2B63I 3ESWA 1WIIA 1N8R1 5FLXf 3IX0A 2JA7I 4Y7NI 4A3DI 1RLYA 4A3KI 2KPIA 4NBFA 4BBRI 2F4MA 1Y1WI 3MZKB 2OTJZ 1VQPZ 1Y1VI 5D1OB 3OW2Z 1QF8A 2W03A 2WB1A 1KD12 1VQ8Z 5T67A 2OOYB 4NBCA 4A3JI 1W2BY 3J7A4 2E2II 2GU2A 2NVYI 4E31A 3PO3I 1VQ91 2DE6A 2Q4ZA 5D1PA 3EERA 4NBEA 3I4NI 1TWFI 1VQM1 1TFIA 3GTMS 2R6MA 3NH5A 3KIHA 5C4XI 3CCR1 1JWHC 3HOXI 1KQSY 1YIJ1 3S17I 5C3EI 1X3WA 2AKLA 2P28A 3S1MI 2WAQA 1S7MA 1QVGY 3BG1B 4RVHA 3MZLB 4CL1A 2QR1B 4S1TA 1Q7Y1 2YU9I 4MD7A 1YJ91 1VQNZ 1YJN1 3CC41 4NOZA 1YHQ1 2JA8I 4NBGA 3CC21 3S1QI 1L1OC 4NH1C 1YITZ 1VQ71 1VQ5Z 4NBBA 1N2FA 2JNYA 4A3MI 2QRDB 3CC2Z 4NBAA 2KI7B 1YI21 1YJ9Z 3J80b 3D6WA 3J80f 1K731 1QYPA 3NDJA 5IT9f 2QA4Z 4NBDA 3GTKI 3VB9A 1S721 1Q862 1Z01A 3CCUZ 2OTLZ 2E2HI 1Z02A 3P5JB 4XX2A 5T6BA 3FQMA 3J81f 1S72Z 5A2Qf 2M6NA 3FQQA 3NH4A 1K732 3CCU1 4A3FI 2P3YA 3CC4Z 1VQ41 3G6EZ 3FKII 4RVDA 4MD8A 3GTMI 3VMGA 2RBLA 3G4SZ 2NVQI 3CQZI 3F3FC 3S16I 3I55Z 2JR6A 2QREB 2W04A 4RS4A 3CCL1 4RVGA 4TNUA 1K8A2 1ZB9A 2IZ3A 2JA6I 3M3YI 4BBSI 4DK1A 4NB8A 5IP9I 2HU9A 1KD11 1Z03A 3CCM1 3HOUI 1KC81 4HGZA 3G4S1 3TDHB 2OZKA 1VQP1 4A3BI 1M901 1RQFA 3CME1 1K9M2 4MD9A 3G711 1Y1VS 2RHBA 4BY7I 1USPA 1DL6A 1NJI1 3PO3S 2QEXZ 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 1;  3CME Z;  3CD6 1;  1YIT Z;  1VQ7 1;  1VQ6 1;  3I56 Z;  1QVG Z;  3CCS 1;  1VQ9 Z;  3CMA 1;  2OTJ 1;  1VQ5 Z;  3CC7 1;  1KQS Z;  1Q86 1;  3CC2 Z;  1YIT 1;  1VQ6 Z;  1YI2 1;  1Q81 1;  3G71 Z;  3CPW Z;  1VQO Z;  1YJ9 Z;  1K9M 1;  1N8R 1;  1K73 1;  3CCV Z;  1N8R 2;  1VQL Z;  1YJN Z;  1M1K 2;  3CCJ Z;  1YI2 Z;  1W2B Z;  3CD6 Z;  3I55 1;  3CXC Y;  2QA4 Z;  3CCQ 1;  3CCS Z;  1S72 1;  3CCV 1;  2OTJ Z;  1VQP Z;  1Q86 2;  1VQ5 1;  3OW2 Z;  3CCU Z;  2OTL Z;  1KC8 2;  3CCJ 1;  1Q82 1;  1S72 Z;  1K73 2;  1VQN 1;  3CCU 1;  1KD1 2;  1VQ8 Z;  1NJI 2;  3CC4 Z;  2QEX 1;  1VQ4 1;  1Q82 2;  1W2B Y;  3G6E Z;  3OW2 