3I561

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i56100
3CCJ1 3CXCY 1M901 3CC71 1Q862 1Q822 1VQ7Z 1S721 1VQPZ 1JJ2Y 1YJ91 1K8A1 3CMAZ 3CC41 1VQKZ 3G6E1 3CCU1 2QEX1 3CCV1 1M902 1KC81 3CC7Z 1NJI1 1VQ71 1W2BY 1YJNZ 1YITZ 1VQP1 3CCQZ 3OW2Z 2QEXZ 1K8A2 1YIJ1 1QVGZ 3CMA1 1VQK1 1VQ6Z 1M1K1 1KC82 1K731 1NJI2 3CC2Z 3G71Z 1VQ9Z 1YJN1 1YIT1 1YIJZ 3CCQ1 1VQ5Z 1VQ4Z 3CD6Z 1M1K2 3CCSZ 1VQ61 3I55Z 3CCL1 1YI2Z 1K732 1KQSY 3CPWY 3CPWZ 3CC21 1VQLZ 3G711 1YHQZ 1VQ91 1QVFY 1YJWZ 3CMEZ 1VQ51 1VQ41 3CD61 3CCLZ 3CCS1 1VQNZ 3CCMZ 3I551 1YI21 1Q811 3CXCZ 1VQL1 2QA4Z 1YHQ1 2OTJZ 3I56Z 3OW2Y 1YJW1 1JJ2Z 3CME1 1QVGY 1K9M1 1VQN1 1Q812 3CCM1 1KD11 1VQMZ 1VQ8Z 3G4SZ 1VQO1 2QA41 1W2BZ 1N8R1 2OTJ1 3I561 1QVFZ 1K9M2 3CCEZ 1Q7Y1 1KD12 2OTLZ 3CCRZ 1VQM1 3CCJZ 1VQ81 1VQOZ 3G4S1 1N8R2 1Q821 1Q861 1S72Z 1YJ9Z 3CCR1 3CC4Z 1Q7Y2 3CCE1 3G6EZ 2OTL1 3CCUZ 3CCVZ 1KQSZ
chains in the Genus database with same CATH superfamily
1M901 4A3GI 3Q87A 4A3KI 4RVDA 2Y0SA 1VQ7Z 3F3PC 2M6NA 3BG1B 4TNUA 3GTOI 2QRDB 1JJ2Y 2E2II 3CC41 3MONA 2QEX1 2R93I 2BJOA 2JIOA 1X0TA 3HOZI 3S1MI 1Z02A 4X6AI 2IV2X 4MD9A 3CCQZ 1VLAA 1I6HI 2JUBA 1QXFA 2HU9A 1ZH1A 1KC82 3GKQA 2IZ4A 3M4OI 1TWCI 3S1NI 3CC2Z 3S2HI 3K7AI 4NBCA 2RT9A 4NBAA 3G71Z 5D1OB 1YIJZ 1PFTA 1VQ4Z 3S17I 1VQ61 2AYDA 4MXUA 1VQLZ 2NVYI 2R7ZI 1QVFY 2JA6I 3TDHB 4XX2A 4BY1I 3CD61 3GTQI 1TFIA 1VQNZ 2QR1B 4Y7NI 4E33A 4DK1A 2V8IA 4A3EI 3J80f 3GTMS 2QA4Z 2OTJZ 3CME1 1QVGY 2K3RA 1K9M1 1Q812 3IX0A 4DQYB 2VPZA 5IP7I 1X3WA 3D6WA 3G4SZ 2B63I 4A3DI 3J81f 1JWHC 2E9HA 2NVQI 3NH5A 1QVFZ 3I4NI 1RNIA 3CCRZ 3S14I 1QF8A 2I3CA 2RPRA 3JAMb 3GTJI 1Q16A 1N8R2 3D2LA 1Q821 2AKLA 4RVGA 1RO0A 2O4HA 3CC4Z 4A3LI 2VPWA 3CCE1 4QTTA 2R92I 2JA8I 2QEXZ 1Z03A 2NAPA 3CXCY 3CC71 3VMIA 1RQFA 4E31A 3M3YI 1YJ91 2V3VA 1K8A1 3QWUA 2P28A 3G6E1 3CCU1 1SIWA 1M902 1FDOA 2GTHA 4NFRA 3HKZA 1QYPA 2JIMA 1VQP1 3OW2Z 1NUIA 3CMA1 1VQK1 1VQ6Z 5FLMI 4A3BI 2OOYB 1P9NA 3EERA 2QLVB 3VB9A 3D9XA 2J6AA 2JIPA 2JIRA 2GTIA 1YJN1 4NB8A 2EGTA 4EWCA 2E2JI 3CD6Z 3HOVI 3BG0B 3CCL1 1KQSY 3CMEZ 1VQ51 3VMHA 5IT9f 1WW9A 3J7A4 1TWHI 4NH1C 2QKDA 4MD8A 2JS4A 