3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
molecule keywords Telomerase-associated protein 82
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4NBFA 3I2ZA 4OO1I 1V43A 1X3FA 4X62Q 2K4KA 1IBKL 2RHQB 1YHQA 3CD6A 1VQHA 1OXTA 2DUDA 1PH5A 1HZCA 2NVYI 2KHIA 2ZM6L 3TS0A 1XPOA 3H0GI 5AJ3Q 4DV6Q 4BY7G 4DV2Q 4BXXH 1SFOI 2Q2HA 4A3DG 3ULLA 3T1YL 2BJOA 4A3LI 2ZJRA 3RN2A 3U50C 2IHEA 4GN5A 1NTGA 4X66Q 5C3EG 1OTCA 1N2FA 2A19A 1QZHA 1BVSA 1HR0L 3GKQA 1L1OC 2ZJPA 4B3TQ 4JCVE 1QVFA 2IHFA 3PUXA 3UE1A 4A3MH 2ES2A 1PH4A 2K5RA 5E7NA 2F4VL 2VUMH 1Q12A 2B3GA 4AH6A 5C0XG 3HOVH 1DL6A 4H02A 3PO2I 3CCVA 1XPRA 4K0KQ 3CCSA 1VQFA 4IJLA 4YY3L 2AWOA 4R4QA 1PH9A 3L2PA 1R9TH 1N8RC 2Q2IA 4OX9L 5GQOA 1CKNA 5IWAQ 1WYDA 3LUSA 3STBD 4MH4A 4L5RC 1LQLA 1A62A 1NBWA 1XMQQ 2VUMG 2R7ZG 1Y1WH 4BBSI 4WJ3M 1Q1EA 2R93G 4A76A 4A3GI 1OXXK 1U5KA 3I55A 2EQSA 2XTIA 3S15I 4HJAA 1ASYA 4DV2L 5IY0A 5C3EH 1YJNA 3T1YQ 3HOYI 5IP7G 2B29A 1VQDA 4A4IA 5M3MH 2Z6KA 1RL2A 4YHHQ 1TWFH 1ZB9A 5CM2M 2F52A 2OCEA 4DV3Q 5C4XG 3PUYA 1VQMA 2R7ZH 2WB1G 1MJEA 2JR6A 2JA7G 1T9HA 4X64L 1RO4A 4IFDI 3KJOA 4AQYL 3RZDH 2N78A 3F2DA 5LMNQ 1X3GA 4KHPQ 3GTMI 2WAQE 2UUCL 4GLXA 4P74A 4A3FG 1CSPA 1PYBA 4AYBG 2E2HI 4DV7L 4JI7Q 1L1OA 1PFSA 1PV4A 2NVXI 1V1QA 3HOVG 1C0AA 4HIKA 1P8LA 2FXQA 3HOXH 1ASZA 3RNUA 2JA7H 2IX1A 3CCJA 2CWPA 1SN8A 2NVTH 4LW1A 1Y1VH 1TWGH 2N49A 1KL9A 5BR8L 1ZB8A 4A3DI 2UXDQ 2IT1A 1SE8A 3S1NH 1VQJA 4A3LG 3KF6B 1MKHA 2E5LQ 2JA5H 1VCIA 3VB9A 3FKIG 2C35B 2BA0A 3RLOA 3I4NH 1YNXA 2LSSA 2UXCQ 1VQKA 1N36Q 2K50A 1K8GA 2K52A 3NBHB 1VQAA 4BBRG 1Q82C 2PI2E 2JA6I 1NJIC 1HNXQ 2R7FA 1CSQA 1CUKA 2RHSB 4XTCS 1VQ8A 4LF6L 2DE5A 2Q2TA 3PO2G 1ML8A 1QUQA 1K83I 1XJVA 4A3II 3CQZH 4JI4L 4QL5A 4JI2L 1KAWA 3PO3G 2OTLA 4A3BG 4JI1Q 3UE0A 1O7IA 3L0OA 4JI5L 3BZCA 2ZTDA 5JEAG 1K0RA 2VQEQ 1Y1VI 1B7YB 5HGQA 1HR0W 4LF4Q 4BY7H 2JNYA 4Y7NI 1EIFA 2OTJA 3D6WA 3OTOL 3RZOH 1IXRA 1K83H 1WCMH 4BBSG 2BH8A 4DR2Q 2ID0A 3HOXI 4DR6L 2CCZA 1PYSB 4IPCA 2RCNA 1N32Q 3PUWA 2V1CC 3HOYG 1EQRA 3HFZB 5IP7I 3GTKI 1B70B 1DGSA 2OQKA 4BA2I 3GTQI 1QVCA 5LMNW 4ALPA 1VQLA 2R92I 2YV5A 3J81j 4A3KG 4R4OA 4GKKQ 3AFPA 3K0XA 3SGIA 1NMFA 1PFTA 5H1SE 4R4IA 2N3SA 4A93G 4GS3A 4UY8C 2PK7A 1M90C 1CKMA 4YWLA 2JE6I 5IP9G 4QY7A 4DV7Q 4JI4Q 2R93H 2B63H 1WCMI 2AMCB 4AYBE 2JEBI 4JI6Q 3CP0A 4JI1L 2NVXH 4GKJL 1YJ9A 4B3RL 1Y1VS 2JA9A 2PI2A 2WAQG 1KHIA 3ERSX 4L5TA 5FLMG 4DR3Q 1Z47A 3KDFB 4HIDA 3EIVA 1Y1WI 1FL0A 4DR4L 1X65A 3RZDI 1EOVA 4QJFA 4DR6Q 2MFIA 4LFBL 1AE2A 3DLLA 1PVOA 4PZ7A 3EBEA 3S24A 1VQBA 1C7YA 2K14A 4NBDA 4B3ML 2D62A 4YCWA 1JE5A 1I94Q 3PV0A 2ZM6Q 4KI0A 2JJQA 2JA5I 5IP7H 3E9IA 4GNXC 4GKKL 3ESWA 3I07A 3S15H 3KOJA 4QIWE 5JJIA 1EWIA 4X62L 3T1HQ 3HKZG 1N34Q 1GO3E 3MEFA 2E2JH 3CCMA 1TWFI 2EIFA 4HIMA 1TFIA 1L2FA 3STBC 2ASBA 5FLMH 2PQAB 3K7AH 1VS0A 5K36G 2YTYA 3CMAA 1S72A 3HOUG 1VQ9A 2D0PA 2CWAA 1B8AA 3MXNB 1USPA 1FVIA 5GAEC 1KXLA 1J6QA 4O2DA 1HR0Q 3S1RI 2ZTEA 2IY5B 4YY3Q 3D0FA 4MTNA 1H95A 1UE7A 1JJ2A 3S17H 5IWAL 1E3PA 4TVAB 3L7ZC 1KQSA 3M4OI 4PZ8A 5GAGC 4DUZQ 1XMQL 3PO3S 3J7A5 1OXUA 1X6OA 4LFCQ 4K0KL 1A8VA 2QGQA 4QTTA 2Z0SA 4DV4L 4DV1Q 3RZOI 4JI8Q 4LF8L 4A3KI 1VQNA 1E22A 3GTPI 1NE3A 2HHHL 1UWVA 4IPDA 1L0WA 5C3EI 4HJ5A 4A3DH 4BBRH 4A3JH 3BZKA 3M85A 2HF1A 2E2II 3CQZI 4A3IH 1JJCB 1XPUA 4UPAA 4GOPB 2MQHA 4DV0L 4LF5Q 1GKHA 3F2CA 3B6YA 1W3SA 1XTDA 3K7AI 3IRBA 4X64Q 5FLMI 3DM3A 3RLFA 4KLKA 4GNXA 3S1MI 4BXXI 2K75A 2KHJA 4DKAC 2JA6H 4KHPL 1MJCA 1X56A 5ELOA 4DK6C 3VDYA 1J5EL 1UE1A 4DV5L 1LYLA 2IX0A 1KIXA 2VL6A 2UUCQ 4NXML 3GTMH 1AH9A 4PZ6A 3HOUH 3J80c 1N33Q 2HQLA 3U4VA 1Q86C 1KRSA 2GVBA 2KPIA 2UUBQ 2VUMI 2JK8A 2Q2UA 2K5NA 2NN6I 1TWCI 1YHBA 5M5WH 3KFUA 3VMGA 3S1QH 4IOCA 1Y14B 4R1JA 3TREA 5FJ8G 4DV4Q 4LF8Q 2Y0SE 3A5UA 5C0XJ 1PH7A 3GTLH 4JV5Q 4NBBA 1G51A 2E2HH 3S1QI 1C9OA 4C2MH 3H3VJ 4POFA 1YVCA 2A1AA 4QGUA 3G6EA 4A3JI 2GN5A 3A5ZB 3K81C 5M3MG 1HZAA 4DV0Q 3G4SA 3I4MI 3AFQA 5BR8Q 4A3GH 4NBCA 1LUZA 4DR5Q 4LNQA 4YWMA 1HNZL 4X66L 4LWCA 5C44G 2F4MA 2UUAQ 5FLXc 1YHAA 1Q8KA 1KC8C 2OQ0A 3PO3I 1VQIA 3BJUA 1GM5A 2K5HA 1OXVA 3CPWA 3S1MH 3S2HH 5JJKA 4HJ9A 1TWHI 2ZTCA 5LMUQ 3HOVI 4WJ4A 3M4QA 4FDBA 4OWTB 2XGTA 1XNQQ 1PHJA 5FJ8H 4NPSA 4DR2L 2OWOA 2UXBQ 3GCFA 2JA8I 3CF5A 4BY1H 1FJGL 2I5HA 1PH6A 4OX9Q 4JI5Q 1I50H 3JAMc 4JV5L 4LF4L 2KCMA 4JI0L 3GTLI 3HOWG 1VQ4A 5IYDH 1XNRQ 3FKII 4BY1I 1KRTA 2JA8H 3PIPA 4GLAC 4Y7NH 4JYAQ 3M4OH 4BBRI 3NENA 3E0EA 1K73C 1X3EA 2JA6G 3CC7A 2CQOA 4C3HH 2R92H 2AKLA 2Z6KC 1I5FA 4L5QA 2F4OA 1X9NA 3ULJA 3S2HI 4JBJA 4DR1L 4BXXG 1IBLQ 4RMFA 4QQBX 1IBMQ 4NBEA 4A3IG 3GTKH 4DV3L 2NZHA 3UDGA 4A3BI 3U58A 2YU9H 2AKWB 1X3WA 1G6PA 2NVQH 4MNOA 1S40A 3K7UC 2I0QA 4A3LH 3AQQA 3PGZA 2AWNA 1SFOH 4B3SQ 1QYPA 1YI2A 4JBMA 3Q8DA 2HT1A 4YCUA 2UXBL 3PF5A 1OXSC 1HNWQ 1HZBA 4X65Q 5IYDG 4JI7L 1QUQB 4J15A 3HOWH 2B63I 4JOIA 4DK3C 2N8NA 3PUVA 3RR5A 1TWHH 4GN3B 4HIOA 1XNRL 1X55A 3GTMS 1UE6A 5J3BA 4IFDG 4IJHA 3ER0A 3CC4A 4JC0A 2R92G 3I7FA 4BA1I 4DR7Q 2UXDL 3Q87A 4A93I 4X6AI 2WFWA 1M1KC 3CW2C 1TWAH 3PCOB 1N34L 2R6GA 5C44I 3I4NI 1IBLL 1K8AC 4PMWA 5IP9I 3S16H 1TWAI 4LUZA 1I6HI 1N36L 2UU9Q 1EUJA 1D7QA 1YEZA 3J7ZC 4LUOA 3FHWA 1JJGA 4NBGA 1TXYA 2AHOB 1L1OB 1PA6A 3RN5A 1VQ7A 4A3CG 1RIPA 4GLVB 3CC2A 4JI2Q 1JMCA 2E2JI 4DUYL 4BY7I 4LFAL 2JA7I 2DE6A 1HNWL 3TEHB 2VQEL 2RBLA 4A3MG 2L15A 3GDEA 4A3FH 1AE3A 1BBWA 2HIVA 5C4XH 3GTJH 4GNXB 4DV1L 3KF8B 1Q7YC 3HOZH 1IL2A 2HHHQ 2VZAA 2P3YA 3E9HA 4NXNL 2VNUD 2ALYB 2PNHA 3CCUA 4RG1A 1JT8A 2JEAI 1IBKQ 3F2BA 1JB7A 3PUZA 4JOIC 3GTQH 3CMEA 2E2IH 2GVAA 1WJJA 1VQEA 3UDXA 3A0JA 2PMZE 4JI8L 1K9MC 4LF5L 3TRZA 2CFMA 1YUAA 3U4ZA 1VLAA 3VMHA 3UDIA 4A3KH 2E5LL 3KF6A 5C4JH 4JBKA 1CKNB 2R93I 1G291 1IYJB 2CKZB 4P72A 1WOCA 5IT9c 5GAHC 4A75A 1J5EQ 1LTLA 3TS2A 4JI6L 3GTGI 3M3YH 1E1OA 5AJ3L 1GD7A 3PF4A 5M5YH 2J6AA 1QVGA 4Y52H 1W2BA 2B63G 4UP8A 4A3BH 3ULPA 1HZ9A 1Q81C 1SLJA 1SR3A 3GTOH 4KHZA 5DLQE 5C4XI 3GTJI 3HKSA 5IYBH 1IZ6A 1VQGA 1USPB 3GTOI 2F4VQ 4LFBQ 1Z9FA 3H15A 1YITA 4A93H 4X6AH 1N33L 4Y52I 3RLNA 3W5OA 5M3FG 3OYYA 3A74A 1RLYA 4GOPA 3HOZI 1HJPA 3S2DH 3J81i 3OTOQ 1EYGA 1BBUA 1WI5A 1LM0A 3K80C 4B3MQ 3I4NG 3W1BA 4AIMA 4GN4B 3HOYH 5C4JI 2RF4A 4A3FI 3LGJA 1P16A 3HKZE 2VQFQ 1XMOQ 2EXDA 3I4MH 4DR5L 1CKOA 4OWXB 3CCEA 4IO9A 3F8TA 3T1HL 2LXKA 3JC66 1MIUA 4R4CA 5ELNA 4XIGS 3W1GA 1E24A 1GVPA 4A3CI 2KENA 3WWVA 4DAMA 2QA4A 1VQCA 1U0LA 4JI3Q 4LF7Q 1X3ZA 2I5MX 1PH3A 2QEXA 2NVQI 2MO0A 1BKBA 1PH8A 3OW2A 2YU9I 3UDFA 4MZ9A 2BA1A 4JBWA 4A3MI 1HNZQ 3KLWA 1XNQL 5LMNL 5IYBG 1I6HH 2NN6G 1VQPA 5JJLA 4DPGA 4YHHL 3GD7A 2LXJA 1PH2A 5GROA 4GKJQ 4P75A 1SRUA 5LMUL 3CXCA 5M3FH 1D8LA 4NOZA 1KD1C 3KJPA 3GO5A 3CCRA 3ICEA 4AQYQ 4HJ7A 1TWGI 3G48A 4LFCL 4DR4Q 3FKIH 2NVTI 2K5VA 2KCTA 4A3EI 2WB1E 4NBAA 4TQUS 4DNIA 2F3IA 4A3JG 2YTXA 1EFWA 4POGA 4JG2A 4R4TA 3I4MG 3S2DI 4EQ5A 4OXPA 1V9PA 2VQFL 1XMOL 2JS4A 2ZJQA 1Y1VG 1E1TA 2NVYH 4JI0Q 2UXCL 1I3QI 2PQAA 3FP9A 2VW9A 1VQ6A 1SMXA 1X54A 5IYCH 4NB9A 2JQOA 3AYHB 4GOPC 3EERA 3S16I 2KBNA 1S3OA 4C3JH 5IP9H 3HOXG 4YWKA 1I94L 4JYAL 1K3RA 4JI3L 4LF7L 3GTPH 2A8VA 4O0AA 4P73A 3S14H 5M5XH 4OONA 4LF6Q 4OO1G 2HIXA 2NZOA 4NB8A 4IPHA 3M3YI 4DR1Q 3GTGH 1WW9A 1IBML 4P71A 3CCQA 4OWWB 2BH2A 3EN2A 4B3RQ 3H0GG 4X65L 2VS1A 3S17I 3I4OA 3KYHC 3H0GH 1HNXL 2ATWA 4C3IH 3HOWI 4B3SL 3M7NA 2UUBL 3HOZG 2DGYA 4UP9A 4BY1G 3S1RH 5EAYA 3AEVA 5GADC 4HJ8A 1UE5A 1VQOA 1WCMG 4BBSH 4DR7L 3D31A 3CCLA 4IPGA 1N32L 5C0XI 1QZGA 1UEBA 1I50I 3PIOA 4DUZL 1A63A 1TWCH 4XX2A 1YJWA 1Y1WG 3H3VI 3BU2A 4LF9L 5C44H 2UU9L 4EX5A 1SROA 3S1NI 2VY3A 3M4PA 3ZJYC 2I5LX 2JA8G 2R7ZI 4IOAA 3H3VH 1PH1A 1E7ZA 2YYZA 2UUAL 1EQQA 3PO3H 5IYCG 4A3GG 2YTVA 3K8AA 4NB3A 1I3QH 1NMGA 3VMIA 2Y0SG 4QTUA 4LFAQ 2DE7A 4DUYQ 1WFQA 4DV6L 1YZ6A 1EIYB 2JA5G 3PSIA 4LUVA 5JEAJ 3J80i 4DR3L 1NY4A 4A3CH 3CPFA 3NELA 4ME3A 4IFDJ 4A3EH 1Q46A 1HH2P 1Q1BA 1FGUA 4UP7A 3I56A 2MNAA 4A3EG 4B3TL 2MO1A 4DV5Q 4NXMQ 3KDFA 1FJGQ 3F1ZA 5IE8A 1NUIA 3HOUI 4YCVA 3G71A 2H5XA 4NXNQ 4PG3A 5HY6A 2D0OA 2WP8J 1N9WA 2R7DA 4APVA 3J81c 1R9TI 2E8GA 3M9BA 4NBHA 3CAMA 1YIJA 3NEMA 4LF9Q 4L5SA 3TQYA 1A0IA 3S14I 1YBYA 3JAMi 3PO2H 4DAYB 1VQ5A
chains in the Genus database with same CATH superfamily
5KEEA 5EQ0A 1V43A 1B3AA 2WIIB 4F88A 4BY7G 2JIRA 4DV6Q 4DV2Q 2L5TA 2RVLA 3HP3A 2ZJRA 2CW0C 3RN2A 3U50C 4GN5A 5C3EG 4X3KA 1OTCA 2A19A 1BVSA 2F0NA 1W6JA 4B3TQ 1QVFA 3AMUA 3FQMA 1CHPD 2F4VL 1WIIA 1Q12A 1GUWA 5C0XG 1ZH1A 1DL6A 3MWYW 1XTCD 3GTGB 5CMDA 3CCSA 5E4XA 4YY3L 1EEFD 1PH9A 3L2PA 1R9TH 4OX9L 3EEDA 1DOLA 1CKNA 5IWAQ 3LUSA 3K5NA 4EWCA 1QE6A 4XYOA 3PO3B 4L5RC 1NBWA 1PLFA 3NBHA 4EQOA 1XMQQ 1GUGA 1KRLA 1OXXK 2XTIA 4CDCC 1ASYA 5IY0A 2EY6A 1YJNA 3J81E 3T1YQ 2NAPA 3A7AB 3NTKA 5IP7G 1BCPF 1STGA 4RCOA 4C3JG 4YHHQ 2F52A 2OCEA 1GHJA 1NJI1 3P20A 1RF2D 1T9HA 1CQFA 1O78A 1RO4A 1JE4A 3OPOA 4AQYL 5K36H 4OGQC 4B9XA 1VQ81 1VQ51 1PYBA 1SAPA 4AYBG 1BBXC 1PV4A 2B2UA 4HIKA 3HOXH 3V2TA 2R93B 5CV7A 2IX1A 4K6LA 3OIQA 3MXGA 3C46A 1TWGH 1A2TA 2J0TD 2Q8TA 4MONA 4A3DI 5EPKA 2Z4IA 3S1NH 4A3LG 3KF6B 1MKHA 2F0QA 2FMMA 5FLXE 2EZVA 1BCPC 1ICWA 1VCIA 3FKIG 2C35B 3I90A 5JAVA 4G7OC 1YNXA 2LSSA 4AYBA 1G8ZD 2K50A 1N36Q 1HPCA 1NJIC 2B8GA 2EY2A 1SMYD 4XTCS 1VQ8A 2Q2TA 2KOLA 1QUQA 2JSOA 1F2LA 4QL5A 4JI2L 4A3BG 4UHVA 4DV7Q 4JI5L 2JA7H 2ZTDA 4CBVA 3TDQA 3K7AB 1PRTF 3OTOL 2PYKA 4BBSG 1PDQA 1YJNZ 4DR2Q 4QUFA 4HMJA 5D1PA 2FFKB 2JMOA 1S5BD 3HOYG 4XQQA 2IZ4A 1B70B 1VQM1 3SK5A 1AA6A 3S14B 1CQVA 3GTQI 4RVDA 2HDMA 3EVQA 1QVCA 1TWAB 2EY1A 3IL8A 2R92I 3J81j 1R9TB 4R4OA 5H1SE 3DWQA 2QW7A 3QO2A 1M90C 3SEBA 4LJZC 3NE5B 4YWLA 2R93H 4JI6Q 2NVXH 4R8NA 2WAQG 4RHRA 1VQ91 3EIVA 1ENFA 4DR4L 1L0XB 5FKAC 2A69C 3CCE1 5IGFA 4LFBL 1AE2A 4ODGA 1EYDA 3EBEA 1YHQZ 3CD6Z 1C7YA 4NBDA 4IQZA 2EYJA 3E6ZX 2DNEA 4N9PA 1Q822 4KI0A 2JA5I 1DJRD 3E9IA 4RKBA 4E2WA 3ESWA 1KLUD 3SHLA 1NP6A 4ABNA 4QIWE 1N34Q 3MEFA 3A8JE 1JICA 2DY7A 3STBC 4FXKC 3CMEZ 3OWFA 3NSWA 1JWUD 3HGBA 3CPWY 1KDAA 1USPA 5GAEC 5KYLA 1J6QA 4O2DA 5ELBA 2ZTEA 1EU3A 2IY5B 4KN7C 1UE7A 1H9MA 5IT9E 1E3PA 1H9SA 3L7ZC 1KQSA 4HGYA 4PZ8A 1ZXTA 3J7A5 3MHBA 1A8VA 4X3TA 4LK1C 3CC2Z 1HQMC 4LF8L 4JI8Q 2LKVA 4IUTA 2HHHL 1UWVA 5C3EI 3K5MA 1K9M2 1ZEQX 3OSOA 2E2II 3CQZI 1JJCB 1XPUA 1QB5D 4LF5Q 1MSHA 3F2CA 1W3SA 1FNWA 1XTDA 5FLMI 1CM9A 3DM3A 4CKCA 2JA6H 3NK9A 4KHPL 5ELOA 1VQMZ 1VQNZ 1AH9A 1LTBD 4DAVA 3CCQZ 4PZ6A 3TP8A 3J80b 1Q86C 3RZDB 2GVBA 2PW5A 2JK8A 3EFXD 2NTSA 2K5NA 2NN6I 2JIQA 4QB4A 1MBYA 1JJ2Z 1XYIA 3TREA 1SFOB 5FLXf 4ZCKA 4JV5Q 1V1OA 1G51A 3T56B 3H3VJ 2A1AA 2NVYB 2L55A 3K81C 1HZAA 2VXWA 4DV0Q 3G4SA 5FLXL 4IALA 4LWCA 5EKIA 2F4MA 5FLXb 1YHAA 5K36G 1VQIA 1ILPA 2K5HA 2RDFA 3J7A4 3W2DA 3KK7A 5LMUQ 1K731 4OWTB 1XNQQ 3D3RA 4XQNA 5FJ8H 2R3ZA 2NWGA 2WV6D 2OWOA 2UXBQ 3GCFA 2JA8I 3S1RB 4JI5Q 3NQTA 1V1PA 2VPXA 1VQ4A 2JA8H 5LL6X 4GLAC 3EA6A 1I4RA 1YJ9Z 4PMCA 3PIPA 1AEXA 4DNTB 3M4OH 4C56C 3E0EA 1X3EA 4FP5D 5A2Qf 3NTIA 4C3HH 2P5ZX 1I5FA 4L5QA 3CCQ1 4JBJA 1KLGD 3I91A 4NBEA 4A3IG 3GTKH 3S16B 3UDGA 4A93B 1HHVA 2YU9H 2B2VA 1X3WA 4MNOA 1GUTA 2I0QA 4A3LH 2AWNA 1SFOH 4B3SQ 1X32A 1SBBB 1W2BZ 1YI2A 3Q8DA 1QVGY 4YCUA 3G7LA 5IYDG 3HOWH 4N8X1 5JVG3 2N8NA 3I551 2OTJZ 2AQ3B 3D4DA 3RR5A 5J3BA 4IJHA 3FVQA 2AYDA 2WFWA 2D9UA 1N34L 5C6AA 4IZ8A 3S16H 5EJWA 1I6HI 2UU9Q 1EUJA 1RD9D 1IKMA 4OELB 3FQQA 1Q821 5F2DA 4NBGA 3TMEA 2EGTA 1RIPA 3FEWX 2DJFC 4JI2Q 5JPNC 3CC2A 4LFAL 3K5OA 2QR1B 3CCJZ 2RBLA 1SNMA 2RT9A 5JOBA 2HIVA 3GTJH 2VUMB 4G4KA 1YNNC 2HHHQ 1BXTA 1QNKA 2VZAA 3E9HA 1B3QA 2ALYB 1WTVA 1IBKQ 4ZLTF 4K8JA 5I2XA 3GTQH 1ML0D 3UDXA 3A0JA 1QILA 4JI8L 1K9MC 3R93A 