Y;  1VQM Z;  3I56 1;  3G4S Z;  1K8A 1;  1YJW 1;  3CMA Z;  1VQ9 1;  3I55 Z;  3CC7 Z;  3CPW Y;  3G6E 1;  3CCL 1;  1VQM 1;  1K8A 2;  1JJ2 Z;  3CCR 1;  1KQS Y;  1YIJ 1;  1YHQ Z;  1KD1 1;  1VQ8 1;  1VQL 1;  3CCL Z;  3CCE 1;  3CCM 1;  1KC8 1;  1Q7Y 2;  1M90 2;  2QA4 1;  1QVF Y;  3CCQ Z;  3G4S 1;  1QVF Z;  1YJW Z;  1VQK Z;  1QVG Y;  1VQP 1;  1VQ4 Z;  2OTL 1;  3CCE Z;  3CCM Z;  1JJ2 Y;  1M90 1;  1Q7Y 1;  3CXC Z;  3CME 1;  1K9M 2;  3G71 1;  1VQ7 Z;  1VQO 1;  1YJ9 1;  1VQK 1;  3CCR Z;  1M1K 1;  1NJI 1;  1VQN Z;  1YJN 1;  1YIJ Z;  3CC4 1;  1Q81 2;  2QEX Z;  1YHQ 1; 
#chains in the Genus database with same CATH topology
 2JIR A;  3CD6 1;  1P9N A;  5IT9 b;  4Y52 I;  1QVG Z;  3CCS 1;  1FDI A;  2HF1 A;  2LIY A;  3RZD I;  2OTJ 1;  3CC7 1;  1RO0 A;  5C4J I;  2DE7 A;  1YUK A;  2PK7 A;  2K5R A;  2GTH A;  3G71 Z;  2JIP A;  1X3Z A;  1WJ2 A;  3S1N I;  1VQL Z;  4MRI A;  3CCJ Z;  1KRL A;  1YI2 Z;  2R7Z I;  2YAD A;  3CD6 Z;  3NH8 A;  3CCS Z;  3VMH A;  2QKD A;  2IZ4 A;  3CCJ 1;  4A3E I;  4DQY B;  3IF8 A;  2VUG A;  3QWU A;  1TWH I;  3K7A I;  4A3I I;  3H3V J;  1VQN 1;  4E30 A;  5IP7 I;  2J6A A;  2QEX 1;  1Q82 2;  2V8J A;  3HOY I;  3LUS A;  2IV2 X;  3OW2 Y;  1VQM Z;  3Q87 A;  4BXX I;  1K8A 1;  1YJW 1;  1USP B;  2V8I A;  5AN9 F;  2GTI A;  3CPW Y;  4E2X A;  3RZO I;  4E2Y A;  1TWC I;  3IFU A;  4E32 A;  3EED A;  1JJ2 Z;  2G2K A;  2QLV B;  4MXU A;  4A3G I;  3U50 C;  2JIQ A;  2Q51 A;  1SFO I;  1YHQ Z;  2F4O A;  1VQ8 1;  1VQL 1;  3CCL Z;  1RNI A;  3CCE 1;  1WW9 A;  5T64 A;  4EWC A;  2QRC B;  1M90 2;  2QA4 1;  4DGL A;  1QVF Y;  3CCQ Z;  1QVF Z;  1YJW Z;  1VQK Z;  4NB9 A;  4RVF A;  3GTJ I;  4X6A I;  2OTL 1;  2I3C A;  3CCE Z;  1NUI A;  3JAM b;  3D9X A;  4HH4 A;  2O53 A;  2M48 A;  1VQ7 Z;  1VQO 1;  3I4M I;  3M4O I;  1VQK 1;  1SIW A;  3S2H I;  3CCR Z;  1M1K 1;  1I3Q I;  1YIJ Z;  1VQ4 Z;  2NVT I;  2VUM I;  