3I561

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56100
1Q821 3CCM1 1VQ51 1KD11 1N8R2 1K9M2 1M1K1 3CCS1 3CC21 3CCV1 3CPWY 1JJ2Z 1YIJZ 1VQK1 1VQ91 1VQ71 1KD12 1YJ9Z 1K732 3CC4Z 1QVGZ 3CCJZ 1Q7Y2 2OTL1 1N8R1 3CXCZ 3CCMZ 3I551 3CME1 2QEX1 1Q861 1K9M1 1VQ5Z 3CD61 2OTJ1 1S721 1QVFY 1YHQ1 3CCSZ 3CC2Z 1VQM1 3CCVZ 3OW2Z 3CCL1 1VQKZ 1VQ9Z 1K731 1K8A2 1Q862 1VQ7Z 3CCQ1 1W2BZ 1Q7Y1 3G6E1 1KC82 2OTLZ 3CPWZ 3CCE1 3CMEZ 3I55Z 2QEXZ 2OTJZ 1NJI2 3CD6Z 1S72Z 1YHQZ 3G711 1Q812 1KQSZ 1YJN1 3CCR1 1VQMZ 1VQ61 2QA41 1K8A1 3CC71 3CCLZ 1JJ2Y 1VQO1 3CCQZ 1VQP1 1VQN1 3I561 1M902 1KC81 1QVGY 3G6EZ 1QVFZ 1YIT1 1NJI1 3CMA1 3CCEZ 1Q811 1VQ41 1VQL1 3G71Z 1YJNZ 1YJW1 3CCRZ 1VQ6Z 2QA4Z 3CC7Z 3OW2Y 1VQOZ 1M901 3G4S1 3CCU1 1VQPZ 1W2BY 1VQNZ 3I56Z 1YI21 1VQ81 1YITZ 3CMAZ 1Q822 1VQ4Z 1VQLZ 1KQSY 1YJWZ 1M1K2 3CXCY 1YIJ1 1YJ91 3G4SZ 3CCUZ 3CC41 1VQ8Z 1YI2Z 3CCJ1
chains in the Genus database with same CATH superfamily
2RBLA 4CL1A 3MONA 4E2XA 2VF1A 3F3PC 1VQ51 2VPWA 1KD11 3D2LA 1M1K1 1RNIA 3NFZA 4BBSI 4NB8A 3VTNA 1JJ2Z 1VQ71 1KD12 3GTPI 2E7ZA 2PMZA 3CC4Z 3CCJZ 1S7MA 2WAQA 2OTL1 3CCMZ 2QEX1 2VUMI 1Q861 3HOWI 5FLXb 1VQM1 1Z01A 3OW2Z 2W03A 1VQKZ 1VQ9Z 1K731 1K8A2 1Q862 4Y52I 1W2BZ 5C4XI 3M4OI 1Q7Y1 4HGYA 5IP9I 4A3CI 3NH5A 4A3FI 3J81f 1I6HI 5D1OA 2GTIA 4TNUA 3G711 2NVXI 3CC71 3RZDI 2QR1B 3CCLZ 1JJ2Y 1VQO1 2RIQA 2JIPA 1VQP1 3GCFA 2JIMA 3I561 3FQMA 4S1TA 4E30A 5CM2M 1NP6A 2QRDB 1Y1WI 1KRLA 3CMA1 2JNYA 2R92I 2OZKA 3FKII 3QWUA 1Q811 1VQ41 1P9NA 1YJNZ 4A93I 3OW2Y 4E32A 2ZAEB 2V3VA 1M901 1W2BY 1LQLA 2HU9A 1YITZ 2JA8I 1YUKA 3NDIA 5C3EI 4MD9A 2KPIA 1YJWZ 1Y8CA 2OOXB 1N2FA 4RS4A 3ESWA 3KIHA 5IT9f 3IX0A 2R7ZI 4HGZA 3NH4A 2QRCB 3CCUZ 3BG0B 1VQ8Z 3JAMb 1RO4A 4MRIA 4QTUA 2M6NA 3GTMI 1USPB 4NBGA 5C4JI 1WIIA 1N8R2 4NBHA 1K9M2 3CCS1 2E2II 2JMOA 3CPWY 1YIJZ 3BG1B 1USPA 1ZH1A 2QLVB 1Z03A 3J80f 4A3LI 3HOXI 3S1MI 3U50C 2QREB 3MZKB 4NBFA 4DQYB 1NUIA 3I551 1YUAA 3CD61 3F3FC 1S721 4NH1C 1QVFY 1I50I 3CC2Z 2JIQA 4BXXI 3CCVZ 2DE5A 2IV2X 2P3YA 3IR7A 5FLXf 2B63I 2LFUA 3CCQ1 3TDHB 1I3QI 2YU9I 5T67A 1ZB8A 5T6BA 5FLMI 4Y7NI 2RPRA 3CMEZ 2OTJZ 