1STHA 2NZ1D 3UDIA 4A3KH 2E5LL 3KF6A 5C4JH 4JBKA 2R93I 5IT9c 1PFNA 5GAHC 1WOCA 1Y1VB 1LTLA 4TSSA 4JI6L 3M3YH 1F2MA 3I55Z 2OTJ1 1DM0B 1GD7A 5M5YH 2J6AA 1LLRD 5ELCA 3N52A 5CBEE 1YI2Z 1W2BA 3CCS1 4Y52H 3HOVB 1HZ9A 2N88A 2F3WA 1Q81C 2IJ0A 1HA5A 1S5CD 5DLQE 2QCPX 1RCVD 3T51B 2DNCA 4LFBQ 4A93H 5CORA 2RHBA 2MHVA 3RLNA 2LFNA 3W5OA 4GOPA 2KA7A 1VQL1 1NR4A 2BE5D 3H0GB 1LM0A 3CC7Z 2E2JB 1WTOA 1WD0A 3W1BA 1SYBA 4GN4B 3HOYH 3LGJA 3J80E 1P16A 2O2LD 1D1IA 1JWHC 4DR5L 4O42A 4ULLA 5EBDA 3CCL1 3F8TA 3MA2B 2Z6BA 3JC66 1MSGA 3DEOA 2JN4A 4XIGS 4A3GB 1IHZA 2EY5A 2QA4A 1I4HA 4IFDH 4C3JB 1AP0A 4JI3Q 4LF7Q 2JA7G 1SNCA 1KTKA 5JEAH 2MO0A 5CR3A 2BA1A 4A3MI 1E2ZA 1S5DD 3CCU1 1RKNA 5D3IB 5M3FH 4WFN3 4HSPA 3KJPA 3GO5A 3ICEA 1FD7D 3K57A 4LFCL 2E75C 2F3IA 4R4TA 3VTNA 4OXPA 1V9PA 2JS4A 1K8MA 2NVYH 4JI0Q 1I3QI 3S9WA 2KCNA 4RVHA 1X54A 1S721 4NB9A 1EWHA 5IP9H 4C3JH 1D5ZC 1S3OA 4RCNA 2ZT9C 3HKZA 2G9HD 2A8VA 4O0AA 3HOZB 4LF6Q 1M901 1FR3A 2NZOA 4NB8A 4I7ZC 3M3YI 3W3AA 4DR1Q 2SDFA 2PW7A 5C5LA 3PQIA 3U9SA 1TS4A 4EVOA 3CCQA 2BH2A 4OEMB 4X65L 3GQBA 2CH4W 1Q812 3KYHC 2B63B 4C3IH 1B53A 3QWNA 2DGYA 5GADC 3UI2A 4HJ8A 1LT5D 4RKLA 2ZXOA 4IPGA 1N32L 2MGSA 2RIQA 5C0XI 1QZGA 1I50I 1Z01A 4DUZL 4XX2A 2IV2X 1Y1WG 3HKZB 2FJ2A 3CCV1 2WB1A 5C44H 2UU9L 5BN3A 2E2DC 4EX5A 1SROA 2VY3A 4EGVA 2PZUA 2CQAA 3PO3H 4A3GG 2YTVA 1NMGA 2ATWA 1Y1WB 4LFAQ 4B3RL 4DV6L 3R8BA 3J80i 1A3UA 1NY4A 4A3CH 2XWBB 1O7LA 2V45A 4CJ2C 1TY0A 1FJGQ 3HOUI 2G9DA 3K5LA 3G6E1 2PZTA 3CCMZ 4HGZA 5IT9f 5HY6A 3J81b 3CCVZ 1HFGA 2BDOA 2C9OA 3M9BA 1YIJA 1AN8A 3I72A 3NEMA 4LF9Q 3TQYA 3JAMi 2J4XA 1VQ5A 4NBFA 1S7MA 1X3FA 4U673 2VB3X 1LT3D 2RHQB 1YHQA 3CD6A 1VQHA 1PH5A 5HGTA 4JPBW 2KHIA 2RBMA 3RD4A 1ENCA 3J81f 3H0GI 5AJ3Q 4BXXH 4A3DG 1SFOI 1C48A 3T1YL 4A3LI 3I561 4X66Q 2NVTB 1YJN1 3MONA 4MD8A 1B4OA 1QZHA 4F7XA 5LHY1 3GKQA 3DUZA 1C8CA 3PUXA 5C4XB 3MZ5A 1Y8NB 1XPRA 4K0KQ 1EY8A 2AWOA 4R4QA 4H44C 4XT1B 2EOTA 2VPYA 1PTOD 5GQOA 4UDUC 4M8AA 3C3LA 1DONA 1WTXA 1B9NA 1LQLA 2R7ZG 3TSSA 1Q1EA 1HXYD 4WRDA 1EY7A 2EQSA 3DWAA 3HZXA 4A3KB 1F2YA 4DV2L 3HOYI 1S4ZA 1VQDA 4A4IA 4RGTA 1GHKA 1RL2A 5COYA 4DV3Q 1B50A 2I46A 3M4OB 4MIUA 3PUYA 1VQMA 2R7ZH 1MJEA 2LIYA 2QA41 1YJWZ 3RUZA 4KD4A 4IFDI 3RZDH 3F2DA 2FINB 2QEX1 1SEBD 2WAQE 2K1BA 2WACA 4GLXA 4P74A 4A3FG 2E2HI 1U4LA 4CKEA 4JI7Q 3HOVG 1C0AA 1P8LA 5CGKA 5IGBA 2F0UA 3LX0A 3OIPA 1EU4A 1A3VA 4LW1A 2N49A 1KL9A 3SE0A 2IT1A 1O7ZA 5EKKA 2E5LQ 1Z02A 2PQEA 3RLOA 1UUPA 4K5VA 3TBIB 3VR3A 1QCBD 5C4HA 3NBHB 4WJWA 1Q82C 2JA6I 2R7FA 1CSQA 5EPLA 1QVFY 2RHSB 4LF6L 3PO2G 2DE5A 2KUMA 1ML8A 3S2DB 2E9HA 3J7AV 1XJVA 3CQZH 1ENAA 1VMPA 1PFBA 4JI1Q 3UE0A 2C5CA 5JEAG 4BY7H 4IN3A 2NB0A 1HR0W 2JNYA 4Y7NI 1EIFA 1J9OA 1K83H 1WCMH 2BE5C 1RNIA 2CCZA 1N32Q 1EQRA 3AU7A 4CJ0B 1BQQT 5CYUA 4ALPA 2V8KA 2YV5A 4A3KG 1ICFB 4GKKQ 3BZDB 4UY8C 2PK7A 5IP9G 3BDCA 4QY7A 1WCMI 4AYBE 4C3IG 3CP0A 4GKJL 1M1K1 1Y1VS 3ERSX 1KHIA 4L5TA 4QF4A 3HOWB 1PRTC 5FO8B 4A3EB 2SNSA 3BG3A 3KDFB 1Y1WI 1FL0A 3BYTB 1YITZ 4QJFA 1EOVA 3DLLA 1VQP1 2BDNA 4PZ7A 1PVOA 1EY9A 2K14A 3EJIA 1SXTA 4FF2A 4QCLA 4JVZA 2D62A 4YCWA 2Z1CA 4S1TA 3PV0A 3T4AC 4MD7A 3OWEB 2V8JA 3I07A 3S15H 3KOJA 5JJIA 4X62L 3HKZG 3FDTA 1LTAD 2AUKA 5E4WC 3K7AH 2YTYA 2ICEC 3CMAA 3HOUG 2E2HB 2EYPA 1XWEA 3MXNB 4BS9A 4OIJA 2DJGC 1K8A1 3I70A 4MTNA 5IGEA 1H95A 3ND8A 3S17H 5ELFA 3M4OI 4DUZQ 1E0BA 1OXUA 1VDZA 4K2KA 3ZYYX 4CGYB 3L3OC 4DV1Q 1M902 3S15B 2ZXPA 4IPDA 3TZUA 4A3DH 1Q861 2F0JA 3BZKA 3H6MA 3M85A 1U9RA 4EQNA 4GOPB 4DV0L 3IRBA 3VR4A 2F0DA 5CV9A 4OIKA 4GNXA 1WTWA 2K75A 4DKAC 2E7ZA 3CC71 2ICIA 1X56A 2L0CA 2L12A 4DK6C 3VDYA 2UUCQ 2GTHA 1LYLA 3S17B 3SK8A 1C4QA 4KKTA 1N33Q 1KRSA 2GTIA 3CRLC 2UUBQ 3JAML 2QDBA 1YHBA 4IOCA 5JPMC 5FJ8G 4DV4Q 1JR0D 1EY6A 4NBBA 2E2HH 3S1QI 1C9OA 1SNDA 4C2MH 2B2VC 2GN5A 3H91A 1VQ41 3FPPA 2F0PA 3I4MI 1TQOA 4LNQA 2PMZB 4X66L 1HNZL 1V8QA 2UUAQ 3G711 2OQ0A 1GM5A 3D8GA 3CPWA 3SK6A 1TWHI 2ZTCA 3M4QA 2XGTA 3JAME 1PHJA 3QG1A 1QOHA 2VF1A 2EDGA 3HG9A 2HDLA 2I5HA 1NR2A 1I4PA 2A73B 3HEJA 2PM9A 1PH6A 5IYDH 1EFID 2WINB 1D5MC 4Y7NH 4BBRI 1A6XA 2JA6G 2SOBA 2Z6KC 2UXCQ 1X9NA 4QUCA 1ONLA 4RMFA 3NHHA 5AFWA 5ELDA 2XIWA 4DV3L 5I4DA 2AKWB 1G6PA 3K7UC 2RA4A 2LFUA 3KF8A 1U4PA 4JBMA 2HT1A 2RQXA 5CC4A 2UXBL 2NVXB 1K83B 1HNWQ 1HZBA 5KIXA 3BVMA 2A74C 1QUQB 1WCMB 1PTOH 2K04A 4P2CB 2XSCA 4DK3C 3NP8A 1XNRL 1A15A 1X55A 4ZUIA 3GTMS 1RTNA 4F87A 3CC4A 3ER0A 4F8MA 5C44B 4CHTB 4DNRB 2UXDL 3R2TA 3CW2C 2WKCA 5C44I 3I4NI 1AZQA 1IBLL 4PMWA 5IP9I 1CHQD 2E2IB 1VQOZ 3A55A 1D7QA 1X3PA 5J1ZA 1KNEA 2F0VA 1BUVT 2O5JC 3OW2Y 4S3SA 2JA8G 1JMCA 2E2JI 2OEOA 4BY7I 4LMQD 2JA7I 2DE6A 4DUYL 2VQEL 1GOZA 4TNUA 4OL7A 1SE3A 3CC41 3GDEA 4A3FH 1D5XC 1I4QA 3GTOB 4DV1L 1QJOA 5D1OA 1BF4A 5M5XB 2P3YA 2VNUD 2PNHA 1I6VC 4RG1A 2JEAI 3F2BA 1JB7A 1EWCA 4JOIC 3J80f 1Q811 2A6HC 2K6AA 1WJJA 2NBFA 1VQEA 3TRZA 1IKLA 1DD2A 2CFMA 1YUAA 2KEEA 3U4ZA 5D65A 1CKNB 2CHBD 2CKZB 3PIO3 2F0TA 2OOXB 1VF7A 3TS2A 2V3VA 4HMIA 1HRJA 2X6LA 1QVGA 4A3BH 4XDXA 4MHEA 1PRTD 4PNYA 5C4XI 1LT6D 3HKSA 3MXPA 1VQGA 4RGNA 5IYBH 2PNRC 3H15A 4X6AH 1YNND 1DOMA 2DN8A 3KUPA 3IF8A 1IL8A 3HOZI 3V96A 1HFNA 3F2UA 3OTOQ 4E2YA 1RQFA 3HS0C 2AUJD 4LAAA 4IO9A 4DXFA 2F0MA 1MIUA 2KENA 1GVPA 4A3CI 3WWVA 3S1NB 1VQCA 1VQLZ 3TN2A 1QF8A 3PIP3 1X3ZA 2JA5B 2NVQI 1U4RA 3UDFA 4JBWA 1K8OA 4RGMA 3BDLA 1BDOA 5JJLA 1PFMA 5A2QE 4ZQ3A 1PH2A 4HN7A 1Q862 2LY7A 5GROA 4ZKCB 5FOBB 1SRUA 2JYOA 3CCRA 2O53A 4AQYQ 1TWGI 3G48A 3FKIH 4A3JG 4DNIA 1Y8CA 1EFWA 1EYCA 4HTHA 2ASBA 1ZYRC 3S2DI 3I4MG 2ZJQA 3I56Z 4GZYC 1E1TA 3IFTA 3SK4A 2VW9A 1DZ1A 2KEDA 1ET9A 2Q2UA 4IURA 3PO3G 3S16I 2KBNA 3S2HH 4JYAL 3BYYB 3P1HA 4P73A 2WAQB 2M9VA 1BR9A 3GTGH 1WW9A 1IBML 4Q5VA 5D1OB 1W2BY 4K2LA 1TR5A 4B3RQ 1YHQ1 3CD61 4ZKBB 3NQIA 4U68A 3M7NA 1PXUA 3T16A 3ERQA 1UE5A 3I8ZA 4DA2A 4OO1H 4BBSH 2K05A 2FMCA 1JOOA 4HCSA 1UEBA 2F0WA 4ZUJA 1GUSA 1TWCH 1EEID 1F9PA 2A69D 1KD11 1F2ZA 3M4PA 3ZJYC 2I5LX 4R8IA 4IOAA 1E7ZA 2WKDA 1WTQA 2J7ZA 1EQQA 1B2TA 5E1FA 5IYCG 4A3MH 1I3QH 4XXEA 4QTUA 2H1EA 1WFQA 3FKIB 1PZID 1YZ6A 2XRSD 3R3OA 1EIYB 2JA5G 3CHBD 3NELA 4FNFA 1FGUA 4UP7A 3I56A 2MNAA 2F0KA 1KD12 2MO1A 4DK1A 4Q0FA 4DV5Q 4NXMQ 4G57A 1VQ71 3GP7A 4YCVA 4NXNQ 1TT2A 2D2CC 4PG3A 2OT2A 1N9WA 3MXUA 5IGDA 1FGBD 1L0YB 2E8GA 3BVZA 1FYCA 1CZWA 2QEXA 3PO2H 1BCPD 4C1NI 1IL2A 3I2ZA 1SNPA 1WTRA 4HR7B 2E76C 2PCFB 1I3QB 1OXTA 2DUDA 4CDEC 1HZCA 2NVYI 3FMCA 1F77A 2ZM6L 3TS0A 1XPOA 2Q2HA 3ULLA 2IHEA 2EYMA 3QJYA 2XRQD 1TWGB 2PPBC 3Q24A 2ZJPA 2KCCA 2W04A 4JCVE 2IHFA 3I4LA 3UE1A 1BO0A 1PH4A 2K5RA 3A8IE 5E7NA 4E32A 2K03A 3HOVH 4H02A 1CA5A 3PO2I 1VQFA 4I65A 1TS3A 1WYDA 4A3MB 3STBD 4BWGB 1Y1WH 1JWSD 4A3GI 1U5KA 3I55A 3S15I 5C3EH 1M4VA 3M7GA 2F03A 1KDBA 5M3MH 2Z6KA 4Y7NB 5C4XG 1TWFH 5CM2M 2Y0SB 2WB1G 1ESFA 4DF7A 4X64L 1MHWC 3H94A 3KJOA 2N78A 4KHPQ 1Q90A 5LMNQ 1KNAA 2O4HA 4E2XA 5A2Qb 1CSPA 2BOSA 4NFRA 3WOEA 1L1OA 1V1QA 2QREB 1ZKOA 1SE2A 2V8IA 3D4RA 3TP6A 3RNUA 2E74C 1SN8A 1Y1VH 1PZJD 3SXHA 4E6IA 2JA5H 3CC21 3E0JA 3VB9A 2BA0A 3I4NH 1YNJD 1K8GA 1VQ61 2K52A 5I9PA 2PI2E 4X3UA 4NW2A 1CT1D 1E2WA 2M48A 1PYWD 2SEBD 4A3II 2CH4A 2F0GA 4JI4L 5J22A 2OTLA 2XN9C 4C3IB 1K0RA 1Y1VI 2V4DA 3CME1 3D6WA 1O7YA 3TZDA 2ID0A 3OMCA 2WAQA 4DR6L 1CTMA 1PYSB 2RCNA 4PQXA 3S2HB 3PUWA 2V1CC 3HFZB 3GTKI 1DGSA 1JQYD 4ME5A 5LMNW 3J7YW 3AFPA 3K0XA 3SGIA 1PFTA 1NMFA 3WOFA 2NYZD 3CCEZ 5M5WB 1BOSA 5DEHA 1CKMA 1HUNA 2JE6I 5IIFA 2JEBI 4JI1L 1RODA 2JA9A 4DR3Q 1VQ4Z 1Z47A 4HIDA 3D2LA 3TP5A 1WVLA 1X65A 2F0EA 3RZDI 3MZLB 1TWFB 3GV3A 1SJHD 4IUQA 4KY6A 1G91A 2JA6B 2F0FA 3G6JB 1IW7C 3S24A 1IYUA 3OW7A 1PTOC 2RCFA 1QVGZ 5A35A 4B3ML 3A54A 1JE5A 2QEXZ 2ZM6Q 4B08A 1STBA 2JJQA 2Q51A 3CPWZ 3MFYA 4GKKL 5CBAE 5T67A 1STNA 3NH4A 1KABA 3K0YA 1TWFI 1Q7Y2 2EIFA 4HIMA 1L2FA 2VB2X 5FLMH 3C1EA 2XWJB 3RZOB 2JIOA 1B8AA 2QDLA 1FVIA 1KXLA 3G4S1 4G7HC 3BG1B 1Z03A 4YY3Q 2EXZA 3D0FA 2OXPA 3MZKB 4KK7A 3SDZA 2Y0SA 1WJ2A 2OZKA 4KJNA 5IWAL 1JJ2A 5CV6A 4TVAB 5KNBA 5T1GA 2QRCB 1XMQL 3PO3S 4LFCQ 1X6OA 1UAPA 1S5ED 4KJOA 4CL1A 2CW0D 4QTTA 2O4XA 5HURA 5I2YA 1EIGA 1F9RA 1JWMD 3RZOI 4DV4L 1VQNA 4A3KI 3MC0B 3N6RA 1VQ7Z 3GTPI 3HOYB 4HJ5A 2JIMA 5KNCA 4A3JH 1TIID 5TSSA 1I50B 4WORA 3A8KE 1GKHA 1WD1A 1H9JA 4DXGA 3RMHA 4X64Q 3K7AI 4TKOB 3RLFA 3S1MI 2KHJA 1VQO1 2ZXRA 1B44D 4MN3A 3Q0AA 3J7AF 3GTMH 4DV5L 2IX0A 4NXML 1EYAA 2N55A 5AN9F 1D2BA 2KPIA 5ISRA 3A56A 1TWCI 1H9KA 3ONAB 5M5WH 2M00A 4IUPA 1B9MA 4R1JA 4H0LC 1II3A 5C0XJ 1PH7A 1VQ6Z 4KD3A 4POFA 1YVCA 3G6EA 3F3FC 2Z4HA 3CKIB 5T64A 3VA5A 5M3MG 2B39A 4MXUA 3CCJ1 3AFQA 3OHXC 4X3SA 4NBCA 1LUZA 4DR5Q 2QF7A 3NUCA 4YWMA 1TWCB 1R4PB 5C44G 4E30A 5J39A 1RJTA 3P5JB 3I3CA 5CV8A 1KC8C 3BJUA 5JJKA 4HJ9A 3CCR1 1QVFZ 1EIHA 4FDBA 4HCEA 1E2VA 2L4NA 3FRPB 4OHJA 4DR2L 1U4MA 4BY1H 1FJGL 4J1MA 4OX9Q 1I50H 2EJMA 2RSOA 3JAMc 2M6NA 2VPWA 1D1KA 4JI0L 3GTLI 3HOWG 4A3IB 1XNRQ 3FKII 4BY1I 1CA6A 1ILQA 1H9RA 2IZ3A 1ET6A 5FO9B 3I4NB 3VR6A 2CQOA 3M4YA 2F4OA 3ULJA 3S2HI 4DR1L 4BXXG 1IBLQ 2IW3A 4A3BI 4RA8A 2K28A 3DM1A 2NVQH 3NPPA 4FXDA 1STEA 3PGZA 1Y69U 2JA7B 3KLSA 3MEHA 4DQYB 1OXSC 4EQPA 3PF5A 1STAA 4X65Q 2RPRA 1JC7A 1X3QA 4QMGA 4E33A 4JOIA 3PUVA 1YJ91 1TWHH 4GN3B 4HIOA 2NUCA 1UE6A 4A3BB 1TVXA 2PMZA 4JC0A 2R92G 4BA1I 3Q87A 4X6AI 1ESRA 3P7JA 3D4WA 1TWAH 3PCOB 3IFDA 2R6GA 3CCUZ 1GUNA 3GTKB 1K8AC 3VYTA 1TWAI 4LUZA 1N36L 2HUGA 2TSSA 3J7ZC 3IR7A 1GUOA 1PTOF 4ZK9B 1PA6A 1VQ7A 4A3CG 1KAAA 3DHQA 1HNWL 3TEHB 5T6BA 5K5PA 1DXMA 2L15A 5C4XH 1BBWA 2GA4B 4GNXB 3PMFA 3HOZH 2NTTA 3CCUA 2YU9B 3NH8A 2NVQB 1JT8A 2ENBA 4L6TB 3PUZA 3CMAZ 2GVAA 4LF5L 2A68C 3CC4Z 1SIWA 5C3XA 1VLAA 1VQN1 1AFPA 3CXCZ 4A75A 1G291 2JA8B 4P72A 3J80L 4K6DA 5AJ3L 3ITPA 3NBIA 1VQPZ 1SMYC 2HCIA 3X3NA 2B63G 4UP8A 4MRIA 1SLJA 2B8FA 2RSNA 1EOTA 3IFUA 1LT4D 4Y52I 4DU9A 3OYYA 3A74A 1RLYA 4RAUC 2I07B 5M3FG 4IFDG 3K80C 4B3MQ 2AQ2B 3I4NG 4AIMA 4A3JB 5C4JI 2RF4A 4A3FI 5G3LD 3TP7A 4V0BA 2QKDA 2VQFQ 2EXDA 2F0OA 3EQLC 5C3EB 3CCEA 1K8A2 1ZYRD 5ELNA 4WJ4A 4DAYA 4RVFA 4DAMA 1E24A 4HAEA 1U0LA 4ZRZA 3NFZA 2I5MX 1PH3A 1PH8A 3OW2A 4MZ9A 3TE5B 5FO7B 1XNQL 2TMPA 3VR5A 2NN6G 4G7ZC 1QNUA 3GD7A 2LXJA 1RHPA 4GKJQ 5I6WA 5LMUL 3CXCA 2RDHA 1RO2A 4HJ7A 1PRTB 3T13A 2NVTI 1QG7A 2K5VA 4A3EI 1Z6HA 4TQUS 4POGA 3WDNA 5A2QL 2OTLZ 3QWUA 4EQ5A 1T5EA 1XMOL 1Y8OB 1JOQA 1STYA 3FP9A 1VQ6A 4A3GH 1I94L 3EERA 3HOXG 4E31A 1K3RA 4XYQA 2OOYB 4IPHA 3BG0B 1OO9B 2G5DA 2QEJC 1CFMA 3EN2A 2EPBA 1W6KA 3O13A 2LS01 3C1FA 1HNXL 3HOWI 4B3SL 3HOZG 4BY1G 3S1RH 5EAYA 2LEXA 1HQRD 1EL0A 1WCMG 1LABA 3A7LA 3D31A 3PIOA 1A63A 5I9OA 2B2TC 3H3VI 4FXGC 4V190 2K5QA 4Z9CB 2K5WA 4K5WA 3URYA 3GV6A 3QIAA 1M1K2 1SYEA 3H3VH 3K8AA 2EYHA 3KIFA 3VMIA 1T5XD 3K6OA 1HTPA 5JEAJ 4KTAA 1VF5C 4IFDJ 4ME3A 3KLSX 2EVBA 4E2ZA 1HH2P 1FDOA 1Q1BA 2NN6H 1TU2B 4KN4C 4B3TL 2GU2A 1DOKA 3F1ZA 5IE8A 1NUIA 1TWHB 1LV9A 4IUNA 2H5XA 5KRUA 4MTKA 2EYFA 2D0OA 4NBHA 1SYDA 2QRDB 4L5SA 3S14I 4DAYB 2B2WC 1LTRD 3NH5A 4OO1I 4X62Q 1HUMA 2K4KA 1IBKL 2QLVB 4AYBB 4C1NK 4FVMA 3HOXB 1XXGA 4JW0A 4BBRB 5KNDA 2BJOA 4HSVA 1NTGA 4N9TA 1TKWB 3DEPA 1N2FA 1HR0L 1VQ5Z 1L1OC 3NDJA 1CK1A 2ES2A 3GTJB 1FDIA 2VUMH 4I7AA 2B3GA 4AH6A 2A5HA 3CCVA 2F0SA 4CJ1B 1R4QB 3KBGA 4IJLA 5M9OA 4J6HA 1N8RC 2Q2IA 3G6EZ 4MH4A 1YIT1 3GTQB 4FF1A 1A62A 2VUMG 4WJ3M 1YUKA 1K732 4BBSI 2R93G 4A76A 4C2MB 4HJAA 3I4MB 2JUBA 2B2YA 3MFGA 5C4JB 2IPKD 2A6ED 2JXMB 4XQJA 1N8R2 2B29A 2O5IC 3H09A 4A3FB 1KC81 1ZB9A 4MD9A 5EKLA 3GTMB 2JR6A 2EYLA 5JVH3 5IGGA 1RO0A 2HCCA 1EZ6A 2KVMA 1X3GA 3GTMI 1Q8IA 5C4ZA 1K9M1 2UUCL 1JOKA 1NUCA 4DV7L 4NKLA 1PFSA 5C0XH 2NVXI 1ASZA 2FXQA 5LL6S 