3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4DR4L 1NE3A 3A0JA 1AE2A 5JJLA 1PA6A 1PH8A 3J7ZC 4GOPB 1R9TI 3PIPA 2A8VA 1L0WA 3RZDI 2WB1E 4LF5L 3M4OH 1UE6A 4XTCS 1HZ9A 1BKBA 1TWHH 1VQHA 5C44H 4BY7G 4GOPC 3J81c 4JI0L 4X62L 3W5OA 2B3GA 1TWGI 2RBLA 3EBEA 1VQDA 4HJ7A 2YV5A 1IBML 4IOCA 3JAMi 2UUAQ 2MO0A 2F4VQ 2IHFA 2JA7G 1J5EQ 4WJ4A 5IYDH 3MEFA 2YTYA 1CKOA 1AH9A 4BBRI 1T9HA 1QZGA 3PUYA 1K8AC 3FHWA 1MJCA 4JV5Q 1E24A 4UP7A 2VS1A 2NVQH 4NXML 2LXJA 5CM2M 4B3SQ 3TRZA 2VQEQ 5IY0A 3A74A 2PQAB 4KLKA 4P74A 2JEAI 1XMOQ 3HOVI 1IBLL 4A3II 4DAMA 2E2HH 2UU9Q 2E2JH 1NMFA 4JBKA 4LWCA 1LM0A 2NN6G 3ULPA 3I07A 1RLYA 1PH5A 1PYBA 4GKKQ 3S14I 4DV0L 4IJHA 4DV5L 1XPUA 1C7YA 4DR3Q 3KOJA 2YU9I 1HZCA 2YTVA 4YWKA 2IX0A 1YI2A 4A3DG 3UDFA 1HR0W 4DAYB 1IZ6A 1TWFI 5HY6A 2RF4A 2JJQA 2ZM6Q 1A62A 5FLMI 3I7FA 3M9BA 4DR2Q 4PZ8A 5IP7I 3S2HH 4LNQA 1BBWA 3PGZA 2BA0A 3KYHC 4K0KL 1YZ6A 2GVBA 2R93I 4YHHL 1VQKA 1PH2A 3U58A 3PIOA 4JI7L 1PFTA 4A3CI 3RN2A 1TWAH 3Q87A 5IYCG 2E2II 1UE1A 2R7ZI 3CCVA 4LUOA 3BU2A 3S16I 3S17I 1VQ4A 3GTLH 1LUZA 1JJGA 4JI0Q 5JJKA 5DLQE 5C3EI 1WCMH 1E7ZA 2HIVA 1MKHA 1VQ5A 1E1TA 2NVYH 2A19A 4LFCL 1E22A 1D7QA 1IBMQ 3WWVA 3T1YQ 4DV6L 1PH1A 3J80c 3Q8DA 4A3LG 1K73C 1C9OA 2R7DA 3S15H 2E5LQ 4A3MG 1E1OA 3GCFA 2JK8A 3RR5A 4HIOA 1Y1VI 4X64L 5GAGC 1VQIA 4QTTA 3VDYA 4A3JI 1N34L 1EUJA 1H95A 2CWAA 1B7YB 4NXMQ 2RHSB 2I5LX 4LW1A 5GADC 4A3GG 4BY1I 1EQRA 4WJ3M 3KF6A 3PUZA 1YUAA 1N2FA 4IJLA 4A3DH 4NBAA 5C4JH 1JT8A 1I6HI 1IBLQ 1HNZL 3PUVA 2JA6G 4LUVA 2ATWA 1RO4A 2NVXI 4NBFA 3GTGI 3RLOA 5JEAG 1WYDA 1U0LA 1VQOA 1Q82C 5M3FG 1I3QI 3PO3G 4DV0Q 2L15A 1N9WA 3HOWH 2UXBL 4DV5Q 2NVTH 2VUMI 4BXXI 4ALPA 2KCMA 4AQYL 1RIPA 4JI6L 1X65A 1EQQA 2R92G 1HZAA 1USPB 3J80i 5IYCH 2DE7A 4LF6Q 3GTPH 1V1QA 1HNWL 3CQZH 4LF8L 4BBSH 5EAYA 5ELOA 4A93G 4JI4L 4QJFA 1Y1WG 4Y7NI 3HKZE 1Q86C 4L5QA 4K0KQ 3HOZI 2ZTCA 4YHHQ 3FKII 2PI2E 3HKSA 1PH4A 4X6AH 4NB3A 4YCWA 4JI7Q 3F1ZA 1SLJA 3CCLA 3HOUG 1WJJA 3UE0A 3CCEA 4A3LH 4QL5A 4NBEA 1V9PA 3HOXG 3S1RI 4A3MH 4DK6C 2JA8I 2VNUD 1A63A 2CWPA 1ASZA 1VQNA 3M7NA 2D0PA 1HR0L 4A3GH 4LFCQ 4GN5A 3STBD 3I4NG 4XX2A 4DV6Q 1Q81C 2D62A 2IY5B 1X3ZA 2OWOA 1Q1EA 1L2FA 4HIMA 5IWAL 3VB9A 2CFMA 4GN3B 4O0AA 2I5MX 4DKAC 1OXSC 3CC4A 3PO3H 1YEZA 4MTNA 1U5KA 4IPGA 1XMQQ 4JOIA 1FGUA 1TWCH 3L7ZC 2OTJA 3S1NH 2R92H 4A3FI 3F2BA 3M4PA 2Z6KA 1G291 1Y1VS 3PUXA 4C3IH 4C3HH 4HJ9A 1HNZQ 1M1KC 3K7AH 1X6OA 4A93H 4JI2L 2F4MA 4IPCA 1CSPA 1Y1WH 4A3KI 1PH6A 5FLXc 2AKWB 4IFDJ 2OTLA 4A3EI 5IYBG 2UXBQ 3J81j 3EERA 1KRSA 1ASYA 3JAMc 3AFQA 4AQYQ 3HOUH 4DNIA 1YHAA 2OQ0A 2KHJA 4P71A 3GTOH 2ZTEA 3HOXH 4LF8Q 1YJWA 4A3BG 1YIJA 1DGSA 4LF7L 3G48A 4NB8A 1YHQA 3KDFA 4JI3L 4BBRG 2F52A 3M4OI 3ZJYC 1I50H 1TWHI 1N32Q 5C44I 1G51A 3I4NH 3CF5A 4R4IA 4PZ6A 4DV3L 4HJ5A 3I4MG 1DL6A 4BA2I 1SN8A 3RNUA 1L1OA 1FVIA 3A5UA 2NZHA 1VQJA 2JA9A 2UUCL 4MNOA 4IFDI 5M3MG 4L5TA 1HR0Q 4OO1I 1JJCB 2BA1A 1KQSA 4A4IA 1EWIA 2EIFA 3RZOH 2AKLA 1N33L 3GTMH 2NVQI 3CCJA 2UUBQ 2V1CC 4LF9L 2MO1A 5IWAQ 1PH9A 2BH8A 5ELNA 3KLWA 3VMGA 2IT1A 3W1GA 1OXUA 4GNXB 3PO3S 5FLMG 2E2HI 1SMXA 2E2JI 4GN4B 2K50A 1IBKL 4GNXC 2P3YA 2R93G 1YNXA 2AWNA 3NBHB 1LQLA 4X65L 4LFBL 2B29A 3GKQA 1Q46A 2KHIA 4A3CG 3IRBA 2R6GA 4DR6L 2NZOA 4JI2Q 1FL0A 4QTUA 4DV1L 1VQ9A 1C0AA 4DR1L 4KHPL 4A3BH 2HF1A 3M85A 1Q1BA 1VQCA 1VQEA 1X54A 4OXPA 3H15A 1XNRL 3S2HI 1D8LA 4R4CA 1A8VA 5GQOA 3I4MH 4JI5L 1FJGL 4DUZL 2DE6A 3FP9A 1I94Q 1VQMA 2KENA 1MJEA 1TWAI 4BY7H 2OQKA 1HNXL 3ESWA 4NBHA 4LF7Q 3ER0A 3GTQH 3S1QH 1W2BA 5M3MH 1CKNA 3G6EA 4DR5Q 3HOYG 4JI3Q 1SFOH 1TFIA 1NBWA 1GO3E 3GTLI 3LGJA 4A3JG 1WCMI 4DR4Q 4OX9L 4DV3Q 3K7UC 1TXYA 3L0OA 3K81C 2NVYI 2PMZE 2WP8J 2JA7H 1LTLA 5C4XG 3CC2A 3I56A 4GLVB 4LF5Q 4NPSA 3HKZG 2EQSA 2DE5A 1VCIA 2UUCQ 2ZTDA 1M90C 1LYLA 4X62Q 3S15I 5IP9G 1YVCA 1G6PA 1KD1C 2YYZA 1XJVA 2BJOA 3CXCA 1X3GA 4R4TA 4LF9Q 1QUQA 3BZCA 4A3DI 5LMNW 3OW2A 5C4JI 4TVAB 2JS4A 4JBWA 1GD7A 2Q2UA 1ML8A 3PO2G 3CCUA 1CSQA 3D31A 3KJOA 4X65Q 4LFBQ 3HOWI 2N8NA 2NVTI 1VQ6A 2HIXA 2F4OA 1UEBA 1B70B 4DV1Q 4GOPA 1HJPA 2KCTA 1V43A 4DR1Q 4KHPQ 4QIWE 3GTPI 3HOYH 4O2DA 3CQZI 4BBSI 2CQOA 1SE8A 3VMHA 4R4OA 4B3ML 3M3YH 5JEAJ 3H3VH 1N8RC 3OYYA 3GO5A 1RL2A 2WFWA 2D0OA 4DUZQ 3D0FA 1Q7YC 5M5XH 4X6AI 1CKMA 5IE8A 5C4XH 1KAWA 2ZJPA 3UDIA 2IHEA 3SGIA 3TEHB 1HNXQ 4A3LI 1KL9A 4RG1A 4JC0A 5IP9H 4A3MI 1J6QA 4DPGA 4C2MH 4R4QA 4UY8C 1X3EA 4OX9Q 1JE5A 1ZB8A 1PVOA 3K0XA 3I55A 1XPRA 4A3GI 3PV0A 2F3IA 4A3FG 3PCOB 2PQAA 3CPFA 4DUYL 4IOAA 1K3RA 1NUIA 3S2DH 1AE3A 2KPIA 1K83H 3H0GG 4A3KG 1X9NA 2B63I 2Q2TA 1VQ8A 1O7IA 3PSIA 5FJ8G 3PO2H 3K80C 3EIVA 2DUDA 4QGUA 4A3EG 2Q2IA 1XNQL 3PO3I 1KHIA 4GLAC 3TQYA 2RCNA 5J3BA 3PUWA 1TWCI 2K5HA 1OXXK 1Y14B 2JA6H 3S1NI 2R92I 3GD7A 4X64Q 2UUAL 3U50C 5C0XG 1EFWA 2F4VL 2JA5G 1UE7A 4DV4L 1EIYB 3K7AI 1N34Q 4JYAL 5M3FH 4A93I 5BR8L 1VQAA 4B3RL 1WW9A 4HJAA 1EOVA 1S40A 1Y1WI 4GKJL 1QYPA 4NBCA 3UE1A 4UP9A 2R7FA 1X3FA 3DLLA 2HT1A 3HOUI 3S1MH 2ID0A 3U4VA 2MFIA 2KBNA 3GTOI 1GKHA 3HOXI 4POGA 4AIMA 2MNAA 2XGTA 4YY3L 4KHZA 1XMOL 2N78A 2IX1A 2UU9L 4JI6Q 3I2ZA 5LMNL 4L5SA 3CPWA 4HIDA 1I50I 4JCVE 4GKKL 4XIGS 2JNYA 1HNWQ 3I4NI 1YITA 4JI4Q 4JBMA 2K75A 3PF5A 3LUSA 2Z0SA 3H0GH 1JJ2A 1WI5A 4B3TL 3NEMA 3J7A5 5FJ8H 4Y52H 3W1BA 3CMEA 3G71A 5M5WH 1EIFA 5AJ3L 3NELA 3AFPA 4DR2L 3KFUA 3JC66 1SRUA 2QGQA 1QVCA 3GTKH 3KF6B 3RZOI 4OWWB 1VQPA 3GTMI 2JQOA 2BH2A 3HOVG 2UXCL 3CAMA 4A3IG 2ES2A 2JA5H 1PFSA 2K5VA 1K9MC 1HH2P 3KJPA 1PH3A 2VW9A 1XNQQ 3GTJH 3E9HA 5LMUL 3ERSX 4PG3A 1VS0A 4J15A 4NBGA 3GDEA 1KRTA 4OONA 1R9TH 1USPA 5IT9c 1YJ9A 2K14A 4YWMA 1X3WA 3T1YL 2AMCB 3RZDH 4DV4Q 4EQ5A 4JYAQ 5BR8Q 5IYBH 3EN2A 2VL6A 4B3RQ 5IP7G 2UXDL 4A3BI 3T1HL 4NB9A 2FXQA 4GKJQ 2E5LL 1TWGH 1WCMG 1QVGA 1WOCA 2YTXA 4NXNL 3I4MI 1MIUA 2C35B 1HZBA 2R7ZG 4IO9A 3B6YA 4AYBE 2JR6A 4BBRH 2DGYA 3CMAA 4YY3Q 5C3EG 4BY7I 3GTQI 3S1QI 1OXTA 5LMNQ 3TREA 1SFOI 3J81i 4L5RC 1SROA 3UDXA 4BA1I 2WAQG 3HOVH 4A3IH 2JA7I 1IXRA 4TQUS 4HIKA 4HJ8A 1Y1VG 3KF8B 4LF6L 4B3TQ 1QVFA 3CCQA 1EYGA 1YBYA 1VLAA 4DV2L 3S14H 2QA4A 5AJ3Q 1Q12A 4BY1G 2YU9H 3STBC 1JB7A 2PNHA 3NENA 4P75A 3HOWG 5K36G 1TWFH 2VZAA 4DV7L 3H3VJ 2UXCQ 4JOIC 5FLMH 3F2DA 3CW2C 5IP7H 4JG2A 2Z6KC 3F2CA 4BBSG 2NN6I 2R93H 2CCZA 4YWLA 4YCUA 5LMUQ 1X56A 1N33Q 3GTMS 1IYJB 4UP8A 2RHQB 2VUMG 4BXXG 4LF4L 3U4ZA 3RLNA 1X55A 4A3CH 2K4KA 3CP0A 3RN5A 1KXLA 4X66L 1UE5A 4JI1L 2E2IH 2CKZB 2R7ZH 3TS0A 4OWTB 4GS3A 3S16H 1XPOA 3S17H 3MXNB 4AH6A 2JEBI 2LXKA 3VMIA 5C3EH 3OTOL 2UXDQ 3T1HQ 4ME3A 1QZHA 1OTCA 3HOZG 1IBKQ 3KDFB 3HOYI 2J6AA 3FKIG 1S3OA 3A5ZB 3CC7A 2EXDA 4DR6Q 3M3YI 1XMQL 2H5XA 3H3VI 2HHHL 4NXNQ 3RLFA 1P16A 4C3JH 2WAQE 3AQQA 2JA8G 5C4XI 1L1OB 1W3SA 1Y1VH 2E8GA 2ASBA 1Z47A 2K52A 4A3JH 1VQLA 1XNRQ 4R1JA 4DR7L 2B63G 2XTIA 2N49A 1L1OC 4NBBA 5IP9I 4BY1H 3G4SA 4JI5Q 1FJGQ 1XTDA 4LFAL 2Q2HA 1NTGA 2GVAA 2I0QA 1YHBA 3BZKA 1I6HH 1PV4A 1N36L 1KIXA 1S72A 2HQLA 4FDBA 4JI8L 3CD6A 2Y0SG 2NVXH 3GTGH 3S2DI 2VQFL 4GNXA 1VQBA 2JE6I 1I3QH 1K83I 4DV2Q 3TS2A 2VY3A 1PHJA 4QQBX 1SR3A 1PYSB 2VUMH 4BXXH 3M4QA 3PO2I 1UWVA 1KC8C 2MQHA 1N32L 4DV7Q 2ALYB 1NMGA 3AYHB 4KI0A 1GM5A 3ULJA 2JA6I 2LSSA 4Y7NH 3HOZH 5E7NA 3FKIH 3CCMA 1K0RA 4LF4Q 4PZ7A 4P73A 2OCEA 3I4OA 3ULLA 1PH7A 4YCVA 2I5HA 4X66Q 4JI1Q 4IPHA 4H02A 1A0IA 1B8AA 4PMWA 3S1RH 4POFA 4QY7A 2JA8H 3S24A 2UUBL 3S1MI 2WB1G 3OTOQ 2QEXA 4GLXA 1NJIC 1J5EL 2K5RA 4NBDA 1VQGA 1VQFA 2B63H 5C0XJ 1CKNB 5GROA 4APVA 4DK3C 5C44G 5JJIA 4MZ9A 4JV5L 1I5FA 5GAHC 4EX5A 1OXVA 1K8GA 4IPDA 2HHHQ 3UDGA 4B3SL 1JMCA 4OWXB 2VQEL 2AHOB 1WFQA 2PK7A 3CCRA 1ZB9A 3E9IA 4NOZA 3E0EA 1E3PA 2Y0SE 4IFDG 3L2PA 4B3MQ 4DR7Q 2N3SA 4OO1G 5IYDG 3H0GI 1CUKA 4A75A 4LUZA 3PF4A 5M5YH 2ZJQA 4Y52I 1NY4A 1VQ7A 4A3FH 3ICEA 1P8LA 2ZJRA 4LFAQ 1YJNA 5H1SE 4UPAA 1GVPA 1IL2A 1BBUA 4RMFA 2A1AA 3AEVA 4DR3L 1N36Q 4AYBG 4MH4A 2AWOA 1QUQB 3GTKI 4JI8Q 2K5NA 2GN5A 4JBJA 4A3KH 1Z9FA 1BVSA 2VQFQ 3CCSA 5HGQA 3HFZB 3BJUA 5C0XI 3DM3A 2JA5I 5GAEC 1I94L 4A3EH 2ZM6L 3F8TA 2PI2A 4DR5L 4A76A 4P72A 4DUYQ 3GTJI 3D6WA 3K8AA 1Q8KA