1YUAA 1FDIA 3FQQA 1YHQ1 2YADA 3HOUI 1JJ2Z 5C4JI 4A3II 5FLXb 1R9TI 4NBHA 4E2YA 1ZB8A 1WZNA 1RLYA 1AA6A 3KIFA 1VQO1 4Y52I 2JNYA 3NDIA 3I561 3KIHA 3S15I 2JA5I 1Z01A 4MONA 2V8KA 1K9M2 3CCEZ 1WCMI 1VQM1 3RZOI 4MRIA 2W03A 1Q861 4BBSI 1YJ9Z 3NH4A 3CCR1 3RZDI 3G6EZ 2JIQA 5T67A 3CCUZ 4E2ZA 2PK7A 3CCJ1 2QRCB 5A2Qb 1Q822 4AYBA 1S721 1VQPZ 2O53A 3CMAZ 1VQKZ 3NH8A 2F4MA 2V8JA 3CCV1 3P5JB 2ZAEB 1NJI1 1I3QI 1W2BY 1Y1VI 2DE5A 2E7ZA 1YJNZ 1K8A2 4S1TA 1Y1WI 1YIJ1 1QVGZ 3GCFA 1M1K1 2NVTI 3VTNA 2IZ3A 1K731 3GTLI 3GTKI 2E2HI 1TWFI 1YIT1 4CL1A 3U50C 3HOWI 2RBLA 1VQ5Z 4NOZA 4RVFA 4BXXI 3CPWY 1Y8CA 1ML8A 2JR6A 4A3MI 1YHQZ 1VQ91 3PO3I 4E30A 3IFUA 3I07A 3CCS1 3I551 4DGLA 1YI21 3CXCZ 4BY7I 3PO3S 2G2KA 5IP9I 3I56Z 3NDJA 1YJW1 3JAMf 2VPYA 3CCM1 1KD11 1VQMZ 3IR7A 2QREB 1L1OC 2Q4ZA 1ZB9A 1LQLA 1NP6A 4MH4A 1Q7Y1 3J80b 4E2WA 3CCJZ 1VQ81 3HOXI 3MZLB 4E2XA 3GTPI 2Q51A 2PM9A 2W04A 5C44I 4MD7A 1S72Z 4A93I 1USPB 5T6BA 4NBGA 3PO2I 2F4OA 3S1RI 3FKII 1X3ZA 3F3FC 2OTL1 3J81b 3CCVZ 4BBRI 3TE5B 1KQSZ 4HGZA 1Q862 3CQZI 2WAQA 3H0GI 3ESWA 3VMGA 2YU9I 4NBBA 3GTGI 3S16I 2R6MA 5LL6f 4RV9A 5C4XI 2NVXI 5T64A 2RIQA 1KC81 3CC7Z 3MZKB 2VUGA 2KPIA 1VQ71 2M48A 1USPA 3EEDA 1YITZ 4A3CI 4HGYA 5C3EI 3GTMI 2PMZA 5AN9F 4NBEA 4A3JI 1NJI2 3LUSA 2VUMI 2OZKA 1KRLA 5D1OA 4QTUA 1VQ9Z 1WIIA 3CCQ1 4NBDA 4RVHA 2P3YA 1M1K2 3CCSZ 3H3VJ 3I55Z 3I4MI 1YI2Z 1K732 5FLXf 2DE6A 3CC21 1YUKA 3G711 1TWAI 2HF1A 1YJWZ 1VQ41 2RHBA 3CCLZ 2DE7A 2LFUA 3CCMZ 1Y1VS 2KI7B 1Q811 4RS4A 1S7MA 3S1QI 1VQL1 1WJ2A 3NFZA 4NBFA 4E32A 2LIYA 4HH4A 1SFOI 3OW2Y 1RO2A 2OOXB 3HOYI 3S2DI 1VQN1 2JA7I 2JMOA 1VQ8Z 2K5RA 2H85A 2LEXA 2VF1A 1W2BZ 2QA41 2OTJ1 1N8R1 5CM2M 2V45A 5IT9b 5A2Qf 2GU2A 5D1PA 1KD12 2OTLZ 3FQMA 1VQOZ 3G4S1 1TWGI 1I50I 1N2FA 4A3FI 1RO4A 1K83I 3T4NB 1Q7Y2 2VPXA 1DL6A 2WB1A 3IF8A 4NB9A 3CPWZ
chains in the Genus database with same CATH topology