1VQ6 1;  3GCF A;  1VQ9 Z;  4E2W A;  3S15 I;  2V8K A;  3HKZ A;  1YIT 1;  2O4H A;  1VQ6 Z;  3MON A;  1Q81 1;  3HOW I;  2RT9 A;  1WCM I;  3NFZ A;  4NFR A;  1VLA A;  3TE5 B;  1ML8 A;  2PMZ A;  4QTU A;  3JAM f;  3CPW Z;  1VQO Z;  1K9M 1;  2R92 I;  3CCV Z;  1N8R 2;  2JMO A;  1YJN Z;  5D1O A;  1M1K 2;  1FDO A;  3HOZ I;  4MON A;  4AYB A;  2K3R A;  2RPR A;  1ZB8 A;  1W2B Z;  2OOX B;  3GTO I;  3I55 1;  3H0G I;  3CXC Y;  2R93 I;  3CCQ 1;  3CCV 1;  3GTG I;  1VQ5 1;  1KC8 2;  1K83 I;  4RV9 A;  1Q82 1;  2JS4 A;  4E2Z A;  1Y8C A;  1R9T I;  4A93 I;  3BG0 B;  1NP6 A;  5CM2 M;  2VPZ A;  1NJI 2;  4HGY A;  3T4N B;  1Q16 A;  3I56 1;  2BJO A;  5LL6 f;  3CMA Z;  3CC7 Z;  3KIF A;  3S2D I;  3GKQ A;  3G6E 1;  2DE5 A;  2H85 A;  3S1R I;  2LFU A;  3PO2 I;  1LQL A;  1ZH1 A;  2RIQ A;  5FLM I;  3GTQ I;  4E33 A;  2JIM A;  4QTT A;  1RO4 A;  2VF1 A;  1I6H I;  3F3P C;  5A2Q b;  1TWA I;  1Q7Y 2;  4NBH A;  3GTL I;  2JUB A;  3CCM Z;  3I07 A;  1JJ2 Y;  3VMI A;  1PFT A;  5FLX b;  3CXC Z;  1YUA A;  4MH4 A;  2JA5 I;  2EGT A;  1I50 I;  1Q81 2;  3VTN A;  4A3C I;  1RO2 A;  3HOV I;  2V45 A;  3J81 b;  3CME Z;  3GTP I;  2ZAE B;  3I56 Z;  2PM9 A;  2Y0S A;  3CMA 1;  2E2J I;  2NVX I;  2AYD A;  1KQS Z;  4A3L I;  3S14 I;  1Q86 1;  5C44 I;  1TWG I;  3NDI A;  2E9H A;  1X0T A;  4BY1 I;  1WZN A;  2B63 I;  3ESW A;  1WII A;  1N8R 1;  5FLX f;  3IX0 A;  2JA7 I;  4Y7N I;  4A3D I;  1RLY A;  4A3K I;  2V3V A;  2KPI A;  4NBF A;  4BBR I;  2F4M A;  1Y1W I;  3MZK B;  2OTJ Z;  1VQP Z;  1Y1V I;  5D1O B;  3OW2 Z;  1QF8 A;  2W03 A;  2WB1 A;  1KD1 2;  1VQ8 Z;  5T67 A;  2OOY B;  4NBC A;  4A3J I;  1W2B Y;  3J7A 4;  2E2I I;  2GU2 A;  2NVY I;  4E31 A;  3PO3 I;  1VQ9 1;  2DE6 A;  2Q4Z A;  5D1P A;  3EER A;  4NBE A;  3I4N I;  2NAP A;  1TWF I;  1VQM 1;  1TFI A;  3GTM S;  2R6M A;  3NH5 A;  3KIH A;  5C4X I;  3CCR 1;  1JWH C;  3HOX I;  1KQS Y;  1YIJ 1;  