chains in the Genus database with same CATH superfamily
4JW0A 4DR4L 4RVDA 3J7A4 1NE3A 2IW3A 3A0JA 4WORA 1BR9A 1AE2A 1D5XC 5JJLA 1PA6A 1PH8A 3E0JA 1CM9A 3MHBA 2A69D 4AYBB 3J7ZC 4GOPB 5CV8A 3UI2A 3O13A 1R9TI 1VF7A 5CC4A 3CXCZ 2F0QA 2RHBA 3PIPA 3J81L 2A8VA 1L0WA 1QOHA 3RZDI 2WB1E 4LF5L 3M4OH 1UE6A 4XTCS 2B2WC 3X3NA 1HZ9A 2XSCA 1BKBA 1TWHH 1VQHA 2Z1CA 3FPUB 1EEID 4E33A 5C44H 4GOPC 5KRUA 4BY7G 3HRZC 2E9HA 2E2HB 3J81c 4JI0L 4FO2A 1CZGA 3BDOA 2E2JB 4X62L 1J8IA 3TBIB 3EFXD 3W5OA 2B3GA 2VB2X 1LABA 1TWGI 4ZYSA 2RBLA 3DEPA 3BVMA 4IURA 3K5LA 3SHLA 4RS4A 1VDZA 3EBEA 1VQDA 4HJ7A 1LTBD 2YV5A 5CBEE 1IBML 1ZYRC 3KLSA 3JAMi 4IOCA 2UUAQ 1TU2B 2MO0A 2F4VQ 1MSHA 2M48A 1DOKA 2EJFC 2A5HA 5T1IA 3HOVB 3T16A 2IHFA 5DAUA 4A3IB 4GZYC 2JA7G 5EQ0A 3CCUZ 3VYSA 2K1BA 4IFDH 5KEEA 1SE2A 2ZT9C 1J5EQ 1Q3LA 1BBXC 3TP7A 4WJ4A 2KHSA 4OO1H 4ZK9B 5IYDH 5CBAE 4MN3A 5IGGA 1G2TA 3MEFA 2YTYA 1CKOA 1AH9A 1BO0A 1FR3A 4BBRI 1D5MC 3J81f 1SDFA 1JOOA 1T9HA 1QZGA 3PUYA 3S14B 1K8AC 3FHWA 1MJCA 1XXGA 4JV5Q 1HA5A 1E24A 3AB9A 4UP7A 2VS1A 1SMYC 2NVQH 4NXML 4NMZA 2LXJA 5FO8B 5CM2M 4B3SQ 3TRZA 5IT9f 1VQ91 1VQOZ 4E30A 2QREB 2CVRA 2VQEQ 3VA7A 3D4RA 5IY0A 3A74A 4BWGB 2PQAB 1TWFB 4KLKA 4LAAA 4U68A 3KLSX 4P74A 1C4QA 1BDOA 2JEAI 1XMOQ 3HOVI 3PQIA 3CXCY 1EWCA 1IBLL 4A3II 1TWAB 4DAMA 2E2HH 2UU9Q 2B2YC 5NUCA 2E2JH 1TKWB 3TZDA 1NMFA 4JBKA 5JJZA 4LWCA 1LM0A 2NN6G 1F2LA 1PRTB 3ULPA 3I07A 1RLYA 3KBXA 1PYBA 1PH5A 4GKKQ 3S14I 3VR4A 4DV0L 4IJHA 1WCMB 1LV9A 2A6ED 4DV5L 1FDIA 1KDAA 1AFPA 2HDMA 1XPUA 1C7YA 4DR3Q 1O7YA 2NVYB 1G6ZA 3KOJA 2YU9I 1SJHD 2KA7A 1HZCA 1LTAD 2YTVA 1PRTC 1I4RA 4YWKA 2IX0A 1YI2A 3PMFA 3PIO3 4A3DG 1M8AA 3UDFA 1HR0W 3TN2A 1A15A 3G6E1 4DAYB 1IZ6A 4NP5A 2KEEA 3TP6A 1TWFI 4NDXA 5HY6A 1FNUA 1RDPD 3MXUA 3S16B 2RF4A 5IGBA 3I55Z 1VQK1 1KDBA 2JJQA 4P2CB 1DCZA 2SOBA 2ZM6Q 4F8MA 1A62A 5EKIA 5FLMI 4K6DA 3I7FA 3M9BA 1EWHA 2Z4HA 2F0GA 3I90A 3MZKB 4XQQA 4DR2Q 4PZ8A 5IP7I 3S2HH 4LNQA 2B8FA 1BBWA 3PGZA 2BA0A 3KYHC 3BDCA 1SNMA 4K0KL 1YZ6A 1PRTF 2GVBA 4RHSA 2R93I 4YHHL 1VQKA 2GTHA 1SAPA 4IUVA 1PH2A 3CCV1 2QKDA 4IZ8A 2GU2A 3U58A 1VQ41 4HCSA 3PIOA 3IAYA 4JI7L 1PFTA 1JE4A 4A3CI 2WAQB 3RN2A 2QR1B 1TWAH 1S5FD 3Q87A 3M4YA 1VQ51 5D1OB 5IYCG 3NDJA 2E2II 1UE1A 2CH4W 2R7ZI 5CV6A 1WTXA 4A3DB 3HS0C 3J7AV 1B3AA 3CCVA 4LUOA 1Y1VB 3BU2A 2K5DA 3S16I 3S17I 1VQ4A 3GTLH 1LUZA 4EGVA 1JJGA 2DY8A 4DQYB 4JI0Q 5JJKA 5DLQE 5C3EI 1WCMH 1E7ZA 2HIVA 1MKHA 1VQ5A 4G4KA 1E1TA 2NVYH 2ZXOA 2EE1A 1SNOA 2EYPA 3H94A 2AQ3B 1QILA 2PPBC 2A19A 3EEDA 2JXMB 4LFCL 1E22A 5EPLA 1D7QA 3J80L 1IBMQ 3WWVA 3T1YQ 2K5QA 3HOWB 4DV6L 1GUTA 1PH1A 2NVTB 2F0HA 3OWEB 3A8IE 2LEXA 2G2KA 1I6HB 3J80c 2RDHA 1V8QA 3BDLA 3DEOA 3T13A 3E5SA 5ELBA 3Q8DA 4A3LG 1K73C 1S4ZA 2F0DA 2CW0D 1C9OA 2R7DA 3S15H 2L5TA 1U4RA 5KNDA 1QCBD 3NPPA 2E5LQ 2NVXB 1EL0A 3GTGB 4A3MG 3H91A 1E1OA 3GCFA 5JPMC 2JK8A 3RR5A 4EVOA 2HDLA 4HIOA 1Y1VI 2A6HD 4X64L 3CQZB 5GAGC 4BBSB 1VQIA 1K9M1 1I3QB 4QTTA 3VDYA 4RVFA 4A3JI 2Q8RE 5CR3A 1N34L 1EUJA 5I9OA 1H95A 3HP3A 5ISRA 3CRKC 2CWAA 1B7YB 1STEA 4NXMQ 2RHSB 4TNUA 3FVQA 2VUMB 2I5LX 4LW1A 5GADC 3LNNA 2XRQD 4A3GG 4BY1I 2BCOA 1EQRA 4WJ3M 3TP5A 3KF6A 2X6GA 3PUZA 1YUAA 1RNIA 1N2FA 4IJLA 5JOBA 4CJ0B 2EPBA 1F9RA 4KHVA 3T4AC 4A3DH 1TIID 4UAIA 4NBAA 1PFBA 5C4JH 1MD2D 1PXUA 2NWGA 2DJGC 1VQO1 3A7AB 1JT8A 1I6HI 1YNJD 1IBLQ 3CPWZ 1HNZL 3PUVA 5IGFA 2PW7A 2JA6G 4LUVA 2ATWA 1PTOD 1E2ZA 1RO4A 1KAAA 4Y7NB 1X32A 5IOCA 1BXTA 4B9WA 4BS9A 2NVXI 4NBFA 1YITZ 3GTGI 2J0TD 3RLOA 5JEAG 3HOZB 4A3MB 2Z8LA 1Y69U 1LT6D 4FP5D 2JSOA 5KYLA 1WYDA 1U0LA 4K2KA 1VQOA 3FKIB 5M3FG 1I3QI 1Q82C 3PO3G 4PMCA 4X3TA 4DV0Q 1CFMA 2L15A 1IKMA 1N9WA 3HOWH 5K36H 2UXBL 4DV5Q 3A55A 1YHQZ 1JJ2Z 2NVTH 2VUMI 4BXXI 1LLRD 4ALPA 2KCMA 4AQYL 1RIPA 1SYCA 1ZXTA 4ID6A 4JI6L 1GUWA 2HU9A 1C48A 1SMYD 1X65A 2VXWA 3DHQA 5TSSA 3CMEZ 3NDIA 1P9NA 3G71Z 4KN4C 1EQQA 2R92G 1HZAA 1LACA 1QB5D 1EQTA 1USPB 3J80i 4QUFA 5ELCA 2DE7A 3IL8A 5IYCH 2JIPA 3S1RB 4LF6Q 3GTPH 4C3IG 2OXPA 1V1QA 1HNWL 3CQZH 2D5DA 2ZAEB 1V1OA 4LF8L 2JA8B 5EAYA 1EY5A 4BBSH 5ELOA 4A93G 3NUCA 4JI4L 4JVZA 4QJFA 3NE5B 3MTSA 4KKSA 3VYTA 4FNFA 3ND8A 2VPZA 1Y1WG 4Y7NI 3HKZE 1N8R2 2B63B 3TE5B 1Q86C 1VQPZ 4L5QA 4NW2A 3CCE1 4K0KQ 3HOZI 3RUZA 2ZTCA 3J81E 4YHHQ 2XNAC 3FKII 2PI2E 3HKSA 1PH4A 2PMZA 5C3XA 4X6AH 4NB3A 1QJOA 2LIYA 3I73A 4YCWA 2LKVA 2SDFA 2EY2A 2IZ3A 4JI7Q 1FD7D 3F1ZA 1RF2D 1SLJA 1NNXA 2KCNA 2PZTA 3VYRA 3CCLA 3HOUG 1Z02A 1WJJA 4DK1A 1XWEA 3UE0A 3CCEA 4A3LH 4QL5A 1NUCA 4JPBW 2F0FA 4NBEA 1V9PA 4K14A 2Y0SB 3HOXG 3S1RI 4A3MH 4DK6C 3T4NB 4C3HB 5G3LD 4C1NI 2JA8I 2VNUD 3SXHA 3SR1A 5ELDA 1A63A 1TS3A 3MXGA 1A3VA 2CWPA 3E6ZX 3NSWA 1ASZA 1VQNA 1GUOA 3M7NA 2R61A 2D0PA 1HR0L 4OL7A 2IJ0A 3RD4A 5L37A 4A3GH 2HCCA 2GTIA 2V8JA 4LFCQ 5EBCA 3IF8A 1T5EA 3IFUA 2NTTA 1SEBD 4GN5A 3STBD 1GHJA 2AQ2B 5KNBA 3I4NG 4XX2A 4DV6Q 2EYLA 2D62A 1Q81C 3U9OA 4EWCA 2IY5B 1X3ZA 2IV2X 3CC41 4MTKA 2OWOA 1STNA 1EU4A 1Q1EA 4R8IA 1L2FA 2W03A 4IUUA 1F2YA 4HIMA 1GXDC 3KF8A 5IWAL 3F3FC 2IPKD 3VB9A 2CFMA 2OTJ1 3HOXB 5JEAH 1EY4A 4GN3B 4O0AA 2I5MX 1TS2A 4E2WA 4QCLA 4DKAC 1JWSD 1OXSC 3CC4A 1GHKA 3PO3H 2Q8TA 1KRLA 3OIPA 1F9QA 1YEZA 4MTNA 1U5KA 2N88A 1SSOA 4IPGA 1XMQQ 1STAA 4JOIA 1DOMA 1ENCA 4RFBA 2JIRA 1FGUA 4DA2A 1TWCH 3CMAZ 2K04A 1SE3A 2NAPA 3L7ZC 2F0MA 2OTJA 1EIHA 1SYEA 3S1NH 2R92H 4A3FI 3F2BA 3QG1A 3M4PA 2Z6KA 1G291 1S5ED 1Y1VS 3PUXA 4C3IH 4C3HH 1JCKB 4FF2A 2OTL1 4HJ9A 4WFN3 2WINB 4IUPA 1HNZQ 1M1KC 3K7AH 1X6OA 2HD3A 4A93H 4JI2L 2F4MA 5A2QL 1MI2A 3KUPA 2F0SA 5D14A 2WB1B 5E4XA 1ONLA 5FLXL 4OIKA 3VR6A 1STBA 3DMUA 1B9NA 4IPCA 2QEJC 3KBGA 1CSPA 1Y1WH 4A3KI 4OGQC 2EDGA 2A73B 5LHY1 1A6XA 2Z4IA 1PH6A 5FLXc 3M4OB 2G9DA 2AKWB 1PFNA 2LS01 4IFDJ 1D5ZC 2OTLA 4N8X1 5C44B 4A3EI 1RCVD 5IYBG 3JAML 4MD8A 1RJTA 2UXBQ 3J81j 3EERA 1KRSA 1ASYA 1BOSA 1CHPD 3JAMc 3AFQA 4AQYQ 1QVFZ 3GV6A 1Z6HA 1YJW1 2MHVA 3HOUH 4DNIA 3K58A 1YHAA 1YIJ1 2OQ0A 5FKAC 3WOEA 4H13C 1VF5C 2KHJA 2JYOA 4P71A 3KIFA 1YHQ1 2QA4Z 3GTOH 2K01A 2VPYA 3BYYB 2ZTEA 3MXNA 3HOXH 4LF8Q 3HKZA 2BE5D 4CBVA 4E2ZA 