1M901 4A3GI 3Q87A 4A3KI 4RVDA 2Y0SA 1VQ7Z 3F3PC 2M6NA 3BG1B 4TNUA 3GTOI 2QRDB 1JJ2Y 2E2II 3CC41 3MONA 2QEX1 2R93I 2BJOA 3HOZI 1X0TA 3S1MI 1Z02A 4X6AI 4MD9A 3CCQZ 1VLAA 1I6HI 2JUBA 2HU9A 1ZH1A 1KC82 3GKQA 2IZ4A 3M4OI 1TWCI 3S1NI 3CC2Z 3S2HI 3K7AI 4NBCA 2RT9A 4NBAA 3G71Z 5D1OB 1YIJZ 1PFTA 1VQ4Z 3S17I 1VQ61 4MXUA 1VQLZ 2NVYI 2R7ZI 1QVFY 2JA6I 3TDHB 4XX2A 4BY1I 3CD61 3GTQI 1TFIA 1VQNZ 2QR1B 4Y7NI 4E33A 4DK1A 2V8IA 4A3EI 3J80f 3GTMS 2QA4Z 2OTJZ 3CME1 1QVGY 2K3RA 1K9M1 1Q812 3IX0A 4DQYB 5IP7I 1X3WA 3D6WA 3G4SZ 2B63I 4A3DI 3J81f 1JWHC 2E9HA 2NVQI 3NH5A 1QVFZ 3I4NI 1RNIA 3CCRZ 3S14I 1QF8A 2I3CA 2RPRA 3JAMb 3GTJI 1N8R2 1Q821 2AKLA 4RVGA 1RO0A 2O4HA 3CC4Z 4A3LI 3CCE1 4QTTA 2R92I 2JA8I 2QEXZ 1Z03A 3CXCY 3CC71 3VMIA 1RQFA 4E31A 3M3YI 1YJ91 1K8A1 3QWUA 2P28A 3G6E1 3CCU1 1M902 2GTHA 4NFRA 3HKZA 1QYPA 1VQP1 3OW2Z 1NUIA 3CMA1 1VQK1 1VQ6Z 5FLMI 4A3BI 2OOYB 1P9NA 3EERA 2QLVB 3VB9A 3D9XA 2J6AA 2GTIA 1YJN1 4NB8A 2EGTA 4EWCA 2E2JI 3CD6Z 3HOVI 3BG0B 3CCL1 1KQSY 3CMEZ 1VQ51 3VMHA 5IT9f 1WW9A 3J7A4 1TWHI 4NH1C 2QKDA 4MD8A 2JS4A 1YUAA 3FQQA 1YHQ1 2YADA 3HOUI 1JJ2Z 5C4JI 4A3II 5FLXb 1R9TI 4NBHA 4E2YA 1ZB8A 1RLYA 3KIFA 1VQO1 4Y52I 2JNYA 3NDIA 3I561 3KIHA 3S15I 2JA5I 1Z01A 4MONA 2V8KA 1K9M2 3CCEZ 1WCMI 1VQM1 3RZOI 4MRIA 2W03A 1Q861 4BBSI 1YJ9Z 3NH4A 3CCR1 3RZDI 3G6EZ 5T67A 3CCUZ 4E2ZA 2PK7A 3CCJ1 2QRCB 5A2Qb 1Q822 4AYBA 1S721 1VQPZ 2O53A 3CMAZ 1VQKZ 3NH8A 2F4MA 2V8JA 3CCV1 3P5JB 2ZAEB 1NJI1 1I3QI 1W2BY 1Y1VI 2DE5A 1YJNZ 1K8A2 4S1TA 1Y1WI 1YIJ1 1QVGZ 3GCFA 1M1K1 2NVTI 3VTNA 2IZ3A 1K731 3GTLI 3GTKI 2E2HI 1TWFI 1YIT1 4CL1A 3U50C 3HOWI 2RBLA 1VQ5Z 4NOZA 4RVFA 4BXXI 3CPWY 1ML8A 2JR6A 4A3MI 1YHQZ 1VQ91 3PO3I 4E30A 3IFUA 3I07A 3CCS1 3I551 4DGLA 1YI21 3CXCZ 4BY7I 3PO3S 2G2KA 5IP9I 3I56Z 3NDJA 1YJW1 3JAMf 3CCM1 1KD11 1VQMZ 2QREB 1L1OC 2Q4ZA 1ZB9A 1LQLA 1NP6A 4MH4A 1Q7Y1 3J80b 4E2WA 3CCJZ 1VQ81 3HOXI 3MZLB 4E2XA 3GTPI 2Q51A 2PM9A 2W04A 5C44I 4MD7A 1S72Z 4A93I 1USPB 5T6BA 4NBGA 3PO2I 2F4OA 3S1RI 3FKII 1X3ZA 3F3FC 2OTL1 3J81b 3CCVZ 4BBRI 3TE5B 1KQSZ 4HGZA 1Q862 3CQZI 2WAQA 3H0GI 3ESWA 3VMGA 2YU9I 4NBBA 3GTGI 3S16I 2R6MA 5LL6f 4RV9A 5C4XI 2NVXI 5T64A 2RIQA 1KC81 3CC7Z 3MZKB 2VUGA 2KPIA 1VQ71 2M48A 1USPA 3EEDA 1YITZ 4A3CI 4HGYA 5C3EI 3GTMI 2PMZA 5AN9F 4NBEA 4A3JI 1NJI2 3LUSA 2VUMI 2OZKA 1KRLA 5D1OA 4QTUA 1VQ9Z 1WIIA 3CCQ1 4NBDA 4RVHA 2P3YA 1M1K2 3CCSZ 