1NJI2 1Y1VI 2JUBA 4MH4A 1X3ZA 4MXUA 2V45A 1YHQZ 3CCR1 4A3DI 1WZNA 1K8A1 1PFTA 3MZLB 5D1PA 1TWAI 3PO3S 5AN9F 3I07A 4RVFA 2RT9A 3G6EZ 3IF8A 3FQQA 1TWGI 5D1OB 4A3GI 2Q4ZA 3CCEZ 3I4MI 4BY7I 1VQ6Z 1L1OC 2QA4Z 4RVHA 2VPZA 4E2WA 5A2Qb 2AYDA 3EERA 1VQNZ 3EEDA 2JA7I 3I4NI 3CQZI 2G2KA 3NDJA 2O4HA 4BBRI 1Q822 4DGLA 1TFIA 5LL6f 1RO0A 1VQLZ 2NAPA 2JIRA 2M48A 2E2HI 2JR6A 3G4SZ 3CC41 1YI2Z 3RZOI 3CCJ1 1WCMI 3GTGI 4DK1A 3CCM1 4NBDA 1RO2A 1FDOA 1VQK1 3GTKI 1VQ91 2E9HA 1Q16A 1YJ9Z 1FDIA 3K7AI 3S1NI 3S2HI 5C44I 2V8KA 3KIFA 2V8IA 2DE6A 1QXFA 1N8R1 1JWHC 3CXCZ 1K9M1 1VQ5Z 4RVDA 4RV9A 3GKQA 4A3BI 1TWFI 4NFRA 1RQFA 4MONA 3CCL1 3T4NB 1VQ7Z 2PM9A 1AA6A 2R93I 2YADA 1KC82 1TWHI 1DL6A 2OTLZ 2QEXZ 1R9TI 1YJN1 1VQMZ 2JA5I 3S1RI 2VPXA 3NH8A 2V8JA 2R6MA 3M3YI 3HOUI 3PO2I 2OOYB 4MD7A 1K83I 2AKLA 1YIT1 1NJI1 3S14I 3S16I 2LIYA 4A3JI 2Q51A 3G71Z 1YJW1 4NBCA 2JS4A 3CC7Z 2RHBA 1VQOZ 1ML8A 3CCU1 1VQPZ 3I56Z 1SFOI 4NBEA 1VQ81 4EWCA 5A2Qf 3CMAZ 2DE7A 1RLYA 3J80b 3J7A4 1VQ4Z 1M1K2 1YIJ1 3D6WA 3HKZA 1ZB9A 2NVTI 2HF1A 5T64A 2EGTA 1WW9A 4E31A 3HOZI 3H3VJ 1Q821 4NOZA 2K3RA 3IFUA 4BY1I 4E2ZA 4NBAA 3D9XA 3CC21 3CCV1 2JA6I 2I3CA 4X6AI 2J6AA 2O53A 2F4MA 1K732 4RVGA 1QVGZ 3GTQI 2LEXA 1Q7Y2 2IZ4A 4HH4A 4QTTA 3CME1 2OTJ1 2F4OA 2WB1A 3GTMS 1YHQ1 3CCSZ 2P28A 3JAMf 4NB9A 4A3EI 4A3KI 4E2YA 2GTHA 1SIWA 4A3MI 3PO3I 2KI7B 3LUSA 3G6E1 3J81b 3GTOI 3CPWZ 3CCE1 3S17I 3I55Z 3CD6Z 3VB9A 1S72Z 2VUGA 1KQSZ 1Q812 1QYPA 1VQ61 2QA41 3VMGA 2BJOA 5IP7I 2W04A 3CCQZ 1VQN1 4MD8A 4AYBA 2PK7A 1M902 1KC81 3Q87A 1QVGY 3VMHA 4NBBA 1QVFZ 2NVYI 3TE5B 3VMIA 3S15I 3S1QI 1VQL1 2NVQI 1VLAA 1Y1VS 3CCRZ 2QKDA 4XX2A 1X0TA 2K5RA 2VPYA 3G4S1 2IZ3A 4E33A 4A3II 1YI21 2GU2A 1Z02A 1X3WA 3GTJI 1KQSY 5IT9b 1WJ2A 2Y0SA 3P5JB 3CXCY 2E2JI 2H85A 2JIOA 1YJ91 3GTLI 3S2DI 1QF8A 1TWCI 3H0GI 3HOVI 3HOYI
chains in the Genus database with same CATH topology