4DU9A 5IIFA 2Q8IB 1YJWA 3CRLC 4A3BG 2RDGA 4HTHA 1YIJA 1DGSA 4LF7L 1YNNC 3I56Z 3G48A 5FLXf 3Q23A 4NB8A 1YHQA 3KDFA 4IN3A 5I6YA 4JI3L 4BBRG 1WD1A 2F52A 2FFKB 3M4OI 3ZJYC 5LL6X 1I50H 3A7LA 1E2WA 1HUMA 1TWHI 5DEHA 1N32Q 5C44I 4EQOA 4G57A 1G51A 4OHJA 1FGBD 3JAMf 2MUYA 3I4NH 3CF5A 2NVQB 2KVMA 4R4IA 4PZ6A 4DV3L 4HMIA 1Q821 4HJ5A 3I4MG 1VMCA 1DL6A 1HPCA 4BA2I 1VMPA 3ZYYX 4KK7A 3SVMA 1SN8A 1RQFA 1Z7TA 2K3RA 3RNUA 3H09A 1L1OA 4DGZA 4TRDA 1DJRD 1FVIA 3J80E 3A5UA 2NZHA 4RVGA 3I8ZA 3VTNA 5EPJA 1VQJA 2JA9A 1EZ8A 2UUCL 2K03A 4MNOA 2QKIC 4K8IA 2I3CA 1KNEA 4ZKBB 3J7AF 3FQQA 4IFDI 2WACA 5M3MG 4K6LA 4A3BB 3CCJ1 1QXFA 3I3CA 4L5TA 3OW2Z 1HR0Q 3CKIB 4OO1I 1EY9A 1W2BY 2F0TA 1JJCB 2BA1A 3NTKA 4K5XA 1KQSA 4A4IA 1EWIA 1WTQA 4HSPA 1QVFY 1GOZA 2EIFA 1QNUA 2P5ZX 3RZOH 2AKLA 1N33L 4ZRZA 3GTMH 1HQMC 1O80A 2NVQI 1KC81 4RV9A 3FQMA 4E32A 3CCJA 2UUBQ 1TY2A 5I4DA 3MONA 3NHHA 2FJ2A 2V1CC 4LF9L 3I4MB 1K9M2 4V0BA 2O4XA 3I70A 4ZUIA 4DXFA 2MO1A 3C46A 5IWAQ 4N8FA 2F0NA 1PH9A 2BH8A 5ELNA 3TP8A 1VQ6Z 3VMGA 3KLWA 2KJXA 2OEOA 2IT1A 3W1GA 1OXUA 1EOTA 4GNXB 4XQJA 1X0TA 3PO3S 5FLMG 1A3UA 4O42A 2E2HI 4BY7B 1SMXA 2DY7A 2F0OA 3S2HB 2E2JI 1B2TA 4CDFC 3S1QB 5M3MB 3QR8A 4H7BA 4GN4B 2FHTA 2FMMA 2K50A 1IBKL 4FVMA 1SFOB 1U4MA 2P3YA 2R3ZA 4GNXC 2R93G 1YNXA 1OO9B 2AWNA 4KN7C 1VQLZ 1PYWD 2O5JC 1Q16A 3NBHB 1LQLA 3DWPA 4X65L 1BCPD 1UUPA 4LFBL 3NTIA 2B29A 3GKQA 1Q46A 2KHIA 1W6KA 4A3CG 3CMA1 3IRBA 2R6GA 4DR6L 5CV5A 2NZOA 3CHBD 4JI2Q 1PMRA 3G7LA 1FL0A 3C1FA 4QTUA 4DV1L 1VQ9A 2JA7B 1MGSA 1C0AA 4I7AA 4DR1L 4KHPL 1H9SB 4A3BH 1PLFA 3K6OA 3F3PC 4HAEA 2W04A 2MJ8A 2OOXB 2VPWA 1XYIA 2HF1A 3NXWA 3GTLB 1NJI1 3M85A 3OW2Y 1HCZA 4CJ1B 3TDQA 4K5VA 1Q1BA 1VQCA 1VQEA 1X54A 1EU3A 2PCFB 4OXPA 4J6HA 2O2LD 3CD6Z 3U9SA 3H15A 3ERQA 1XNRL 2A68C 2B2VA 3S2HI 4KY6A 3G6JB 1D8LA 4R4CA 1VQM1 1A8VA 5GQOA 2RCFA 4G7OC 4XDXA 3I4MH 1PTOH 5DM73 1LTRD 4JI5L 1FJGL 3LX0A 4DUZL 2DE6A 4XXEA 3FP9A 1X3QA 1AW7A 1EY7A 4DFAA 2DN8A 1G91A 1I94Q 1D1KA 2IX3A 1VQMA 2KENA 1MJEA 4ZQ3A 4DN4M 1TWAI 5FO7B 4BY7H 2OQKA 1MBYA 3ESWA 1HNXL 4NBHA 2BDNA 4C3JG 3S15B 2XN9C 4LF7Q 3ER0A 3GTQH 1AEXA 3S1QH 1W2BA 5M3MH 1CKNA 4CHTB 1M1K1 3G6EA 4DNRB 4DR5Q 3HOYG 4JI3Q 4X3UA 2RDFA 1FYCA 4C1NK 1SFOH 1TFIA 5DNFA 1NBWA 1GO3E 3GTLI 3LGJA 3NK9A 3BS1A 2B2UC 4A3JG 1L0XB 3CC21 3D9XA 1HUNA 3I561 1WCMI 1FNWA 4DR4Q 4OX9L 1RODA 1VQ8Z 4DV3Q 3K7UC 1TXYA 2B2TC 2AUKA 3L0OA 2F3WA 3K81C 2NVYI 2KQ3A 1GUSA 1NR2A 2PMZE 2WP8J 2F03A 2JA7H 5C5LA 4OEMB 4HGZA 1LTLA 3EROA 1WD0A 3P5JB 5C4XG 1V1PA 1GJXA 3CC2A 1LTID 1CA5A 3I56A 4GLVB 4H0LC 5C4JB 4LF5Q 4NPSA 3EQLC 3HKZG 2EQSA 2DE5A 1VCIA 3LWEA 5J39A 2UUCQ 4J1MA 5T6BA 2EJGC 2RSOA 2ZTDA 4DAVA 4KD3A 1M90C 3HG9A 1LYLA 2K7VA 4X3KA 3J81b 5I6WA 4ZCKA 4X62Q 1WIIA 3S15I 5IP9G 1YVCA 1G6PA 3HOYB 2EGTA 1LT3D 1GUNA 1KD1C 5E3FA 2RSNA 5IT9b 1SXTA 3MVVA 3DXJC 2YYZA 1XJVA 3F2UA 1NR4A 2BJOA 5BN4A 3CXCA 1ENFA 4RGMA 1X3GA 1RTOA 4R4TA 4HMJA 4LF9Q 1QUQA 3BZCA 2EY5A 3NH4A 1F2ZA 2F0WA 2K05A 1HRJA 1IYUA 3FRPB 5M5XB 4A3DI 5LMNW 3K59A 1A2TA 3T51B 3T53B 3GTPB 3OW2A 1QE6A 5C4JI 1E2VA 3CCU1 3BG1B 1IW7C 2NN6H 1K8MA 4TVAB 4MD9A 2JS4A 2PNRC 4JBWA 5A2QE 3CCRZ 3Q6SA 4NKLA 1VQ61 4Z9CB 4CDEC 1A2UA 1GD7A 3OIQA 4CKBA 2Q2UA 5FLXE 2A74C 2LMCB 1ML8A 2EXZA 1I4HA 3MWYW 3PO2G 5AN9F 4HEDA 1L0YB 3QIAA 3MZLB 3CCUA 1CSQA 3D31A 2QDBA 2KI7B 3KJOA 1ILPA 3R2TA 2QLVB 4X65Q 3J80f 4LFBQ 1BF4A 3JAME 3HOWI 2N8NA 4XYQA 2NVTI 1HTLD 1VQ6A 2KCCA 2B2WA 2HIXA 2F4OA 1ZYRD 1UEBA 1B70B 3Q0AA 4S1TA 4AYBA 1VQL1 4DV1Q 4GOPA 1HJPA 2KCTA 1VQ7Z 1V43A 4DR1Q 4KHPQ 1F9SA 5E4WC 1YJNZ 4QIWE 3GTPI 4MONA 3S2DB 3HOYH 3HGBA 4O2DA 3CQZI 1EY0A 4BBSI 2CQOA 3VR3A 1K83B 1B4OA 1SE8A 3VMHA 4R4OA 4B3ML 2OF1A 3WDNA 2WV6D 4IUTA 3M3YH 4M8AA 1K28A 5JEAJ 4KTAA 3H3VH 4B08A 1MSGA 1K8A1 1Y8NB 2XWJB 1I6VC 3X3MA 1AZQA 4XT1B 1N8RC 2D2CC 4A3GB 3OYYA 3GO5A 3NWSA 4HGYA 1RL2A 2WFWA 2D0OA 4DUZQ 3D0FA 1Q7YC 2E2DC 4O1NA 1G2SA 5M5XH 4X6AI 1CKMA 4KKUA 5M9OA 1UAPA 5IE8A 5C4XH 2A69C 5KGUA 1KAWA 4B9XA 1CI3M 2L11A 2ZJPA 4U673 3UDIA 2H4OA 2IHEA 3SGIA 3TEHB 1HNXQ 1SNQA 2JA6B 1NSNS 4A3LI 1KL9A 2LFUA 4RG1A 1SYFA 4JC0A 3I551 2N55A 1KNAA 1XTCD 2EOTA 5IP9H 4A3MI 1Q822 1J6QA 1U4PA 4DPGA 4C2MH 3R3OA 4R4QA 2QILA 4DGLA 5M3FB 4UY8C 3PO3B 1X3EA 2EYMA 2EYJA 1QNKA 4OX9Q 1JE5A 3K5NA 1B1ZA 1B9MA 1ZB8A 1PVOA 3K0XA 3I55A 1TWCB 4K5WA 3MXPA 3NWTA 4R8NA 1XPRA 4A3GI 2KUMA 2Z9HA 2F3IA 2RKSA 3PV0A 5EKKA 4RHRA 2EYOA 1CQFA 4A3FG 3PCOB 3S1NB 2B2YA 2R92B 4CGYB 2PQAA 3CPWY 5T1GA 1DM0B 1VQ81 3CPFA 4DUYL 4IOAA 1K3RA 1PRTD 2XRSD 1NUIA 3S2DH 1AE3A 2KPIA 4MRIA 4C3IB 3QJYA 3K7AB 1K83H 1H9RA 4A93B 2XWBB 3S1MB 1RKNA 1NP6A 1YJ9Z 1Q862 3N6RA 1SIWA 3H0GG 4A3KG 2QDLA 1X9NA 2B63I 1Y1WB 2Q2TA 1VQ8A 4LK1C 1EYCA 2TMPA 1KC82 1O7IA 3PSIA 5FJ8G 2L1BA 3KLRA 1JJ2Y 1JC7A 3PO2H 3K80C 3EIVA 2DUDA 3A54A 4QGUA 4A3EG 2Q2IA 1HTPA 1ZKOA 1KLGD 1XNQL 1IYVA 3N52A 3PO3I 1H9KA 1KHIA 2CH4A 3NP8A 4GLAC 3TQYA 3BYTB 2V8IA 4FF4A 2RCNA 5J3BA 3PUWA 3QOJA 3CU7A 1B44D 1TWCI 2K5HA 3WOFA 3HOUB 1OXXK 5CV4A 1HHVA 1Y14B 2JA6H 3S1NI 3IR7A 2Q4ZA 1QVGZ 2R92I 4DAYA 4ZKCB 4S3SA 3GD7A 3A8JE 3GTOB 1SJED 1DZ1A 1S7MA 4X64Q 2UUAL 4RH6A 3U50C 5C0XG 1RO0A 1EFWA 2F4VL 2JA5G 1HQRD 1UE7A 5AFWA 4DV4L 1EIYB 3K7AI 1N34Q 4CKEA 3GP7A 4QB4A 5M3FH 4A93I 4JYAL 5BR8L 1VQAA 2EJMA 4B3RL 1BUVT 1WW9A 1Q8IA 4HJAA 1EOVA 1S40A 1JWMD 1JOQA 3H0GB 5FK9C 1Y1WI 3DWQA 4GKJL 1LO5D 1ESRA 1AZPA 4PQXA 3OW7A 1BNZA 1I50B 2A6EC 4FXGC 1QYPA 4NBCA 5EGTA 1BQQT 3UE1A 5M5WB 1O7ZA 3BG3A 4UP9A 2R7FA 1CZWA 3I4NB 1JWUD 1X3FA 1KD11 2WAQA 2G5DA 3V2TA 3DLLA 2HT1A 1NJI2 1O7LA 3HOUI 3S1MH 2RVLA 5D1OA 2H85A 1II3A 2RQXA 2ID0A 3U4VA 1FDOA 2MFIA 5KNCA 2KBNA 3Q24A 3GTOI 1GKHA 3IFTA 3K5OA 1K731 1AN8A 1EEFD 3HOXI 1ET6A 4MIUA 4AIMA 4POGA 1CT1D 1JQYD 2MNAA 2XGTA 1IKLA 2NBFA 4Q5VA 4YY3L 4KHZA 1D1IA 1RO2A 1Z01A 3SK8A 1XMOL 1G8ZD 2N78A 3FEWX 1KDCA 4PV1C 1YI2Z 2PQEA 1IW7D 1YIT1 2IX1A 4DF7A 2UU9L 5D3IB 4G7HC 4F7XA 3ONAB 4JI6Q 3I2ZA 3C1EA 5LMNL 4L5SA 3CPWA 1AA6A 4HIDA 3CCQZ 2SEBD 1LTSD 3IFDA 1I50I 2RIQA 1DOLA 1JB3A 4E2XA 4N9PA 1PDQA 3RZOB 4JCVE 1SE4A 3W2DA 4GKKL 4XIGS 2JNYA 3GTMB 1HNWQ 3I4NI 1YITA 1M1K2 1ESFA 1SYGA 1QVGY 1LTTD 3CME1 3G711 3NBIA 3QB3A 3BVZA 4JI4Q 5CV9A 4JBMA 1IHZA 2K75A 1CK1A 3OPOA 3TMEA 3PF5A 1HFGA 5A2Qf 3LUSA 1VQKZ 2K5WA 5D65A 3FMCA 2VUGA 2Z0SA 2C5CA 5JVH3 3H0GH 1JJ2A 1WI5A 2QF7A 1H9MA 1SNCA 4B3TL 3RZDB 3NEMA 2EY1A 3J7A5 5FJ8H 4Y52H 3W1BA 3K57A 3SEBA 3CMEA 3G71A 4RWSC 2VF1A 5M5WH 1VQP1 1EIFA 4KD4A 5AJ3L 3NELA 3AFPA 1O78A 4QUCA 5EBDA 3MA2B 4IQZA 4DR2L 3KFUA 3CCVZ 3JC66 1SRUA 1VQ4Z 5JPNC 5C6AA 4DXGA 2QGQA 1YUKA 4CKCA 1QVCA 1SNDA 3GTKH 3KF6B 4ABNA 1HA6A 3I91A 3RZOI 4OWWB 1VQPA 5CYUA 1VQ5Z 3GTMI 2F3VA 3HZXA 2L9HA 2JQOA 2BH2A 2CW0C 5C0XH 1ICFB 3HOVG 2UXCL 3CAMA 4A3IG 5EKLA 1CTMA 2ES2A 1Q7Y1 2LY7A 2JA5H 1NCVA 1PFSA 2K5VA 5LL6f 2A6HC 1K9MC 3BZDB 1HH2P 3KJPA 2V45A 2LFNA 1PH3A 4C56C 4BBRB 3SK5A 3TZUA 3C3LA 1YJ91 2QRCB 4CJ2C 2VW9A 1XNQQ 1Q861 3GTJH 2FINB 3E9HA 1K8OA 5LMUL 1EQVA 3SDZA 4R9WA 5KYIA 1DONA 4QMGA 3ERSX 4PG3A 