3S17 I;  5C3E I;  1X3W A;  2AKL A;  1QXF A;  2P28 A;  3S1M I;  2LEX A;  2WAQ A;  1S7M A;  1QVG Y;  3BG1 B;  4RVH A;  3MZL B;  4CL1 A;  2QR1 B;  4S1T A;  1Q7Y 1;  3D2L A;  3IR7 A;  2YU9 I;  4MD7 A;  1YJ9 1;  1VQN Z;  1YJN 1;  3CC4 1;  4NOZ A;  1YHQ 1;  2JA8 I;  4NBG A;  3CC2 1;  3S1Q I;  1L1O C;  4NH1 C;  1YIT Z;  1VQ7 1;  1VQ5 Z;  4NBB A;  1N2F A;  2JNY A;  4A3M I;  2QRD B;  3CC2 Z;  4NBA A;  2KI7 B;  1YI2 1;  2VPW A;  1YJ9 Z;  2VPY A;  3J80 b;  3D6W A;  3J80 f;  1K73 1;  1QYP A;  3NDJ A;  5IT9 f;  2QA4 Z;  4NBD A;  3GTK I;  2JIO A;  3VB9 A;  1S72 1;  1Q86 2;  1Z01 A;  3CCU Z;  2OTL Z;  2E2H I;  2VPX A;  1Z02 A;  3P5J B;  4XX2 A;  5T6B A;  3FQM A;  3J81 f;  1S72 Z;  5A2Q f;  2M6N A;  3FQQ A;  3NH4 A;  1K73 2;  3CCU 1;  4A3F I;  2P3Y A;  3CC4 Z;  1VQ4 1;  3G6E Z;  3FKI I;  4RVD A;  4MD8 A;  3GTM I;  3VMG A;  2RBL A;  3G4S Z;  2NVQ I;  3CQZ I;  3F3F C;  3S16 I;  3I55 Z;  2JR6 A;  2QRE B;  2E7Z A;  2W04 A;  4RS4 A;  3CCL 1;  4RVG A;  4TNU A;  1K8A 2;  1ZB9 A;  2IZ3 A;  2JA6 I;  3M3Y I;  4BBS I;  4DK1 A;  4NB8 A;  5IP9 I;  2HU9 A;  1KD1 1;  1Z03 A;  3CCM 1;  3HOU I;  1KC8 1;  4HGZ A;  3G4S 1;  3TDH B;  2OZK A;  1VQP 1;  4A3B I;  1M90 1;  1RQF A;  3CME 1;  1K9M 2;  4MD9 A;  3G71 1;  1Y1V S;  2RHB A;  4BY7 I;  1USP A;  1DL6 A;  1NJI 1;  3PO3 S;  2QEX Z;  1AA6 A; 
#chains in the Genus database with same CATH homology
 3CD6 1;  1P9N A;  5IT9 b;  4Y52 I;  1QVG Z;  3CCS 1;  2HF1 A;  2LIY A;  3RZD I;  2OTJ 1;  3CC7 1;  1RO0 A;  5C4J I;  2DE7 A;  1YUK A;  2PK7 A;  2K5R A;  2GTH A;  3G71 Z;  1X3Z A;  3S1N I;  1VQL Z;  4MRI A;  3CCJ Z;  1KRL A;  1YI2 Z;  2R7Z I;  2YAD A;  3CD6 Z;  3NH8 A;  3CCS Z;  3VMH A;  2QKD A;  2IZ4 A;  3CCJ 1;  4A3E I;  4DQY B;  3IF8 A;  2VUG A;  3QWU A;  1TWH I;  3K7A I;  4A3I I;  3H3V J;  1VQN 1;  4E30 A;  5IP7 I;  2J6A A;  2QEX 1;  1Q82 2;  2V8J A;  3HOY