3H3VJ 3I55Z 3I4MI 1YI2Z 1K732 5FLXf 2DE6A 3CC21 1YUKA 3G711 1TWAI 2HF1A 1YJWZ 1VQ41 2RHBA 3CCLZ 2DE7A 2LFUA 3CCMZ 1Y1VS 2KI7B 1Q811 4RS4A 1S7MA 3S1QI 1VQL1 3NFZA 4NBFA 4E32A 2LIYA 4HH4A 1SFOI 3OW2Y 1RO2A 2OOXB 3HOYI 3S2DI 1VQN1 2JA7I 2JMOA 1VQ8Z 2K5RA 2H85A 2VF1A 1W2BZ 2QA41 2OTJ1 1N8R1 5CM2M 5IT9b 5A2Qf 2GU2A 5D1PA 1KD12 2OTLZ 3FQMA 1VQOZ 3G4S1 1TWGI 1I50I 1N2FA 4A3FI 1RO4A 1K83I 3T4NB 1Q7Y2 1DL6A 2WB1A 3IF8A 4NB9A 3CPWZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ 1;  3CXC Y;  1M90 1;  3CC7 1;  1Q86 2;  1Q82 2;  1VQ7 Z;  1S72 1;  1VQP Z;  1JJ2 Y;  1YJ9 1;  1K8A 1;  3CMA Z;  3CC4 1;  1VQK Z;  3G6E 1;  3CCU 1;  2QEX 1;  3CCV 1;  1M90 2;  1KC8 1;  3CC7 Z;  1NJI 1;  1VQ7 1;  1W2B Y;  1YJN Z;  1YIT Z;  1VQP 1;  3CCQ Z;  3OW2 Z;  2QEX Z;  1K8A 2;  1YIJ 1;  1QVG Z;  3CMA 1;  1VQK 1;  1VQ6 Z;  1M1K 1;  1KC8 2;  1K73 1;  1NJI 2;  3CC2 Z;  3G71 Z;  1VQ9 Z;  1YJN 1;  1YIT 1;  1YIJ Z;  3CCQ 1;  1VQ5 Z;  1VQ4 Z;  3CD6 Z;  1M1K 2;  3CCS Z;  1VQ6 1;  3I55 Z;  3CCL 1;  1YI2 Z;  1K73 2;  1KQS Y;  3CPW Y;  3CPW Z;  3CC2 1;  1VQL Z;  3G71 1;  1YHQ Z;  1VQ9 1;  1QVF Y;  1YJW Z;  3CME Z;  1VQ5 1;  1VQ4 1;  3CD6 1;  3CCL Z;  3CCS 1;  1VQN Z;  3CCM Z;  3I55 1;  1YI2 1;  1Q81 1;  3CXC Z;  1VQL 1;  2QA4 Z;  1YHQ 1;  2OTJ Z;  3I56 Z;  3OW2 Y;  1YJW 1;  1JJ2 Z;  3CME 1;  1QVG Y;  1K9M 1;  1VQN 1;  1Q81 2;  3CCM 1;  1KD1 1;  1VQM Z;  1VQ8 Z;  3G4S Z;  1VQO 1;  2QA4 1;  1W2B Z;  1N8R 1;  2OTJ 1;  3I56 1;  1QVF Z;  1K9M 2;  3CCE Z;  1Q7Y 1;  1KD1 2;  2OTL Z;  3CCR Z;  1VQM 1;  3CCJ Z;  1VQ8 1;  1VQO Z;  3G4S 1;  1N8R 2;  1Q82 1;  1Q86 1;  1S72 Z;  1YJ9 Z;  3CCR 1;  3CC4 Z;  1Q7Y 2;  3CCE 1;  3G6E Z;  2OTL 1;  3CCU Z;  3CCV Z;  1KQS Z; 
#chains in the Genus database with same CATH topology
 1M90 1;  4A3G I;  3Q87 A;  4A3K I;  4RVD A;  2Y0S A;  1VQ7 Z;  3F3P C;  2M6N A;  3BG1 B;  4TNU A;  3GTO I;  2QRD B;  1JJ2 Y;  2E2I I;  3CC4 1;  3MON A;  2QEX 1;  2R93 I;  2BJO A;  2JIO A;  1X0T A;  3HOZ I;  3S1M I;  1Z02 A;  4X6A I;  2IV2 X;  4MD9 A;  3CCQ Z;  1VLA A;  1I6H I;  2JUB A;  1QXF A;  2HU9 A;  1ZH1 A;  