2SNSA 1EIGA 1VS0A 4J15A 5IT9L 4NBGA 3GDEA 1PTOB 2L55A 1KRTA 3CC7Z 3BVGA 4OONA 5COYA 5CV7A 1R9TH 1USPA 5IT9c 2PM9A 1YJ9A 2K14A 3BG0B 4YWMA 1Q90A 1YNJC 1TQOA 1X3WA 3T1YL 2AMCB 2MP1A 1WZNA 3RZDH 2PW5A 4DV4Q 2EYHA 2P28A 1PTOC 4EQ5A 4JYAQ 4NH1C 5BR8Q 1EFID 3IX0A 5IYBH 3EN2A 2VL6A 4B3RQ 1H9JA 2RA4A 5IP7G 3QOLA 2UXDL 3OSOA 3MAQA 3GTQB 4A3BI 3T1HL 2X69A 4NB9A 2FXQA 4GKJQ 4FYDA 2E5LL 2NUCA 1TWGH 3T56B 4RA8A 4NFRA 3D4DA 1WCMG 1QVGA 2PMZB 2G9HD 2B39A 4CL1A 2F0JA 3G4SZ 1PTOF 1WOCA 2YTXA 2YU9B 4NXNL 3I4MI 1F9PA 3P20A 1MIUA 5T67A 1Q811 2C35B 4WRDA 2WKCA 3K0YA 5I2XA 1PFMA 2J4XA 1HZBA 2R7ZG 2Y0SA 4IO9A 5A2Qb 3B6YA 1JORA 5EPKA 4AYBE 2JR6A 4BBRH 5FLXb 2DGYA 4JK1C 1K8A2 2YADA 3CMAA 4YY3Q 1F2MA 4HSVA 4Q0FA 3L3OC 2OZKA 1S72Z 5C3EG 1PZJD 2D9UA 4BY7I 4I7ZC 4WJWA 1EY8A 2BOSA 3R8BA 3GTQI 3NFZA 3S1QI 5HGTA 1RTNA 1OXTA 4J8QA 3JAMb 4MXUA 5LMNQ 3RMHA 3TREA 1SFOI 3J81i 1YI21 4KJOA 4QF4A 3OOCA 4L5RC 2R93B 4E31A 1SROA 3KK7A 3UDXA 2Q51A 4BA1I 3CCQ1 2WAQG 3HOVH 3W3AA 4A3IH 4E6IA 2QA41 2JA7I 2QCPX 1IXRA 1T5XD 4TQUS 4RKBA 4HIKA 1R4PB 2FMCA 1K3BC 2E2IB 2M6NA 3VA5A 2R7ZB 4HJ8A 1WTHA 1Y1VG 3KF8B 4LF6L 4B3TQ 1QVFA 3S17B 5I2YA 3CCLZ 1U9RA 2ICIA 3CCQA 3R93A 3CCEZ 1EYGA 1YBYA 1VLAA 4DV2L 3S14H 4MD7A 5C3EB 1ET9A 2JN4A 2MPMA 2QA4A 5AJ3Q 2H1EA 2CQAA 1LT4D 2R6MA 1Q12A 4PMBA 4BY1G 4F87A 2YU9H 3STBC 2PO4A 1JB7A 3MZ5A 2V4DA 3SK4A 4M1UB 1U4LA 1QWYA 2JP1A 2PNHA 3NENA 5A35A 3KIHA 3CCMZ 1S5BD 4P75A 3QO2A 3QWUA 5G3LF 3HOWG 5K36G 4OIJA 1TWFH 2VZAA 4DV7L 3H3VJ 1VQNZ 4FXDA 1CA6A 3AMUA 2UXCQ 4JOIC 3SK6A 3LWUA 1KLUD 4QIWB 4CDDC 1ILQA 5J22A 4KV6A 2WB1A 1R4QB 3NH5A 5FLMH 3F2DA 2VPXA 2O5IC 3CW2C 3HEJA 5IP7H 4JG2A 4C3JB 4HH4A 2Z6KC 4F88A 3F2CA 4I65A 4BBSG 2HUGA 1YNND 2NN6I 2M9VA 2SNMA 2R93H 2CCZA 2ZXPA 4YWLA 2QEXZ 4YCUA 3S9WA 5LMUQ 5K5PA 4A3JB 1X56A 1Y8OB 1N33Q 1JWHC 4E2YA 3GTMS 1IYJB 4UP8A 2RHQB 2VUMG 4EQPA 4BXXG 3M3YB 2JUBA 4EQNA 3U4ZA 4LF4L 3RLNA 1X55A 5D1PA 4A3CH 3EJIA 1I4GA 2K4KA 2TSSA 3CP0A 3J7YW 3V05A 2HCIA 3RN5A 4V190 4X66L 1UE5A 4BY1B 1KXLA 1DD2A 4X3SA 4JI1L 2IL8A 4N9TA 3CC4Z 5EJWA 3SE0A 1TY0A 3MFYA 2E2IH 1I4QA 2CKZB 2R7ZH 5D3DA 3TS0A 5C4XB 5T64A 4OWTB 4GS3A 3H3VC 3S16H 1XPOA 3S17H 3CC71 1TR5A 3MXNB 1M902 1SBBB 3HKZB 2AUJD 4AH6A 3TSSA 2JEBI 2OTJZ 3VMIA 2LXKA 1WTRA 2PZWA 5C3EH 3OTOL 2UXDQ 4IUNA 3T1HQ 4MHEA 2E76C 4ME3A 1QZHA 1OTCA 4RVHA 1IBKQ 3HOZG 1KD12 4ULLA 3KDFB 3HOYI 4FF1A 4C2MB 2J6AA 3FKIG 1S3OA 3A5ZB 3CC7A 4ZAIA 3E3XA 2L0CA 2EXDA 4FXKC 3A56A 2K32A 3MFGA 2Z6BA 2JMOA 3M3YI 4DR6Q 1ZH1A 1XMQL 1K732 1WTOA 2RT9A 2EYFA 2H5XA 3H3VI 2HHHL 1WVLA 1XX8A 4NXNQ 2WIIB 1ML0D 4UHVA 3D8GA 3RLFA 4ILWA 2DNEA 2PZUA 1HFNA 2OTLZ 1P16A 2OT2A 2ENBA 2BE5C 4C3JH 2K33A 2WAQE 4ODGA 1RHPA 3G4S1 3AQQA 5C4XI 2JA8G 1L1OB 1W3SA 1Y1VH 2EY6A 5JAVA 4ME5A 2E8GA 4DAPA 2ASBA 1Z47A 2K52A 4UDUC 1I4XA 4A3JH 3GQBA 4YIJA 1VQLA 1EZ6A 1WJ2A 1DYQA 2O53A 1XNRQ 4R1JA 2K28A 4DR7L 2M2LA 2B63G 2XTIA 2N49A 1L1OC 3CCSZ 1PZKD 4NBBA 3OMGA 2L4NA 2MGSA 5IP9I 4BY1H 1S721 3G4SA 2O4HA 3PO2B 1JR0D 1CHQD 1CQVA 2NZ1D 5JVG3 5HURA 2EVBA 4JI5Q 1FJGQ 3CD61 1XTDA 1YJWZ 2F1MA 4TKOB 1YIJZ 2Q2HA 4LFAL 1NTGA 2GVAA 2KOLA 2I0QA 3EA6A 2CHBD 1YHBA 3BZKA 1I6HH 3D4WA 1PV4A 1N36L 1QF8A 5FO9B 5IODA 1EY6A 1KIXA 3R2IA 1B3QA 2F0VA 1S72A 2HQLA 4FDBA 4RCNA 1GUGA 4JI8L 2GA4B 2AYDA 4KY5A 3CD6A 4K8JA 2Y0SG 5F2DA 3I4LA 2NVXH 3GTGH 3VR2A 3S2DI 1ENAA 4C3HG 2VQFL 4GNXA 3P75A 1VQBA 2JE6I 2BDOA 1SYDA 1K83I 1JICA 1I3QH 3Q22A 4RAUC 2QRDB 4DV2Q 3TS2A 2VY3A 1PHJA 4QQBX 3MEHA 1SR3A 1PYSB 2VUMH 4BXXH 1STGA 1TS5A 3M4QA 3CCL1 2AQ1B 5FOBB 4RGOS 1X3PA 2A68D 4XYOA 3PO2I 1Q7Y2 1D6EC 1UWVA 1KC8C 4KMUC 3NBHA 1I4PA 2MQHA 1N32L 3ITPA 4DV7Q 2ALYB 1IL8A 3VR5A 5BN3A 5DM63 2F4IA 1NMGA 2ICEC 1TS4A 2E7ZA 3AYHB 4L63B 3CCM1 3K5MA 4KI0A 1KQSZ 5IT9E 1EYAA 3URYA 1GM5A 2F0IA 3ULJA 1H9SA 1Y8PB 3P7JA 2JA6I 4KKTA 2LSSA 1B53A 4H44C 4XT3B 1VQN1 1KTKA 4Y7NH 2RBMA 2JIOA 3I72A 2IZ4A 3HOZH 5E7NA 3CCJZ 5CGKA 2KEDA 1BCPB 1D2BA 3FKIH 4HN7A 3V96A 1QG7A 3H6MA 3CCMA 4IUQA 1K0RA 1STYA 2B8GA 2F0EA 1TT2A 3D6CA 2IWHA 4LF4Q 2DJFC 4RGTA 3OMCA 5ELFA 4PZ7A 4P73A 3D2LA 2OCEA 3I4OA 3ULLA 1PH7A 3J80b 4YCVA 2XIWA 3NTHA 4RKLA 2I5HA 4X66Q 2QEX1 2M00A 3AU7A 5M5YB 1BCPC 4JI1Q 3OHXC 1WTVA 1WTPA 4IPHA 4H02A 4RGNA 4A3FB 1A0IA 2XVSA 2V8KA 1B8AA 4PMWA 1E0BA 3S1RH 1PZID 4POFA 1J9OA 4QY7A 1TVXA 4ZUJA 1C8CA 2B2VC 2OOYB 2JA8H 3S24A 5IGCA 4DNTB 2B2UA 2X6LA 4DK0A 2UUBL 2DNCA 4TSSA 3NQIA 2JIMA 2RPRA 3S1MI 2WB1G 1ZEQX 2J7ZA 3OTOQ 2QEXA 5IGDA 1KABA 2QW7A 2V3VA 4GLXA 1NJIC 2B2TA 1J5EL 2K5RA 4NBDA 1VQGA 1VQFA 3EVQA 4FF3A 2B63H 4A3KB 5C0XJ 3OWFA 1CKNB 5GROA 1M901 4XQNA 1LTGD 1SNPA 2E75C 4APVA 4DK3C 5CORA 1BCPF 5C44G 5JJIA 3CCR1 4KY7A 4MZ9A 1VQ9Z 1Q812 1HXYD 1JOKA 2WKDA 3IKJA 1Y8CA 3M7GA 4A3EB 1UNSA 5C4HA 4JV5L 1EYDA 1I5FA 3FPPA 5GAHC 4EX5A 1OXVA 2JIQA 1MHWC 1FNVA 1K8GA 4LJZC 2ZXRA 1F77A 4IPDA 2C9OA 4LMQD 2HHHQ 3NH8A 3UDGA 4B3SL 1JMCA 1B50A 2F0UA 2PYKA 3DM1A 2AHOB 4HCEA 4OWXB 2VQEL 3GTKB 2NB0A 1WFQA 1STHA 2PK7A 4KJNA 4ZLTF 3NQTA 3CCRA 1ZB9A 1KQSY 3E9IA 1V1PB 5J1ZA 3A8KE 5LL6S 4NOZA 4OELB 3E0EA 1VQ71 1E3PA 3C2PA 1S5DD 3VYUA 2JA5B 2Y0SE 4IFDG 1YJN1 3L2PA 4B3MQ 3D3RA 5C3WA 4DR7Q 1DXMA 2N3SA 3ND9A 4OO1G 5IYDG 3H0GI 2E74C 1CUKA 4L6TB 5E1FA 4A75A 1A3TA 4LUZA 3PF4A 5ELEA 5M5YH 1Z03A 1VQMZ 4Y52I 1LT5D 1NY4A 2ZJQA 1VQ7A 1TWHB 2NTSA 4A3FH 1SYBA 3ICEA 3GTJB 1P8LA 2ZJRA 2I46A 4LFAQ 2VB3X 4G7ZC 1YJNA 5H1SE 4UPAA 3CCS1 1W2BZ 1GVPA 1IL2A 1BBUA 2F0LA 4RMFA 3FDTA 3G6EZ 2A1AA 2I07B 3AEVA 4DR3L 1N36Q 2KECA 4RCOA 1ICWA 4AYBG 4MH4A 1WTWA 3P1HA 4IALA 2AWOA 1QUQB 3QWNA 3GTKI 1R9TB 4JI8Q 4CDCC 2K5NA 2GN5A 4HR7B 4JBJA 2NYZD 4A3KH 1UEAB 2L12A 1Z9FA 1BVSA 1M4VA 2VQFQ 1AP0A 3TDHB 3CCSA 2EZVA 1K0SA 5HGQA 3HFZB 3BJUA 4PNYA 5C4ZA 2F0PA 5IGEA 5C0XI 3DUZA 3DM3A 2JA5I 4K2LA 5GAEC 1I94L 4A3EH 2ZM6L 3PIP3 3F8TA 2HQEA 2PI2A 3MC0B 5BN5A 3CC2Z 1W6JA 4DR5L 4A76A 1TWGB 5KIXA 1RD9D 2K6AA 1S5CD 4P72A 5C5MA 4DUYQ 1NAPA 4L8JA 5I9PA 3GTJI 3D6WA 3DWAA 3K8AA 5CMDA 2F0KA 3GV3A 1N8R1 3L9AX 1Q8KA
chains in the Genus database with same CATH topology