1HCZA 2IL8A 3CCJA 2CWPA 2NVTH 4FF3A 3C2PA 5BR8L 1ZB8A 1F9QA 2QILA 2UXDQ 3OMGA 1SE8A 5DM63 1VQJA 1LTSD 1GXDC 4N8FA 3OOCA 1VQKA 5G3LF 2A68D 2DY8A 2W03A 1VQAA 3IX0A 3KLRA 4BBRG 1HNXQ 1J8IA 4K8IA 1CUKA 1SNQA 4CDFC 1K83I 1H9SB 1HA6A 1S72Z 2MUYA 1KAWA 1O7IA 2X69A 3L0OA 3BZCA 5CV4A 2VQEQ 4FF4A 4LF4Q 1B7YB 3V05A 5HGQA 5BN4A 4FYDA 4KKSA 2HD3A 2OTJA 3RZOH 1IXRA 2BH8A 3HOXI 3LNNA 3MVVA 4IPCA 5KYIA 1MD2D 1NAPA 3CRKC 3T53B 4C3HB 5IP7I 2A6EC 2OQKA 4M1UB 3VYSA 5T1IA 4BA2I 2KJXA 1VQLA 2QA4Z 1YJW1 1SYFA 4KV6A 1SNOA 4RS4A 2SNMA 5CV5A 5IODA 4A93G 4R4IA 2N3SA 4GS3A 3LWUA 2VPZA 3S1QB 4JI4Q 2B63H 1A3TA 2AMCB 2Z8LA 3BVGA 4BY7B 1YJ9A 2PI2A 5FLMG 3QB3A 3DMUA 4IUVA 3KIHA 1LTGD 2G2KA 4DR6Q 2MFIA 2R7ZB 1VQBA 1KC82 3D6CA 4K5XA 2JIPA 3S1MB 1I94Q 5IP7H 3ND9A 4GNXC 2B2TA 1YIJZ 2MP1A 2QKIC 1EWIA 3T1HQ 2IX3A 2BCOA 1WTHA 1GO3E 2E2JH 3CCMA 1TFIA 2PQAB 1VS0A 4BBSB 1S72A 4KHVA 1VQ9A 2D0PA 2KHSA 2CWAA 4ILWA 1S5FD 5C5MA 4ZYSA 1HR0Q 3S1RI 2H85A 1WZNA 3KBXA 2AQ1B 4RV9A 4KY7A 5JJZA 3SR1A 5GAGC 5D3DA 4K0KL 2RDGA 2F0LA 1TY2A 2QGQA 4NDXA 4IUUA 1LO5D 3CQZB 3K59A 2Z0SA 3U9OA 1E22A 1NE3A 1FNUA 1X0TA 3CCM1 1L0WA 1JB3A 1EZ8A 3FPUB 4BBRH 4RH6A 3J81L 2HF1A 4A3IH 1CI3M 5L37A 5C3WA 4UPAA 2MQHA 3B6YA 1YNJC 3MAQA 1KDCA 4KLKA 4BXXI 1MJCA 1KIXA 4KMUC 1J5EL 1UE1A 2IWHA 2VL6A 1XX8A 4ZAIA 4DAPA 1WTPA 3J80c 3HOUH 2HQLA 3U4VA 5IT9L 5LL6f 3NTHA 2VUMI 3NXWA 4DN4M 2D5DA 1KQSZ 1PZKD 1TS2A 3KFUA 3VMGA 3S1QH 1NSNS 1Y14B 3CU7A 4LF8Q 2R6MA 3I73A 3QR8A 2Y0SE 3A5UA 3GTLH 2M2LA 2HQEA 4QGUA 2HU9A 1RDPD 2EJGC 4A3JI 1VQ9Z 3A5ZB 3LWEA 2Q4ZA 3BS1A 5BR8Q 2L9HA 1LTTD 3Q23A 3JAMf 5FLXc 1Q8KA 3VYUA 2MJ8A 3PO3I 2B2YC 2L1BA 5EGTA 3S1MH 1MI2A 1OXVA 3E3XA 1GJXA 4L8JA 4KKUA 2K5DA 3HOUB 5DNFA 3HOVI 4JK1C 5M3FB 1YIJ1 2K01A 1I4GA 1JJ2Y 1DCZA 4NPSA 5E3FA 3CF5A 4PMBA 3JAMb 4JV5L 4LF4L 2KCMA 1NJI2 1KRTA 5FK9C 1QXFA 4HH4A 1A2UA 5M3MB 4JYAQ 3QOJA 4H13C 4NP5A 3NENA 1K73C 3CC7A 2R92H 2AKLA 3T4NB 4FO2A 2KI7B 4QQBX 2PZWA 3R2IA 1JORA 2LMCB 1IBMQ 3IAYA 1LTID 3G4SZ 2NZHA 2P28A 3U58A 2K3RA 1V1PB 4DK0A 4DGLA 1S40A 3X3MA 3AQQA 1QYPA 4K14A 2XNAC 1AZPA 5DM73 1LACA 5IGCA 1RTOA 4JI7L 2Q8RE 4J15A 2B63I 2F0IA 2F1MA 1O80A 5D14A 5M5YB 2RKSA 1EY4A 4RWSC 1QWYA 1G2TA 5I6YA 1K28A 4CKBA 3I7FA 4DR7Q 4A93I 1BNZA 4R9WA 3VR2A 4DFAA 1VQ8Z 1G2SA 5BN5A 5NUCA 1VQKZ 2F3VA 1YEZA 4C3HG 4LUOA 1YI21 3FHWA 3GTLB 1JJGA 4BY1B 1TXYA 2AHOB 1L1OB 2K33A 5DAUA 3RN5A 1IYVA 2FHTA 4GLVB 3L9AX 3F3PC 1SYCA 5ELEA 4A3MG 1SDFA 2CVRA 1AE3A 3MTSA 3DWPA 1HTLD 1B1ZA 1N8R1 3KF8B 1K3BC 1Q7YC 2K7VA 4NXNL 1I6HB 1NCVA 1SE4A 3CMEA 2E2IH 2EJFC 2PMZE 4TRDA 3VMHA 1SYGA 3CCRZ 2OTL1 4PV1C 1PTOB 1K0SA 5IT9b 1BCPB 1IYJB 4L63B 1J5EQ 3GTGI 1E1OA 3PF4A 3Q22A 5KGUA 3ULPA 1EY0A 1SR3A 3GTOH 3OW2Z 4KHZA 2B2UC 4B9WA 1UEAB 3GTJI 1D6EC 3NWSA 1IZ6A 1USPB 3GTOI 4KY5A 2F4VQ 1Z9FA 1PMRA 1YITA 1F9SA 1N33L 1Q7Y1 1EQTA 3E5SA 1HJPA 3K58A 3J81i 1EYGA 3S2DH 1BBUA 1WI5A 2OF1A 1JCKB 2L11A 3HKZE 4A3DB 4RVGA 2VUGA 1XMOQ 3NDIA 1Y8PB 3I4MH 1CKOA 4OWXB 4UAIA 3AB9A 3T1HL 2LXKA 4R4CA 3W1GA 1BKBA 2YU9I 5IOCA 1HNZQ 3KLWA 2EYOA 5LMNL 5IYBG 2ZAEB 1I6HH 1VQPA 4DPGA 4HEDA 4YHHL 3SVMA 4P75A 1KD1C 1D8LA 4NOZA 2EE1A 2I3CA 2F4IA 3Q6SA 4RHSA 3CMA1 2KQ3A 4DR4Q 2KCTA 2WB1E 4NBAA 3G71Z 2YTXA 4JG2A 4QIWB 2VQFL 1SJED 4CDDC 1Y1VG 2UXCL 4RGOS 2PQAA 1VQK1 4H7BA 3M3YB 1SMXA 1G6ZA 5IYCH 2JQOA 3AYHB 4GOPC 1Z7TA 4YWKA 3DXJC 4JI3L 4LF7L 3GTPH 3TDHB 1SSOA 3S14H 2Q8IB 4O1NA 4OONA 5M5XH 4OO1G 2HIXA 4DGZA 3IKJA 4ID6A 4P71A 1Q16A 3PO2B 1VMCA 4OWWB 4J8QA 3H0GG 2VS1A 3S17I 3I4OA 3H0GH 2UUBL 1P9NA 4UP9A 4XT3B 1MGSA 1TS5A 2F0HA 3AEVA 3CCLZ 1VQOA 4DR7L 1UNSA 3MXNA 2JP1A 3CCLA 1DYQA 1AW7A 3NWTA 3VYRA 1YJWA 2R92B 3BU2A 4NH1C 3BDOA 3H3VC 4LF9L 3GTPB 3EROA 1EY5A 2XVSA 3S1NI 1NNXA 2R7ZI 2R61A 1PH1A 2YYZA 2UUAL 1IW7D 3QOLA 2H4OA 4NB3A 2B2WA 2Y0SG 5EBCA 4DUYQ 2DE7A 2KECA 4NMZA 2WB1B 4RFBA 3PSIA 2MPMA 4LUVA 1I4XA 2A6HD 3HRZC 1Q3LA 4DR3L 3CPFA 4A3EH 1Q46A 3D9XA 1KQSY 3CXCY 4A3EG 1M8AA 3KDFA 1CZGA 2Z9HA 3G71A 3CCSZ 4YIJA 2WP8J 4APVA 2R7DA 3J81c 2YADA 1R9TI 3P75A 2X6GA 3CAMA 1FNVA 2K32A 1A0IA 2PO4A 1YBYA 1EQVA 3VA7A 5EPJA 1M1KC
chains in the Genus database with same CATH topology
1V43A 4BY7G 4DV6Q 4DV2Q 2ZJRA 3RN2A 3U50C 4GN5A 5C3EG 1OTCA 2A19A 1BVSA 4B3TQ 1QVFA 3FQMA 2F4VL 1WIIA 1Q12A 5C0XG 1ZH1A 1DL6A 3CCSA 4YY3L 1PH9A 3L2PA 1R9TH 4OX9L 3EEDA 1CKNA 5IWAQ 3LUSA 4EWCA 4L5RC 1NBWA 1XMQQ 1KRLA 1OXXK 2XTIA 1ASYA 5IY0A 1YJNA 3T1YQ 5IP7G 4YHHQ 2F52A 2OCEA 1NJI1 1T9HA 1RO4A 4AQYL 1VQ81 1VQ51 1PYBA 4AYBG 1PV4A 4HIKA 3HOXH 2IX1A 1TWGH 4MONA 4A3DI 3S1NH 4A3LG 3KF6B 1MKHA 1VCIA 3FKIG 2C35B 1YNXA 2LSSA 4AYBA 1N36Q 2K50A 1NJIC 4XTCS 1VQ8A 2Q2TA 1QUQA 4QL5A 4JI2L 4A3BG 4DV7Q 4JI5L 2JA7H 2ZTDA 3OTOL 4BBSG 1YJNZ 4DR2Q 5D1PA 2JMOA 3HOYG 2IZ4A 1B70B 1VQM1 3GTQI 4RVDA 1QVCA 2R92I 3J81j 4R4OA 5H1SE 1M90C 4YWLA 2R93H 4JI6Q 2NVXH 2WAQG 1VQ91 3EIVA 4DR4L 3CCE1 4LFBL 1AE2A 3EBEA 1YHQZ 3CD6Z 1C7YA 4NBDA 1Q822 4KI0A 2JA5I 3E9IA 4E2WA 3ESWA 1NP6A 4QIWE 1N34Q 3MEFA 3STBC 3CMEZ 3CPWY 5GAEC 1USPA 1J6QA 4O2DA 2ZTEA 2IY5B 1UE7A 1E3PA 1KQSA 3L7ZC 4HGYA 4PZ8A 3J7A5 1A8VA 3CC2Z 4LF8L 4JI8Q 2HHHL 1UWVA 5C3EI 1K9M2 2E2II 3CQZI 1JJCB 1XPUA 4LF5Q 3F2CA 1W3SA 1XTDA 5FLMI 3DM3A 2JA6H 4KHPL 5ELOA 1VQMZ 1VQNZ 1AH9A 3CCQZ 4PZ6A 3J80b 1Q86C 2GVBA 2JK8A 2K5NA 2NN6I 1JJ2Z 3TREA 5FLXf 4JV5Q 1G51A 3H3VJ 2A1AA 3K81C 1HZAA 4DV0Q 3G4SA 4LWCA 2F4MA 5FLXb 1YHAA 5K36G 1VQIA 2K5HA 3J7A4 5LMUQ 1K731 4OWTB 1XNQQ 5FJ8H 2OWOA 2UXBQ 3GCFA 2JA8I 4JI5Q 1VQ4A 2JA8H 3PIPA 4GLAC 1YJ9Z 3M4OH 3E0EA 1X3EA 5A2Qf 4C3HH 4L5QA 1I5FA 3CCQ1 4JBJA 4NBEA 4A3IG 3GTKH 3UDGA 2YU9H 1X3WA 4MNOA 2I0QA 4A3LH 2AWNA 1SFOH 4B3SQ 1W2BZ 1YI2A 3Q8DA 1QVGY 4YCUA 5IYDG 3HOWH 2N8NA 3I551 2OTJZ 3RR5A 5J3BA 4IJHA 2WFWA 1N34L 3S16H 1I6HI 2UU9Q 1EUJA 3FQQA 1Q821 4NBGA 2EGTA 1RIPA 3CC2A 4JI2Q 4LFAL 2QR1B 3CCJZ 2RBLA 2RT9A 2HIVA 3GTJH 2HHHQ 2VZAA 3E9HA 2ALYB 1IBKQ 3GTQH 3UDXA 3A0JA 4JI8L 1K9MC 3UDIA 4A3KH 2E5LL 3KF6A 5C4JH 4JBKA 2R93I 5IT9c 5GAHC 1WOCA 1LTLA 4JI6L 3M3YH 3I55Z 2OTJ1 1GD7A 5M5YH 2J6AA 1YI2Z 1W2BA 3CCS1 4Y52H 1HZ9A 1Q81C 5DLQE 4LFBQ 4A93H 2RHBA 3RLNA 3W5OA 4GOPA 1VQL1 1LM0A 3CC7Z 3W1BA 4GN4B 3HOYH 3LGJA 1P16A 1JWHC 4DR5L 3CCL1 3F8TA 3JC66 4XIGS 2QA4A 4LF7Q 4JI3Q 2JA7G 2MO0A 2BA1A 4A3MI 3CCU1 5M3FH 3KJPA 3GO5A 3ICEA 4LFCL 2F3IA 4R4TA 3VTNA 4OXPA 1V9PA 2JS4A 2NVYH 4JI0Q 1I3QI 4RVHA 1X54A 1S721 4NB9A 5IP9H 4C3JH 1S3OA 3HKZA 2A8VA 4O0AA 4LF6Q 1M901 2NZOA 4NB8A 4DR1Q 3M3YI 3CCQA 2BH2A 4X65L 1Q812 3KYHC 4C3IH 2DGYA 5GADC 4HJ8A 4IPGA 1N32L 2RIQA 5C0XI 1QZGA 1I50I 1Z01A 4DUZL 4XX2A 1Y1WG 3CCV1 2WB1A 5C44H 2UU9L 4EX5A 1SROA 2VY3A 3PO3H 4A3GG 2YTVA 2ATWA 1NMGA 4B3RL 4LFAQ 4DV6L 3J80i 1NY4A 4A3CH 1FJGQ 3HOUI 3G6E1 3CCMZ 4HGZA 5IT9f 5HY6A 3J81b 3CCVZ 3M9BA 1YIJA 3NEMA 4LF9Q 3TQYA 3JAMi 1VQ5A 4NBFA 1S7MA 1X3FA 2RHQB 1YHQA 3CD6A 1VQHA 1PH5A 2KHIA 3J81f 3H0GI 5AJ3Q 4BXXH 4A3DG 1SFOI 3T1YL 4A3LI 3I561 4X66Q 1YJN1 3MONA 4MD8A 1QZHA 3GKQA 3PUXA 1XPRA 4K0KQ 2AWOA 4R4QA 5GQOA 1LQLA 2R7ZG 1Q1EA 2EQSA 4DV2L 3HOYI 1VQDA 4A4IA 1RL2A 4DV3Q 3PUYA 1VQMA 2R7ZH 1MJEA 2LIYA 2QA41 1YJWZ 4IFDI 3RZDH 3F2DA 2QEX1 2WAQE 4GLXA 4P74A 4A3FG 2E2HI 4JI7Q 3HOVG 1C0AA 1P8LA 4LW1A 2N49A 1KL9A 2IT1A 2E5LQ 1Z02A 3RLOA 3NBHB 1Q82C 2JA6I 2R7FA 1CSQA 4LF6L 1QVFY 2RHSB 3PO2G 2DE5A 1ML8A 2E9HA 1XJVA 3CQZH 4JI1Q 3UE0A 5JEAG 4BY7H 1HR0W 2JNYA 4Y7NI 1EIFA 1K83H 1WCMH 1RNIA 2CCZA 1N32Q 1EQRA 4ALPA 2V8KA 2YV5A 4A3KG 4GKKQ 4UY8C 2PK7A 5IP9G 4QY7A 1WCMI 4AYBE 3CP0A 4GKJL 1M1K1 1Y1VS 3ERSX 1KHIA 4L5TA 3KDFB 1Y1WI 1FL0A 1YITZ 4QJFA 1EOVA 3DLLA 1VQP1 1PVOA 4PZ7A 2K14A 2D62A 4YCWA 4S1TA 3PV0A 4MD7A 2V8JA 3I07A 3S15H 3KOJA 5JJIA 4X62L 3HKZG 3K7AH 2YTYA 3CMAA 3HOUG 3MXNB 1K8A1 4MTNA 1H95A 3S17H 3M4OI 4DUZQ 1OXUA 4DV1Q 1M902 4IPDA 4A3DH 1Q861 3BZKA 3M85A 4GOPB 4DV0L 3IRBA 4GNXA 2K75A 4DKAC 3CC71 4DK6C 1X56A 3VDYA 2UUCQ 2GTHA 1LYLA 1N33Q 1KRSA 2GTIA 2UUBQ 1YHBA 4IOCA 5FJ8G 4DV4Q 4NBBA 2E2HH 3S1QI 1C9OA 4C2MH 2GN5A 1VQ41 3I4MI 4LNQA 1HNZL 4X66L 2UUAQ 3G711 2OQ0A 1GM5A 3CPWA 1TWHI 2ZTCA 3M4QA 2XGTA 1PHJA 2VF1A 2I5HA 1PH6A 2PM9A 5IYDH 4Y7NH 4BBRI 2JA6G 2Z6KC 2UXCQ 1X9NA 4RMFA 4DV3L 2AKWB 1G6PA 3K7UC 2LFUA 4JBMA 2HT1A 2UXBL 1HNWQ 1HZBA 1QUQB 4DK3C 1XNRL 1X55A 3GTMS 3CC4A 3ER0A 2UXDL 3CW2C 5C44I 3I4NI 1IBLL 4PMWA 5IP9I 1VQOZ 1D7QA 3OW2Y 2JA8G 1JMCA 2E2JI 4DUYL 4BY7I 2JA7I 2DE6A 2VQEL 4TNUA 3CC41 3GDEA 4A3FH 4DV1L 5D1OA 2P3YA 2VNUD 2PNHA 4RG1A 2JEAI 3F2BA 1JB7A 4JOIC 3J80f 1Q811 1WJJA 1VQEA 3TRZA 2CFMA 1YUAA 3U4ZA 1CKNB 2CKZB 2OOXB 3TS2A 1QVGA 4A3BH 5C4XI 3HKSA 5IYBH 1VQGA 3H15A 4X6AH 3IF8A 3HOZI 3OTOQ 4E2YA 1RQFA 4IO9A 1MIUA 2KENA 1GVPA 4A3CI 3WWVA 1VQCA 1VQLZ 1QF8A 1X3ZA 2NVQI 3UDFA 4JBWA 5JJLA 1PH2A 1Q862 5GROA 1SRUA 3CCRA 2O53A 4AQYQ 1TWGI 3G48A 3FKIH 4A3JG 2ASBA 4DNIA 1EFWA 3I4MG 3S2DI 2ZJQA 3I56Z 1E1TA 2VW9A 2Q2UA 3PO3G 3S2HH 3S16I 2KBNA 4JYAL 4P73A 3GTGH 1WW9A 1IBML 5D1OB 1W2BY 4B3RQ 1YHQ1 3CD61 3M7NA 1UE5A 4BBSH 1UEBA 1TWCH 1KD11 3M4PA 3ZJYC 2I5LX 4IOAA 1E7ZA 1EQQA 5IYCG 4A3MH 1I3QH 4QTUA 1EIYB 1WFQA 2JA5G 1YZ6A 3NELA 1FGUA 4UP7A 3I56A 2MNAA 1KD12 2MO1A 4DK1A 4DV5Q 4NXMQ 1VQ71 4YCVA 4NXNQ 4PG3A 1N9WA 2E8GA 2QEXA 3PO2H 1IL2A 3I2ZA 1OXTA 2DUDA 1HZCA 2NVYI 2ZM6L 3TS0A 1XPOA 2Q2HA 3ULLA 2IHEA 2ZJPA 2W04A 4JCVE 2IHFA 3UE1A 1PH4A 2K5RA 5E7NA 4E32A 3HOVH 4H02A 3PO2I 1VQFA 1WYDA 3STBD 1Y1WH 4A3GI 1U5KA 3I55A 3S15I 5C3EH 5M3MH 2Z6KA 5C4XG 1TWFH 5CM2M 2WB1G 4X64L 3KJOA 2N78A 4KHPQ 5LMNQ 2O4HA 4E2XA 5A2Qb 1CSPA 4NFRA 1L1OA 1V1QA 2QREB 2V8IA 3RNUA 1SN8A 1Y1VH 2JA5H 3CC21 3VB9A 2BA0A 3I4NH 1K8GA 1VQ61 2K52A 2PI2E 2M48A 4A3II 4JI4L 2OTLA 1K0RA 1Y1VI 3CME1 3D6WA 2ID0A 2WAQA 4DR6L 1PYSB 2RCNA 3PUWA 2V1CC 3HFZB 3GTKI 1DGSA 5LMNW 3AFPA 3K0XA 3SGIA 1PFTA 1NMFA 3CCEZ 1CKMA 2JE6I 2JEBI 4JI1L 2JA9A 4DR3Q 1VQ4Z 1Z47A 4HIDA 1X65A 3RZDI 3MZLB 3S24A 1QVGZ 4B3ML 1JE5A 2QEXZ 2ZM6Q 2Q51A 3CPWZ 2JJQA 4GKKL 5T67A 3NH4A 1TWFI 1Q7Y2 2EIFA 4HIMA 1L2FA 5FLMH 1B8AA 1KXLA 1FVIA 3G4S1 3BG1B 1Z03A 4YY3Q 3D0FA 3MZKB 2Y0SA 2OZKA 1JJ2A 5IWAL 4TVAB 2QRCB 1XMQL 3PO3S 4LFCQ 1X6OA 4CL1A 4QTTA 4DV4L 1VQNA 3RZOI 4A3KI 1VQ7Z 3GTPI 4HJ5A 4A3JH 1GKHA 4X64Q 3K7AI 3RLFA 3S1MI 2KHJA 1VQO1 3GTMH 4DV5L 2IX0A 4NXML 5AN9F 2KPIA 1TWCI 5M5WH 4R1JA 5C0XJ 1PH7A 1VQ6Z 4POFA 1YVCA 3G6EA 3F3FC 5T64A 5M3MG 4MXUA 3CCJ1 3AFQA 4NBCA 1LUZA 4DR5Q 4YWMA 5C44G 4E30A 3P5JB 1KC8C 3BJUA 5JJKA 4HJ9A 3CCR1 1QVFZ 4FDBA 4DR2L 4BY1H 1FJGL 4OX9Q 1I50H 3JAMc 2M6NA 4JI0L 3GTLI 3HOWG 1XNRQ 3FKII 4BY1I 2IZ3A 2CQOA 2F4OA 3ULJA 3S2HI 4DR1L 4BXXG 1IBLQ 4A3BI 2NVQH 3PGZA 4DQYB 1OXSC 3PF5A 4X65Q 2RPRA 4E33A 4JOIA 3PUVA 1YJ91 1TWHH 4GN3B 4HIOA 1UE6A 2PMZA 4JC0A 2R92G 4BA1I 3Q87A 4X6AI 1TWAH 3PCOB 2R6GA 3CCUZ 1K8AC 1TWAI 4LUZA 1N36L 3J7ZC 1PA6A 1VQ7A 4A3CG 1HNWL 3TEHB 5T6BA 2L15A 5C4XH 1BBWA 4GNXB 3HOZH 3CCUA 3NH8A 1JT8A 3PUZA 3CMAZ 2GVAA 4LF5L 3CC4Z 1VLAA 1VQN1 3CXCZ 4A75A 1G291 4P72A 5AJ3L 1VQPZ 2B63G 4UP8A 4MRIA 1SLJA 3IFUA 4Y52I 5M3FG 3OYYA 3A74A 1RLYA 4IFDG 3K80C 4B3MQ 3I4NG 4AIMA 5C4JI 2RF4A 4A3FI 2QKDA 2VQFQ 2EXDA 3CCEA 1K8A2 5ELNA 4WJ4A 4RVFA 4DAMA 1E24A 1U0LA 3NFZA 2I5MX 1PH3A 1PH8A 3OW2A 4MZ9A 3TE5B 1XNQL 2NN6G 3GD7A 2LXJA 4GKJQ 5LMUL 3CXCA 1RO2A 4HJ7A 2NVTI 2K5VA 4A3EI 4POGA 4TQUS 2OTLZ 3QWUA 4EQ5A 1XMOL 3FP9A 1VQ6A 4A3GH 1I94L 3EERA 3HOXG 4E31A 1K3RA 2OOYB 4IPHA 3BG0B 3EN2A 1HNXL 3HOWI 4B3SL 3HOZG 4BY1G 3S1RH 5EAYA 1WCMG 3D31A 3PIOA 1A63A 3H3VI 1M1K2 3H3VH 3K8AA 3KIFA 3VMIA 5JEAJ 4IFDJ 4ME3A 4E2ZA 1HH2P 1Q1BA 4B3TL 2GU2A 3F1ZA 5IE8A 1NUIA 2H5XA 2D0OA 4NBHA 