1KC8 2;  3GKQ A;  2IZ4 A;  3M4O I;  1TWC I;  3S1N I;  3CC2 Z;  3S2H I;  3K7A I;  4NBC A;  2RT9 A;  4NBA A;  3G71 Z;  5D1O B;  1YIJ Z;  1PFT A;  1VQ4 Z;  3S17 I;  1VQ6 1;  2AYD A;  4MXU A;  1VQL Z;  2NVY I;  2R7Z I;  1QVF Y;  2JA6 I;  3TDH B;  4XX2 A;  4BY1 I;  3CD6 1;  3GTQ I;  1TFI A;  1VQN Z;  2QR1 B;  4Y7N I;  4E33 A;  4DK1 A;  2V8I A;  4A3E I;  3J80 f;  3GTM S;  2QA4 Z;  2OTJ Z;  3CME 1;  1QVG Y;  2K3R A;  1K9M 1;  1Q81 2;  3IX0 A;  4DQY B;  2VPZ A;  5IP7 I;  1X3W A;  3D6W A;  3G4S Z;  2B63 I;  4A3D I;  3J81 f;  1JWH C;  2E9H A;  2NVQ I;  3NH5 A;  1QVF Z;  3I4N I;  1RNI A;  3CCR Z;  3S14 I;  1QF8 A;  2I3C A;  2RPR A;  3JAM b;  3GTJ I;  1Q16 A;  1N8R 2;  3D2L A;  1Q82 1;  2AKL A;  4RVG A;  1RO0 A;  2O4H A;  3CC4 Z;  4A3L I;  2VPW A;  3CCE 1;  4QTT A;  2R92 I;  2JA8 I;  2QEX Z;  1Z03 A;  2NAP A;  3CXC Y;  3CC7 1;  3VMI A;  1RQF A;  4E31 A;  3M3Y I;  1YJ9 1;  2V3V A;  1K8A 1;  3QWU A;  2P28 A;  3G6E 1;  3CCU 1;  1SIW A;  1M90 2;  1FDO A;  2GTH A;  4NFR A;  3HKZ A;  1QYP A;  2JIM A;  1VQP 1;  3OW2 Z;  1NUI A;  3CMA 1;  1VQK 1;  1VQ6 Z;  5FLM I;  4A3B I;  2OOY B;  1P9N A;  3EER A;  2QLV B;  3VB9 A;  3D9X A;  2J6A A;  2JIP A;  2JIR A;  2GTI A;  1YJN 1;  4NB8 A;  2EGT A;  4EWC A;  2E2J I;  3CD6 Z;  3HOV I;  3BG0 B;  3CCL 1;  1KQS Y;  3CME Z;  1VQ5 1;  3VMH A;  5IT9 f;  1WW9 A;  3J7A 4;  1TWH I;  4NH1 C;  2QKD A;  4MD8 A;  2JS4 A;  1YUA A;  1FDI A;  3FQQ A;  1YHQ 1;  2YAD A;  3HOU I;  1JJ2 Z;  5C4J I;  4A3I I;  5FLX b;  1R9T I;  4NBH A;  4E2Y A;  1ZB8 A;  1WZN A;  1RLY A;  1AA6 A;  3KIF A;  1VQO 1;  4Y52 I;  2JNY A;  3NDI A;  3I56 1;  3KIH A;  3S15 I;  2JA5 I;  1Z01 A;  4MON A;  2V8K A;  1K9M 2;  3CCE Z;  1WCM I;  1VQM 1;  3RZO I;  4MRI A;  2W03 A;  1Q86 1;  4BBS I;  1YJ9 Z;  3NH4 A;  3CCR 1;  3RZD I;  3G6E Z;  2JIQ A;  5T67 A;  3CCU Z;  4E2Z A;  2PK7 A;  3CCJ 1;  2QRC B;  5A2Q b;  1Q82 2;  4AYB A;  1S72 1;  1VQP Z;  2O53 A;  3CMA Z;  1VQK Z;  3NH8 A;  2F4M A;  2V8J A;  3CCV 1;  3P5J B;  2ZAE B;  1NJI 1;  1I3Q I;  1W2B Y;  1Y1V I;  2DE5 A;  2E7Z A;  1YJN Z;  1K8A 2;  4S1T A;  1Y1W I;  1YIJ 1;  1QVG Z;  3GCF A;  1M1K 1;  2NVT I;  3VTN A;  2IZ3 A;  1K73 1;  3GTL I;  3GTK I;  2E2H I;  1TWF I;  1YIT 1;  4CL1 A;  3U50 C;  3HOW I;  2RBL A;  1VQ5 Z;  4NOZ A;  4RVF A;  4BXX I;  3CPW Y;  1Y8C A;  1ML8 A;  2JR6 A;  4A3M I;  1YHQ Z;  1VQ9 1;  3PO3 I;  4E30 A;  3IFU A;  3I07 A;  3CCS 1;  3I55 1;  4DGL A;  1YI2 1;  3CXC Z;  4BY7 I;  3PO3 S;  2G2K A;  5IP9 I;  3I56 Z;  3NDJ A;  1YJW 1;  3JAM f;  2VPY A;  3CCM 1;  1KD1 1;  1VQM Z;  3IR7 A;  2QRE B;  1L1O C;  2Q4Z A;  1ZB9 A;  1LQL A;  1NP6 A;  4MH4 A;  1Q7Y 1;  3J80 b;  4E2W A;  3CCJ Z;  1VQ8 1;  3HOX I;  3MZL B;  4E2X A;  3GTP I;  2Q51 A;  2PM9 A;  2W04 A;  5C44 I;  4MD7 A;  1S72 Z;  4A93 I;  1USP B;  5T6B A;  4NBG A;  3PO2 I;  2F4O A;  3S1R I;  3FKI I;  1X3Z A;  3F3F C;  2OTL 1;  3J81 b;  3CCV Z;  4BBR I;  3TE5 B;  1KQS Z;  4HGZ A;  1Q86 2;  3CQZ I;  2WAQ A;  3H0G I;  3ESW A;  3VMG A;  2YU9 I;  4NBB A;  3GTG I;  3S16 I;  2R6M A;  5LL6 f;  4RV9 A;  5C4X I;  2NVX I;  5T64 A;  2RIQ A;  1KC8 1;  3CC7 Z;  3MZK B;  2VUG A;  2KPI A;  1VQ7 1;  2M48 A;  1USP A;  3EED A;  1YIT Z;  4A3C I;  4HGY A;  5C3E I;  3GTM I;  2PMZ A;  5AN9 F;  4NBE A;  4A3J I;  1NJI 2;  3LUS A;  2VUM I;  2OZK A;  1KRL A;  5D1O A;  4QTU A;  1VQ9 Z;  1WII A;  3CCQ 1;  4NBD A;  4RVH A;  2P3Y A;  1M1K 2;  3CCS Z;  3H3V J;  3I55 Z;  3I4M I;  1YI2 Z;  1K73 2;  5FLX f;  2DE6 A;  3CC2 1;  1YUK A;  3G71 1;  1TWA I;  2HF1 A;  1YJW Z;  1VQ4 1;  2RHB A;  3CCL Z;  2DE7 A;  2LFU A;  3CCM Z;  1Y1V S;  2KI7 B;  1Q81 1;  4RS4 A;  1S7M A;  3S1Q I;  1VQL 1;  1WJ2 A;  3NFZ A;  4NBF A;  4E32 A;  2LIY A;  4HH4 A;  1SFO I;  3OW2 Y;  1RO2 A;  2OOX B;  3HOY I;  3S2D I;  1VQN 1;  2JA7 I;  2JMO A;  1VQ8 Z;  2K5R A;  2H85 A;  2LEX A;  2VF1 A;  1W2B Z;  2QA4 1;  2OTJ 1;  1N8R 1;  5CM2 M;  2V45 A;  5IT9 b;  5A2Q f;  2GU2 A;  5D1P A;  1KD1 2;  2OTL Z;  3FQM A;  1VQO Z;  3G4S 1;  1TWG I;  1I50 I;  1N2F A;  4A3F I;  1RO4 A;  1K83 I;  3T4N B;  1Q7Y 2;  2VPX A;  1DL6 A;  2WB1 A;  3IF8 A;  4NB9 A;  3CPW Z; 
#chains in the Genus database with same CATH homology