4DR4L 4RVDA 3J7A4 1NE3A 3A0JA 1AE2A 5JJLA 1PA6A 1PH8A 3J7ZC 4GOPB 1R9TI 3CXCZ 2RHBA 3PIPA 2A8VA 1L0WA 3RZDI 2WB1E 4LF5L 3M4OH 1UE6A 4XTCS 1HZ9A 1BKBA 1TWHH 1VQHA 4E33A 5C44H 4GOPC 4BY7G 2E9HA 3J81c 4JI0L 4X62L 3W5OA 2B3GA 1TWGI 2RBLA 4RS4A 3EBEA 1VQDA 4HJ7A 2YV5A 1IBML 4IOCA 3JAMi 2UUAQ 2MO0A 2F4VQ 2M48A 2IHFA 2JA7G 3CCUZ 1J5EQ 4WJ4A 5IYDH 3MEFA 2YTYA 1CKOA 1AH9A 4BBRI 3J81f 1T9HA 1QZGA 3PUYA 1K8AC 3FHWA 1MJCA 4JV5Q 1E24A 4UP7A 2VS1A 2NVQH 4NXML 2LXJA 5CM2M 4B3SQ 3TRZA 5IT9f 1VQ91 1VQOZ 4E30A 2QREB 2VQEQ 5IY0A 3A74A 2PQAB 4KLKA 4P74A 2JEAI 1XMOQ 3HOVI 3CXCY 1IBLL 4A3II 4DAMA 2E2HH 2UU9Q 2E2JH 1NMFA 4JBKA 4LWCA 1LM0A 2NN6G 3ULPA 3I07A 1RLYA 1PH5A 1PYBA 4GKKQ 3S14I 4DV0L 4IJHA 4DV5L 1XPUA 1C7YA 4DR3Q 3KOJA 2YU9I 1HZCA 2YTVA 4YWKA 2IX0A 1YI2A 4A3DG 3UDFA 1HR0W 3G6E1 4DAYB 1IZ6A 1TWFI 5HY6A 2RF4A 3I55Z 1VQK1 2JJQA 2ZM6Q 1A62A 5FLMI 3I7FA 3M9BA 3MZKB 4DR2Q 4PZ8A 5IP7I 3S2HH 4LNQA 1BBWA 3PGZA 2BA0A 3KYHC 4K0KL 1YZ6A 2GVBA 2R93I 4YHHL 1VQKA 2GTHA 1PH2A 3CCV1 2QKDA 2GU2A 3U58A 1VQ41 3PIOA 4JI7L 1PFTA 4A3CI 3RN2A 2QR1B 1TWAH 3Q87A 1VQ51 5D1OB 5IYCG 3NDJA 2E2II 1UE1A 2R7ZI 3CCVA 4LUOA 3BU2A 3S16I 3S17I 1VQ4A 3GTLH 1LUZA 1JJGA 4DQYB 4JI0Q 5JJKA 5DLQE 5C3EI 1WCMH 1E7ZA 2HIVA 1MKHA 1VQ5A 1E1TA 2NVYH 2A19A 3EEDA 4LFCL 1E22A 1D7QA 1IBMQ 3WWVA 3T1YQ 4DV6L 1PH1A 2G2KA 3J80c 3Q8DA 4A3LG 1K73C 1C9OA 2R7DA 3S15H 2E5LQ 4A3MG 1E1OA 3GCFA 2JK8A 3RR5A 4HIOA 1Y1VI 4X64L 5GAGC 1VQIA 1K9M1 4QTTA 3VDYA 4RVFA 4A3JI 1N34L 1EUJA 1H95A 2CWAA 1B7YB 4NXMQ 2RHSB 4TNUA 2I5LX 4LW1A 5GADC 4A3GG 4BY1I 1EQRA 4WJ3M 3KF6A 3PUZA 1YUAA 1RNIA 1N2FA 4IJLA 4A3DH 4NBAA 5C4JH 1VQO1 1JT8A 1I6HI 1IBLQ 3CPWZ 1HNZL 3PUVA 2JA6G 4LUVA 2ATWA 1RO4A 2NVXI 4NBFA 1YITZ 3GTGI 3RLOA 5JEAG 1WYDA 1U0LA 1VQOA 1Q82C 5M3FG 1I3QI 3PO3G 4DV0Q 2L15A 1N9WA 3HOWH 2UXBL 4DV5Q 1YHQZ 1JJ2Z 2NVTH 2VUMI 4BXXI 4ALPA 2KCMA 4AQYL 1RIPA 4JI6L 2HU9A 1X65A 3CMEZ 3NDIA 1P9NA 3G71Z 1EQQA 2R92G 1HZAA 1USPB 3J80i 5IYCH 2DE7A 4LF6Q 3GTPH 1V1QA 1HNWL 3CQZH 4LF8L 2ZAEB 4BBSH 5EAYA 5ELOA 4A93G 4JI4L 4QJFA 1Y1WG 4Y7NI 3HKZE 1N8R2 3TE5B 1Q86C 1VQPZ 4L5QA 3CCE1 4K0KQ 3HOZI 2ZTCA 4YHHQ 3FKII 2PI2E 3HKSA 1PH4A 2PMZA 4X6AH 4NB3A 2LIYA 4YCWA 2IZ3A 4JI7Q 3F1ZA 1SLJA 3CCLA 3HOUG 1Z02A 1WJJA 4DK1A 3UE0A 3CCEA 4A3LH 4QL5A 4NBEA 1V9PA 3HOXG 3S1RI 4A3MH 4DK6C 3T4NB 2JA8I 2VNUD 1A63A 2CWPA 1ASZA 1VQNA 3M7NA 2D0PA 1HR0L 4A3GH 2GTIA 2V8JA 4LFCQ 3IF8A 3IFUA 4GN5A 3STBD 3I4NG 4XX2A 4DV6Q 1Q81C 2D62A 4EWCA 2IY5B 1X3ZA 3CC41 2OWOA 1Q1EA 1L2FA 2W03A 4HIMA 5IWAL 3F3FC 3VB9A 2CFMA 2OTJ1 4GN3B 4O0AA 2I5MX 4E2WA 4DKAC 1OXSC 3CC4A 3PO3H 1KRLA 1YEZA 4MTNA 1U5KA 4IPGA 1XMQQ 4JOIA 1FGUA 1TWCH 3CMAZ 3L7ZC 2OTJA 3S1NH 2R92H 4A3FI 3F2BA 3M4PA 2Z6KA 1G291 1Y1VS 3PUXA 4C3IH 4C3HH 2OTL1 4HJ9A 1HNZQ 1M1KC 3K7AH 1X6OA 4A93H 4JI2L 2F4MA 4IPCA 1CSPA 1Y1WH 4A3KI 1PH6A 5FLXc 2AKWB 4IFDJ 2OTLA 4A3EI 5IYBG 4MD8A 2UXBQ 3J81j 3EERA 1KRSA 1ASYA 3JAMc 3AFQA 4AQYQ 1QVFZ 1YJW1 3HOUH 4DNIA 1YHAA 1YIJ1 2OQ0A 2KHJA 4P71A 3KIFA 1YHQ1 2QA4Z 3GTOH 2ZTEA 3HOXH 4LF8Q 3HKZA 4E2ZA 1YJWA 4A3BG 1YIJA 1DGSA 4LF7L 3I56Z 3G48A 5FLXf 4NB8A 1YHQA 3KDFA 4JI3L 4BBRG 2F52A 3M4OI 3ZJYC 1I50H 1TWHI 1N32Q 5C44I 1G51A 3JAMf 3I4NH 3CF5A 4R4IA 4PZ6A 4DV3L 1Q821 4HJ5A 3I4MG 1DL6A 4BA2I 1SN8A 1RQFA 2K3RA 3RNUA 1L1OA 1FVIA 3A5UA 2NZHA 4RVGA 3VTNA 1VQJA 2JA9A 2UUCL 4MNOA 2I3CA 4IFDI 3FQQA 5M3MG 3CCJ1 4L5TA 3OW2Z 1HR0Q 4OO1I 1W2BY 1JJCB 2BA1A 1KQSA 4A4IA 1EWIA 1QVFY 2EIFA 3RZOH 2AKLA 1N33L 3GTMH 2NVQI 1KC81 4RV9A 3FQMA 4E32A 3CCJA 2UUBQ 3MONA 2V1CC 4LF9L 1K9M2 2MO1A 5IWAQ 1PH9A 2BH8A 5ELNA 1VQ6Z 3VMGA 3KLWA 2IT1A 3W1GA 1OXUA 4GNXB 1X0TA 3PO3S 5FLMG 2E2HI 1SMXA 2E2JI 4GN4B 2K50A 1IBKL 4GNXC 2P3YA 2R93G 1YNXA 2AWNA 1VQLZ 3NBHB 1LQLA 4X65L 4LFBL 2B29A 3GKQA 1Q46A 2KHIA 4A3CG 3CMA1 3IRBA 2R6GA 4DR6L 2NZOA 4JI2Q 1FL0A 4QTUA 4DV1L 1VQ9A 1C0AA 4DR1L 4KHPL 4A3BH 3F3PC 2W04A 2OOXB 2HF1A 1NJI1 3M85A 3OW2Y 1Q1BA 1VQCA 1VQEA 1X54A 4OXPA 3CD6Z 3H15A 1XNRL 3S2HI 1D8LA 4R4CA 1VQM1 1A8VA 5GQOA 3I4MH 4JI5L 1FJGL 4DUZL 2DE6A 3FP9A 1I94Q 1VQMA 2KENA 1MJEA 1TWAI 4BY7H 2OQKA 1HNXL 3ESWA 4NBHA 4LF7Q 3ER0A 3GTQH 3S1QH 1W2BA 5M3MH 1CKNA 1M1K1 3G6EA 4DR5Q 3HOYG 4JI3Q 1SFOH 1TFIA 1NBWA 1GO3E 3GTLI 3LGJA 4A3JG 3CC21 3D9XA 3I561 1WCMI 4DR4Q 4OX9L 1VQ8Z 4DV3Q 3K7UC 1TXYA 3L0OA 3K81C 2NVYI 2PMZE 2WP8J 2JA7H 4HGZA 1LTLA 3P5JB 5C4XG 3CC2A 3I56A 4GLVB 4LF5Q 4NPSA 3HKZG 2EQSA 2DE5A 1VCIA 2UUCQ 5T6BA 2ZTDA 1M90C 1LYLA 3J81b 4X62Q 1WIIA 3S15I 5IP9G 1YVCA 1G6PA 2EGTA 1KD1C 5IT9b 2YYZA 1XJVA 2BJOA 3CXCA 1X3GA 4R4TA 4LF9Q 1QUQA 3BZCA 3NH4A 4A3DI 5LMNW 3OW2A 5C4JI 3CCU1 3BG1B 4TVAB 4MD9A 2JS4A 4JBWA 3CCRZ 1VQ61 1GD7A 2Q2UA 1ML8A 3PO2G 5AN9F 3MZLB 3CCUA 1CSQA 3D31A 2KI7B 3KJOA 2QLVB 4X65Q 3J80f 4LFBQ 3HOWI 2N8NA 2NVTI 1VQ6A 2HIXA 2F4OA 1UEBA 1B70B 4S1TA 4AYBA 1VQL1 4DV1Q 4GOPA 1HJPA 2KCTA 1VQ7Z 1V43A 4DR1Q 4KHPQ 1YJNZ 4QIWE 3GTPI 4MONA 3HOYH 4O2DA 3CQZI 4BBSI 2CQOA 1SE8A 3VMHA 4R4OA 4B3ML 3M3YH 5JEAJ 3H3VH 1K8A1 1N8RC 3OYYA 3GO5A 4HGYA 1RL2A 2WFWA 2D0OA 4DUZQ 3D0FA 1Q7YC 5M5XH 4X6AI 1CKMA 5IE8A 5C4XH 1KAWA 2ZJPA 3UDIA 2IHEA 3SGIA 3TEHB 1HNXQ 4A3LI 1KL9A 2LFUA 4RG1A 4JC0A 3I551 5IP9H 4A3MI 1Q822 1J6QA 4DPGA 4C2MH 4R4QA 4DGLA 4UY8C 1X3EA 4OX9Q 1JE5A 1ZB8A 1PVOA 3K0XA 3I55A 1XPRA 4A3GI 3PV0A 2F3IA 4A3FG 3PCOB 2PQAA 3CPWY 1VQ81 3CPFA 4DUYL 4IOAA 1K3RA 1NUIA 3S2DH 1AE3A 2KPIA 4MRIA 1K83H 1NP6A 1YJ9Z 1Q862 3H0GG 4A3KG 1X9NA 2B63I 2Q2TA 1VQ8A 1KC82 1O7IA 3PSIA 5FJ8G 1JJ2Y 3PO2H 3K80C 3EIVA 2DUDA 4QGUA 4A3EG 2Q2IA 1XNQL 3PO3I 1KHIA 4GLAC 3TQYA 2V8IA 2RCNA 5J3BA 3PUWA 1TWCI 2K5HA 1OXXK 1Y14B 2JA6H 3S1NI 2R92I 2Q4ZA 1QVGZ 3GD7A 1S7MA 4X64Q 2UUAL 3U50C 5C0XG 1RO0A 1EFWA 2F4VL 2JA5G 1UE7A 4DV4L 1EIYB 3K7AI 1N34Q 4JYAL 5M3FH 4A93I 5BR8L 1VQAA 4B3RL 1WW9A 4HJAA 1EOVA 1S40A 1Y1WI 4GKJL 1QYPA 4NBCA 3UE1A 4UP9A 2R7FA 1X3FA 1KD11 2WAQA 3DLLA 2HT1A 1NJI2 3HOUI 3S1MH 5D1OA 2H85A 2ID0A 3U4VA 2MFIA 2KBNA 3GTOI 1GKHA 1K731 3HOXI 4POGA 4AIMA 2MNAA 2XGTA 4YY3L 4KHZA 1RO2A 1Z01A 1XMOL 2N78A 1YI2Z 1YIT1 2IX1A 2UU9L 4JI6Q 3I2ZA 5LMNL 4L5SA 3CPWA 4HIDA 3CCQZ 1I50I 2RIQA 4E2XA 4JCVE 4GKKL 4XIGS 2JNYA 1HNWQ 3I4NI 1YITA 1M1K2 1QVGY 3CME1 3G711 4JI4Q 4JBMA 2K75A 3PF5A 5A2Qf 3LUSA 1VQKZ 2VUGA 2Z0SA 3H0GH 1JJ2A 1WI5A 4B3TL 3NEMA 3J7A5 5FJ8H 4Y52H 3W1BA 3CMEA 3G71A 2VF1A 5M5WH 1VQP1 1EIFA 5AJ3L 3NELA 3AFPA 4DR2L 3KFUA 3CCVZ 3JC66 1SRUA 1VQ4Z 2QGQA 1YUKA 1QVCA 3GTKH 3KF6B 3RZOI 4OWWB 1VQPA 1VQ5Z 3GTMI 2JQOA 2BH2A 3HOVG 2UXCL 3CAMA 4A3IG 2ES2A 1Q7Y1 2JA5H 1PFSA 2K5VA 5LL6f 1K9MC 1HH2P 3KJPA 1PH3A 1YJ91 2QRCB 2VW9A 1XNQQ 1Q861 3GTJH 3E9HA 5LMUL 3ERSX 4PG3A 1VS0A 4J15A 4NBGA 3GDEA 1KRTA 3CC7Z 4OONA 1R9TH 1USPA 5IT9c 2PM9A 1YJ9A 2K14A 3BG0B 4YWMA 1X3WA 3T1YL 2AMCB 3RZDH 4DV4Q 2P28A 4EQ5A 4JYAQ 4NH1C 5BR8Q 3IX0A 5IYBH 3EN2A 2VL6A 4B3RQ 5IP7G 2UXDL 4A3BI 3T1HL 4NB9A 2FXQA 4GKJQ 2E5LL 1TWGH 4NFRA 1WCMG 1QVGA 4CL1A 3G4SZ 1WOCA 2YTXA 4NXNL 3I4MI 1MIUA 5T67A 1Q811 2C35B 1HZBA 2R7ZG 2Y0SA 4IO9A 5A2Qb 3B6YA 4AYBE 2JR6A 4BBRH 5FLXb 2DGYA 1K8A2 2YADA 3CMAA 4YY3Q 2OZKA 1S72Z 5C3EG 4BY7I 3GTQI 3NFZA 3S1QI 1OXTA 3JAMb 4MXUA 5LMNQ 3TREA 1SFOI 3J81i 1YI21 4L5RC 4E31A 1SROA 3UDXA 2Q51A 4BA1I 3CCQ1 2WAQG 3HOVH 4A3IH 2QA41 2JA7I 1IXRA 4TQUS 4HIKA 2M6NA 4HJ8A 1Y1VG 3KF8B 4LF6L 4B3TQ 1QVFA 3CCLZ 3CCQA 3CCEZ 1EYGA 1YBYA 1VLAA 4DV2L 3S14H 4MD7A 2QA4A 5AJ3Q 2R6MA 1Q12A 4BY1G 2YU9H 3STBC 1JB7A 2PNHA 3NENA 3KIHA 3CCMZ 4P75A 3QWUA 3HOWG 5K36G 1TWFH 2VZAA 4DV7L 3H3VJ 1VQNZ 2UXCQ 4JOIC 2WB1A 3NH5A 5FLMH 3F2DA 3CW2C 5IP7H 4JG2A 4HH4A 2Z6KC 3F2CA 4BBSG 2NN6I 2R93H 2CCZA 4YWLA 2QEXZ 4YCUA 5LMUQ 1X56A 1N33Q 1JWHC 4E2YA 3GTMS 1IYJB 4UP8A 2RHQB 2VUMG 4BXXG 2JUBA 4LF4L 3U4ZA 3RLNA 1X55A 5D1PA 4A3CH 2K4KA 3CP0A 3RN5A 1KXLA 4X66L 1UE5A 4JI1L 3CC4Z 2E2IH 2CKZB 2R7ZH 3TS0A 5T64A 4OWTB 4GS3A 3S16H 1XPOA 3S17H 3CC71 3MXNB 1M902 4AH6A 2JEBI 2OTJZ 3VMIA 2LXKA 5C3EH 3OTOL 2UXDQ 3T1HQ 4ME3A 1QZHA 1OTCA 4RVHA 1IBKQ 3HOZG 1KD12 