2RBLA 4CL1A 3MONA 4E2XA 2VF1A 3F3PC 1VQ51 1KD11 1M1K1 1RNIA 3NFZA 4BBSI 4NB8A 3VTNA 1JJ2Z 1VQ71 1KD12 3GTPI 2PMZA 3CC4Z 3CCJZ 1S7MA 2WAQA 2OTL1 3CCMZ 2QEX1 2VUMI 1Q861 3HOWI 5FLXb 1VQM1 1Z01A 3OW2Z 2W03A 1VQKZ 1VQ9Z 1K731 1K8A2 1Q862 4Y52I 1W2BZ 5C4XI 3M4OI 1Q7Y1 4HGYA 5IP9I 4A3CI 3NH5A 4A3FI 3J81f 1I6HI 5D1OA 2GTIA 4TNUA 3G711 2NVXI 3CC71 3RZDI 2QR1B 3CCLZ 1JJ2Y 1VQO1 2RIQA 1VQP1 3GCFA 3I561 3FQMA 4S1TA 4E30A 5CM2M 1NP6A 2QRDB 1Y1WI 1KRLA 3CMA1 2JNYA 2R92I 2OZKA 3FKII 3QWUA 1Q811 1VQ41 1P9NA 1YJNZ 4A93I 3OW2Y 4E32A 2ZAEB 1M901 1W2BY 1LQLA 2HU9A 1YITZ 2JA8I 1YUKA 3NDIA 5C3EI 4MD9A 2KPIA 1YJWZ 2OOXB 1N2FA 4RS4A 3ESWA 3KIHA 5IT9f 3IX0A 2R7ZI 4HGZA 3NH4A 2QRCB 3CCUZ 3BG0B 1VQ8Z 3JAMb 1RO4A 4MRIA 4QTUA 2M6NA 3GTMI 1USPB 4NBGA 5C4JI 1WIIA 1N8R2 4NBHA 1K9M2 3CCS1 2E2II 2JMOA 3CPWY 1YIJZ 3BG1B 1USPA 1ZH1A 2QLVB 1Z03A 3J80f 4A3LI 3HOXI 3S1MI 3U50C 2QREB 3MZKB 4NBFA 4DQYB 1NUIA 3I551 1YUAA 3CD61 3F3FC 1S721 4NH1C 1QVFY 1I50I 3CC2Z 4BXXI 3CCVZ 2DE5A 2B63I 2P3YA 5FLXf 2LFUA 3CCQ1 3TDHB 1I3QI 2YU9I 5T67A 1ZB8A 5T6BA 5FLMI 4Y7NI 2RPRA 3CMEZ 2OTJZ 1NJI2 1Y1VI 2JUBA 4MH4A 1X3ZA 4MXUA 1YHQZ 3CCR1 4A3DI 1K8A1 1PFTA 3MZLB 5D1PA 1TWAI 3PO3S 5AN9F 3I07A 4RVFA 2RT9A 3G6EZ 3IF8A 3FQQA 1TWGI 5D1OB 4A3GI 2Q4ZA 3CCEZ 3I4MI 4BY7I 1VQ6Z 1L1OC 2QA4Z 4RVHA 4E2WA 5A2Qb 3EERA 1VQNZ 3EEDA 2JA7I 3I4NI 3CQZI 2G2KA 3NDJA 2O4HA 4BBRI 1Q822 4DGLA 1TFIA 5LL6f 1RO0A 1VQLZ 2M48A 2E2HI 2JR6A 3G4SZ 3CC41 1YI2Z 3RZOI 3CCJ1 1WCMI 3GTGI 4DK1A 3CCM1 4NBDA 1RO2A 1VQK1 3GTKI 1VQ91 2E9HA 1YJ9Z 3K7AI 3S1NI 3S2HI 5C44I 2V8KA 3KIFA 2V8IA 2DE6A 1N8R1 1JWHC 3CXCZ 1K9M1 1VQ5Z 4RVDA 4RV9A 3GKQA 4A3BI 1TWFI 4NFRA 1RQFA 4MONA 3CCL1 3T4NB 1VQ7Z 2PM9A 2R93I 2YADA 1KC82 1TWHI 1DL6A 2OTLZ 2QEXZ 1R9TI 1YJN1 1VQMZ 2JA5I 3S1RI 3NH8A 2V8JA 2R6MA 3M3YI 3HOUI 3PO2I 2OOYB 4MD7A 1K83I 2AKLA 1YIT1 1NJI1 3S14I 3S16I 2LIYA 4A3JI 2Q51A 3G71Z 1YJW1 4NBCA 2JS4A 3CC7Z 2RHBA 1VQOZ 1ML8A 3CCU1 1VQPZ 3I56Z 1SFOI 4NBEA 1VQ81 4EWCA 5A2Qf 3CMAZ 2DE7A 1RLYA 3J80b 3J7A4 1VQ4Z 1M1K2 1YIJ1 3D6WA 3HKZA 1ZB9A 2NVTI 2HF1A 5T64A 2EGTA 1WW9A 4E31A 3HOZI 3H3VJ 1Q821 4NOZA 2K3RA 3IFUA 4BY1I 4E2ZA 4NBAA 3D9XA 3CC21 3CCV1 2JA6I 2I3CA 4X6AI 2J6AA 2O53A 2F4MA 1K732 4RVGA 1QVGZ 3GTQI 1Q7Y2 2IZ4A 4HH4A 4QTTA 3CME1 2OTJ1 2F4OA 2WB1A 3GTMS 1YHQ1 3CCSZ 2P28A 3JAMf 4NB9A 4A3EI 4A3KI 4E2YA 2GTHA 4A3MI 3PO3I 2KI7B 