2QRDB 4L5SA 3S14I 4DAYB 3NH5A 4OO1I 4X62Q 2K4KA 1IBKL 2QLVB 2BJOA 1NTGA 1N2FA 1HR0L 1VQ5Z 1L1OC 3NDJA 2ES2A 2VUMH 2B3GA 4AH6A 3CCVA 4IJLA 1N8RC 2Q2IA 3G6EZ 4MH4A 1YIT1 1A62A 2VUMG 4WJ3M 1YUKA 1K732 4BBSI 2R93G 4A76A 4HJAA 2JUBA 1N8R2 2B29A 1KC81 1ZB9A 4MD9A 2JR6A 1RO0A 1X3GA 3GTMI 1K9M1 2UUCL 4DV7L 1PFSA 2NVXI 1ASZA 2FXQA 3CCJA 2CWPA 2NVTH 5BR8L 1ZB8A 2UXDQ 1SE8A 1VQJA 1VQKA 2W03A 1VQAA 3IX0A 4BBRG 1HNXQ 1CUKA 1K83I 1S72Z 1KAWA 1O7IA 3L0OA 3BZCA 2VQEQ 4LF4Q 1B7YB 5HGQA 2OTJA 3RZOH 1IXRA 2BH8A 3HOXI 4IPCA 5IP7I 2OQKA 4BA2I 1VQLA 2QA4Z 1YJW1 4RS4A 4A93G 4R4IA 2N3SA 4GS3A 4JI4Q 2B63H 2AMCB 1YJ9A 2PI2A 5FLMG 3KIHA 2G2KA 4DR6Q 2MFIA 1VQBA 1KC82 1I94Q 5IP7H 4GNXC 1YIJZ 1EWIA 3T1HQ 1GO3E 2E2JH 3CCMA 1TFIA 2PQAB 1VS0A 1S72A 1VQ9A 2D0PA 2CWAA 1HR0Q 3S1RI 2H85A 4RV9A 5GAGC 4K0KL 2QGQA 2Z0SA 1E22A 1NE3A 1X0TA 3CCM1 1L0WA 4BBRH 2HF1A 4A3IH 4UPAA 2MQHA 3B6YA 4KLKA 4BXXI 1MJCA 1KIXA 1J5EL 1UE1A 2VL6A 3HOUH 3J80c 2HQLA 3U4VA 5LL6f 2VUMI 1KQSZ 3KFUA 3VMGA 3S1QH 1Y14B 4LF8Q 2R6MA 2Y0SE 3A5UA 3GTLH 4QGUA 2HU9A 4A3JI 1VQ9Z 3A5ZB 2Q4ZA 5BR8Q 3JAMf 5FLXc 1Q8KA 3PO3I 3S1MH 1OXVA 3HOVI 1YIJ1 1JJ2Y 4NPSA 3CF5A 3JAMb 4JV5L 4LF4L 2KCMA 1NJI2 1KRTA 4HH4A 4JYAQ 3NENA 1K73C 3CC7A 2R92H 2AKLA 3T4NB 2KI7B 4QQBX 1IBMQ 3G4SZ 2NZHA 2P28A 3U58A 2K3RA 4DGLA 1S40A 3AQQA 1QYPA 4JI7L 4J15A 2B63I 3I7FA 4DR7Q 4A93I 1VQ8Z 1VQKZ 1YEZA 4LUOA 1YI21 3FHWA 1JJGA 1TXYA 2AHOB 1L1OB 3RN5A 4GLVB 3F3PC 4A3MG 1AE3A 1N8R1 3KF8B 1Q7YC 4NXNL 3CMEA 2E2IH 2PMZE 3VMHA 3CCRZ 2OTL1 5IT9b 1IYJB 1J5EQ 3GTGI 1E1OA 3PF4A 3ULPA 1SR3A 3GTOH 3OW2Z 4KHZA 3GTJI 1IZ6A 1USPB 3GTOI 2F4VQ 1Z9FA 1YITA 1N33L 1Q7Y1 1HJPA 3S2DH 3J81i 1EYGA 1BBUA 1WI5A 3HKZE 4RVGA 2VUGA 1XMOQ 3NDIA 3I4MH 1CKOA 4OWXB 3T1HL 2LXKA 4R4CA 3W1GA 1BKBA 2YU9I 1HNZQ 3KLWA 5LMNL 5IYBG 2ZAEB 1I6HH 1VQPA 4DPGA 4YHHL 4P75A 1KD1C 1D8LA 4NOZA 2I3CA 3CMA1 4DR4Q 2KCTA 2WB1E 4NBAA 3G71Z 2YTXA 4JG2A 2VQFL 1Y1VG 2UXCL 2PQAA 1VQK1 1SMXA 5IYCH 2JQOA 3AYHB 4GOPC 4YWKA 4JI3L 4LF7L 3GTPH 3TDHB 3S14H 5M5XH 4OONA 4OO1G 2HIXA 4P71A 4OWWB 3H0GG 2VS1A 3S17I 3I4OA 3H0GH 2UUBL 1P9NA 4UP9A 3AEVA 3CCLZ 1VQOA 4DR7L 3CCLA 1YJWA 3BU2A 4NH1C 4LF9L 3S1NI 2R7ZI 1PH1A 2YYZA 2UUAL 4NB3A 2Y0SG 4DUYQ 2DE7A 3PSIA 4LUVA 4DR3L 3CPFA 4A3EH 1Q46A 3D9XA 1KQSY 3CXCY 4A3EG 3KDFA 3G71A 3CCSZ 2WP8J 4APVA 2R7DA 3J81c 2YADA 1R9TI 3CAMA 1A0IA 1YBYA 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBF A;  3I2Z A;  4OO1 I;  1V43 A;  1X3F A;  4X62 Q;  2K4K A;  1IBK L;  2RHQ B;  1YHQ A;  3CD6 A;  1VQH A;  1OXT A;  2DUD A;  1PH5 A;  1HZC A;  2NVY I;  2KHI A;  2ZM6 L;  3TS0 A;  1XPO A;  3H0G I;  5AJ3 Q;  4DV6 Q;  4BY7 G;  4DV2 Q;  4BXX H;  1SFO I;  2Q2H A;  4A3D G;  3ULL A;  3T1Y L;  2BJO A;  4A3L I;  2ZJR A;  3RN2 A;  3U50 C;  2IHE A;  4GN5 A;  1NTG A;  4X66 Q;  5C3E G;  1OTC A;  1N2F A;  2A19 A;  1QZH A;  1BVS A;  1HR0 L;  3GKQ A;  1L1O C;  2ZJP A;  4B3T Q;  4JCV E;  1QVF A;  2IHF A;  3PUX A;  3UE1 A;  4A3M H;  2ES2 A;  1PH4 A;  2K5R A;  5E7N A;  2F4V L;  2VUM H;  1Q12 A;  2B3G A;  4AH6 A;  5C0X G;  3HOV H;  1DL6 A;  4H02 A;  3PO2 I;  3CCV A;  1XPR A;  4K0K Q;  3CCS A;  1VQF A;  4IJL A;  4YY3 L;  2AWO A;  4R4Q A;  1PH9 A;  3L2P A;  1R9T H;  1N8R C;  2Q2I A;  4OX9 L;  5GQO A;  1CKN A;  5IWA Q;  1WYD A;  3LUS A;  3STB D;  4MH4 A;  4L5R C;  1LQL A;  1A62 A;  1NBW A;  1XMQ Q;  2VUM G;  2R7Z G;  1Y1W H;  4BBS I;  4WJ3 M;  1Q1E A;  2R93 G;  4A76 A;  4A3G I;  1OXX K;  1U5K A;  3I55 A;  2EQS A;  2XTI A;  3S15 I;  4HJA A;  1ASY A;  4DV2 L;  5IY0 A;  5C3E H;  1YJN A;  3T1Y Q;  3HOY I;  5IP7 G;  2B29 A;  1VQD A;  4A4I A;  5M3M H;  2Z6K A;  1RL2 A;  4YHH Q;  1TWF H;  1ZB9 A;  5CM2 M;  2F52 A;  2OCE A;  4DV3 Q;  5C4X G;  3PUY A;  1VQM A;  2R7Z H;  2WB1 G;  1MJE A;  2JR6 A;  2JA7 G;  1T9H A;  4X64 L;  1RO4 A;  4IFD I;  3KJO A;  4AQY L;  3RZD H;  2N78 A;  3F2D A;  5LMN Q;  1X3G A;  4KHP Q;  3GTM I;  2WAQ E;  2UUC L;  4GLX A;  4P74 A;  4A3F G;  1CSP A;  1PYB A;  4AYB G;  2E2H I;  4DV7 L;  4JI7 Q;  1L1O A;  1PFS A;  1PV4 A;  2NVX I;  1V1Q A;  3HOV G;  1C0A A;  4HIK A;  1P8L A;  2FXQ A;  3HOX H;  1ASZ A;  3RNU A;  2JA7 H;  2IX1 A;  3CCJ A;  2CWP A;  1SN8 A;  2NVT H;  4LW1 A;  1Y1V H;  1TWG H;  2N49 A;  1KL9 A;  5BR8 L;  1ZB8 A;  4A3D I;  2UXD Q;  2IT1 A;  1SE8 A;  3S1N H;  1VQJ A;  4A3L G;  3KF6 B;  1MKH A;  2E5L Q;  2JA5 H;  1VCI A;  3VB9 A;  3FKI G;  2C35 B;  2BA0 A;  3RLO A;  3I4N H;  1YNX A;  2LSS A;  2UXC Q;  1VQK A;  1N36 Q;  2K50 A;  1K8G A;  2K52 A;  3NBH B;  1VQA A;  4BBR G;  1Q82 C;  2PI2 E;  2JA6 I;  1NJI C;  1HNX Q;  2R7F A;  1CSQ A;  1CUK A;  2RHS B;  4XTC S;  1VQ8 A;  4LF6 L;  2DE5 A;  2Q2T A;  3PO2 G;  1ML8 A;  1QUQ A;  1K83 I;  1XJV A;  4A3I I;  3CQZ H;  4JI4 L;  4QL5 A;  4JI2 L;  1KAW A;  3PO3 G;  2OTL A;  4A3B G;  4JI1 Q;  3UE0 A;  1O7I A;  3L0O A;  4JI5 L;  3BZC A;  2ZTD A;  5JEA G;  1K0R A;  2VQE Q;  1Y1V I;  1B7Y B;  5HGQ A;  1HR0 W;  4LF4 Q;  4BY7 H;  2JNY A;  4Y7N I;  1EIF A;  2OTJ A;  3D6W A;  3OTO L;  3RZO H;  1IXR A;  1K83 H;  1WCM H;  4BBS G;  2BH8 A;  4DR2 Q;  2ID0 A;  3HOX I;  4DR6 L;  2CCZ A;  1PYS B;  4IPC A;  2RCN A;  1N32 Q;  3PUW A;  2V1C C;  3HOY G;  1EQR A;  3HFZ B;  5IP7 I;  3GTK I;  1B70 B;  1DGS A;  2OQK A;  4BA2 I;  3GTQ I;  1QVC A;  5LMN W;  4ALP A;  1VQL A;  2R92 I;  2YV5 A;  3J81 j;  4A3K G;  4R4O A;  4GKK Q;  3AFP A;  3K0X A;  3SGI A;  1NMF A;  1PFT A;  5H1S E;  4R4I A;  2N3S A;  4A93 G;  4GS3 A;  4UY8 C;  2PK7 A;  1M90 C;  1CKM A;  4YWL A;  2JE6 I;  5IP9 G;  4QY7 A;  4DV7 Q;  4JI4 Q;  2R93 H;  2B63 H;  1WCM I;  2AMC B;  4AYB E;  2JEB I;  4JI6 Q;  3CP0 A;  4JI1 L;  2NVX H;  4GKJ L;  1YJ9 A;  4B3R L;  1Y1V S;  2JA9 A;  2PI2 A;  2WAQ G;  1KHI A;  3ERS X;  4L5T A;  5FLM G;  4DR3 Q;  1Z47 A;  3KDF B;  4HID A;  3EIV A;  1Y1W I;  1FL0 A;  4DR4 L;  1X65 A;  3RZD I;  1EOV A;  4QJF A;  4DR6 Q;  2MFI A;  4LFB L;  1AE2 A;  3DLL A;  1PVO A;  4PZ7 A;  3EBE A;  3S24 A;  1VQB A;  1C7Y A;  2K14 A;  4NBD A;  4B3M L;  2D62 A;  4YCW A;  1JE5 A;  1I94 Q;  3PV0 A;  2ZM6 Q;  4KI0 A;  2JJQ A;  2JA5 I;  5IP7 H;  3E9I A;  4GNX C;  4GKK L;  3ESW A;  3I07 A;  3S15 H;  3KOJ A;  4QIW E;  5JJI A;  1EWI A;  4X62 L;  3T1H Q;  3HKZ G;  1N34 Q;  1GO3 E;  3MEF A;  2E2J H;  3CCM A;  1TWF I;  2EIF A;  4HIM A;  1TFI A;  1L2F A;  3STB C;  2ASB A;  5FLM H;  2PQA B;  3K7A H;  1VS0 A;  5K36 G;  2YTY A;  3CMA A;  1S72 A;  3HOU G;  1VQ9 A;  2D0P A;  2CWA A;  1B8A A;  3MXN B;  1USP A;  1FVI A;  5GAE C;  1KXL A;  1J6Q A;  4O2D A;  1HR0 Q;  3S1R I;  2ZTE A;  2IY5 B;  4YY3 Q;  3D0F A;  4MTN A;  1H95 A;  1UE7 A;  1JJ2 A;  3S17 H;  5IWA L;  1E3P A;  4TVA B;  3L7Z C;  1KQS A;  3M4O I;  4PZ8 A;  5GAG C;  4DUZ Q;  1XMQ L;  3PO3 S;  3J7A 5;  1OXU A;  1X6O A;  4LFC Q;  4K0K L;  1A8V A;  2QGQ A;  4QTT A;  2Z0S A;  4DV4 L;  4DV1 Q;  3RZO I;  4JI8 Q;  4LF8 L;  4A3K I;  1VQN A;  1E22 A;  3GTP I;  1NE3 A;  2HHH L;  1UWV A;  4IPD A;  1L0W A;  5C3E I;  4HJ5 A;  4A3D H;  4BBR H;  4A3J H;  3BZK A;  3M85 A;  2HF1 A;  2E2I I;  3CQZ I;  4A3I H;  1JJC B;  1XPU A;  4UPA A;  4GOP B;  2MQH A;  4DV0 L;  4LF5 Q;  1GKH A;  3F2C A;  3B6Y A;  1W3S A;  1XTD A;  3K7A I;  3IRB A;  4X64 Q;  5FLM I;  3DM3 A;  3RLF A;  4KLK A;  4GNX A;  3S1M I;  4BXX I;  2K75 A;  2KHJ A;  4DKA C;  2JA6 H;  4KHP L;  1MJC A;  1X56 A;  5ELO A;  4DK6 C;  3VDY A;  1J5E L;  1UE1 A;  4DV5 L;  1LYL A;  2IX0 A;  1KIX A;  2VL6 A;  2UUC Q;  4NXM L;  3GTM H;  1AH9 A;  4PZ6 A;  3HOU H;  3J80 c;  1N33 Q;  2HQL A;  3U4V A;  1Q86 C;  1KRS A;  2GVB A;  2KPI A;  2UUB Q;  2VUM I;  2JK8 A;  2Q2U A;  2K5N A;  2NN6 I;  1TWC I;  1YHB A;  5M5W H;  3KFU A;  3VMG A;  3S1Q H;  4IOC A;  1Y14 B;  4R1J A;  3TRE A;  5FJ8 G;  4DV4 Q;  4LF8 Q;  2Y0S E;  3A5U A;  5C0X J;  1PH7 A;  3GTL H;  4JV5 Q;  4NBB A;  1G51 A;  2E2H H;  3S1Q I;  1C9O A;  4C2M H;  3H3V J;  4POF A;  1YVC A;  2A1A A;  4QGU A;  3G6E A;  4A3J I;  2GN5 A;  3A5Z B;  3K81 C;  5M3M G;  1HZA A;  4DV0 Q;  3G4S A;  3I4M I;  3AFQ A;  5BR8 Q;  4A3G H;  4NBC A;  1LUZ A;  4DR5 Q;  4LNQ A;  4YWM A;  1HNZ L;  4X66 L;  4LWC A;  5C44 G;  2F4M A;  2UUA Q;  5FLX c;  1YHA A;  1Q8K A;  1KC8 C;  2OQ0 A;  3PO3 I;  1VQI A;  3BJU A;  1GM5 A;  2K5H A;  1OXV A;  3CPW A;  3S1M H;  3S2H H;  5JJK A;  4HJ9 A;  1TWH I;  2ZTC A;  5LMU Q;  3HOV I;  4WJ4 A;  3M4Q A;  4FDB A;  4OWT B;  2XGT A;  1XNQ Q;  1PHJ A;  5FJ8 H;  4NPS A;  4DR2 L;  2OWO A;  2UXB Q;  3GCF A;  2JA8 I;  3CF5 A;  4BY1 H;  1FJG L;  2I5H A;  1PH6 A;  4OX9 Q;  4JI5 Q;  1I50 H;  3JAM c;  4JV5 L;  4LF4 L;  2KCM A;  4JI0 L;  3GTL I;  3HOW G;  1VQ4 A;  5IYD H;  1XNR Q;  3FKI I;  4BY1 I;  1KRT A;  2JA8 H;  3PIP A;  4GLA C;  4Y7N H;  4JYA Q;  3M4O H;  4BBR I;  3NEN A;  3E0E A;  1K73 C;  1X3E A;  2JA6 G;  3CC7 A;  2CQO A;  4C3H H;  2R92 H;  2AKL A;  2Z6K C;  1I5F A;  4L5Q A;  2F4O A;  1X9N A;  3ULJ A;  3S2H I;  4JBJ A;  4DR1 L;  4BXX G;  1IBL Q;  4RMF A;  4QQB X;  1IBM Q;  4NBE A;  4A3I G;  3GTK H;  4DV3 L;  2NZH A;  3UDG A;  4A3B I;  3U58 A;  2YU9 H;  2AKW B;  1X3W A;  1G6P A;  2NVQ H;  4MNO A;  1S40 A;  3K7U C;  2I0Q A;  4A3L H;  3AQQ A;  3PGZ A;  2AWN A;  1SFO H;  4B3S Q;  1QYP A;  1YI2 A;  4JBM A;  3Q8D A;  2HT1 A;  4YCU A;  2UXB L;  3PF5 A;  1OXS C;  1HNW Q;  1HZB A;  4X65 Q;  5IYD G;  4JI7 L;  1QUQ B;  4J15 A;  3HOW H;  2B63 I;  4JOI A;  4DK3 C;  2N8N A;  3PUV A;  3RR5 A;  1TWH H;  4GN3 B;  4HIO A;  1XNR L;  1X55 A;  3GTM S;  1UE6 A;  5J3B A;  4IFD G;  4IJH A;  3ER0 A;  3CC4 A;  4JC0 A;  2R92 G;  3I7F A;  4BA1 I;  4DR7 Q;  2UXD L;  3Q87 A;  4A93 I;  4X6A I;  2WFW A;  1M1K C;  3CW2 C;  1TWA H;  3PCO B;  1N34 L;  2R6G A;  5C44 I;  3I4N I;  1IBL L;  1K8A C;  4PMW A;  5IP9 I;  3S16 H;  1TWA I;  4LUZ A;  1I6H I;  1N36 L;  2UU9 Q;  1EUJ A;  1D7Q A;  1YEZ A;  3J7Z C;  4LUO A;  3FHW A;  1JJG A;  4NBG A;  1TXY A;  2AHO B;  1L1O B;  1PA6 A;  3RN5 A;  1VQ7 A;  4A3C G;  1RIP A;  4GLV B;  3CC2 A;  4JI2 Q;  1JMC A;  2E2J I;  4DUY L;  4BY7 I;  4LFA L;  2JA7 I;  2DE6 A;  1HNW L;  3TEH B;  2VQE L;  2RBL A;  4A3M G;  2L15 A;  3GDE A;  4A3F H;  1AE3 A;  1BBW A;  2HIV A;  5C4X H;  3GTJ H;  4GNX B;  4DV1 L;  3KF8 B;  1Q7Y C;  3HOZ H;  1IL2 A;  2HHH Q;  2VZA A;  2P3Y A;  3E9H A;  4NXN L;  2VNU D;  2ALY B;  2PNH A;  3CCU A;  4RG1 A;  1JT8 A;  2JEA I;  1IBK Q;  3F2B A;  1JB7 A;  3PUZ A;  4JOI C;  3GTQ H;  3CME A;  2E2I H;  2GVA A;  1WJJ A;  1VQE A;  3UDX A;  3A0J A;  2PMZ E;  4JI8 L;  1K9M C;  4LF5 L;  3TRZ A;  2CFM A;  1YUA A;  3U4Z A;  1VLA A;  3VMH A;  3UDI A;  4A3K H;  2E5L L;  3KF6 A;  5C4J H;  4JBK A;  1CKN B;  2R93 I;  1G29 1;  1IYJ B;  2CKZ B;  4P72 A;  1WOC A;  5IT9 c;  5GAH C;  4A75 A;  1J5E Q;  1LTL A;  3TS2 A;  4JI6 L;  3GTG I;  3M3Y H;  1E1O A;  5AJ3 L;  1GD7 A;  3PF4 A;  5M5Y H;  2J6A A;  1QVG A;  4Y52 H;  1W2B A;  2B63 G;  4UP8 A;  4A3B H;  3ULP A;  1HZ9 A;  1Q81 C;  1SLJ A;  1SR3 A;  3GTO H;  4KHZ A;  5DLQ E;  5C4X I;  3GTJ I;  3HKS A;  5IYB H;  1IZ6 A;  1VQG A;  1USP B;  3GTO I;  2F4V Q;  4LFB Q;  1Z9F A;  3H15 A;  1YIT A;  4A93 H;  4X6A H;  1N33 L;  4Y52 I;  3RLN A;  3W5O A;  5M3F G;  3OYY A;  3A74 A;  1RLY A;  4GOP A;  3HOZ I;  1HJP A;  3S2D H;  3J81 i;  3OTO Q;  1EYG A;  1BBU A;  1WI5 A;  1LM0 A;  3K80 C;  4B3M Q;  3I4N G;  3W1B A;  4AIM A;  4GN4 B;  3HOY H;  5C4J I;  2RF4 A;  4A3F I;  3LGJ A;  1P16 A;  3HKZ E;  2VQF Q;  1XMO Q;  2EXD A;  3I4M H;  4DR5 L;  1CKO