I;  3LUS A;  3OW2 Y;  1VQM Z;  3Q87 A;  4BXX I;  1K8A 1;  1YJW 1;  1USP B;  2V8I A;  5AN9 F;  2GTI A;  3CPW Y;  4E2X A;  3RZO I;  4E2Y A;  1TWC I;  3IFU A;  4E32 A;  3EED A;  1JJ2 Z;  2G2K A;  2QLV B;  4MXU A;  4A3G I;  3U50 C;  1SFO I;  2Q51 A;  1YHQ Z;  2F4O A;  1VQ8 1;  1VQL 1;  3CCL Z;  1RNI A;  3CCE 1;  1WW9 A;  5T64 A;  4EWC A;  2QRC B;  1M90 2;  2QA4 1;  4DGL A;  1QVF Y;  3CCQ Z;  1QVF Z;  1YJW Z;  1VQK Z;  4RVF A;  3GTJ I;  4X6A I;  2OTL 1;  2I3C A;  3CCE Z;  1NUI A;  3JAM b;  3D9X A;  4HH4 A;  2O53 A;  2M48 A;  1VQ7 Z;  1VQO 1;  3I4M I;  3M4O I;  1VQK 1;  3S2H I;  3CCR Z;  1M1K 1;  1I3Q I;  1YIJ Z;  1VQ4 Z;  2NVT I;  2VUM I;  1VQ6 1;  3GCF A;  1VQ9 Z;  4E2W A;  3S15 I;  2V8K A;  3HKZ A;  1YIT 1;  2O4H A;  1VQ6 Z;  3MON A;  1Q81 1;  3HOW I;  2RT9 A;  1WCM I;  3NFZ A;  4NFR A;  1VLA A;  3TE5 B;  1ML8 A;  2PMZ A;  4QTU A;  3JAM f;  3CPW Z;  1VQO Z;  1K9M 1;  2R92 I;  3CCV Z;  1N8R 2;  2JMO A;  1YJN Z;  5D1O A;  1M1K 2;  3HOZ I;  4MON A;  4AYB A;  2K3R A;  2RPR A;  1ZB8 A;  1W2B Z;  2OOX B;  3GTO I;  3I55 1;  3H0G I;  3CXC Y;  2R93 I;  3CCQ 1;  3CCV 1;  3GTG I;  1VQ5 1;  1KC8 2;  1K83 I;  4RV9 A;  1Q82 1;  2JS4 A;  4E2Z A;  1R9T I;  4A93 I;  3BG0 B;  1NP6 A;  5CM2 M;  1NJI 2;  4HGY A;  3T4N B;  3I56 1;  2BJO A;  5LL6 f;  3CMA Z;  3CC7 Z;  3KIF A;  3S2D I;  3GKQ A;  3G6E 1;  2DE5 A;  2H85 A;  3S1R I;  2LFU A;  3PO2 I;  1LQL A;  1ZH1 A;  2RIQ A;  5FLM I;  3GTQ I;  4E33 A;  4QTT A;  1RO4 A;  2VF1 A;  1I6H I;  3F3P C;  5A2Q b;  1TWA I;  1Q7Y 2;  4NBH A;  3GTL I;  2JUB A;  3CCM Z;  3I07 A;  1JJ2 Y;  3VMI A;  1PFT A;  5FLX b;  3CXC Z;  1YUA A;  4MH4 A;  2JA5 I;  2EGT A;  1I50 I;  1Q81 2;  3VTN A;  4A3C I;  1RO2 A;  3HOV I;  3J81 b;  3CME Z;  3GTP I;  2ZAE B;  3I56 Z;  2PM9 A;  2Y0S A;  3CMA 1;  2E2J I;  2NVX I;  1KQS Z;  4A3L I;  3S14 I;  1Q86 1;  5C44 I;  1TWG I;  