3LUSA 3G6E1 3J81b 3GTOI 3CPWZ 3CCE1 3S17I 3I55Z 3CD6Z 3VB9A 1S72Z 2VUGA 1KQSZ 1Q812 1QYPA 1VQ61 2QA41 3VMGA 2BJOA 5IP7I 2W04A 3CCQZ 1VQN1 4MD8A 4AYBA 2PK7A 1M902 1KC81 3Q87A 1QVGY 3VMHA 4NBBA 1QVFZ 2NVYI 3TE5B 3VMIA 3S15I 3S1QI 1VQL1 2NVQI 1VLAA 1Y1VS 3CCRZ 2QKDA 4XX2A 1X0TA 2K5RA 3G4S1 2IZ3A 4E33A 4A3II 1YI21 2GU2A 1Z02A 1X3WA 3GTJI 1KQSY 5IT9b 2Y0SA 3P5JB 3CXCY 2E2JI 2H85A 1YJ91 3GTLI 3S2DI 1QF8A 1TWCI 3H0GI 3HOVI 3HOYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 1;  3CCM 1;  1VQ5 1;  1KD1 1;  1N8R 2;  1K9M 2;  1M1K 1;  3CCS 1;  3CC2 1;  3CCV 1;  3CPW Y;  1JJ2 Z;  1YIJ Z;  1VQK 1;  1VQ9 1;  1VQ7 1;  1KD1 2;  1YJ9 Z;  1K73 2;  3CC4 Z;  1QVG Z;  3CCJ Z;  1Q7Y 2;  2OTL 1;  1N8R 1;  3CXC Z;  3CCM Z;  3I55 1;  3CME 1;  2QEX 1;  1Q86 1;  1K9M 1;  1VQ5 Z;  3CD6 1;  2OTJ 1;  1S72 1;  1QVF Y;  1YHQ 1;  3CCS Z;  3CC2 Z;  1VQM 1;  3CCV Z;  3OW2 Z;  3CCL 1;  1VQK Z;  1VQ9 Z;  1K73 1;  1K8A 2;  1Q86 2;  1VQ7 Z;  3CCQ 1;  1W2B Z;  1Q7Y 1;  3G6E 1;  1KC8 2;  2OTL Z;  3CPW Z;  3CCE 1;  3CME Z;  3I55 Z;  2QEX Z;  2OTJ Z;  1NJI 2;  3CD6 Z;  1S72 Z;  1YHQ Z;  3G71 1;  1Q81 2;  1KQS Z;  1YJN 1;  3CCR 1;  1VQM Z;  1VQ6 1;  2QA4 1;  1K8A 1;  3CC7 1;  3CCL Z;  1JJ2 Y;  1VQO 1;  3CCQ Z;  1VQP 1;  1VQN 1;  3I56 1;  1M90 2;  1KC8 1;  1QVG Y;  3G6E Z;  1QVF Z;  1YIT 1;  1NJI 1;  3CMA 1;  3CCE Z;  1Q81 1;  1VQ4 1;  1VQL 1;  3G71 Z;  1YJN Z;  1YJW 1;  3CCR Z;  1VQ6 Z;  2QA4 Z;  3CC7 Z;  3OW2 Y;  1VQO Z;  1M90 1;  3G4S 1;  3CCU 1;  1VQP Z;  1W2B Y;  1VQN Z;  3I56 Z;  1YI2 1;  1VQ8 1;  1YIT Z;  3CMA Z;  1Q82 2;  1VQ4 Z;  1VQL Z;  1KQS Y;  1YJW Z;  1M1K 2;  3CXC Y;  1YIJ 1;  1YJ9 1;  3G4S Z;  3CCU Z;  3CC4 1;  1VQ8 Z;  1YI2 Z;  3CCJ 1; 
#chains in the Genus database with same CATH topology
 2RBL A;  4CL1 A;  3MON A;  4E2X A;  2VF1 A;  3F3P C;  1VQ5 1;  2VPW A;  1KD1 1;  3D2L A;  1M1K 1;  1RNI A;  3NFZ A;  4BBS I;  4NB8 A;  3VTN A;  1JJ2 Z;  1VQ7 1;  1KD1 2;  3GTP I;  2E7Z A;  2PMZ A;  3CC4 Z;  3CCJ Z;  1S7M A;  2WAQ A;  2OTL 1;  3CCM Z;  2QEX 1;  2VUM I;  1Q86 1;  3HOW I;  5FLX b;  1VQM 1;  1Z01 A;  3OW2 