A;  4OWX B;  3CCE A;  4IO9 A;  3F8T A;  3T1H L;  2LXK A;  3JC6 6;  1MIU A;  4R4C A;  5ELN A;  4XIG S;  3W1G A;  1E24 A;  1GVP A;  4A3C I;  2KEN A;  3WWV A;  4DAM A;  2QA4 A;  1VQC A;  1U0L A;  4JI3 Q;  4LF7 Q;  1X3Z A;  2I5M X;  1PH3 A;  2QEX A;  2NVQ I;  2MO0 A;  1BKB A;  1PH8 A;  3OW2 A;  2YU9 I;  3UDF A;  4MZ9 A;  2BA1 A;  4JBW A;  4A3M I;  1HNZ Q;  3KLW A;  1XNQ L;  5LMN L;  5IYB G;  1I6H H;  2NN6 G;  1VQP A;  5JJL A;  4DPG A;  4YHH L;  3GD7 A;  2LXJ A;  1PH2 A;  5GRO A;  4GKJ Q;  4P75 A;  1SRU A;  5LMU L;  3CXC A;  5M3F H;  1D8L A;  4NOZ A;  1KD1 C;  3KJP A;  3GO5 A;  3CCR A;  3ICE A;  4AQY Q;  4HJ7 A;  1TWG I;  3G48 A;  4LFC L;  4DR4 Q;  3FKI H;  2NVT I;  2K5V A;  2KCT A;  4A3E I;  2WB1 E;  4NBA A;  4TQU S;  4DNI A;  2F3I A;  4A3J G;  2YTX A;  1EFW A;  4POG A;  4JG2 A;  4R4T A;  3I4M G;  3S2D I;  4EQ5 A;  4OXP A;  1V9P A;  2VQF L;  1XMO L;  2JS4 A;  2ZJQ A;  1Y1V G;  1E1T A;  2NVY H;  4JI0 Q;  2UXC L;  1I3Q I;  2PQA A;  3FP9 A;  2VW9 A;  1VQ6 A;  1SMX A;  1X54 A;  5IYC H;  4NB9 A;  2JQO A;  3AYH B;  4GOP C;  3EER A;  3S16 I;  2KBN A;  1S3O A;  4C3J H;  5IP9 H;  3HOX G;  4YWK A;  1I94 L;  4JYA L;  1K3R A;  4JI3 L;  4LF7 L;  3GTP H;  2A8V A;  4O0A A;  4P73 A;  3S14 H;  5M5X H;  4OON A;  4LF6 Q;  4OO1 G;  2HIX A;  2NZO A;  4NB8 A;  4IPH A;  3M3Y I;  4DR1 Q;  3GTG H;  1WW9 A;  1IBM L;  4P71 A;  3CCQ A;  4OWW B;  2BH2 A;  3EN2 A;  4B3R Q;  3H0G G;  4X65 L;  2VS1 A;  3S17 I;  3I4O A;  3KYH C;  3H0G H;  1HNX L;  2ATW A;  4C3I H;  3HOW I;  4B3S L;  3M7N A;  2UUB L;  3HOZ G;  2DGY A;  4UP9 A;  4BY1 G;  3S1R H;  5EAY A;  3AEV A;  5GAD C;  4HJ8 A;  1UE5 A;  1VQO A;  1WCM G;  4BBS H;  4DR7 L;  3D31 A;  3CCL A;  4IPG A;  1N32 L;  5C0X I;  1QZG A;  1UEB A;  1I50 I;  3PIO A;  4DUZ L;  1A63 A;  1TWC H;  4XX2 A;  1YJW A;  1Y1W G;  3H3V I;  3BU2 A;  4LF9 L;  5C44 H;  2UU9 L;  4EX5 A;  1SRO A;  3S1N I;  2VY3 A;  3M4P A;  3ZJY C;  2I5L X;  2JA8 G;  2R7Z I;  4IOA A;  3H3V H;  1PH1 A;  1E7Z A;  2YYZ A;  2UUA L;  1EQQ A;  3PO3 H;  5IYC G;  4A3G G;  2YTV A;  3K8A A;  4NB3 A;  1I3Q H;  1NMG A;  3VMI A;  2Y0S G;  4QTU A;  4LFA Q;  2DE7 A;  4DUY Q;  1WFQ A;  4DV6 L;  1YZ6 A;  1EIY B;  2JA5 G;  3PSI A;  4LUV A;  5JEA J;  3J80 i;  4DR3 L;  1NY4 A;  4A3C H;  3CPF A;  3NEL A;  4ME3 A;  4IFD J;  4A3E H;  1Q46 A;  1HH2 P;  1Q1B A;  1FGU A;  4UP7 A;  3I56 A;  2MNA A;  4A3E G;  4B3T L;  2MO1 A;  4DV5 Q;  4NXM Q;  3KDF A;  1FJG Q;  3F1Z A;  5IE8 A;  1NUI A;  3HOU I;  4YCV A;  3G71 A;  2H5X A;  4NXN Q;  4PG3 A;  5HY6 A;  2D0O A;  2WP8 J;  1N9W A;  2R7D A;  4APV A;  3J81 c;  1R9T I;  2E8G A;  3M9B A;  4NBH A;  3CAM A;  1YIJ A;  3NEM A;  4LF9 Q;  4L5S A;  3TQY A;  1A0I A;  3S14 I;  1YBY A;  3JAM i;  3PO2 H;  4DAY B;  1VQ5 A; 
#chains in the Genus database with same CATH topology
 5KEE A;  5EQ0 A;  1V43 A;  1B3A A;  2WII B;  4F88 A;  4BY7 G;  2JIR A;  4DV6 Q;  4DV2 Q;  2L5T A;  2RVL A;  3HP3 A;  2ZJR A;  2CW0 C;  3RN2 A;  3U50 C;  4GN5 A;  5C3E G;  4X3K A;  1OTC A;  2A19 A;  1BVS A;  2F0N A;  1W6J A;  4B3T Q;  1QVF A;  3AMU A;  3FQM A;  1CHP D;  2F4V L;  1WII A;  1Q12 A;  1GUW A;  5C0X G;  1ZH1 A;  1DL6 A;  3MWY W;  1XTC D;  3GTG B;  5CMD A;  3CCS A;  5E4X A;  4YY3 L;  1EEF D;  1PH9 A;  3L2P A;  1R9T H;  4OX9 L;  3EED A;  1DOL A;  1CKN A;  5IWA Q;  3LUS A;  3K5N A;  4EWC A;  1QE6 A;  4XYO A;  3PO3 B;  4L5R C;  1NBW A;  1PLF A;  3NBH A;  4EQO A;  1XMQ Q;  1GUG A;  1KRL A;  1OXX K;  2XTI A;  4CDC C;  1ASY A;  5IY0 A;  2EY6 A;  1YJN A;  3J81 E;  3T1Y Q;  2NAP A;  3A7A B;  3NTK A;  5IP7 G;  1BCP F;  1STG A;  4RCO A;  4C3J G;  4YHH Q;  2F52 A;  2OCE A;  1GHJ A;  1NJI 1;  3P20 A;  1RF2 D;  1T9H A;  1CQF A;  1O78 A;  1RO4 A;  1JE4 A;  3OPO A;  4AQY L;  5K36 H;  4OGQ C;  4B9X A;  1VQ8 1;  1VQ5 1;  1PYB A;  1SAP A;  4AYB G;  1BBX C;  1PV4 A;  2B2U A;  4HIK A;  3HOX H;  3V2T A;  2R93 B;  5CV7 A;  2IX1 A;  4K6L A;  3OIQ A;  3MXG A;  3C46 A;  1TWG H;  1A2T A;  2J0T D;  2Q8T A;  4MON A;  4A3D I;  5EPK A;  2Z4I A;  3S1N H;  4A3L G;  3KF6 B;  1MKH A;  2F0Q A;  2FMM A;  5FLX E;  2EZV A;  1BCP C;  1ICW A;  1VCI A;  3FKI G;  2C35 B;  3I90 A;  5JAV A;  4G7O C;  1YNX A;  2LSS A;  4AYB A;  1G8Z D;  2K50 A;  1N36 Q;  1HPC A;  1NJI C;  2B8G A;  2EY2 A;  1SMY D;  4XTC S;  1VQ8 A;  2Q2T A;  2KOL A;  1QUQ A;  2JSO A;  1F2L A;  4QL5 A;  4JI2 L;  4A3B G;  4UHV A;  4DV7 Q;  4JI5 L;  2JA7 H;  2ZTD A;  4CBV A;  3TDQ A;  3K7A B;  1PRT F;  3OTO L;  2PYK A;  4BBS G;  1PDQ A;  1YJN Z;  4DR2 Q;  4QUF A;  4HMJ A;  5D1P A;  2FFK B;  2JMO A;  1S5B D;  3HOY G;  4XQQ A;  2IZ4 A;  1B70 B;  1VQM 1;  3SK5 A;  1AA6 A;  3S14 B;  1CQV A;  3GTQ I;  4RVD A;  2HDM A;  3EVQ A;  1QVC A;  1TWA B;  2EY1 A;  3IL8 A;  2R92 I;  3J81 j;  1R9T B;  4R4O A;  5H1S E;  3DWQ A;  2QW7 A;  3QO2 A;  1M90 C;  3SEB A;  4LJZ C;  3NE5 B;  4YWL A;  2R93 H;  4JI6 Q;  2NVX H;  4R8N A;  2WAQ G;  4RHR A;  1VQ9 1;  3EIV A;  1ENF A;  4DR4 L;  1L0X B;  5FKA C;  2A69 C;  3CCE 1;  5IGF A;  4LFB L;  1AE2 A;  4ODG A;  1EYD A;  3EBE A;  1YHQ Z;  3CD6 Z;  1C7Y A;  4NBD A;  4IQZ A;  2EYJ A;  3E6Z X;  2DNE A;  4N9P A;  1Q82 2;  4KI0 A;  2JA5 I;  1DJR D;  3E9I A;  4RKB A;  4E2W A;  3ESW A;  1KLU D;  3SHL A;  1NP6 A;  4ABN A;  4QIW E;  1N34 Q;  3MEF A;  3A8J E;  1JIC A;  2DY7 A;  3STB C;  4FXK C;  3CME Z;  3OWF A;  3NSW A;  1JWU D;  3HGB A;  3CPW Y;  1KDA A;  1USP A;  5GAE C;  5KYL A;  1J6Q A;  4O2D A;  5ELB A;  2ZTE A;  1EU3 A;  2IY5 B;  4KN7 C;  1UE7 A;  1H9M A;  5IT9 E;  1E3P A;  1H9S A;  3L7Z C;  1KQS A;  4HGY A;  4PZ8 A;  1ZXT A;  3J7A 5;  3MHB A;  1A8V A;  4X3T A;  4LK1 C;  3CC2 Z;  1HQM C;  4LF8 L;  4JI8 Q;  2LKV A;  4IUT A;  2HHH L;  1UWV A;  5C3E I;  3K5M A;  1K9M 2;  1ZEQ X;  3OSO A;  2E2I I;  3CQZ I;  1JJC B;  1XPU A;  1QB5 D;  4LF5 Q;  1MSH A;  3F2C A;  1W3S A;  1FNW A;  1XTD A;  5FLM I;  1CM9 A;  3DM3 A;  4CKC A;  2JA6 H;  3NK9 A;  4KHP L;  5ELO A;  1VQM Z;  1VQN Z;  1AH9 A;  1LTB D;  4DAV A;  3CCQ Z;  4PZ6 A;  3TP8 A;  3J80 b;  1Q86 C;  3RZD B;  2GVB A;  2PW5 A;  2JK8 A;  3EFX D;  2NTS A;  2K5N A;  2NN6 I;  2JIQ A;  4QB4 A;  1MBY A;  1JJ2 Z;  1XYI A;  3TRE A;  1SFO B;  5FLX f;  4ZCK A;  4JV5 Q;  1V1O A;  1G51 A;  3T56 B;  3H3V J;  2A1A A;  2NVY B;  2L55 A;  3K81 C;  1HZA A;  2VXW A;  4DV0 Q;  3G4S A;  5FLX L;  4IAL A;  4LWC A;  5EKI A;  2F4M A;  5FLX b;  1YHA A;  5K36 G;  1VQI A;  1ILP A;  2K5H A;  2RDF A;  3J7A 4;  3W2D A;  3KK7 A;  5LMU Q;  1K73 1;  4OWT B;  1XNQ Q;  3D3R A;  4XQN A;  5FJ8 H;  2R3Z A;  2NWG A;  2WV6 D;  2OWO A;  2UXB Q;  3GCF A;  2JA8 I;  3S1R B;  4JI5 Q;  3NQT A;  1V1P A;  2VPX A;  1VQ4 A;  2JA8 H;  5LL6 X;  4GLA C;  3EA6 A;  1I4R A;  1YJ9 Z;  4PMC A;  3PIP A;  1AEX A;  4DNT B;  3M4O H;  4C56 C;  3E0E A;  1X3E A;  4FP5 D;  5A2Q f;  3NTI A;  4C3H H;  2P5Z X;  1I5F A;  4L5Q A;  3CCQ 1;  4JBJ A;  1KLG D;  3I91 A;  4NBE A;  4A3I G;  3GTK H;  3S16 B;  3UDG A;  4A93 B;  1HHV A;  2YU9 H;  2B2V A;  1X3W A;  4MNO A;  1GUT A;  2I0Q A;  4A3L H;  2AWN A;  1SFO H;  4B3S Q;  1X32 A;  1SBB B;  1W2B Z;  1YI2 A;  3Q8D A;  1QVG Y;  4YCU A;  3G7L A;  5IYD G;  3HOW H;  4N8X 1;  5JVG 3;  2N8N A;  3I55 1;  2OTJ Z;  2AQ3 B;  3D4D A;  3RR5 A;  5J3B A;  4IJH A;  3FVQ A;  2AYD A;  2WFW A;  2D9U A;  1N34 L;  5C6A A;  4IZ8 A;  3S16 H;  5EJW A;  1I6H I;  2UU9 Q;  1EUJ A;  1RD9 D;  1IKM A;  4OEL B;  3FQQ A;  1Q82 1;  5F2D A;  4NBG A;  3TME A;  2EGT A;  1RIP A;  3FEW X;  2DJF C;  4JI2 Q;  5JPN C;  3CC2 A;  4LFA L;  3K5O A;  2QR1 B;  3CCJ Z;  2RBL A;  1SNM A;  2RT9 A;  5JOB A;  2HIV A;  3GTJ H;  2VUM B;  4G4K A;  1YNN C;  2HHH Q;  1BXT A;  1QNK A;  2VZA A;  3E9H A;  1B3Q A;  2ALY B;  1WTV A;  1IBK Q;  4ZLT F;  4K8J A;  5I2X A;  3GTQ H;  1ML0 D;  3UDX A;  3A0J A;  1QIL A;  4JI8 L;  1K9M C;  3R93 A;  1STH A;  2NZ1 D;  3UDI A;  4A3K H;  2E5L L;  3KF6 A;  5C4J H;  4JBK A;  2R93 I;  5IT9 c;  1PFN A;  5GAH C;  1WOC A;  1Y1V B;  1LTL A;  4TSS A;  4JI6 L;  3M3Y H;  1F2M A;  3I55 Z;  2OTJ 1;  1DM0 B;  1GD7 A;  5M5Y H;  2J6A A;  1LLR D;  5ELC A;  3N52 A;  5CBE E;  1YI2 Z;  1W2B A;  3CCS 1;  4Y52 H;  3HOV B;  1HZ9 A;  2N88 A;  2F3W A;  1Q81 C;  2IJ0 A;  1HA5 A;  1S5C D;  5DLQ E;  2QCP X;  1RCV D;  3T51 B;  2DNC A;  4LFB Q;  4A93 H;  5COR A;  2RHB A;  2MHV A;  3RLN A;  2LFN A;  3W5O A;  4GOP A;  2KA7 A;  1VQL 1;  1NR4 A;  2BE5 D;  3H0G B;  1LM0 A;  3CC7 Z;  2E2J B;  1WTO A;  1WD0 A;  3W1B A;  1SYB A;  4GN4 B;  3HOY H;  3LGJ A;  3J80 E;  1P16 A;  2O2L D;  1D1I A;  1JWH C;  4DR5 L;  4O42 A;  4ULL A;  5EBD A;  3CCL 1;  3F8T A;  3MA2 B;  2Z6B A;  3JC6 6;  1MSG A;  3DEO A;  2JN4 A;  4XIG S;  4A3G B;  1IHZ A;  2EY5 A;  2QA4 A;  1I4H A;  4IFD H;  4C3J B;  1AP0 A;  4JI3 Q;  4LF7 Q;  2JA7 G;  1SNC A;  1KTK A;  5JEA H;  2MO0 A;  5CR3 A;  2BA1 A;  4A3M I;  1E2Z A;  1S5D D;  3CCU 1;  1RKN A;  5D3I B;  5M3F H;  4WFN 3;  4HSP A;  3KJP A;  3GO5 A;  3ICE A;  1FD7 D;  3K57 A;  4LFC L;  2E75 C;  2F3I A;  4R4T A;  3VTN A;  4OXP A;  1V9P A;  2JS4 A;  1K8M A;  2NVY H;  4JI0 Q;  1I3Q I;  3S9W A;  2KCN A;  4RVH A;  1X54 A;  1S72 1;  4NB9 A;  1EWH A;  5IP9 H;  4C3J H;  1D5Z C;  1S3O A;  4RCN A;  2ZT9 C;  3HKZ A;  2G9H D;  2A8V A;  4O0A A;  3HOZ B;  4LF6 Q;  1M90 1;  1FR3 A;  2NZO A;  4NB8 A;  4I7Z C;  3M3Y I;  3W3A A;  4DR1 Q;  2SDF A;  2PW7 A;  5C5L A;  3PQI A;  3U9S A;  1TS4 A;  4EVO A;  3CCQ A;  2BH2 A;  4OEM B;  4X65 L;  3GQB A;  2CH4 W;  1Q81 2;  3KYH C;  2B63 B;  4C3I H;  1B53 A;  3QWN A;  2DGY A;  5GAD C;  3UI2 A;  4HJ8 A;  1LT5 D;  4RKL A;  2ZXO A;  4IPG A;  1N32 L;  2MGS A;  2RIQ A;  5C0X I;  1QZG A;  1I50 I;  1Z01 A;  4DUZ L;  4XX2 A;  2IV2 X;  1Y1W G;  3HKZ B;  2FJ2 A;  3CCV 1;  2WB1 A;  5C44 H;  2UU9 L;  5BN3 A;  2E2D C;  4EX5 A;  1SRO A;  2VY3 A;  4EGV A;  2PZU A;  2CQA A;  3PO3 H;  4A3G G;  2YTV A;  1NMG A;  2ATW A;  1Y1W B;  4LFA Q;  4B3R L;  4DV6 L;  3R8B A;  3J80 i;  1A3U A;  1NY4 A;  4A3C H;  2XWB B;  1O7L A;  2V45 A;  4CJ2 C;  1TY0 A;  1FJG Q;  3HOU I;  2G9D A;  3K5L A;  3G6E 1;  2PZT A;  3CCM Z;  4HGZ A;  5IT9 f;  5HY6 A;  3J81 b;  3CCV Z;  1HFG A;  2BDO A;  2C9O A;  3M9B A;  1YIJ A;  1AN8 A;  3I72 A;  3NEM A;  4LF9 Q;  3TQY A;  3JAM i;  2J4X A;  1VQ5 A;  4NBF A;  1S7M A;  1X3F A;  4U67 3;  2VB3 X;  1LT3 D;  2RHQ B;  1YHQ A;  3CD6 A;  1VQH A;  1PH5 A;  5HGT A;  4JPB W;  2KHI A;  2RBM A;  3RD4 A;  1ENC A;  3J81 f;  3H0G I;  5AJ3 Q;  4BXX H;  4A3D G;  1SFO I;  1C48 A;  3T1Y L;  4A3L I;  3I56 1;  4X66 Q;  2NVT B;  1YJN 1;  3MON A;  4MD8 A;  1B4O A;  1QZH A;  4F7X A;  5LHY 1;  3GKQ A;  3DUZ A;  1C8C A;  3PUX A;  5C4X B;  3MZ5 A;  1Y8N B;  1XPR A;  4K0K Q;  1EY8 A;  2AWO A;  4R4Q A;  4H44 C;  4XT1 B;  2EOT A;  2VPY A;  1PTO D;  5GQO A;  4UDU C;  4M8A A;  3C3L A;  1DON A;  1WTX A;  1B9N A;  1LQL A;  2R7Z G;  3TSS A;  1Q1E A;  1HXY D;  4WRD A;  1EY7 A;  2EQS A;  3DWA A;  3HZX A;  4A3K B;  1F2Y A;  4DV2 L;  3HOY I;  1S4Z A;  1VQD A;  4A4I A;  4RGT A;  1GHK A;  1RL2 A;  5COY A;  4DV3 Q;  1B50 A;  2I46 A;  3M4O B;  4MIU A;  3PUY A;  1VQM A;  2R7Z H;  1MJE A;  2LIY A;  2QA4 1;  1YJW Z;  3RUZ A;  4KD4 A;  4IFD I;  3RZD H;  3F2D A;  2FIN B;  2QEX 1;  1SEB D;  2WAQ E;  2K1B A;  2WAC A;  4GLX A;  4P74 A;  4A3F G;  2E2H I;  1U4L A;  4CKE A;  4JI7 Q;  3HOV G;  1C0A A;  1P8L A;  5CGK A;  5IGB A;  2F0U A;  3LX0 A;  3OIP A;  1EU4 A;  1A3V A;  4LW1 A;  