 1M90 1;  4A3G I;  3Q87 A;  4A3K I;  4RVD A;  2Y0S A;  1VQ7 Z;  3F3P C;  2M6N A;  3BG1 B;  4TNU A;  3GTO I;  2QRD B;  1JJ2 Y;  2E2I I;  3CC4 1;  3MON A;  2QEX 1;  2R93 I;  2BJO A;  3HOZ I;  1X0T A;  3S1M I;  1Z02 A;  4X6A I;  4MD9 A;  3CCQ Z;  1VLA A;  1I6H I;  2JUB A;  2HU9 A;  1ZH1 A;  1KC8 2;  3GKQ A;  2IZ4 A;  3M4O I;  1TWC I;  3S1N I;  3CC2 Z;  3S2H I;  3K7A I;  4NBC A;  2RT9 A;  4NBA A;  3G71 Z;  5D1O B;  1YIJ Z;  1PFT A;  1VQ4 Z;  3S17 I;  1VQ6 1;  4MXU A;  1VQL Z;  2NVY I;  2R7Z I;  1QVF Y;  2JA6 I;  3TDH B;  4XX2 A;  4BY1 I;  3CD6 1;  3GTQ I;  1TFI A;  1VQN Z;  2QR1 B;  4Y7N I;  4E33 A;  4DK1 A;  2V8I A;  4A3E I;  3J80 f;  3GTM S;  2QA4 Z;  2OTJ Z;  3CME 1;  1QVG Y;  2K3R A;  1K9M 1;  1Q81 2;  3IX0 A;  4DQY B;  5IP7 I;  1X3W A;  3D6W A;  3G4S Z;  2B63 I;  4A3D I;  3J81 f;  1JWH C;  2E9H A;  2NVQ I;  3NH5 A;  1QVF Z;  3I4N I;  1RNI A;  3CCR Z;  3S14 I;  1QF8 A;  2I3C A;  2RPR A;  3JAM b;  3GTJ I;  1N8R 2;  1Q82 1;  2AKL A;  4RVG A;  1RO0 A;  2O4H A;  3CC4 Z;  4A3L I;  3CCE 1;  4QTT A;  2R92 I;  2JA8 I;  2QEX Z;  1Z03 A;  3CXC Y;  3CC7 1;  3VMI A;  1RQF A;  4E31 A;  3M3Y I;  1YJ9 1;  1K8A 1;  3QWU A;  2P28 A;  3G6E 1;  3CCU 1;  1M90 2;  2GTH A;  4NFR A;  3HKZ A;  1QYP A;  1VQP 1;  3OW2 Z;  1NUI A;  3CMA 1;  1VQK 1;  1VQ6 Z;  5FLM I;  4A3B I;  2OOY B;  1P9N A;  3EER A;  2QLV B;  3VB9 A;  3D9X A;  2J6A A;  2GTI A;  1YJN 1;  4NB8 A;  2EGT A;  4EWC A;  2E2J I;  3CD6 Z;  3HOV I;  3BG0 B;  3CCL 1;  1KQS Y;  3CME Z;  1VQ5 1;  3VMH A;  5IT9 f;  1WW9 A;  3J7A 4;  1TWH I;  4NH1 C;  2QKD A;  4MD8 A;  2JS4 A;  1YUA A;  3FQQ A;  1YHQ 1;  2YAD A;  3HOU I;  1JJ2 Z;  5C4J I;  4A3I I;  5FLX b;  1R9T I;  4NBH A;  4E2Y A;  1ZB8 A;  1RLY A;  3KIF A;  1VQO 1;  4Y52 I;  2JNY A;  3NDI A;  3I56 1;  3KIH A;  3S15 I;  2JA5 I;  1Z01 A;  4MON A;  2V8K A;  1K9M 2;  3CCE Z;  1WCM I;  1VQM 1;  3RZO I;  4MRI A;  2W03 A;  1Q86 1;  4BBS I;  1YJ9 Z;  3NH4 A;  3CCR 1;  3RZD I;  3G6E Z;  5T67 A;  3CCU Z;  4E2Z A;  2PK7 A;  3CCJ 1;  2QRC B;  5A2Q b;  1Q82 2;  4AYB A;  1S72 1;  1VQP Z;  2O53 A;  3CMA Z;  1VQK Z;  3NH8 A;  2F4M A;  2V8J A;  3CCV 