Z;  2W03 A;  1VQK Z;  1VQ9 Z;  1K73 1;  1K8A 2;  1Q86 2;  4Y52 I;  1W2B Z;  5C4X I;  3M4O I;  1Q7Y 1;  4HGY A;  5IP9 I;  4A3C I;  3NH5 A;  4A3F I;  3J81 f;  1I6H I;  5D1O A;  2GTI A;  4TNU A;  3G71 1;  2NVX I;  3CC7 1;  3RZD I;  2QR1 B;  3CCL Z;  1JJ2 Y;  1VQO 1;  2RIQ A;  2JIP A;  1VQP 1;  3GCF A;  2JIM A;  3I56 1;  3FQM A;  4S1T A;  4E30 A;  5CM2 M;  1NP6 A;  2QRD B;  1Y1W I;  1KRL A;  3CMA 1;  2JNY A;  2R92 I;  2OZK A;  3FKI I;  3QWU A;  1Q81 1;  1VQ4 1;  1P9N A;  1YJN Z;  4A93 I;  3OW2 Y;  4E32 A;  2ZAE B;  2V3V A;  1M90 1;  1W2B Y;  1LQL A;  2HU9 A;  1YIT Z;  2JA8 I;  1YUK A;  3NDI A;  5C3E I;  4MD9 A;  2KPI A;  1YJW Z;  1Y8C A;  2OOX B;  1N2F A;  4RS4 A;  3ESW A;  3KIH A;  5IT9 f;  3IX0 A;  2R7Z I;  4HGZ A;  3NH4 A;  2QRC B;  3CCU Z;  3BG0 B;  1VQ8 Z;  3JAM b;  1RO4 A;  4MRI A;  4QTU A;  2M6N A;  3GTM I;  1USP B;  4NBG A;  5C4J I;  1WII A;  1N8R 2;  4NBH A;  1K9M 2;  3CCS 1;  2E2I I;  2JMO A;  3CPW Y;  1YIJ Z;  3BG1 B;  1USP A;  1ZH1 A;  2QLV B;  1Z03 A;  3J80 f;  4A3L I;  3HOX I;  3S1M I;  3U50 C;  2QRE B;  3MZK B;  4NBF A;  4DQY B;  1NUI A;  3I55 1;  1YUA A;  3CD6 1;  3F3F C;  1S72 1;  4NH1 C;  1QVF Y;  1I50 I;  3CC2 Z;  2JIQ A;  4BXX I;  3CCV Z;  2DE5 A;  2IV2 X;  2P3Y A;  3IR7 A;  5FLX f;  2B63 I;  2LFU A;  3CCQ 1;  3TDH B;  1I3Q I;  2YU9 I;  5T67 A;  1ZB8 A;  5T6B A;  5FLM I;  4Y7N I;  2RPR A;  3CME Z;  2OTJ Z;  1NJI 2;  1Y1V I;  2JUB A;  4MH4 A;  1X3Z A;  4MXU A;  2V45 A;  1YHQ Z;  3CCR 1;  4A3D I;  1WZN A;  1K8A 1;  1PFT A;  3MZL B;  5D1P A;  1TWA I;  3PO3 S;  5AN9 F;  3I07 A;  4RVF A;  2RT9 A;  3G6E Z;  3IF8 A;  3FQQ A;  1TWG I;  5D1O B;  4A3G I;  2Q4Z A;  3CCE Z;  3I4M I;  4BY7 I;  1VQ6 Z;  1L1O C;  2QA4 Z;  4RVH A;  2VPZ A;  4E2W A;  5A2Q b;  2AYD A;  3EER A;  1VQN Z;  3EED A;  2JA7 I;  3I4N I;  3CQZ I;  2G2K A;  3NDJ A;  2O4H A;  4BBR I;  1Q82 2;  4DGL A;  1TFI A;  5LL6 f;  1RO0 A;  1VQL Z;  2NAP A;  2JIR A;  2M48 A;  2E2H I;  2JR6 A;  3G4S Z;  3CC4 1;  1YI2 Z;  3RZO I;  3CCJ 1;  1WCM I;  3GTG I;  4DK1 A;  3CCM 1;  4NBD A;  1RO2 A;  1FDO A;  1VQK 1;  3GTK I;  