2N49 A;  1KL9 A;  3SE0 A;  2IT1 A;  1O7Z A;  5EKK A;  2E5L Q;  1Z02 A;  2PQE A;  3RLO A;  1UUP A;  4K5V A;  3TBI B;  3VR3 A;  1QCB D;  5C4H A;  3NBH B;  4WJW A;  1Q82 C;  2JA6 I;  2R7F A;  1CSQ A;  5EPL A;  1QVF Y;  2RHS B;  4LF6 L;  3PO2 G;  2DE5 A;  2KUM A;  1ML8 A;  3S2D B;  2E9H A;  3J7A V;  1XJV A;  3CQZ H;  1ENA A;  1VMP A;  1PFB A;  4JI1 Q;  3UE0 A;  2C5C A;  5JEA G;  4BY7 H;  4IN3 A;  2NB0 A;  1HR0 W;  2JNY A;  4Y7N I;  1EIF A;  1J9O A;  1K83 H;  1WCM H;  2BE5 C;  1RNI A;  2CCZ A;  1N32 Q;  1EQR A;  3AU7 A;  4CJ0 B;  1BQQ T;  5CYU A;  4ALP A;  2V8K A;  2YV5 A;  4A3K G;  1ICF B;  4GKK Q;  3BZD B;  4UY8 C;  2PK7 A;  5IP9 G;  3BDC A;  4QY7 A;  1WCM I;  4AYB E;  4C3I G;  3CP0 A;  4GKJ L;  1M1K 1;  1Y1V S;  3ERS X;  1KHI A;  4L5T A;  4QF4 A;  3HOW B;  1PRT C;  5FO8 B;  4A3E B;  2SNS A;  3BG3 A;  3KDF B;  1Y1W I;  1FL0 A;  3BYT B;  1YIT Z;  4QJF A;  1EOV A;  3DLL A;  1VQP 1;  2BDN A;  4PZ7 A;  1PVO A;  1EY9 A;  2K14 A;  3EJI A;  1SXT A;  4FF2 A;  4QCL A;  4JVZ A;  2D62 A;  4YCW A;  2Z1C A;  4S1T A;  3PV0 A;  3T4A C;  4MD7 A;  3OWE B;  2V8J A;  3I07 A;  3S15 H;  3KOJ A;  5JJI A;  4X62 L;  3HKZ G;  3FDT A;  1LTA D;  2AUK A;  5E4W C;  3K7A H;  2YTY A;  2ICE C;  3CMA A;  3HOU G;  2E2H B;  2EYP A;  1XWE A;  3MXN B;  4BS9 A;  4OIJ A;  2DJG C;  1K8A 1;  3I70 A;  4MTN A;  5IGE A;  1H95 A;  3ND8 A;  3S17 H;  5ELF A;  3M4O I;  4DUZ Q;  1E0B A;  1OXU A;  1VDZ A;  4K2K A;  3ZYY X;  4CGY B;  3L3O C;  4DV1 Q;  1M90 2;  3S15 B;  2ZXP A;  4IPD A;  3TZU A;  4A3D H;  1Q86 1;  2F0J A;  3BZK A;  3H6M A;  3M85 A;  1U9R A;  4EQN A;  4GOP B;  4DV0 L;  3IRB A;  3VR4 A;  2F0D A;  5CV9 A;  4OIK A;  4GNX A;  1WTW A;  2K75 A;  4DKA C;  2E7Z A;  3CC7 1;  2ICI A;  1X56 A;  2L0C A;  2L12 A;  4DK6 C;  3VDY A;  2UUC Q;  2GTH A;  1LYL A;  3S17 B;  3SK8 A;  1C4Q A;  4KKT A;  1N33 Q;  1KRS A;  2GTI A;  3CRL C;  2UUB Q;  3JAM L;  2QDB A;  1YHB A;  4IOC A;  5JPM C;  5FJ8 G;  4DV4 Q;  1JR0 D;  1EY6 A;  4NBB A;  2E2H H;  3S1Q I;  1C9O A;  1SND A;  4C2M H;  2B2V C;  2GN5 A;  3H91 A;  1VQ4 1;  3FPP A;  2F0P A;  3I4M I;  1TQO A;  4LNQ A;  2PMZ B;  4X66 L;  1HNZ L;  1V8Q A;  2UUA Q;  3G71 1;  2OQ0 A;  1GM5 A;  3D8G A;  3CPW A;  3SK6 A;  1TWH I;  2ZTC A;  3M4Q A;  2XGT A;  3JAM E;  1PHJ A;  3QG1 A;  1QOH A;  2VF1 A;  2EDG A;  3HG9 A;  2HDL A;  2I5H A;  1NR2 A;  1I4P A;  2A73 B;  3HEJ A;  2PM9 A;  1PH6 A;  5IYD H;  1EFI D;  2WIN B;  1D5M C;  4Y7N H;  4BBR I;  1A6X A;  2JA6 G;  2SOB A;  2Z6K C;  2UXC Q;  1X9N A;  4QUC A;  1ONL A;  4RMF A;  3NHH A;  5AFW A;  5ELD A;  2XIW A;  4DV3 L;  5I4D A;  2AKW B;  1G6P A;  3K7U C;  2RA4 A;  2LFU A;  3KF8 A;  1U4P A;  4JBM A;  2HT1 A;  2RQX A;  5CC4 A;  2UXB L;  2NVX B;  1K83 B;  1HNW Q;  1HZB A;  5KIX A;  3BVM A;  2A74 C;  1QUQ B;  1WCM B;  1PTO H;  2K04 A;  4P2C B;  2XSC A;  4DK3 C;  3NP8 A;  1XNR L;  1A15 A;  1X55 A;  4ZUI A;  3GTM S;  1RTN A;  4F87 A;  3CC4 A;  3ER0 A;  4F8M A;  5C44 B;  4CHT B;  4DNR B;  2UXD L;  3R2T A;  3CW2 C;  2WKC A;  5C44 I;  3I4N I;  1AZQ A;  1IBL L;  4PMW A;  5IP9 I;  1CHQ D;  2E2I B;  1VQO Z;  3A55 A;  1D7Q A;  1X3P A;  5J1Z A;  1KNE A;  2F0V A;  1BUV T;  2O5J C;  3OW2 Y;  4S3S A;  2JA8 G;  1JMC A;  2E2J I;  2OEO A;  4BY7 I;  4LMQ D;  2JA7 I;  2DE6 A;  4DUY L;  2VQE L;  1GOZ A;  4TNU A;  4OL7 A;  1SE3 A;  3CC4 1;  3GDE A;  4A3F H;  1D5X C;  1I4Q A;  3GTO B;  4DV1 L;  1QJO A;  5D1O A;  1BF4 A;  5M5X B;  2P3Y A;  2VNU D;  2PNH A;  1I6V C;  4RG1 A;  2JEA I;  3F2B A;  1JB7 A;  1EWC A;  4JOI C;  3J80 f;  1Q81 1;  2A6H C;  2K6A A;  1WJJ A;  2NBF A;  1VQE A;  3TRZ A;  1IKL A;  1DD2 A;  2CFM A;  1YUA A;  2KEE A;  3U4Z A;  5D65 A;  1CKN B;  2CHB D;  2CKZ B;  3PIO 3;  2F0T A;  2OOX B;  1VF7 A;  3TS2 A;  2V3V A;  4HMI A;  1HRJ A;  2X6L A;  1QVG A;  4A3B H;  4XDX A;  4MHE A;  1PRT D;  4PNY A;  5C4X I;  1LT6 D;  3HKS A;  3MXP A;  1VQG A;  4RGN A;  5IYB H;  2PNR C;  3H15 A;  4X6A H;  1YNN D;  1DOM A;  2DN8 A;  3KUP A;  3IF8 A;  1IL8 A;  3HOZ I;  3V96 A;  1HFN A;  3F2U A;  3OTO Q;  4E2Y A;  1RQF A;  3HS0 C;  2AUJ D;  4LAA A;  4IO9 A;  4DXF A;  2F0M A;  1MIU A;  2KEN A;  1GVP A;  4A3C I;  3WWV A;  3S1N B;  1VQC A;  1VQL Z;  3TN2 A;  1QF8 A;  3PIP 3;  1X3Z A;  2JA5 B;  2NVQ I;  1U4R A;  3UDF A;  4JBW A;  1K8O A;  4RGM A;  3BDL A;  1BDO A;  5JJL A;  1PFM A;  5A2Q E;  4ZQ3 A;  1PH2 A;  4HN7 A;  1Q86 2;  2LY7 A;  5GRO A;  4ZKC B;  5FOB B;  1SRU A;  2JYO A;  3CCR A;  2O53 A;  4AQY Q;  1TWG I;  3G48 A;  3FKI H;  4A3J G;  4DNI A;  1Y8C A;  1EFW A;  1EYC A;  4HTH A;  2ASB A;  1ZYR C;  3S2D I;  3I4M G;  2ZJQ A;  3I56 Z;  4GZY C;  1E1T A;  3IFT A;  3SK4 A;  2VW9 A;  1DZ1 A;  2KED A;  1ET9 A;  2Q2U A;  4IUR A;  3PO3 G;  3S16 I;  2KBN A;  3S2H H;  4JYA L;  3BYY B;  3P1H A;  4P73 A;  2WAQ B;  2M9V A;  1BR9 A;  3GTG H;  1WW9 A;  1IBM L;  4Q5V A;  5D1O B;  1W2B Y;  4K2L A;  1TR5 A;  4B3R Q;  1YHQ 1;  3CD6 1;  4ZKB B;  3NQI A;  4U68 A;  3M7N A;  1PXU A;  3T16 A;  3ERQ A;  1UE5 A;  3I8Z A;  4DA2 A;  4OO1 H;  4BBS H;  2K05 A;  2FMC A;  1JOO A;  4HCS A;  1UEB A;  2F0W A;  4ZUJ A;  1GUS A;  1TWC H;  1EEI D;  1F9P A;  2A69 D;  1KD1 1;  1F2Z A;  3M4P A;  3ZJY C;  2I5L X;  4R8I A;  4IOA A;  1E7Z A;  2WKD A;  1WTQ A;  2J7Z A;  1EQQ A;  1B2T A;  5E1F A;  5IYC G;  4A3M H;  1I3Q H;  4XXE A;  4QTU A;  2H1E A;  1WFQ A;  3FKI B;  1PZI D;  1YZ6 A;  2XRS D;  3R3O A;  1EIY B;  2JA5 G;  3CHB D;  3NEL A;  4FNF A;  1FGU A;  4UP7 A;  3I56 A;  2MNA A;  2F0K A;  1KD1 2;  2MO1 A;  4DK1 A;  4Q0F A;  4DV5 Q;  4NXM Q;  4G57 A;  1VQ7 1;  3GP7 A;  4YCV A;  4NXN Q;  1TT2 A;  2D2C C;  4PG3 A;  2OT2 A;  1N9W A;  3MXU A;  5IGD A;  1FGB D;  1L0Y B;  2E8G A;  3BVZ A;  1FYC A;  1CZW A;  2QEX A;  3PO2 H;  1BCP D;  4C1N I;  1IL2 A;  3I2Z A;  1SNP A;  1WTR A;  4HR7 B;  2E76 C;  2PCF B;  1I3Q B;  1OXT A;  2DUD A;  4CDE C;  1HZC A;  2NVY I;  3FMC A;  1F77 A;  2ZM6 L;  3TS0 A;  1XPO A;  2Q2H A;  3ULL A;  2IHE A;  2EYM A;  3QJY A;  2XRQ D;  1TWG B;  2PPB C;  3Q24 A;  2ZJP A;  2KCC A;  2W04 A;  4JCV E;  2IHF A;  3I4L A;  3UE1 A;  1BO0 A;  1PH4 A;  2K5R A;  3A8I E;  5E7N A;  4E32 A;  2K03 A;  3HOV H;  4H02 A;  1CA5 A;  3PO2 I;  1VQF A;  4I65 A;  1TS3 A;  1WYD A;  4A3M B;  3STB D;  4BWG B;  1Y1W H;  1JWS D;  4A3G I;  1U5K A;  3I55 A;  3S15 I;  5C3E H;  1M4V A;  3M7G A;  2F03 A;  1KDB A;  5M3M H;  2Z6K A;  4Y7N B;  5C4X G;  1TWF H;  5CM2 M;  2Y0S B;  2WB1 G;  1ESF A;  4DF7 A;  4X64 L;  1MHW C;  3H94 A;  3KJO A;  2N78 A;  4KHP Q;  1Q90 A;  5LMN Q;  1KNA A;  2O4H A;  4E2X A;  5A2Q b;  1CSP A;  2BOS A;  4NFR A;  3WOE A;  1L1O A;  1V1Q A;  2QRE B;  1ZKO A;  1SE2 A;  2V8I A;  3D4R A;  3TP6 A;  3RNU A;  2E74 C;  1SN8 A;  1Y1V H;  1PZJ D;  3SXH A;  4E6I A;  2JA5 H;  3CC2 1;  3E0J A;  3VB9 A;  2BA0 A;  3I4N H;  1YNJ D;  1K8G A;  1VQ6 1;  2K52 A;  5I9P A;  2PI2 E;  4X3U A;  4NW2 A;  1CT1 D;  1E2W A;  2M48 A;  1PYW D;  2SEB D;  4A3I I;  2CH4 A;  2F0G A;  4JI4 L;  5J22 A;  2OTL A;  2XN9 C;  4C3I B;  1K0R A;  1Y1V I;  2V4D A;  3CME 1;  3D6W A;  1O7Y A;  3TZD A;  2ID0 A;  3OMC A;  2WAQ A;  4DR6 L;  1CTM A;  1PYS B;  2RCN A;  4PQX A;  3S2H B;  3PUW A;  2V1C C;  3HFZ B;  3GTK I;  1DGS A;  1JQY D;  4ME5 A;  5LMN W;  3J7Y W;  3AFP A;  3K0X A;  3SGI A;  1PFT A;  1NMF A;  3WOF A;  2NYZ D;  3CCE Z;  5M5W B;  1BOS A;  5DEH A;  1CKM A;  1HUN A;  2JE6 I;  5IIF A;  2JEB I;  4JI1 L;  1ROD A;  2JA9 A;  4DR3 Q;  1VQ4 Z;  1Z47 A;  4HID A;  3D2L A;  3TP5 A;  1WVL A;  1X65 A;  2F0E A;  3RZD I;  3MZL B;  1TWF B;  3GV3 A;  1SJH D;  4IUQ A;  4KY6 A;  1G91 A;  2JA6 B;  2F0F A;  3G6J B;  1IW7 C;  3S24 A;  1IYU A;  3OW7 A;  1PTO C;  2RCF A;  1QVG Z;  5A35 A;  4B3M L;  3A54 A;  1JE5 A;  2QEX Z;  2ZM6 Q;  4B08 A;  1STB A;  2JJQ A;  2Q51 A;  3CPW Z;  3MFY A;  4GKK L;  5CBA E;  5T67 A;  1STN A;  3NH4 A;  1KAB A;  3K0Y A;  1TWF I;  1Q7Y 2;  2EIF A;  4HIM A;  1L2F A;  2VB2 X;  5FLM H;  3C1E A;  2XWJ B;  3RZO B;  2JIO A;  1B8A A;  2QDL A;  1FVI A;  1KXL A;  3G4S 1;  4G7H C;  3BG1 B;  1Z03 A;  4YY3 Q;  2EXZ A;  3D0F A;  2OXP A;  3MZK B;  4KK7 A;  3SDZ A;  2Y0S A;  1WJ2 A;  2OZK A;  4KJN A;  5IWA L;  1JJ2 A;  5CV6 A;  4TVA B;  5KNB A;  5T1G A;  2QRC B;  1XMQ L;  3PO3 S;  4LFC Q;  1X6O A;  1UAP A;  1S5E D;  4KJO A;  4CL1 A;  2CW0 D;  4QTT A;  2O4X A;  5HUR A;  5I2Y A;  1EIG A;  1F9R A;  1JWM D;  3RZO I;  4DV4 L;  1VQN A;  4A3K I;  3MC0 B;  3N6R A;  1VQ7 Z;  3GTP I;  3HOY B;  4HJ5 A;  2JIM A;  5KNC A;  4A3J H;  1TII D;  5TSS A;  1I50 B;  4WOR A;  3A8K E;  1GKH A;  1WD1 A;  1H9J A;  4DXG A;  3RMH A;  4X64 Q;  3K7A I;  4TKO B;  3RLF A;  3S1M I;  2KHJ A;  1VQO 1;  2ZXR A;  1B44 D;  4MN3 A;  3Q0A A;  3J7A F;  3GTM H;  4DV5 L;  2IX0 A;  4NXM L;  1EYA A;  2N55 A;  5AN9 F;  1D2B A;  2KPI A;  5ISR A;  3A56 A;  1TWC I;  1H9K A;  3ONA B;  5M5W H;  2M00 A;  4IUP A;  1B9M A;  4R1J A;  4H0L C;  1II3 A;  5C0X J;  1PH7 A;  1VQ6 Z;  4KD3 A;  4POF A;  1YVC A;  3G6E A;  3F3F C;  2Z4H A;  3CKI B;  5T64 A;  3VA5 A;  5M3M G;  2B39 A;  4MXU A;  3CCJ 1;  3AFQ A;  3OHX C;  4X3S A;  4NBC A;  1LUZ A;  4DR5 Q;  2QF7 A;  3NUC A;  4YWM A;  1TWC B;  1R4P B;  5C44 G;  4E30 A;  5J39 A;  1RJT A;  3P5J B;  3I3C A;  5CV8 A;  1KC8 C;  3BJU A;  5JJK A;  4HJ9 A;  3CCR 1;  1QVF Z;  1EIH A;  4FDB A;  4HCE A;  1E2V A;  2L4N A;  3FRP B;  4OHJ A;  4DR2 L;  1U4M A;  4BY1 H;  1FJG L;  4J1M A;  4OX9 Q;  1I50 H;  2EJM A;  2RSO A;  3JAM c;  2M6N A;  2VPW A;  1D1K A;  4JI0 L;  3GTL I;  3HOW G;  4A3I B;  1XNR Q;  3FKI I;  4BY1 I;  1CA6 A;  1ILQ A;  1H9R A;  2IZ3 A;  1ET6 A;  5FO9 B;  3I4N B;  3VR6 A;  2CQO A;  3M4Y A;  2F4O A;  3ULJ A;  3S2H I;  4DR1 L;  4BXX G;  1IBL Q;  2IW3 A;  4A3B I;  4RA8 A;  2K28 A;  3DM1 A;  2NVQ H;  3NPP A;  4FXD A;  1STE A;  3PGZ A;  1Y69 U;  2JA7 B;  3KLS A;  3MEH A;  4DQY B;  1OXS C;  4EQP A;  3PF5 A;  1STA A;  4X65 Q;  2RPR A;  1JC7 A;  1X3Q A;  4QMG A;  4E33 A;  4JOI A;  3PUV A;  1YJ9 1;  1TWH H;  4GN3 B;  4HIO A;  2NUC A;  1UE6 A;  4A3B B;  1TVX A;  2PMZ A;  4JC0 A;  2R92 G;  4BA1 I;  3Q87 A;  4X6A I;  1ESR A;  3P7J A;  3D4W A;  1TWA H;  3PCO B;  3IFD A;  2R6G A;  3CCU Z;  1GUN A;  3GTK B;  1K8A C;  3VYT A;  1TWA I;  4LUZ A;  1N36 L;  2HUG A;  2TSS A;  3J7Z C;  3IR7 A;  1GUO A;  1PTO F;  4ZK9 B;  1PA6 A;  1VQ7 A;  4A3C G;  1KAA A;  3DHQ A;  1HNW L;  3TEH B;  5T6B A;  5K5P A;  1DXM A;  2L15 A;  5C4X H;  1BBW A;  2GA4 B;  4GNX B;  3PMF A;  3HOZ H;  2NTT A;  3CCU A;  2YU9 B;  3NH8 A;  2NVQ B;  1JT8 A;  2ENB A;  4L6T B;  3PUZ A;  3CMA Z;  2GVA A;  4LF5 L;  2A68 C;  3CC4 Z;  1SIW A;  5C3X A;  1VLA A;  1VQN 1;  1AFP A;  3CXC Z;  4A75 A;  1G29 1;  2JA8 B;  4P72 A;  3J80 L;  4K6D A;  5AJ3 L;  3ITP A;  3NBI A;  1VQP Z;  1SMY C;  2HCI A;  3X3N A;  2B63 G;  4UP8 A;  4MRI A;  1SLJ A;  2B8F A;  2RSN A;  1EOT A;  3IFU A;  1LT4 D;  4Y52 I;  4DU9 A;  3OYY A;  3A74 A;  1RLY A;  4RAU C;  2I07 B;  5M3F G;  4IFD G;  3K80 C;  4B3M Q;  2AQ2 B;  3I4N G;  4AIM A;  4A3J B;  5C4J I;  2RF4 A;  4A3F I;  5G3L D;  3TP7 A;  4V0B A;  2QKD A;  2VQF Q;  2EXD A;  2F0O A;  3EQL C;  5C3E B;  3CCE A;  1K8A 2;  1ZYR D;  5ELN A;  4WJ4 A;  4DAY A;  4RVF A;  4DAM A;  1E24 A;  4HAE A;  1U0L A;  4ZRZ A;  3NFZ A;  2I5M X;  1PH3 A;  1PH8 A;  3OW2 A;  4MZ9 A;  3TE5 B;  5FO7 B;  1XNQ L;  2TMP A;  3VR5 A;  2NN6 G;  4G7Z C;  1QNU A;  3GD7 A;  2LXJ A;  1RHP A;  4GKJ Q;  5I6W A;  5LMU L;  3CXC A;  2RDH A;  1RO2 A;  4HJ7 A;  1PRT B;  3T13 A;  2NVT I;  1QG7 A;  2K5V A;  4A3E I;  1Z6H A;  4TQU S;  4POG A;  3WDN A;  5A2Q L;  2OTL Z;  3QWU A;  4EQ5 A;  1T5E A;  1XMO L;  1Y8O B;  1JOQ A;  1STY A;  3FP9 A;  1VQ6 A;  4A3G H;  1I94 L;  3EER A;  3HOX G;  4E31 A;  1K3R A;  4XYQ A;  2OOY B;  4IPH A;  3BG0 B;  1OO9 B;  2G5D A;  2QEJ C;  1CFM A;  3EN2 A;  2EPB A;  1W6K A;  3O13 A;  2LS0 1;  3C1F A;  1HNX L;  3HOW I;  4B3S L;  3HOZ G;  4BY1 G;  3S1R H;  5EAY A;  2LEX A;  1HQR D;  1EL0 A;  1WCM G;  1LAB A;  3A7L A;  3D31 A;  3PIO A;  1A63 A;  5I9O A;  2B2T C;  3H3V I;  4FXG C;  4V19 0;  2K5Q A;  4Z9C B;  2K5W A;  4K5W A;  3URY A;  3GV6 A;  3QIA A;  1M1K 2;  1SYE A;  3H3V H;  3K8A A;  2EYH A;  3KIF A;  3VMI A;  1T5X D;  3K6O A;  1HTP A;  5JEA J;  4KTA A;  1VF5 C;  4IFD J;  4ME3 A;  3KLS X;  2EVB A;  4E2Z A;  1HH2 P;  1FDO A;  1Q1B A;  2NN6 H;  1TU2 B;  4KN4 C;  4B3T L;  2GU2 A;  1DOK A;  3F1Z A;  5IE8 A;  1NUI A;  1TWH B;  1LV9 A;  4IUN A;  2H5X A;  5KRU A;  4MTK A;  2EYF A;  2D0O A;  4NBH A;  1SYD A;  2QRD B;  4L5S A;  3S14 I;  4DAY B;  2B2W C;  1LTR D;  3NH5 A;  4OO1 I;  4X62 Q;  1HUM A;  2K4K A;  1IBK L;  2QLV B;  4AYB B;  4C1N K;  4FVM A;  3HOX B;  1XXG A;  4JW0 A;  4BBR B;  5KND A;  2BJO A;  4HSV A;  1NTG A;  4N9T A;  1TKW B;  3DEP A;  1N2F A;  1HR0 L;  1VQ5 Z;  1L1O C;  3NDJ A;  1CK1 A;  2ES2 A;  3GTJ B;  1FDI A;  2VUM H;  4I7A A;  2B3G A;  4AH6 A;  2A5H A;  3CCV A;  2F0S A;  4CJ1 B;  1R4Q B;  3KBG A;  4IJL A;  5M9O A;  4J6H A;  1N8R C;  2Q2I A;  3G6E Z;  4MH4 A;  1YIT 1;  3GTQ B;  4FF1 A;  1A62 A;  2VUM G;  4WJ3 M;  1YUK A;  1K73 2;  4BBS I;  2R93 G;  4A76 A;  4C2M B;  4HJA A;  3I4M B;  2JUB A;  2B2Y A;  3MFG A;  5C4J B;  2IPK D;  2A6E D;  2JXM B;  4XQJ A;  1N8R 2;  2B29 A;  2O5I C;  3H09 A;  4A3F B;  1KC8 1;  1ZB9 A;  4MD9 A;  5EKL A;  3GTM B;  2JR6 A;  2EYL A;  5JVH 3;  5IGG A;  1RO0 A;  2HCC A;  1EZ6 A;  2KVM A;  1X3G A;  3GTM I;  1Q8I A;  5C4Z A;  1K9M 1;  2UUC L;  1JOK A;  1NUC A;  4DV7 L;  4NKL A;  1PFS A;  5C0X H;  2NVX I;  1ASZ A;  2FXQ A;  5LL6 S;  1HCZ A;  2IL8 A;  3CCJ A;  2CWP A;  2NVT H;  4FF3 A;  3C2P A;  5BR8 L;  1ZB8 A;  1F9Q A;  2QIL A;  2UXD Q;  3OMG A;  1SE8 A;  5DM6 3;  1VQJ A;  1LTS D;  1GXD C;  4N8F A;  3OOC A;  1VQK A;  5G3L F;  2A68 D;  2DY8 A;  2W03 A;  1VQA A;  3IX0 A;  3KLR A;  4BBR G;  1HNX Q;  1J8I A;  4K8I A;  1CUK A;  1SNQ A;  4CDF C;  1K83 I;  1H9S B;  1HA6 A;  1S72 Z;  2MUY A;  1KAW A;  1O7I A;  2X69 A;  3L0O A;  3BZC A;  5CV4 A;  2VQE Q;  4FF4 A;  4LF4 Q;  1B7Y B;  3V05 A;  5HGQ A;  5BN4 A;  4FYD A;  4KKS A;  2HD3 A;  2OTJ A;  3RZO H;  1IXR A;  2BH8 A;  3HOX I;  3LNN A;  3MVV A;  4IPC A;  5KYI A;  1MD2 D;  1NAP A;  3CRK C;  3T53 B;  4C3H B;  5IP7 I;  2A6E C;  2OQK A;  4M1U B;  3VYS A;  5T1I A;  4BA2 I;  2KJX A;  1VQL A;  2QA4 Z;  1YJW 1;  1SYF A;  4KV6 A;  1SNO A;  4RS4 A;  2SNM A;  5CV5 A;  5IOD A;  4A93 G;  4R4I A;  2N3S A;  4GS3 A;  3LWU A;  2VPZ A;  3S1Q B;  4JI4 Q;  2B63 H;  1A3T A;  2AMC B;  2Z8L A;  3BVG A;  4BY7 B;  1YJ9 A;  2PI2 A;  5FLM G;  3QB3 A;  3DMU A;  4IUV A;  3KIH A;  1LTG D;  2G2K A;  4DR6 Q;  2MFI A;  2R7Z B;  1VQB A;  1KC8 2;  3D6C A;  4K5X A;  2JIP A;  3S1M B;  1I94 Q;  5IP7 H;  3ND9 A;  4GNX C;  2B2T A;  1YIJ Z;  2MP1 A;  2QKI C;  1EWI A;  3T1H Q;  2IX3 A;  2BCO A;  1WTH A;  1GO3 E;  2E2J H;  3CCM A;  1TFI A;  2PQA B;  1VS0 A;  4BBS B;  1S72 A;  4KHV A;  1VQ9 A;  2D0P A;  2KHS A;  2CWA A;  4ILW A;  1S5F D;  5C5M A;  4ZYS A;  1HR0 Q;  3S1R I;  2H85 A;  1WZN A;  3KBX A;  2AQ1 B;  4RV9 A;  4KY7 A;  5JJZ A;  3SR1 A;  5GAG C;  5D3D A;  4K0K L;  2RDG A;  2F0L A;  1TY2 A;  2QGQ A;  4NDX A;  4IUU A;  1LO5 D;  3CQZ B;  3K59 A;  2Z0S A;  3U9O A;  1E22 A;  1NE3 A;  1FNU A;  1X0T A;  3CCM 1;  1L0W A;  1JB3 A;  1EZ8 A;  3FPU B;  4BBR H;  4RH6 A;  3J81 L;  2HF1 A;  4A3I H;  1CI3 M;  5L37 A;  5C3W A;  4UPA A;  2MQH A;  3B6Y A;  1YNJ C;  3MAQ A;  1KDC A;  4KLK A;  4BXX I;  1MJC A;  1KIX A;  4KMU C;  1J5E L;  1UE1 A;  2IWH A;  2VL6 A;  1XX8 A;  4ZAI A;  4DAP A;  1WTP A;  3J80 c;  3HOU H;  2HQL A;  3U4V A;  5IT9 L;  5LL6 f;  3NTH A;  2VUM I;  3NXW A;  4DN4 M;  2D5D A;  1KQS Z;  1PZK D;  1TS2 A;  3KFU A;  3VMG A;  3S1Q H;  1NSN S;  1Y14 B;  3CU7 A;  4LF8 Q;  2R6M A;  3I73 A;  3QR8 A;  2Y0S E;  3A5U A;  3GTL H;  2M2L A;  2HQE A;  4QGU A;  2HU9 A;  1RDP D;  2EJG C;  4A3J I;  1VQ9 Z;  3A5Z B;  3LWE A;  2Q4Z A;  3BS1 A;  5BR8 Q;  2L9H A;  1LTT D;  3Q23 A;  3JAM f;  5FLX c;  1Q8K A;  3VYU A;  2MJ8 A;  3PO3 I;  2B2Y C;  2L1B A;  5EGT A;  3S1M H;  1MI2 A;  1OXV A;  3E3X A;  1GJX A;  4L8J A;  4KKU A;  2K5D A;  3HOU B;  5DNF A;  3HOV I;  4JK1 C;  5M3F B;  1YIJ 1;  2K01 A;  1I4G A;  1JJ2 Y;  1DCZ A;  4NPS A;  5E3F A;  3CF5 A;  4PMB A;  3JAM b;  4JV5 L;  4LF4 L;  2KCM A;  1NJI 2;  1KRT A;  5FK9 C;  1QXF A;  4HH4 A;  1A2U A;  5M3M B;  4JYA Q;  3QOJ A;  4H13 C;  4NP5 A;  3NEN A;  1K73 C;  3CC7 A;  2R92 H;  2AKL A;  3T4N B;  4FO2 A;  2KI7 B;  4QQB X;  2PZW A;  3R2I A;  1JOR A;  2LMC B;  1IBM Q;  3IAY A;  1LTI D;  3G4S Z;  2NZH A;  2P28 A;  3U58 A;  2K3R A;  1V1P B;  4DK0 A;  4DGL A;  1S40 A;  3X3M A;  3AQQ A;  1QYP A;  4K14 A;  2XNA C;  1AZP A;  5DM7 3;  1LAC A;  5IGC A;  1RTO A;  4JI7 L;  2Q8R E;  4J15 A;  2B63 I;  2F0I A;  2F1M A;  1O80 A;  5D14 A;  5M5Y B;  2RKS A;  1EY4 A;  4RWS C;  1QWY A;  1G2T A;  5I6Y A;  1K28 A;  4CKB A;  3I7F A;  4DR7 Q;  4A93 I;  1BNZ A;  4R9W A;  3VR2 A;  4DFA A;  1VQ8 Z;  1G2S A;  5BN5 A;  5NUC A;  1VQK Z;  2F3V A;  1YEZ A;  4C3H G;  4LUO A;  1YI2 1;  3FHW A;  3GTL B;  1JJG A;  4BY1 B;  1TXY A;  2AHO B;  1L1O B;  2K33 A;  5DAU A;  3RN5 A;  1IYV A;  2FHT A;  4GLV B;  3L9A X;  3F3P C;  1SYC A;  5ELE A;  4A3M G;  1SDF A;  2CVR A;  1AE3 A;  3MTS A;  3DWP A;  1HTL D;  1B1Z A;  1N8R 1;  3KF8 B;  1K3B C;  1Q7Y C;  2K7V A;  4NXN L;  1I6H B;  1NCV A;  1SE4 A;  3CME A;  2E2I H;  2EJF C;  2PMZ E;  4TRD A;  3VMH A;  1SYG A;  3CCR Z;  2OTL 1;  4PV1 C;  1PTO B;  1K0S A;  5IT9 b;  1BCP B;  1IYJ B;  4L63 B;  1J5E Q;  3GTG I;  1E1O A;  3PF4 A;  3Q22 A;  5KGU A;  3ULP A;  1EY0 A;  1SR3 A;  3GTO H;  3OW2 Z;  4KHZ A;  2B2U C;  4B9W A;  1UEA B;  3GTJ I;  1D6E C;  3NWS A;  1IZ6 A;  1USP B;  3GTO I;  4KY5 A;  2F4V Q;  1Z9F A;  1PMR A;  1YIT A;  1F9S A;  1N33 L;  1Q7Y 1;  1EQT A;  3E5S A;  1HJP A;  3K58 A;  3J81 i;  1EYG A;  3S2D H;  1BBU A;  1WI5 A;  2OF1 A;  1JCK B;  2L11 A;  3HKZ E;  4A3D B;  4RVG A;  2VUG A;  1XMO Q;  3NDI A;  1Y8P B;  3I4M H;  1CKO A;  4OWX B;  4UAI A;  3AB9 A;  3T1H L;  2LXK A;  4R4C A;  3W1G A;  1BKB A;  2YU9 I;  5IOC A;  1HNZ Q;  3KLW A;  2EYO A;  5LMN L;  5IYB G;  2ZAE B;  1I6H H;  1VQP A;  4DPG A;  4HED A;  4YHH L;  3SVM A;  4P75 A;  1KD1 C;  1D8L A;  4NOZ A;  2EE1 A;  2I3C A;  2F4I A;  3Q6S A;  4RHS A;  3CMA 1;  2KQ3 A;  4DR4 Q;  2KCT A;  2WB1 E;  4NBA A;  3G71 Z;  2YTX A;  4JG2 A;  4QIW B;  2VQF L;  1SJE D;  4CDD C;  1Y1V G;  2UXC L;  4RGO S;  2PQA A;  1VQK 1;  4H7B A;  3M3Y B;  1SMX A;  1G6Z A;  5IYC H;  2JQO A;  3AYH B;  4GOP C;  1Z7T A;  4YWK A;  3DXJ C;  4JI3 L;  4LF7 L;  3GTP H;  3TDH B;  1SSO A;  3S14 H;  2Q8I B;  4O1N A;  4OON A;  5M5X H;  4OO1 G;  2HIX A;  4DGZ A;  3IKJ A;  4ID6 A;  4P71 A;  1Q16 A;  3PO2 B;  1VMC A;  4OWW B;  4J8Q A;  3H0G G;  2VS1 A;  3S17 I;  3I4O A;  3H0G H;  2UUB L;  1P9N A;  4UP9 A;  4XT3 B;  1MGS A;  1TS5 A;  2F0H A;  3AEV A;  3CCL Z;  1VQO A;  4DR7 L;  1UNS A;  3MXN A;  2JP1 A;  3CCL A;  1DYQ A;  1AW7 A;  3NWT A;  3VYR A;  1YJW A;  2R92 B;  3BU2 A;  4NH1 C;  3BDO A;  3H3V C;  4LF9 L;  3GTP B;  3ERO A;  1EY5 A;  2XVS A;  3S1N I;  1NNX A;  2R7Z I;  2R61 A;  1PH1 A;  2YYZ A;  2UUA L;  1IW7 D;  3QOL A;  2H4O A;  4NB3 A;  2B2W A;  2Y0S G;  5EBC A;  4DUY Q;  2DE7 A;  2KEC A;  4NMZ A;  2WB1 B;  4RFB A;  3PSI A;  2MPM A;  4LUV A;  1I4X A;  2A6H D;  3HRZ C;  1Q3L A;  4DR3 L;  3CPF A;  4A3E H;  1Q46 A;  3D9X A;  1KQS Y;  3CXC Y;  4A3E G;  1M8A A;  3KDF A;  1CZG A;  2Z9H A;  3G71 A;  3CCS Z;  4YIJ A;  2WP8 J;  4APV A;  2R7D A;  3J81 c;  2YAD A;  1R9T I;  3P75 A;  2X6G A;  3CAM A;  1FNV A;  2K32 A;  1A0I A;  2PO4 A;  1YBY A;  1EQV A;  3VA7 A;  5EPJ A;  1M1K C; 
#chains in the Genus database with same CATH homology
 1V43 A;  4BY7 G;  4DV6 Q;  4DV2 Q;  2ZJR A;  3RN2 A;  3U50 C;  4GN5 A;  5C3E G;  1OTC A;  2A19 A;  1BVS A;  4B3T Q;  1QVF A;  3FQM A;  2F4V L;  1WII A;  1Q12 A;  5C0X G;  1ZH1 A;  1DL6 A;  3CCS A;  4YY3 L;  1PH9 A;  3L2P A;  1R9T H;  4OX9 L;  3EED A;  1CKN A;  5IWA Q;  3LUS A;  4EWC A;  4L5R C;  1NBW A;  1XMQ Q;  1KRL A;  1OXX K;  2XTI A;  1ASY A;  5IY0 A;  1YJN A;  3T1Y Q;  5IP7 G;  4YHH Q;  2F52 A;  2OCE A;  1NJI 1;  1T9H A;  1RO4 A;  4AQY L;  1VQ8 1;  1VQ5 1;  1PYB A;  4AYB G;  1PV4 A;  4HIK A;  3HOX H;  2IX1 A;  1TWG H;  4MON A;  4A3D I;  3S1N H;  4A3L G;  3KF6 B;  1MKH A;  1VCI A;  3FKI G;  2C35 B;  1YNX A;  2LSS A;  4AYB A;  1N36 Q;  2K50 A;  1NJI C;  4XTC S;  1VQ8 A;  2Q2T A;  1QUQ A;  4QL5 A;  4JI2 L;  4A3B G;  4DV7 Q;  4JI5 L;  2JA7 H;  2ZTD A;  3OTO L;  4BBS G;  1YJN Z;  4DR2 Q;  5D1P A;  2JMO A;  3HOY G;  2IZ4 A;  1B70 B;  1VQM 1;  3GTQ I;  4RVD A;  1QVC A;  2R92 I;  3J81 j;  4R4O A;  5H1S E;  1M90 C;  4YWL A;  2R93 H;  4JI6 Q;  2NVX H;  2WAQ G;  1VQ9 1;  3EIV A;  4DR4 L;  3CCE 1;  4LFB L;  1AE2 A;  3EBE A;  1YHQ Z;  3CD6 Z;  1C7Y A;  4NBD A;  1Q82 2;  4KI0 A;  2JA5 I;  3E9I A;  4E2W A;  3ESW A;  1NP6 A;  4QIW E;  1N34 Q;  3MEF A;  3STB C;  3CME Z;  3CPW Y;  5GAE C;  1USP A;  1J6Q A;  4O2D A;  2ZTE A;  2IY5 B;  1UE7 A;  1E3P A;  1KQS A;  3L7Z C;  4HGY A;  4PZ8 A;  3J7A 5;  1A8V A;  3CC2 Z;  4LF8 L;  4JI8 Q;  2HHH L;  1UWV A;  5C3E I;  1K9M 2;  2E2I I;  3CQZ I;  1JJC B;  1XPU A;  4LF5 Q;  3F2C A;  1W3S A;  1XTD A;  5FLM I;  3DM3 A;  2JA6 H;  4KHP L;  5ELO A;  1VQM Z;  1VQN Z;  1AH9 A;  3CCQ Z;  4PZ6 A;  3J80 b;  1Q86 C;  2GVB A;  2JK8 A;  2K5N A;  2NN6 I;  1JJ2 Z;  3TRE A;  5FLX f;  4JV5 Q;  1G51 A;  3H3V J;  2A1A A;  3K81 C;  1HZA A;  4DV0 Q;  3G4S A;  4LWC A;  2F4M A;  5FLX b;  1YHA A;  5K36 G;  1VQI A;  2K5H A;  3J7A 4;  5LMU Q;  1K73 1;  4OWT B;  1XNQ Q;  5FJ8 H;  2OWO A;  2UXB Q;  3GCF A;  2JA8 I;  4JI5 Q;  1VQ4 A;  2JA8 H;  3PIP A;  4GLA C;  1YJ9 Z;  3M4O H;  3E0E A;  1X3E A;  5A2Q f;  4C3H H;  4L5Q A;  1I5F A;  3CCQ 1;  4JBJ A;  4NBE A;  4A3I G;  3GTK H;  3UDG A;  2YU9 H;  1X3W A;  4MNO A;  2I0Q A;  4A3L H;  2AWN A;  1SFO H;  4B3S Q;  1W2B Z;  1YI2 A;  3Q8D A;  1QVG Y;  4YCU A;  5IYD G;  3HOW H;  2N8N A;  3I55 1;  2OTJ Z;  3RR5 A;  5J3B A;  4IJH A;  2WFW A;  1N34 L;  3S16 H;  1I6H I;  2UU9 Q;  1EUJ A;  3FQQ A;  1Q82 1;  4NBG A;  2EGT A;  1RIP A;  3CC2 A;  4JI2 Q;  4LFA L;  2QR1 B;  3CCJ Z;  2RBL A;  2RT9 A;  2HIV A;  3GTJ H;  2HHH Q;  2VZA A;  3E9H A;  2ALY B;  1IBK Q;  3GTQ H;  3UDX A;  3A0J A;  4JI8 L;  1K9M C;  3UDI A;  4A3K H;  2E5L L;  3KF6 A;  5C4J H;  4JBK A;  2R93 I;  5IT9 c;  5GAH C;  1WOC A;  1LTL A;  4JI6 L;  3M3Y H;  3I55 Z;  2OTJ 1;  1GD7 A;  5M5Y H;  2J6A A;  1YI2 Z;  1W2B A;  3CCS 1;  4Y52 H;  1HZ9 A;  1Q81 C;  5DLQ E;  4LFB Q;  4A93 H;  2RHB A;  3RLN A;  3W5O A;  4GOP A;  1VQL 1;  1LM0 A;  3CC7 Z;  3W1B A;  4GN4 B;  3HOY H;  3LGJ A;  1P16 A;  1JWH C;  4DR5 L;  3CCL 1;  3F8T A;  3JC6 6;  4XIG S;  2QA4 A;  4LF7 Q;  4JI3 Q;  2JA7 G;  2MO0 A;  2BA1 A;  4A3M