1;  3P5J B;  2ZAE B;  1NJI 1;  1I3Q I;  1W2B Y;  1Y1V I;  2DE5 A;  1YJN Z;  1K8A 2;  4S1T A;  1Y1W I;  1YIJ 1;  1QVG Z;  3GCF A;  1M1K 1;  2NVT I;  3VTN A;  2IZ3 A;  1K73 1;  3GTL I;  3GTK I;  2E2H I;  1TWF I;  1YIT 1;  4CL1 A;  3U50 C;  3HOW I;  2RBL A;  1VQ5 Z;  4NOZ A;  4RVF A;  4BXX I;  3CPW Y;  1ML8 A;  2JR6 A;  4A3M I;  1YHQ Z;  1VQ9 1;  3PO3 I;  4E30 A;  3IFU A;  3I07 A;  3CCS 1;  3I55 1;  4DGL A;  1YI2 1;  3CXC Z;  4BY7 I;  3PO3 S;  2G2K A;  5IP9 I;  3I56 Z;  3NDJ A;  1YJW 1;  3JAM f;  3CCM 1;  1KD1 1;  1VQM Z;  2QRE B;  1L1O C;  2Q4Z A;  1ZB9 A;  1LQL A;  1NP6 A;  4MH4 A;  1Q7Y 1;  3J80 b;  4E2W A;  3CCJ Z;  1VQ8 1;  3HOX I;  3MZL B;  4E2X A;  3GTP I;  2Q51 A;  2PM9 A;  2W04 A;  5C44 I;  4MD7 A;  1S72 Z;  4A93 I;  1USP B;  5T6B A;  4NBG A;  3PO2 I;  2F4O A;  3S1R I;  3FKI I;  1X3Z A;  3F3F C;  2OTL 1;  3J81 b;  3CCV Z;  4BBR I;  3TE5 B;  1KQS Z;  4HGZ A;  1Q86 2;  3CQZ I;  2WAQ A;  3H0G I;  3ESW A;  3VMG A;  2YU9 I;  4NBB A;  3GTG I;  3S16 I;  2R6M A;  5LL6 f;  4RV9 A;  5C4X I;  2NVX I;  5T64 A;  2RIQ A;  1KC8 1;  3CC7 Z;  3MZK B;  2VUG A;  2KPI A;  1VQ7 1;  2M48 A;  1USP A;  3EED A;  1YIT Z;  4A3C I;  4HGY A;  5C3E I;  3GTM I;  2PMZ A;  5AN9 F;  4NBE A;  4A3J I;  1NJI 2;  3LUS A;  2VUM I;  2OZK A;  1KRL A;  5D1O A;  4QTU A;  1VQ9 Z;  1WII A;  3CCQ 1;  4NBD A;  4RVH A;  2P3Y A;  1M1K 2;  3CCS Z;  3H3V J;  3I55 Z;  3I4M I;  1YI2 Z;  1K73 2;  5FLX f;  2DE6 A;  3CC2 1;  1YUK A;  3G71 1;  1TWA I;  2HF1 A;  1YJW Z;  1VQ4 1;  2RHB A;  3CCL Z;  2DE7 A;  2LFU A;  3CCM Z;  1Y1V S;  2KI7 B;  1Q81 1;  4RS4 A;  1S7M A;  3S1Q I;  1VQL 1;  3NFZ A;  4NBF A;  4E32 A;  2LIY A;  4HH4 A;  1SFO I;  3OW2 Y;  1RO2 A;  2OOX B;  3HOY I;  3S2D I;  1VQN 1;  2JA7 I;  2JMO A;  1VQ8 Z;  2K5R A;  2H85 A;  2VF1 A;  1W2B Z;  2QA4 1;  2OTJ 1;  1N8R 1;  5CM2 M;  5IT9 b;  5A2Q f;  2GU2 A;  5D1P A;  1KD1 2;  2OTL Z;  3FQM A;  1VQO Z;  3G4S 1;  1TWG I;  1I50 I;  1N2F A;  4A3F I;  1RO4 A;  1K83 I;  3T4N B;  1Q7Y 2;  1DL6 A;  2WB1 A;  3IF8 A;  4NB9 A;  3CPW Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...