1VQ9 1;  2E9H A;  1Q16 A;  1YJ9 Z;  1FDI A;  3K7A I;  3S1N I;  3S2H I;  5C44 I;  2V8K A;  3KIF A;  2V8I A;  2DE6 A;  1QXF A;  1N8R 1;  1JWH C;  3CXC Z;  1K9M 1;  1VQ5 Z;  4RVD A;  4RV9 A;  3GKQ A;  4A3B I;  1TWF I;  4NFR A;  1RQF A;  4MON A;  3CCL 1;  3T4N B;  1VQ7 Z;  2PM9 A;  1AA6 A;  2R93 I;  2YAD A;  1KC8 2;  1TWH I;  1DL6 A;  2OTL Z;  2QEX Z;  1R9T I;  1YJN 1;  1VQM Z;  2JA5 I;  3S1R I;  2VPX A;  3NH8 A;  2V8J A;  2R6M A;  3M3Y I;  3HOU I;  3PO2 I;  2OOY B;  4MD7 A;  1K83 I;  2AKL A;  1YIT 1;  1NJI 1;  3S14 I;  3S16 I;  2LIY A;  4A3J I;  2Q51 A;  3G71 Z;  1YJW 1;  4NBC A;  2JS4 A;  3CC7 Z;  2RHB A;  1VQO Z;  1ML8 A;  3CCU 1;  1VQP Z;  3I56 Z;  1SFO I;  4NBE A;  1VQ8 1;  4EWC A;  5A2Q f;  3CMA Z;  2DE7 A;  1RLY A;  3J80 b;  3J7A 4;  1VQ4 Z;  1M1K 2;  1YIJ 1;  3D6W A;  3HKZ A;  1ZB9 A;  2NVT I;  2HF1 A;  5T64 A;  2EGT A;  1WW9 A;  4E31 A;  3HOZ I;  3H3V J;  1Q82 1;  4NOZ A;  2K3R A;  3IFU A;  4BY1 I;  4E2Z A;  4NBA A;  3D9X A;  3CC2 1;  3CCV 1;  2JA6 I;  2I3C A;  4X6A I;  2J6A A;  2O53 A;  2F4M A;  1K73 2;  4RVG A;  1QVG Z;  3GTQ I;  2LEX A;  1Q7Y 2;  2IZ4 A;  4HH4 A;  4QTT A;  3CME 1;  2OTJ 1;  2F4O A;  2WB1 A;  3GTM S;  1YHQ 1;  3CCS Z;  2P28 A;  3JAM f;  4NB9 A;  4A3E I;  4A3K I;  4E2Y A;  2GTH A;  1SIW A;  4A3M I;  3PO3 I;  2KI7 B;  3LUS A;  3G6E 1;  3J81 b;  3GTO I;  3CPW Z;  3CCE 1;  3S17 I;  3I55 Z;  3CD6 Z;  3VB9 A;  1S72 Z;  2VUG A;  1KQS Z;  1Q81 2;  1QYP A;  1VQ6 1;  2QA4 1;  3VMG A;  2BJO A;  5IP7 I;  2W04 A;  3CCQ Z;  1VQN 1;  4MD8 A;  4AYB A;  2PK7 A;  1M90 2;  1KC8 1;  3Q87 A;  1QVG Y;  3VMH A;  4NBB A;  1QVF Z;  2NVY I;  3TE5 B;  3VMI A;  3S15 I;  3S1Q I;  1VQL 1;  2NVQ I;  1VLA A;  1Y1V S;  3CCR Z;  2QKD A;  4XX2 A;  1X0T A;  2K5R A;  2VPY A;  3G4S 1;  2IZ3 A;  4E33 A;  4A3I I;  1YI2 1;  2GU2 A;  1Z02 A;  1X3W A;  3GTJ I;  1KQS Y;  5IT9 b;  1WJ2 A;  2Y0S A;  3P5J B;  3CXC Y;  2E2J I;  2H85 A;  2JIO A;  1YJ9 1;  3GTL I;  3S2D I;  1QF8 A;  1TWC I;  3H0G I;  3HOV I;  3HOY I; 
#chains in the Genus database with same CATH homology