3KDFB 3HOYI 2J6AA 3FKIG 1S3OA 3A5ZB 3CC7A 2EXDA 4DR6Q 2JMOA 3M3YI 1ZH1A 1XMQL 1K732 2RT9A 2H5XA 3H3VI 2HHHL 4NXNQ 3RLFA 2OTLZ 1P16A 4C3JH 2WAQE 3G4S1 3AQQA 5C4XI 2JA8G 1L1OB 1W3SA 1Y1VH 2E8GA 2ASBA 1Z47A 2K52A 4A3JH 1VQLA 2O53A 1XNRQ 4R1JA 4DR7L 2B63G 2XTIA 2N49A 1L1OC 3CCSZ 4NBBA 5IP9I 4BY1H 1S721 3G4SA 2O4HA 4JI5Q 1FJGQ 3CD61 1XTDA 1YJWZ 1YIJZ 2Q2HA 4LFAL 1NTGA 2GVAA 2I0QA 1YHBA 3BZKA 1I6HH 1PV4A 1N36L 1QF8A 1KIXA 1S72A 2HQLA 4FDBA 4JI8L 3CD6A 2Y0SG 2NVXH 3GTGH 3S2DI 2VQFL 4GNXA 1VQBA 2JE6I 1K83I 1I3QH 2QRDB 4DV2Q 3TS2A 2VY3A 1PHJA 4QQBX 1SR3A 1PYSB 2VUMH 4BXXH 3M4QA 3CCL1 3PO2I 1Q7Y2 1UWVA 1KC8C 2MQHA 1N32L 4DV7Q 2ALYB 1NMGA 3AYHB 3CCM1 4KI0A 1KQSZ 1GM5A 3ULJA 2JA6I 2LSSA 1VQN1 4Y7NH 2IZ4A 3HOZH 5E7NA 3CCJZ 3FKIH 3CCMA 1K0RA 4LF4Q 4PZ7A 4P73A 2OCEA 3I4OA 3ULLA 1PH7A 3J80b 4YCVA 2I5HA 4X66Q 2QEX1 4JI1Q 4IPHA 4H02A 1A0IA 2V8KA 1B8AA 4PMWA 3S1RH 4POFA 4QY7A 2OOYB 2JA8H 3S24A 2UUBL 2RPRA 3S1MI 2WB1G 3OTOQ 2QEXA 4GLXA 1NJIC 1J5EL 2K5RA 4NBDA 1VQGA 1VQFA 2B63H 5C0XJ 1CKNB 5GROA 1M901 4APVA 4DK3C 5C44G 5JJIA 3CCR1 4MZ9A 1VQ9Z 1Q812 4JV5L 1I5FA 5GAHC 4EX5A 1OXVA 1K8GA 4IPDA 2HHHQ 3NH8A 3UDGA 4B3SL 1JMCA 4OWXB 2VQEL 2AHOB 1WFQA 2PK7A 3CCRA 1ZB9A 1KQSY 3E9IA 4NOZA 3E0EA 1VQ71 1E3PA 2Y0SE 4IFDG 1YJN1 3L2PA 4B3MQ 4DR7Q 2N3SA 4OO1G 5IYDG 3H0GI 1CUKA 4A75A 4LUZA 3PF4A 5M5YH 1Z03A 1VQMZ 4Y52I 1NY4A 2ZJQA 1VQ7A 4A3FH 3ICEA 1P8LA 2ZJRA 4LFAQ 1YJNA 5H1SE 4UPAA 3CCS1 1W2BZ 1GVPA 1IL2A 1BBUA 4RMFA 3G6EZ 2A1AA 3AEVA 4DR3L 1N36Q 4AYBG 4MH4A 2AWOA 1QUQB 3GTKI 4JI8Q 2K5NA 2GN5A 4JBJA 4A3KH 1Z9FA 1BVSA 2VQFQ 3TDHB 3CCSA 5HGQA 3HFZB 3BJUA 5C0XI 3DM3A 2JA5I 5GAEC 1I94L 4A3EH 2ZM6L 3F8TA 2PI2A 3CC2Z 4DR5L 4A76A 4P72A 4DUYQ 3GTJI 3D6WA 3K8AA 1N8R1 1Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 L;  1NE3 A;  3A0J A;  1AE2 A;  5JJL A;  1PA6 A;  1PH8 A;  3J7Z C;  4GOP B;  1R9T I;  3PIP A;  2A8V A;  1L0W A;  3RZD I;  2WB1 E;  4LF5 L;  3M4O H;  1UE6 A;  4XTC S;  1HZ9 A;  1BKB A;  1TWH H;  1VQH A;  5C44 H;  4BY7 G;  4GOP C;  3J81 c;  4JI0 L;  4X62 L;  3W5O A;  2B3G A;  1TWG I;  2RBL A;  3EBE A;  1VQD A;  4HJ7 A;  2YV5 A;  1IBM L;  4IOC A;  3JAM i;  2UUA Q;  2MO0 A;  2F4V Q;  2IHF A;  2JA7 G;  1J5E Q;  4WJ4 A;  5IYD H;  3MEF A;  2YTY A;  1CKO A;  1AH9 A;  4BBR I;  1T9H A;  1QZG A;  3PUY A;  1K8A C;  3FHW A;  1MJC A;  4JV5 Q;  1E24 A;  4UP7 A;  2VS1 A;  2NVQ H;  4NXM L;  2LXJ A;  5CM2 M;  4B3S Q;  3TRZ A;  2VQE Q;  5IY0 A;  3A74 A;  2PQA B;  4KLK A;  4P74 A;  2JEA I;  1XMO Q;  3HOV I;  1IBL L;  4A3I I;  4DAM A;  2E2H H;  2UU9 Q;  2E2J H;  1NMF A;  4JBK A;  4LWC A;  1LM0 A;  2NN6 G;  3ULP A;  3I07 A;  1RLY A;  1PH5 A;  1PYB A;  4GKK Q;  3S14 I;  4DV0 L;  4IJH A;  4DV5 L;  1XPU A;  1C7Y A;  4DR3 Q;  3KOJ A;  2YU9 I;  1HZC A;  2YTV A;  4YWK A;  2IX0 A;  1YI2 A;  4A3D G;  3UDF A;  1HR0 W;  4DAY B;  1IZ6 A;  1TWF I;  5HY6 A;  2RF4 A;  2JJQ A;  2ZM6 Q;  1A62 A;  5FLM I;  3I7F A;  3M9B A;  4DR2 Q;  4PZ8 A;  5IP7 I;  3S2H H;  4LNQ A;  1BBW A;  3PGZ A;  2BA0 A;  3KYH C;  4K0K L;  1YZ6 A;  2GVB A;  2R93 I;  4YHH L;  1VQK A;  1PH2 A;  3U58 A;  3PIO A;  4JI7 L;  1PFT A;  4A3C I;  3RN2 A;  1TWA H;  3Q87 A;  5IYC G;  2E2I I;  1UE1 A;  2R7Z I;  3CCV A;  4LUO A;  3BU2 A;  3S16 I;  3S17 I;  1VQ4 A;  3GTL H;  1LUZ A;  1JJG A;  4JI0 Q;  5JJK A;  5DLQ E;  5C3E I;  1WCM H;  1E7Z A;  2HIV A;  1MKH A;  1VQ5 A;  1E1T A;  2NVY H;  2A19 A;  4LFC L;  1E22 A;  1D7Q A;  1IBM Q;  3WWV A;  3T1Y Q;  4DV6 L;  1PH1 A;  3J80 c;  3Q8D A;  4A3L G;  1K73 C;  1C9O A;  2R7D A;  3S15 H;  2E5L Q;  4A3M G;  1E1O A;  3GCF A;  2JK8 A;  3RR5 A;  4HIO A;  1Y1V I;  4X64 L;  5GAG C;  1VQI A;  4QTT A;  3VDY A;  4A3J I;  1N34 L;  1EUJ A;  1H95 A;  2CWA A;  1B7Y B;  4NXM Q;  2RHS B;  2I5L X;  4LW1 A;  5GAD C;  4A3G G;  4BY1 I;  1EQR A;  4WJ3 M;  3KF6 A;  3PUZ A;  1YUA A;  1N2F A;  4IJL A;  4A3D H;  4NBA A;  5C4J H;  1JT8 A;  1I6H I;  1IBL Q;  1HNZ L;  3PUV A;  2JA6 G;  4LUV A;  2ATW A;  1RO4 A;  2NVX I;  4NBF A;  3GTG I;  3RLO A;  5JEA G;  1WYD A;  1U0L A;  1VQO A;  1Q82 C;  5M3F G;  1I3Q I;  3PO3 G;  4DV0 Q;  2L15 A;  1N9W A;  3HOW H;  2UXB L;  4DV5 Q;  2NVT H;  2VUM I;  4BXX I;  4ALP A;  2KCM A;  4AQY L;  1RIP A;  4JI6 L;  1X65 A;  1EQQ A;  2R92 G;  1HZA A;  1USP B;  3J80 i;  5IYC H;  2DE7 A;  4LF6 Q;  3GTP H;  1V1Q A;  1HNW L;  3CQZ H;  4LF8 L;  4BBS H;  5EAY A;  5ELO A;  4A93 G;  4JI4 L;  4QJF A;  1Y1W G;  4Y7N I;  3HKZ E;  1Q86 C;  4L5Q A;  4K0K Q;  3HOZ I;  2ZTC A;  4YHH Q;  3FKI I;  2PI2 E;  3HKS A;  1PH4 A;  4X6A H;  4NB3 A;  4YCW A;  4JI7 Q;  3F1Z A;  1SLJ A;  3CCL A;  3HOU G;  1WJJ A;  3UE0 A;  3CCE A;  4A3L H;  4QL5 A;  4NBE A;  1V9P A;  3HOX G;  3S1R I;  4A3M H;  4DK6 C;  2JA8 I;  2VNU D;  1A63 A;  2CWP A;  1ASZ A;  1VQN A;  3M7N A;  2D0P A;  1HR0 L;  4A3G H;  4LFC Q;  4GN5 A;  3STB D;  3I4N G;  4XX2 A;  4DV6 Q;  1Q81 C;  2D62 A;  2IY5 B;  1X3Z A;  2OWO A;  1Q1E A;  1L2F A;  4HIM A;  5IWA L;  3VB9 A;  2CFM A;  4GN3 B;  4O0A A;  2I5M X;  4DKA C;  1OXS C;  3CC4 A;  3PO3 H;  1YEZ A;  4MTN A;  1U5K A;  4IPG A;  1XMQ Q;  4JOI A;  1FGU A;  1TWC H;  3L7Z C;  2OTJ A;  3S1N H;  2R92 H;  4A3F I;  3F2B A;  3M4P A;  2Z6K A;  1G29 1;  1Y1V S;  3PUX A;  4C3I H;  4C3H H;  4HJ9 A;  1HNZ Q;  1M1K C;  3K7A H;  1X6O A;  4A93 H;  4JI2 L;  2F4M A;  4IPC A;  1CSP A;  1Y1W H;  4A3K I;  1PH6 A;  5FLX c;  2AKW B;  4IFD J;  2OTL A;  4A3E I;  5IYB G;  2UXB Q;  3J81 j;  3EER A;  1KRS A;  1ASY A;  3JAM c;  3AFQ A;  4AQY Q;  3HOU H;  4DNI A;  1YHA A;  2OQ0 A;  2KHJ A;  4P71 A;  3GTO H;  2ZTE A;  3HOX H;  4LF8 Q;  1YJW A;  4A3B G;  1YIJ A;  1DGS A;  4LF7 L;  3G48 A;  4NB8 A;  1YHQ A;  3KDF A;  4JI3 L;  4BBR G;  2F52 A;  3M4O I;  3ZJY C;  1I50 H;  1TWH I;  1N32 Q;  5C44 I;  1G51 A;  3I4N H;  3CF5 A;  4R4I A;  4PZ6 A;  4DV3 L;  4HJ5 A;  3I4M G;  1DL6 A;  4BA2 I;  1SN8 A;  3RNU A;  1L1O A;  1FVI A;  3A5U A;  2NZH A;  1VQJ A;  2JA9 A;  2UUC L;  4MNO A;  4IFD I;  5M3M G;  4L5T A;  1HR0 Q;  4OO1 I;  1JJC B;  2BA1 A;  1KQS A;  4A4I A;  1EWI A;  2EIF A;  3RZO H;  2AKL A;  1N33 L;  3GTM H;  2NVQ I;  3CCJ A;  2UUB Q;  2V1C C;  4LF9 L;  2MO1 A;  5IWA Q;  1PH9 A;  2BH8 A;  5ELN A;  3KLW A;  3VMG A;  2IT1 A;  3W1G A;  1OXU A;  4GNX B;  3PO3 S;  5FLM G;  2E2H I;  1SMX A;  2E2J I;  4GN4 B;  2K50 A;  1IBK L;  4GNX C;  2P3Y A;  2R93 G;  1YNX A;  2AWN A;  3NBH B;  1LQL A;  4X65 L;  4LFB L;  2B29 A;  3GKQ A;  1Q46 A;  2KHI A;  4A3C G;  3IRB A;  2R6G A;  4DR6 L;  2NZO A;  4JI2 Q;  1FL0 A;  4QTU A;  4DV1 L;  1VQ9 A;  1C0A A;  4DR1 L;  4KHP L;  4A3B H;  2HF1 A;  3M85 A;  1Q1B A;  1VQC A;  1VQE A;  1X54 A;  4OXP A;  3H15 A;  1XNR L;  3S2H I;  1D8L A;  4R4C A;  1A8V A;  5GQO A;  3I4M H;  4JI5 L;  1FJG L;  4DUZ L;  2DE6 A;  3FP9 A;  1I94 Q;  1VQM A;  2KEN A;  1MJE A;  1TWA I;  4BY7 H;  2OQK A;  1HNX L;  3ESW A;  4NBH A;  4LF7 Q;  3ER0 A;  3GTQ H;  3S1Q H;  1W2B A;  5M3M H;  