3NDI A;  2E9H A;  1X0T A;  4BY1 I;  2B63 I;  3ESW A;  1WII A;  1N8R 1;  5FLX f;  3IX0 A;  2JA7 I;  4Y7N I;  4A3D I;  1RLY A;  4A3K I;  2KPI A;  4NBF A;  4BBR I;  2F4M A;  1Y1W I;  3MZK B;  2OTJ Z;  1VQP Z;  1Y1V I;  5D1O B;  3OW2 Z;  1QF8 A;  2W03 A;  2WB1 A;  1KD1 2;  1VQ8 Z;  5T67 A;  2OOY B;  4NBC A;  4A3J I;  1W2B Y;  3J7A 4;  2E2I I;  2GU2 A;  2NVY I;  4E31 A;  3PO3 I;  1VQ9 1;  2DE6 A;  2Q4Z A;  5D1P A;  3EER A;  4NBE A;  3I4N I;  1TWF I;  1VQM 1;  1TFI A;  3GTM S;  2R6M A;  3NH5 A;  3KIH A;  5C4X I;  3CCR 1;  1JWH C;  3HOX I;  1KQS Y;  1YIJ 1;  3S17 I;  5C3E I;  1X3W A;  2AKL A;  2P28 A;  3S1M I;  2WAQ A;  1S7M A;  1QVG Y;  3BG1 B;  4RVH A;  3MZL B;  4CL1 A;  2QR1 B;  4S1T A;  1Q7Y 1;  2YU9 I;  4MD7 A;  1YJ9 1;  1VQN Z;  1YJN 1;  3CC4 1;  4NOZ A;  1YHQ 1;  2JA8 I;  4NBG A;  3CC2 1;  3S1Q I;  1L1O C;  4NH1 C;  1YIT Z;  1VQ7 1;  1VQ5 Z;  4NBB A;  1N2F A;  2JNY A;  4A3M I;  2QRD B;  3CC2 Z;  4NBA A;  2KI7 B;  1YI2 1;  1YJ9 Z;  3J80 b;  3D6W A;  3J80 f;  1K73 1;  1QYP A;  3NDJ A;  5IT9 f;  2QA4 Z;  4NBD A;  3GTK I;  3VB9 A;  1S72 1;  1Q86 2;  1Z01 A;  3CCU Z;  2OTL Z;  2E2H I;  1Z02 A;  3P5J B;  4XX2 A;  5T6B A;  3FQM A;  3J81 f;  1S72 Z;  5A2Q f;  2M6N A;  3FQQ A;  3NH4 A;  1K73 2;  3CCU 1;  4A3F I;  2P3Y A;  3CC4 Z;  1VQ4 1;  3G6E Z;  3FKI I;  4RVD A;  4MD8 A;  3GTM I;  3VMG A;  2RBL A;  3G4S Z;  2NVQ I;  3CQZ I;  3F3F C;  3S16 I;  3I55 Z;  2JR6 A;  2QRE B;  2W04 A;  4RS4 A;  3CCL 1;  4RVG A;  4TNU A;  1K8A 2;  1ZB9 A;  2IZ3 A;  2JA6 I;  3M3Y I;  4BBS I;  4DK1 A;  4NB8 A;  5IP9 I;  2HU9 A;  1KD1 1;  1Z03 A;  3CCM 1;  3HOU I;  1KC8 1;  4HGZ A;  3G4S 1;  3TDH B;  2OZK A;  1VQP 1;  4A3B I;  1M90 1;  1RQF A;  3CME 1;  1K9M 2;  4MD9 A;  3G71 1;  1Y1V S;  2RHB A;  4BY7 I;  1USP A;  1DL6 A;  1NJI 1;  3PO3 S;  2QEX Z;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...