 2RBL A;  4CL1 A;  3MON A;  4E2X A;  2VF1 A;  3F3P C;  1VQ5 1;  1KD1 1;  1M1K 1;  1RNI A;  3NFZ A;  4BBS I;  4NB8 A;  3VTN A;  1JJ2 Z;  1VQ7 1;  1KD1 2;  3GTP I;  2PMZ A;  3CC4 Z;  3CCJ Z;  1S7M A;  2WAQ A;  2OTL 1;  3CCM Z;  2QEX 1;  2VUM I;  1Q86 1;  3HOW I;  5FLX b;  1VQM 1;  1Z01 A;  3OW2 Z;  2W03 A;  1VQK Z;  1VQ9 Z;  1K73 1;  1K8A 2;  1Q86 2;  4Y52 I;  1W2B Z;  5C4X I;  3M4O I;  1Q7Y 1;  4HGY A;  5IP9 I;  4A3C I;  3NH5 A;  4A3F I;  3J81 f;  1I6H I;  5D1O A;  2GTI A;  4TNU A;  3G71 1;  2NVX I;  3CC7 1;  3RZD I;  2QR1 B;  3CCL Z;  1JJ2 Y;  1VQO 1;  2RIQ A;  1VQP 1;  3GCF A;  3I56 1;  3FQM A;  4S1T A;  4E30 A;  5CM2 M;  1NP6 A;  2QRD B;  1Y1W I;  1KRL A;  3CMA 1;  2JNY A;  2R92 I;  2OZK A;  3FKI I;  3QWU A;  1Q81 1;  1VQ4 1;  1P9N A;  1YJN Z;  4A93 I;  3OW2 Y;  4E32 A;  2ZAE B;  1M90 1;  1W2B Y;  1LQL A;  2HU9 A;  1YIT Z;  2JA8 I;  1YUK A;  3NDI A;  5C3E I;  4MD9 A;  2KPI A;  1YJW Z;  2OOX B;  1N2F A;  4RS4 A;  3ESW A;  3KIH A;  5IT9 f;  3IX0 A;  2R7Z I;  4HGZ A;  3NH4 A;  2QRC B;  3CCU Z;  3BG0 B;  1VQ8 Z;  3JAM b;  1RO4 A;  4MRI A;  4QTU A;  2M6N A;  3GTM I;  1USP B;  4NBG A;  5C4J I;  1WII A;  1N8R 2;  4NBH A;  1K9M 2;  3CCS 1;  2E2I I;  2JMO A;  3CPW Y;  1YIJ Z;  3BG1 B;  1USP A;  1ZH1 A;  2QLV B;  1Z03 A;  3J80 f;  4A3L I;  3HOX I;  3S1M I;  3U50 C;  2QRE B;  3MZK B;  4NBF A;  4DQY B;  1NUI A;  3I55 1;  1YUA A;  3CD6 1;  3F3F C;  1S72 1;  4NH1 C;  1QVF Y;  1I50 I;  3CC2 Z;  4BXX I;  3CCV Z;  2DE5 A;  2B63 I;  2P3Y A;  5FLX f;  2LFU A;  3CCQ 1;  3TDH B;  1I3Q I;  2YU9 I;  5T67 A;  1ZB8 A;  5T6B A;  5FLM I;  4Y7N I;  2RPR A;  3CME Z;  2OTJ Z;  1NJI 2;  1Y1V I;  2JUB A;  4MH4 A;  1X3Z A;  4MXU A;  1YHQ Z;  3CCR 1;  4A3D I;  1K8A 1;  1PFT A;  3MZL B;  5D1P A;  1TWA I;  3PO3 S;  5AN9 F;  3I07 A;  4RVF A;  2RT9 A;  3G6E Z;  3IF8 A;  3FQQ A;  1TWG I;  5D1O B;  4A3G I;  2Q4Z A;  3CCE Z;  3I4M I;  4BY7 I;  1VQ6 Z;  1L1O C;  2QA4 Z;  4RVH A;  4E2W A;  5A2Q b;  3EER A;  1VQN Z;  3EED A;  2JA7 I;  3I4N I;  3CQZ I;  2G2K A;  3NDJ A;  2O4H A;  4BBR I;  1Q82 2;  4DGL A;  1TFI A;  5LL6 f;  1RO0 A;  1VQL Z;  2M48 A;  2E2H I;  