I;  3CCU 1;  5M3F H;  3KJP A;  3GO5 A;  3ICE A;  4LFC L;  2F3I A;  4R4T A;  3VTN A;  4OXP A;  1V9P A;  2JS4 A;  2NVY H;  4JI0 Q;  1I3Q I;  4RVH A;  1X54 A;  1S72 1;  4NB9 A;  5IP9 H;  4C3J H;  1S3O A;  3HKZ A;  2A8V A;  4O0A A;  4LF6 Q;  1M90 1;  2NZO A;  4NB8 A;  4DR1 Q;  3M3Y I;  3CCQ A;  2BH2 A;  4X65 L;  1Q81 2;  3KYH C;  4C3I H;  2DGY A;  5GAD C;  4HJ8 A;  4IPG A;  1N32 L;  2RIQ A;  5C0X I;  1QZG A;  1I50 I;  1Z01 A;  4DUZ L;  4XX2 A;  1Y1W G;  3CCV 1;  2WB1 A;  5C44 H;  2UU9 L;  4EX5 A;  1SRO A;  2VY3 A;  3PO3 H;  4A3G G;  2YTV A;  2ATW A;  1NMG A;  4B3R L;  4LFA Q;  4DV6 L;  3J80 i;  1NY4 A;  4A3C H;  1FJG Q;  3HOU I;  3G6E 1;  3CCM Z;  4HGZ A;  5IT9 f;  5HY6 A;  3J81 b;  3CCV Z;  3M9B A;  1YIJ A;  3NEM A;  4LF9 Q;  3TQY A;  3JAM i;  1VQ5 A;  4NBF A;  1S7M A;  1X3F A;  2RHQ B;  1YHQ A;  3CD6 A;  1VQH A;  1PH5 A;  2KHI A;  3J81 f;  3H0G I;  5AJ3 Q;  4BXX H;  4A3D G;  1SFO I;  3T1Y L;  4A3L I;  3I56 1;  4X66 Q;  1YJN 1;  3MON A;  4MD8 A;  1QZH A;  3GKQ A;  3PUX A;  1XPR A;  4K0K Q;  2AWO A;  4R4Q A;  5GQO A;  1LQL A;  2R7Z G;  1Q1E A;  2EQS A;  4DV2 L;  3HOY I;  1VQD A;  4A4I A;  1RL2 A;  4DV3 Q;  3PUY A;  1VQM A;  2R7Z H;  1MJE A;  2LIY A;  2QA4 1;  1YJW Z;  4IFD I;  3RZD H;  3F2D A;  2QEX 1;  2WAQ E;  4GLX A;  4P74 A;  4A3F G;  2E2H I;  4JI7 Q;  3HOV G;  1C0A A;  1P8L A;  4LW1 A;  2N49 A;  1KL9 A;  2IT1 A;  2E5L Q;  1Z02 A;  3RLO A;  3NBH B;  1Q82 C;  2JA6 I;  2R7F A;  1CSQ A;  4LF6 L;  1QVF Y;  2RHS B;  3PO2 G;  2DE5 A;  1ML8 A;  2E9H A;  1XJV A;  3CQZ H;  4JI1 Q;  3UE0 A;  5JEA G;  4BY7 H;  1HR0 W;  2JNY A;  4Y7N I;  1EIF A;  1K83 H;  1WCM H;  1RNI A;  2CCZ A;  1N32 Q;  1EQR A;  4ALP A;  2V8K A;  2YV5 A;  4A3K G;  4GKK Q;  4UY8 C;  2PK7 A;  5IP9 G;  4QY7 A;  1WCM I;  4AYB E;  3CP0 A;  4GKJ L;  1M1K 1;  1Y1V S;  3ERS X;  1KHI A;  4L5T A;  3KDF B;  1Y1W I;  1FL0 A;  1YIT Z;  4QJF A;  1EOV A;  3DLL A;  1VQP 1;  1PVO A;  4PZ7 A;  2K14 A;  2D62 A;  4YCW A;  4S1T A;  3PV0 A;  4MD7 A;  2V8J A;  3I07 A;  3S15 H;  3KOJ A;  5JJI A;  4X62 L;  3HKZ G;  3K7A H;  2YTY A;  3CMA A;  3HOU G;  3MXN B;  1K8A 1;  4MTN A;  1H95 A;  3S17 H;  3M4O I;  4DUZ Q;  1OXU A;  4DV1 Q;  1M90 2;  4IPD A;  4A3D H;  1Q86 1;  3BZK A;  3M85 A;  4GOP B;  4DV0 L;  3IRB A;  4GNX A;  2K75 A;  4DKA C;  3CC7 1;  4DK6 C;  1X56 A;  3VDY A;  2UUC Q;  2GTH A;  1LYL A;  1N33 Q;  1KRS A;  2GTI A;  2UUB Q;  1YHB A;  4IOC A;  5FJ8 G;  4DV4 Q;  4NBB A;  2E2H H;  3S1Q I;  1C9O A;  4C2M H;  2GN5 A;  1VQ4 1;  3I4M I;  4LNQ A;  1HNZ L;  4X66 L;  2UUA Q;  3G71 1;  2OQ0 A;  1GM5 A;  3CPW A;  1TWH I;  2ZTC A;  3M4Q A;  2XGT A;  1PHJ A;  2VF1 A;  2I5H A;  1PH6 A;  2PM9 A;  5IYD H;  4Y7N H;  4BBR I;  2JA6 G;  2Z6K C;  2UXC Q;  1X9N A;  4RMF A;  4DV3 L;  2AKW B;  1G6P A;  3K7U C;  2LFU A;  4JBM A;  2HT1 A;  2UXB L;  1HNW Q;  1HZB A;  1QUQ B;  4DK3 C;  1XNR L;  1X55 A;  3GTM S;  3CC4 A;  3ER0 A;  2UXD L;  3CW2 C;  5C44 I;  3I4N I;  1IBL L;  4PMW A;  5IP9 I;  1VQO Z;  1D7Q A;  3OW2 Y;  2JA8 G;  1JMC A;  2E2J I;  4DUY L;  4BY7 I;  2JA7 I;  2DE6 A;  2VQE L;  4TNU A;  3CC4 1;  3GDE A;  4A3F H;  4DV1 L;  5D1O A;  2P3Y A;  2VNU D;  2PNH A;  4RG1 A;  2JEA I;  3F2B A;  1JB7 A;  4JOI C;  3J80 f;  1Q81 1;  1WJJ A;  1VQE A;  3TRZ A;  2CFM A;  1YUA A;  3U4Z A;  1CKN B;  2CKZ B;  2OOX B;  3TS2 A;  1QVG A;  4A3B H;  5C4X I;  3HKS A;  5IYB H;  1VQG A;  3H15 A;  4X6A H;  3IF8 A;  3HOZ I;  3OTO Q;  4E2Y A;  1RQF A;  4IO9 A;  1MIU A;  2KEN A;  1GVP A;  4A3C I;  3WWV A;  1VQC A;  1VQL Z;  1QF8 A;  1X3Z A;  2NVQ I;  3UDF A;  4JBW A;  5JJL A;  1PH2 A;  1Q86 2;  5GRO A;  1SRU A;  3CCR A;  2O53 A;  4AQY Q;  1TWG I;  3G48 A;  3FKI H;  4A3J G;  2ASB A;  4DNI A;  1EFW A;  3I4M G;  3S2D I;  2ZJQ A;  3I56 Z;  1E1T A;  2VW9 A;  2Q2U A;  3PO3 G;  3S2H H;  3S16 I;  2KBN A;  4JYA L;  4P73 A;  3GTG H;  1WW9 A;  1IBM L;  5D1O B;  1W2B Y;  4B3R Q;  1YHQ 1;  3CD6 1;  3M7N A;  1UE5 A;  4BBS H;  1UEB A;  1TWC H;  1KD1 1;  3M4P A;  3ZJY C;  2I5L X;  4IOA A;  1E7Z A;  1EQQ A;  5IYC G;  4A3M H;  1I3Q H;  4QTU A;  1EIY B;  1WFQ A;  2JA5 G;  1YZ6 A;  3NEL A;  1FGU A;  4UP7 A;  3I56 A;  2MNA A;  1KD1 2;  2MO1 A;  4DK1 A;  4DV5 Q;  4NXM Q;  1VQ7 1;  4YCV A;  4NXN Q;  4PG3 A;  1N9W A;  2E8G A;  2QEX A;  3PO2 H;  1IL2 A;  3I2Z A;  1OXT A;  2DUD A;  1HZC A;  2NVY I;  2ZM6 L;  3TS0 A;  1XPO A;  2Q2H A;  3ULL A;  2IHE A;  2ZJP A;  2W04 A;  4JCV E;  2IHF A;  3UE1 A;  1PH4 A;  2K5R A;  5E7N A;  4E32 A;  3HOV H;  4H02 A;  3PO2 I;  1VQF A;  1WYD A;  3STB D;  1Y1W H;  4A3G I;  1U5K A;  3I55 A;  3S15 I;  5C3E H;  5M3M H;  2Z6K A;  5C4X G;  1TWF H;  5CM2 M;  2WB1 G;  4X64 L;  3KJO A;  2N78 A;  4KHP Q;  5LMN Q;  2O4H A;  4E2X A;  5A2Q b;  1CSP A;  4NFR A;  1L1O A;  1V1Q A;  2QRE B;  2V8I A;  3RNU A;  1SN8 A;  1Y1V H;  2JA5 H;  3CC2 1;  3VB9 A;  2BA0 A;  3I4N H;  1K8G A;  1VQ6 1;  2K52 A;  2PI2 E;  2M48 A;  4A3I I;  4JI4 L;  2OTL A;  1K0R A;  1Y1V I;  3CME 1;  3D6W A;  2ID0 A;  2WAQ A;  4DR6 L;  1PYS B;  2RCN A;  3PUW A;  2V1C C;  3HFZ B;  3GTK I;  1DGS A;  5LMN W;  3AFP A;  3K0X A;  3SGI A;  1PFT A;  1NMF A;  3CCE Z;  1CKM A;  2JE6 I;  2JEB I;  4JI1 L;  2JA9 A;  4DR3 Q;  1VQ4 Z;  1Z47 A;  4HID A;  1X65 A;  3RZD I;  3MZL B;  3S24 A;  1QVG Z;  4B3M L;  1JE5 A;  2QEX Z;  2ZM6 Q;  2Q51 A;  3CPW Z;  2JJQ A;  4GKK L;  5T67 A;  3NH4 A;  1TWF I;  1Q7Y 2;  2EIF A;  4HIM A;  1L2F A;  5FLM H;  1B8A A;  1KXL A;  1FVI A;  3G4S 1;  3BG1 B;  1Z03 A;  4YY3 Q;  3D0F A;  3MZK B;  2Y0S A;  2OZK A;  1JJ2 A;  5IWA L;  4TVA B;  2QRC B;  1XMQ L;  3PO3 S;  4LFC Q;  1X6O A;  4CL1 A;  4QTT A;  4DV4 L;  1VQN A;  3RZO I;  4A3K I;  1VQ7 Z;  3GTP I;  4HJ5 A;  4A3J H;  1GKH A;  4X64 Q;  3K7A I;  3RLF A;  3S1M I;  2KHJ A;  1VQO 1;  3GTM H;  4DV5 L;  2IX0 A;  4NXM L;  5AN9 F;  2KPI A;  1TWC I;  5M5W H;  4R1J A;  5C0X J;  1PH7 A;  1VQ6 Z;  4POF A;  1YVC A;  3G6E A;  3F3F C;  5T64 A;  5M3M G;  4MXU A;  3CCJ 1;  3AFQ A;  4NBC A;  1LUZ A;  4DR5 Q;  4YWM A;  5C44 G;  4E30 A;  3P5J B;  1KC8 C;  3BJU A;  5JJK A;  4HJ9 A;  3CCR 1;  1QVF Z;  4FDB A;  4DR2 L;  4BY1 H;  1FJG L;  4OX9 Q;  1I50 H;  3JAM c;  2M6N A;  4JI0 L;  3GTL I;  3HOW G;  1XNR Q;  3FKI I;  4BY1 I;  2IZ3 A;  2CQO A;  2F4O A;  3ULJ A;  3S2H I;  4DR1 L;  4BXX G;  1IBL Q;  4A3B I;  2NVQ H;  3PGZ A;  4DQY B;  1OXS C;  3PF5 A;  4X65 Q;  2RPR A;  4E33 A;  4JOI A;  3PUV A;  1YJ9 1;  1TWH H;  4GN3 B;  4HIO A;  1UE6 A;  2PMZ A;  4JC0 A;  2R92 G;  4BA1 I;  3Q87 A;  4X6A I;  1TWA H;  3PCO B;  2R6G A;  3CCU Z;  1K8A C;  1TWA I;  4LUZ A;  1N36 L;  3J7Z C;  1PA6 A;  1VQ7 A;  4A3C G;  1HNW L;  3TEH B;  5T6B A;  2L15 A;  5C4X H;  1BBW A;  4GNX B;  3HOZ H;  3CCU A;  3NH8 A;  1JT8 A;  3PUZ A;  3CMA Z;  2GVA A;  4LF5 L;  3CC4 Z;  1VLA A;  1VQN 1;  3CXC Z;  4A75 A;  1G29 1;  4P72 A;  5AJ3 L;  1VQP Z;  2B63 G;  4UP8 A;  4MRI A;  1SLJ A;  3IFU A;  4Y52 I;  5M3F G;  3OYY A;  3A74 A;  1RLY A;  4IFD G;  3K80 C;  4B3M Q;  3I4N G;  4AIM A;  5C4J I;  2RF4 A;  4A3F I;  2QKD A;  2VQF Q;  2EXD A;  3CCE A;  1K8A 2;  5ELN A;  4WJ4 A;  4RVF A;  4DAM A;  1E24 A;  1U0L A;  3NFZ A;  2I5M X;  1PH3 A;  1PH8 A;  3OW2 A;  4MZ9 A;  3TE5 B;  1XNQ L;  2NN6 G;  3GD7 A;  2LXJ A;  4GKJ Q;  5LMU L;  3CXC A;  1RO2 A;  4HJ7 A;  2NVT I;  2K5V A;  4A3E I;  4POG A;  4TQU S;  2OTL Z;  3QWU A;  4EQ5 A;  1XMO L;  3FP9 A;  1VQ6 A;  4A3G H;  1I94 L;  3EER A;  3HOX G;  4E31 A;  1K3R A;  2OOY B;  4IPH A;  3BG0 B;  3EN2 A;  1HNX L;  3HOW I;  4B3S L;  3HOZ G;  4BY1 G;  3S1R H;  5EAY A;  1WCM G;  3D31 A;  3PIO A;  1A63 A;  3H3V I;  1M1K 2;  3H3V H;  3K8A A;  3KIF A;  3VMI A;  5JEA J;  4IFD J;  4ME3 A;  4E2Z A;  1HH2 P;  1Q1B A;  4B3T L;  2GU2 A;  3F1Z A;  5IE8 A;  1NUI A;  2H5X A;  2D0O A;  4NBH A;  2QRD B;  4L5S A;  3S14 I;  4DAY B;  3NH5 A;  4OO1 I;  4X62 Q;  2K4K A;  1IBK L;  2QLV B;  2BJO A;  1NTG A;  1N2F A;  1HR0 L;  1VQ5 Z;  1L1O C;  3NDJ A;  2ES2 A;  2VUM H;  2B3G A;  4AH6 A;  3CCV A;  4IJL A;  1N8R C;  2Q2I A;  3G6E Z;  4MH4 A;  1YIT 1;  1A62 A;  2VUM G;  4WJ3 M;  1YUK A;  1K73 2;  4BBS I;  2R93 G;  4A76 A;  4HJA A;  2JUB A;  1N8R 2;  2B29 A;  1KC8 1;  1ZB9 A;  4MD9 A;  2JR6 A;  1RO0 A;  1X3G A;  3GTM I;  1K9M 1;  2UUC L;  4DV7 L;  1PFS A;  2NVX I;  1ASZ A;  2FXQ A;  3CCJ A;  2CWP A;  2NVT H;  5BR8 L;  1ZB8 A;  2UXD Q;  1SE8 A;  1VQJ A;  1VQK A;  2W03 A;  1VQA A;  3IX0 A;  4BBR G;  1HNX Q;  1CUK A;  1K83 I;  1S72 Z;  1KAW A;  1O7I A;  3L0O A;  3BZC A;  2VQE Q;  4LF4 Q;  1B7Y B;  5HGQ A;  2OTJ A;  3RZO H;  1IXR A;  2BH8 A;  3HOX I;  4IPC A;  5IP7 I;  2OQK A;  4BA2 I;  1VQL A;  2QA4 Z;  1YJW 1;  4RS4 A;  4A93 G;  4R4I A;  2N3S A;  4GS3 A;  4JI4 Q;  2B63 H;  2AMC B;  1YJ9 A;  2PI2 A;  5FLM G;  3KIH A;  2G2K A;  4DR6 Q;  2MFI A;  1VQB A;  1KC8 2;  1I94 Q;  5IP7 H;  4GNX C;  1YIJ Z;  1EWI A;  3T1H Q;  1GO3 E;  2E2J H;  3CCM A;  1TFI A;  2PQA B;  1VS0 A;  1S72 A;  1VQ9 A;  2D0P A;  2CWA A;  1HR0 Q;  3S1R I;  2H85 A;  4RV9 A;  5GAG C;  4K0K L;  2QGQ A;  2Z0S A;  1E22 A;  1NE3 A;  1X0T A;  3CCM 1;  1L0W A;  4BBR H;  2HF1 A;  4A3I H;  4UPA A;  2MQH A;  3B6Y A;  4KLK A;  4BXX I;  1MJC A;  1KIX A;  1J5E L;  1UE1 A;  2VL6 A;  3HOU H;  3J80 c;  2HQL A;  3U4V A;  5LL6 f;  2VUM I;  1KQS Z;  3KFU A;  3VMG A;  3S1Q H;  1Y14 B;  4LF8 Q;  2R6M A;  2Y0S E;  3A5U A;  3GTL H;  4QGU A;  2HU9 A;  4A3J I;  1VQ9 Z;  3A5Z B;  2Q4Z A;  5BR8 Q;  3JAM f;  5FLX c;  1Q8K A;  3PO3 I;  3S1M H;  1OXV A;  3HOV I;  1YIJ 1;  1JJ2 Y;  4NPS A;  3CF5 A;  3JAM b;  4JV5 L;  4LF4 L;  2KCM A;  1NJI 2;  1KRT A;  4HH4 A;  4JYA Q;  3NEN A;  1K73 C;  3CC7 A;  2R92 H;  2AKL A;  3T4N B;  2KI7 B;  4QQB X;  1IBM Q;  3G4S Z;  2NZH A;  2P28 A;  3U58 A;  2K3R A;  4DGL A;  1S40 A;  3AQQ A;  1QYP A;  4JI7 L;  4J15 A;  2B63 I;  3I7F A;  4DR7 Q;  4A93 I;  1VQ8 Z;  1VQK Z;  1YEZ A;  4LUO A;  1YI2 1;  3FHW A;  1JJG A;  1TXY A;  2AHO B;  1L1O B;  3RN5 A;  4GLV B;  3F3P C;  4A3M G;  1AE3 A;  1N8R 1;  3KF8 B;  1Q7Y C;  4NXN L;  3CME A;  2E2I H;  2PMZ E;  3VMH A;  3CCR Z;  2OTL 1;  5IT9 b;  1IYJ B;  1J5E Q;  3GTG I;  1E1O A;  3PF4 A;  3ULP A;  1SR3 A;  3GTO H;  3OW2 Z;  4KHZ A;  3GTJ I;  1IZ6 A;  1USP B;  3GTO I;  2F4V Q;  1Z9F A;  1YIT A;  1N33 L;  1Q7Y 1;  1HJP A;  3S2D H;  3J81 i;  1EYG A;  1BBU A;  1WI5 A;  3HKZ E;  4RVG A;  2VUG A;  1XMO Q;  3NDI A;  3I4M H;  1CKO A;  4OWX B;  3T1H L;  2LXK A;  4R4C A;  3W1G A;  1BKB A;  2YU9 I;  1HNZ Q;  3KLW A;  5LMN L;  5IYB G;  2ZAE B;  1I6H H;  1VQP A;  4DPG A;  4YHH L;  4P75 A;  1KD1 C;  1D8L A;  4NOZ A;  2I3C A;  3CMA 1;  4DR4 Q;  2KCT A;  2WB1 E;  4NBA A;  3G71 Z;  2YTX A;  4JG2 A;  2VQF L;  1Y1V G;  2UXC L;  2PQA A;  1VQK 1;  1SMX A;  5IYC H;  2JQO A;  3AYH B;  4GOP C;  4YWK A;  4JI3 L;  4LF7 L;  3GTP H;  3TDH B;  3S14 H;  5M5X H;  4OON A;  4OO1 G;  2HIX A;  4P71 A;  4OWW B;  3H0G G;  2VS1 A;  3S17 I;  3I4O A;  3H0G H;  2UUB L;  1P9N A;  4UP9 A;  3AEV A;  3CCL Z;  1VQO A;  4DR7 L;  3CCL A;  1YJW A;  3BU2 A;  4NH1 C;  4LF9 L;  3S1N I;  2R7Z I;  1PH1 A;  2YYZ A;  2UUA L;  4NB3 A;  2Y0S G;  4DUY Q;  2DE7 A;  3PSI A;  4LUV A;  4DR3 L;  3CPF A;  4A3E H;  1Q46 A;  3D9X A;  1KQS Y;  3CXC Y;  4A3E G;  3KDF A;  3G71 A;  3CCS Z;  2WP8 J;  4APV A;  2R7D A;  3J81 c;  2YAD A;  1R9T I;  3CAM A;  1A0I A;  1YBY A;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...