1CKN A;  3G6E A;  4DR5 Q;  3HOY G;  4JI3 Q;  1SFO H;  1TFI A;  1NBW A;  1GO3 E;  3GTL I;  3LGJ A;  4A3J G;  1WCM I;  4DR4 Q;  4OX9 L;  4DV3 Q;  3K7U C;  1TXY A;  3L0O A;  3K81 C;  2NVY I;  2PMZ E;  2WP8 J;  2JA7 H;  1LTL A;  5C4X G;  3CC2 A;  3I56 A;  4GLV B;  4LF5 Q;  4NPS A;  3HKZ G;  2EQS A;  2DE5 A;  1VCI A;  2UUC Q;  2ZTD A;  1M90 C;  1LYL A;  4X62 Q;  3S15 I;  5IP9 G;  1YVC A;  1G6P A;  1KD1 C;  2YYZ A;  1XJV A;  2BJO A;  3CXC A;  1X3G A;  4R4T A;  4LF9 Q;  1QUQ A;  3BZC A;  4A3D I;  5LMN W;  3OW2 A;  5C4J I;  4TVA B;  2JS4 A;  4JBW A;  1GD7 A;  2Q2U A;  1ML8 A;  3PO2 G;  3CCU A;  1CSQ A;  3D31 A;  3KJO A;  4X65 Q;  4LFB Q;  3HOW I;  2N8N A;  2NVT I;  1VQ6 A;  2HIX A;  2F4O A;  1UEB A;  1B70 B;  4DV1 Q;  4GOP A;  1HJP A;  2KCT A;  1V43 A;  4DR1 Q;  4KHP Q;  4QIW E;  3GTP I;  3HOY H;  4O2D A;  3CQZ I;  4BBS I;  2CQO A;  1SE8 A;  3VMH A;  4R4O A;  4B3M L;  3M3Y H;  5JEA J;  3H3V H;  1N8R C;  3OYY A;  3GO5 A;  1RL2 A;  2WFW A;  2D0O A;  4DUZ Q;  3D0F A;  1Q7Y C;  5M5X H;  4X6A I;  1CKM A;  5IE8 A;  5C4X H;  1KAW A;  2ZJP A;  3UDI A;  2IHE A;  3SGI A;  3TEH B;  1HNX Q;  4A3L I;  1KL9 A;  4RG1 A;  4JC0 A;  5IP9 H;  4A3M I;  1J6Q A;  4DPG A;  4C2M H;  4R4Q A;  4UY8 C;  1X3E A;  4OX9 Q;  1JE5 A;  1ZB8 A;  1PVO A;  3K0X A;  3I55 A;  1XPR A;  4A3G I;  3PV0 A;  2F3I A;  4A3F G;  3PCO B;  2PQA A;  3CPF A;  4DUY L;  4IOA A;  1K3R A;  1NUI A;  3S2D H;  1AE3 A;  2KPI A;  1K83 H;  3H0G G;  4A3K G;  1X9N A;  2B63 I;  2Q2T A;  1VQ8 A;  1O7I A;  3PSI A;  5FJ8 G;  3PO2 H;  3K80 C;  3EIV A;  2DUD A;  4QGU A;  4A3E G;  2Q2I A;  1XNQ L;  3PO3 I;  1KHI A;  4GLA C;  3TQY A;  2RCN A;  5J3B A;  3PUW A;  1TWC I;  2K5H A;  1OXX K;  1Y14 B;  2JA6 H;  3S1N I;  2R92 I;  3GD7 A;  4X64 Q;  2UUA L;  3U50 C;  5C0X G;  1EFW A;  2F4V L;  2JA5 G;  1UE7 A;  4DV4 L;  1EIY B;  3K7A I;  1N34 Q;  4JYA L;  5M3F H;  4A93 I;  5BR8 L;  1VQA A;  4B3R L;  1WW9 A;  4HJA A;  1EOV A;  1S40 A;  1Y1W I;  4GKJ L;  1QYP A;  4NBC A;  3UE1 A;  4UP9 A;  2R7F A;  1X3F A;  3DLL A;  2HT1 A;  3HOU I;  3S1M H;  2ID0 A;  3U4V A;  2MFI A;  2KBN A;  3GTO I;  1GKH A;  3HOX I;  4POG A;  4AIM A;  2MNA A;  2XGT A;  4YY3 L;  4KHZ A;  1XMO L;  2N78 A;  2IX1 A;  2UU9 L;  4JI6 Q;  3I2Z A;  5LMN L;  4L5S A;  3CPW A;  4HID A;  1I50 I;  4JCV E;  4GKK L;  4XIG S;  2JNY A;  1HNW Q;  3I4N I;  1YIT A;  4JI4 Q;  4JBM A;  2K75 A;  3PF5 A;  3LUS A;  2Z0S A;  3H0G H;  1JJ2 A;  1WI5 A;  4B3T L;  3NEM A;  3J7A 5;  5FJ8 H;  4Y52 H;  3W1B A;  3CME A;  3G71 A;  5M5W H;  1EIF A;  5AJ3 L;  3NEL A;  3AFP A;  4DR2 L;  3KFU A;  3JC6 6;  1SRU A;  2QGQ A;  1QVC A;  3GTK H;  3KF6 B;  3RZO I;  4OWW B;  1VQP A;  3GTM I;  2JQO A;  2BH2 A;  3HOV G;  2UXC L;  3CAM A;  4A3I G;  2ES2 A;  2JA5 H;  1PFS A;  2K5V A;  1K9M C;  1HH2 P;  3KJP A;  1PH3 A;  2VW9 A;  1XNQ Q;  3GTJ H;  3E9H A;  5LMU L;  3ERS X;  4PG3 A;  1VS0 A;  4J15 A;  4NBG A;  3GDE A;  1KRT A;  4OON A;  1R9T H;  1USP A;  5IT9 c;  1YJ9 A;  2K14 A;  4YWM A;  1X3W A;  3T1Y L;  2AMC B;  3RZD H;  4DV4 Q;  4EQ5 A;  4JYA Q;  5BR8 Q;  5IYB H;  3EN2 A;  2VL6 A;  4B3R Q;  5IP7 G;  2UXD L;  4A3B I;  3T1H L;  4NB9 A;  2FXQ A;  4GKJ Q;  2E5L L;  1TWG H;  1WCM G;  1QVG A;  1WOC A;  2YTX A;  4NXN L;  3I4M I;  1MIU A;  2C35 B;  1HZB A;  2R7Z G;  4IO9 A;  3B6Y A;  4AYB E;  2JR6 A;  4BBR H;  2DGY A;  3CMA A;  4YY3 Q;  5C3E G;  4BY7 I;  3GTQ I;  3S1Q I;  1OXT A;  5LMN Q;  3TRE A;  1SFO I;  3J81 i;  4L5R C;  1SRO A;  3UDX A;  4BA1 I;  2WAQ G;  3HOV H;  4A3I H;  2JA7 I;  1IXR A;  4TQU S;  4HIK A;  4HJ8 A;  1Y1V G;  3KF8 B;  4LF6 L;  4B3T Q;  1QVF A;  3CCQ A;  1EYG A;  1YBY A;  1VLA A;  4DV2 L;  3S14 H;  2QA4 A;  5AJ3 Q;  1Q12 A;  4BY1 G;  2YU9 H;  3STB C;  1JB7 A;  2PNH A;  3NEN A;  4P75 A;  3HOW G;  5K36 G;  1TWF H;  2VZA A;  4DV7 L;  3H3V J;  2UXC Q;  4JOI C;  5FLM H;  3F2D A;  3CW2 C;  5IP7 H;  4JG2 A;  2Z6K C;  3F2C A;  4BBS G;  2NN6 I;  2R93 H;  2CCZ A;  4YWL A;  4YCU A;  5LMU Q;  1X56 A;  1N33 Q;  3GTM S;  1IYJ B;  4UP8 A;  2RHQ B;  2VUM G;  4BXX G;  4LF4 L;  3U4Z A;  3RLN A;  1X55 A;  4A3C H;  2K4K A;  3CP0 A;  3RN5 A;  1KXL A;  4X66 L;  1UE5 A;  4JI1 L;  2E2I H;  2CKZ B;  2R7Z H;  3TS0 A;  4OWT B;  4GS3 A;  3S16 H;  1XPO A;  3S17 H;  3MXN B;  4AH6 A;  2JEB I;  2LXK A;  3VMI A;  5C3E H;  3OTO L;  2UXD Q;  3T1H Q;  4ME3 A;  1QZH A;  1OTC A;  3HOZ G;  1IBK Q;  3KDF B;  3HOY I;  2J6A A;  3FKI G;  1S3O A;  3A5Z B;  3CC7 A;  2EXD A;  4DR6 Q;  3M3Y I;  1XMQ L;  2H5X A;  3H3V I;  2HHH L;  4NXN Q;  3RLF A;  1P16 A;  4C3J H;  2WAQ E;  3AQQ A;  2JA8 G;  5C4X I;  1L1O B;  1W3S A;  1Y1V H;  2E8G A;  2ASB A;  1Z47 A;  2K52 A;  4A3J H;  1VQL A;  1XNR Q;  4R1J A;  4DR7 L;  2B63 G;  2XTI A;  2N49 A;  1L1O C;  4NBB A;  5IP9 I;  4BY1 H;  3G4S A;  4JI5 Q;  1FJG Q;  1XTD A;  4LFA L;  2Q2H A;  1NTG A;  2GVA A;  2I0Q A;  1YHB A;  3BZK A;  1I6H H;  1PV4 A;  1N36 L;  1KIX A;  1S72 A;  2HQL A;  4FDB A;  4JI8 L;  3CD6 A;  2Y0S G;  2NVX H;  3GTG H;  3S2D I;  2VQF L;  4GNX A;  1VQB A;  2JE6 I;  1I3Q H;  1K83 I;  4DV2 Q;  3TS2 A;  2VY3 A;  1PHJ A;  4QQB X;  1SR3 A;  1PYS B;  2VUM H;  4BXX H;  3M4Q A;  3PO2 I;  1UWV A;  1KC8 C;  2MQH A;  1N32 L;  4DV7 Q;  2ALY B;  1NMG A;  3AYH B;  4KI0 A;  1GM5 A;  3ULJ A;  2JA6 I;  2LSS A;  4Y7N H;  3HOZ H;  5E7N A;  3FKI H;  3CCM A;  1K0R A;  4LF4 Q;  4PZ7 A;  4P73 A;  2OCE A;  3I4O A;  3ULL A;  1PH7 A;  4YCV A;  2I5H A;  4X66 Q;  4JI1 Q;  4IPH A;  4H02 A;  1A0I A;  1B8A A;  4PMW A;  3S1R H;  4POF A;  4QY7 A;  2JA8 H;  3S24 A;  2UUB L;  3S1M I;  2WB1 G;  3OTO Q;  2QEX A;  4GLX A;  1NJI C;  1J5E L;  2K5R A;  4NBD A;  1VQG A;  1VQF A;  2B63 H;  5C0X J;  1CKN B;  5GRO A;  4APV A;  4DK3 C;  5C44 G;  5JJI A;  4MZ9 A;  4JV5 L;  1I5F A;  5GAH C;  4EX5 A;  1OXV A;  1K8G A;  4IPD A;  2HHH Q;  3UDG A;  4B3S L;  1JMC A;  4OWX B;  2VQE L;  2AHO B;  1WFQ A;  2PK7 A;  3CCR A;  1ZB9 A;  3E9I A;  4NOZ A;  3E0E A;  1E3P A;  2Y0S E;  4IFD G;  3L2P A;  4B3M Q;  4DR7 Q;  2N3S A;  4OO1 G;  5IYD G;  3H0G I;  1CUK A;  4A75 A;  4LUZ A;  3PF4 A;  5M5Y H;  2ZJQ A;  4Y52 I;  1NY4 A;  1VQ7 A;  4A3F H;  3ICE A;  1P8L A;  2ZJR A;  4LFA Q;  1YJN A;  5H1S E;  4UPA A;  1GVP A;  1IL2 A;  1BBU A;  4RMF A;  2A1A A;  3AEV A;  4DR3 L;  1N36 Q;  4AYB G;  4MH4 A;  2AWO A;  1QUQ B;  3GTK I;  4JI8 Q;  2K5N A;  2GN5 A;  4JBJ A;  4A3K H;  1Z9F A;  1BVS A;  2VQF Q;  3CCS A;  5HGQ A;  3HFZ B;  3BJU A;  5C0X I;  3DM3 A;  2JA5 I;  5GAE C;  1I94 L;  4A3E H;  2ZM6 L;  3F8T A;  2PI2 A;  4DR5 L;  4A76 A;  4P72 A;  4DUY Q;  3GTJ I;  3D6W A;  3K8A A;  1Q8K A; 
#chains in the Genus database with same CATH topology