2JR6 A;  3G4S Z;  3CC4 1;  1YI2 Z;  3RZO I;  3CCJ 1;  1WCM I;  3GTG I;  4DK1 A;  3CCM 1;  4NBD A;  1RO2 A;  1VQK 1;  3GTK I;  1VQ9 1;  2E9H A;  1YJ9 Z;  3K7A I;  3S1N I;  3S2H I;  5C44 I;  2V8K A;  3KIF A;  2V8I A;  2DE6 A;  1N8R 1;  1JWH C;  3CXC Z;  1K9M 1;  1VQ5 Z;  4RVD A;  4RV9 A;  3GKQ A;  4A3B I;  1TWF I;  4NFR A;  1RQF A;  4MON A;  3CCL 1;  3T4N B;  1VQ7 Z;  2PM9 A;  2R93 I;  2YAD A;  1KC8 2;  1TWH I;  1DL6 A;  2OTL Z;  2QEX Z;  1R9T I;  1YJN 1;  1VQM Z;  2JA5 I;  3S1R I;  3NH8 A;  2V8J A;  2R6M A;  3M3Y I;  3HOU I;  3PO2 I;  2OOY B;  4MD7 A;  1K83 I;  2AKL A;  1YIT 1;  1NJI 1;  3S14 I;  3S16 I;  2LIY A;  4A3J I;  2Q51 A;  3G71 Z;  1YJW 1;  4NBC A;  2JS4 A;  3CC7 Z;  2RHB A;  1VQO Z;  1ML8 A;  3CCU 1;  1VQP Z;  3I56 Z;  1SFO I;  4NBE A;  1VQ8 1;  4EWC A;  5A2Q f;  3CMA Z;  2DE7 A;  1RLY A;  3J80 b;  3J7A 4;  1VQ4 Z;  1M1K 2;  1YIJ 1;  3D6W A;  3HKZ A;  1ZB9 A;  2NVT I;  2HF1 A;  5T64 A;  2EGT A;  1WW9 A;  4E31 A;  3HOZ I;  3H3V J;  1Q82 1;  4NOZ A;  2K3R A;  3IFU A;  4BY1 I;  4E2Z A;  4NBA A;  3D9X A;  3CC2 1;  3CCV 1;  2JA6 I;  2I3C A;  4X6A I;  2J6A A;  2O53 A;  2F4M A;  1K73 2;  4RVG A;  1QVG Z;  3GTQ I;  1Q7Y 2;  2IZ4 A;  4HH4 A;  4QTT A;  3CME 1;  2OTJ 1;  2F4O A;  2WB1 A;  3GTM S;  1YHQ 1;  3CCS Z;  2P28 A;  3JAM f;  4NB9 A;  4A3E I;  4A3K I;  4E2Y A;  2GTH A;  4A3M I;  3PO3 I;  2KI7 B;  3LUS A;  3G6E 1;  3J81 b;  3GTO I;  3CPW Z;  3CCE 1;  3S17 I;  3I55 Z;  3CD6 Z;  3VB9 A;  1S72 Z;  2VUG A;  1KQS Z;  1Q81 2;  1QYP A;  1VQ6 1;  2QA4 1;  3VMG A;  2BJO A;  5IP7 I;  2W04 A;  3CCQ Z;  1VQN 1;  4MD8 A;  4AYB A;  2PK7 A;  1M90 2;  1KC8 1;  3Q87 A;  1QVG Y;  3VMH A;  4NBB A;  1QVF Z;  2NVY I;  3TE5 B;  3VMI A;  3S15 I;  3S1Q I;  1VQL 1;  2NVQ I;  1VLA A;  1Y1V S;  3CCR Z;  2QKD A;  4XX2 A;  1X0T A;  2K5R A;  3G4S 1;  2IZ3 A;  4E33 A;  4A3I I;  1YI2 1;  2GU2 A;  1Z02 A;  1X3W A;  3GTJ I;  1KQS Y;  5IT9 b;  2Y0S A;  3P5J B;  3CXC Y;  2E2J I;  2H85 A;  1YJ9 1;  3GTL I;  3S2D I;  1QF8 A;  1TWC I;  3H0G I;  3HOV I;  3HOY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...