 4JW0 A;  4DR4 L;  4RVD A;  3J7A 4;  1NE3 A;  2IW3 A;  3A0J A;  4WOR A;  1BR9 A;  1AE2 A;  1D5X C;  5JJL A;  1PA6 A;  1PH8 A;  3E0J A;  1CM9 A;  3MHB A;  2A69 D;  4AYB B;  3J7Z C;  4GOP B;  5CV8 A;  3UI2 A;  3O13 A;  1R9T I;  1VF7 A;  5CC4 A;  3CXC Z;  2F0Q A;  2RHB A;  3PIP A;  3J81 L;  2A8V A;  1L0W A;  1QOH A;  3RZD I;  2WB1 E;  4LF5 L;  3M4O H;  1UE6 A;  4XTC S;  2B2W C;  3X3N A;  1HZ9 A;  2XSC A;  1BKB A;  1TWH H;  1VQH A;  2Z1C A;  3FPU B;  1EEI D;  4E33 A;  5C44 H;  4GOP C;  5KRU A;  4BY7 G;  3HRZ C;  2E9H A;  2E2H B;  3J81 c;  4JI0 L;  4FO2 A;  1CZG A;  3BDO A;  2E2J B;  4X62 L;  1J8I A;  3TBI B;  3EFX D;  3W5O A;  2B3G A;  2VB2 X;  1LAB A;  1TWG I;  4ZYS A;  2RBL A;  3DEP A;  3BVM A;  4IUR A;  3K5L A;  3SHL A;  4RS4 A;  1VDZ A;  3EBE A;  1VQD A;  4HJ7 A;  1LTB D;  2YV5 A;  5CBE E;  1IBM L;  1ZYR C;  3KLS A;  3JAM i;  4IOC A;  2UUA Q;  1TU2 B;  2MO0 A;  2F4V Q;  1MSH A;  2M48 A;  1DOK A;  2EJF C;  2A5H A;  5T1I A;  3HOV B;  3T16 A;  2IHF A;  5DAU A;  4A3I B;  4GZY C;  2JA7 G;  5EQ0 A;  3CCU Z;  3VYS A;  2K1B A;  4IFD H;  5KEE A;  1SE2 A;  2ZT9 C;  1J5E Q;  1Q3L A;  1BBX C;  3TP7 A;  4WJ4 A;  2KHS A;  4OO1 H;  4ZK9 B;  5IYD H;  5CBA E;  4MN3 A;  5IGG A;  1G2T A;  3MEF A;  2YTY A;  1CKO A;  1AH9 A;  1BO0 A;  1FR3 A;  4BBR I;  1D5M C;  3J81 f;  1SDF A;  1JOO A;  1T9H A;  1QZG A;  3PUY A;  3S14 B;  1K8A C;  3FHW A;  1MJC A;  1XXG A;  4JV5 Q;  1HA5 A;  1E24 A;  3AB9 A;  4UP7 A;  2VS1 A;  1SMY C;  2NVQ H;  4NXM L;  4NMZ A;  2LXJ A;  5FO8 B;  5CM2 M;  4B3S Q;  3TRZ A;  5IT9 f;  1VQ9 1;  1VQO Z;  4E30 A;  2QRE B;  2CVR A;  2VQE Q;  3VA7 A;  3D4R A;  5IY0 A;  3A74 A;  4BWG B;  2PQA B;  1TWF B;  4KLK A;  4LAA A;  4U68 A;  3KLS X;  4P74 A;  1C4Q A;  1BDO A;  2JEA I;  1XMO Q;  3HOV I;  3PQI A;  3CXC Y;  1EWC A;  1IBL L;  4A3I I;  1TWA B;  4DAM A;  2E2H H;  2UU9 Q;  2B2Y C;  5NUC A;  2E2J H;  1TKW B;  3TZD A;  1NMF A;  4JBK A;  5JJZ A;  4LWC A;  1LM0 A;  2NN6 G;  1F2L A;  1PRT B;  3ULP A;  3I07 A;  1RLY A;  3KBX A;  1PYB A;  1PH5 A;  4GKK Q;  3S14 I;  3VR4 A;  4DV0 L;  4IJH A;  1WCM B;  1LV9 A;  2A6E D;  4DV5 L;  1FDI A;  1KDA A;  1AFP A;  2HDM A;  1XPU A;  1C7Y A;  4DR3 Q;  1O7Y A;  2NVY B;  1G6Z A;  3KOJ A;  2YU9 I;  1SJH D;  2KA7 A;  1HZC A;  1LTA D;  2YTV A;  1PRT C;  1I4R A;  4YWK A;  2IX0 A;  1YI2 A;  3PMF A;  3PIO 3;  4A3D G;  1M8A A;  3UDF A;  1HR0 W;  3TN2 A;  1A15 A;  3G6E 1;  4DAY B;  1IZ6 A;  4NP5 A;  2KEE A;  3TP6 A;  1TWF I;  4NDX A;  5HY6 A;  1FNU A;  1RDP D;  3MXU A;  3S16 B;  2RF4 A;  5IGB A;  3I55 Z;  1VQK 1;  1KDB A;  2JJQ A;  4P2C B;  1DCZ A;  2SOB A;  2ZM6 Q;  4F8M A;  1A62 A;  5EKI A;  5FLM I;  4K6D A;  3I7F A;  3M9B A;  1EWH A;  2Z4H A;  2F0G A;  3I90 A;  3MZK B;  4XQQ A;  4DR2 Q;  4PZ8 A;  5IP7 I;  3S2H H;  4LNQ A;  2B8F A;  1BBW A;  3PGZ A;  2BA0 A;  3KYH C;  3BDC A;  1SNM A;  4K0K L;  1YZ6 A;  1PRT F;  2GVB A;  4RHS A;  2R93 I;  4YHH L;  1VQK A;  2GTH A;  1SAP A;  4IUV A;  1PH2 A;  3CCV 1;  2QKD A;  4IZ8 A;  2GU2 A;  3U58 A;  1VQ4 1;  4HCS A;  3PIO A;  3IAY A;  4JI7 L;  1PFT A;  1JE4 A;  4A3C I;  2WAQ B;  3RN2 A;  2QR1 B;  1TWA H;  1S5F D;  3Q87 A;  3M4Y A;  1VQ5 1;  5D1O B;  5IYC G;  3NDJ A;  2E2I I;  1UE1 A;  2CH4 W;  2R7Z I;  5CV6 A;  1WTX A;  4A3D B;  3HS0 C;  3J7A V;  1B3A A;  3CCV A;  4LUO A;  1Y1V B;  3BU2 A;  2K5D A;  3S16 I;  3S17 I;  1VQ4 A;  3GTL H;  1LUZ A;  4EGV A;  1JJG A;  2DY8 A;  4DQY B;  4JI0 Q;  5JJK A;  5DLQ E;  5C3E I;  1WCM H;  1E7Z A;  2HIV A;  1MKH A;  1VQ5 A;  4G4K A;  1E1T A;  2NVY H;  2ZXO A;  2EE1 A;  1SNO A;  2EYP A;  3H94 A;  2AQ3 B;  1QIL A;  2PPB C;  2A19 A;  3EED A;  2JXM B;  4LFC L;  1E22 A;  5EPL A;  1D7Q A;  3J80 L;  1IBM Q;  3WWV A;  3T1Y Q;  2K5Q A;  3HOW B;  4DV6 L;  1GUT A;  1PH1 A;  2NVT B;  2F0H A;  3OWE B;  3A8I E;  2LEX A;  2G2K A;  1I6H B;  3J80 c;  2RDH A;  1V8Q A;  3BDL A;  3DEO A;  3T13 A;  3E5S A;  5ELB A;  3Q8D A;  4A3L G;  1K73 C;  1S4Z A;  2F0D A;  2CW0 D;  1C9O A;  2R7D A;  3S15 H;  2L5T A;  1U4R A;  5KND A;  1QCB D;  3NPP A;  2E5L Q;  2NVX B;  1EL0 A;  3GTG B;  4A3M G;  3H91 A;  1E1O A;  3GCF A;  5JPM C;  2JK8 A;  3RR5 A;  4EVO A;  2HDL A;  4HIO A;  1Y1V I;  2A6H D;  4X64 L;  3CQZ B;  5GAG C;  4BBS B;  1VQI A;  1K9M 1;  1I3Q B;  4QTT A;  3VDY A;  4RVF A;  4A3J I;  2Q8R E;  5CR3 A;  1N34 L;  1EUJ A;  5I9O A;  1H95 A;  3HP3 A;  5ISR A;  3CRK C;  2CWA A;  1B7Y B;  1STE A;  4NXM Q;  2RHS B;  4TNU A;  3FVQ A;  2VUM B;  2I5L X;  4LW1 A;  5GAD C;  3LNN A;  2XRQ D;  4A3G G;  4BY1 I;  2BCO A;  1EQR A;  4WJ3 M;  3TP5 A;  3KF6 A;  2X6G A;  3PUZ A;  1YUA A;  1RNI A;  1N2F A;  4IJL A;  5JOB A;  4CJ0 B;  2EPB A;  1F9R A;  4KHV A;  3T4A C;  4A3D H;  1TII D;  4UAI A;  4NBA A;  1PFB A;  5C4J H;  1MD2 D;  1PXU A;  2NWG A;  2DJG C;  1VQO 1;  3A7A B;  1JT8 A;  1I6H I;  1YNJ D;  1IBL Q;  3CPW Z;  1HNZ L;  3PUV A;  5IGF A;  2PW7 A;  2JA6 G;  4LUV A;  2ATW A;  1PTO D;  1E2Z A;  1RO4 A;  1KAA A;  4Y7N B;  1X32 A;  5IOC A;  1BXT A;  4B9W A;  4BS9 A;  2NVX I;  4NBF A;  1YIT Z;  3GTG I;  2J0T D;  3RLO A;  5JEA G;  3HOZ B;  4A3M B;  2Z8L A;  1Y69 U;  1LT6 D;  4FP5 D;  2JSO A;  5KYL A;  1WYD A;  1U0L A;  4K2K A;  1VQO A;  3FKI B;  5M3F G;  1I3Q I;  1Q82 C;  3PO3 G;  4PMC A;  4X3T A;  4DV0 Q;  1CFM A;  2L15 A;  1IKM A;  1N9W A;  3HOW H;  5K36 H;  2UXB L;  4DV5 Q;  3A55 A;  1YHQ Z;  1JJ2 Z;  2NVT H;  2VUM I;  4BXX I;  1LLR D;  4ALP A;  2KCM A;  4AQY L;  1RIP A;  1SYC A;  1ZXT A;  4ID6 A;  4JI6 L;  1GUW A;  2HU9 A;  1C48 A;  1SMY D;  1X65 A;  2VXW A;  3DHQ A;  5TSS A;  3CME Z;  3NDI A;  1P9N A;  3G71 Z;  4KN4 C;  1EQQ A;  2R92 G;  1HZA A;  1LAC A;  1QB5 D;  1EQT A;  1USP B;  3J80 i;  4QUF A;  5ELC A;  2DE7 A;  3IL8 A;  5IYC H;  2JIP A;  3S1R B;  4LF6 Q;  3GTP H;  4C3I G;  2OXP A;  1V1Q A;  1HNW L;  3CQZ H;  2D5D A;  2ZAE B;  1V1O A;  4LF8 L;  2JA8 B;  5EAY A;  1EY5 A;  4BBS H;  5ELO A;  4A93 G;  3NUC A;  4JI4 L;  4JVZ A;  4QJF A;  3NE5 B;  3MTS A;  4KKS A;  3VYT A;  4FNF A;  3ND8 A;  2VPZ A;  1Y1W G;  4Y7N I;  3HKZ E;  1N8R 2;  2B63 B;  3TE5 B;  1Q86 C;  1VQP Z;  4L5Q A;  4NW2 A;  3CCE 1;  4K0K Q;  3HOZ I;  3RUZ A;  2ZTC A;  3J81 E;  4YHH Q;  2XNA C;  3FKI I;  2PI2 E;  3HKS A;  1PH4 A;  2PMZ A;  5C3X A;  4X6A H;  4NB3 A;  1QJO A;  2LIY A;  3I73 A;  4YCW A;  2LKV A;  2SDF A;  2EY2 A;  2IZ3 A;  4JI7 Q;  1FD7 D;  3F1Z A;  1RF2 D;  1SLJ A;  1NNX A;  2KCN A;  2PZT A;  3VYR A;  3CCL A;  3HOU G;  1Z02 A;  1WJJ A;  4DK1 A;  1XWE A;  3UE0 A;  3CCE A;  4A3L H;  4QL5 A;  1NUC A;  4JPB W;  2F0F A;  4NBE A;  1V9P A;  4K14 A;  2Y0S B;  3HOX G;  3S1R I;  4A3M H;  4DK6 C;  3T4N B;  4C3H B;  5G3L D;  4C1N I;  2JA8 I;  2VNU D;  3SXH A;  3SR1 A;  5ELD A;  1A63 A;  1TS3 A;  3MXG A;  1A3V A;  2CWP A;  3E6Z X;  3NSW A;  1ASZ A;  1VQN A;  1GUO A;  3M7N A;  2R61 A;  2D0P A;  1HR0 L;  4OL7 A;  2IJ0 A;  3RD4 A;  5L37 A;  4A3G H;  2HCC A;  2GTI A;  2V8J A;  4LFC Q;  5EBC A;  3IF8 A;  1T5E A;  3IFU A;  2NTT A;  1SEB D;  4GN5 A;  3STB D;  1GHJ A;  2AQ2 B;  5KNB A;  3I4N G;  4XX2 A;  4DV6 Q;  2EYL A;  2D62 A;  1Q81 C;  3U9O A;  4EWC A;  2IY5 B;  1X3Z A;  2IV2 X;  3CC4 1;  4MTK A;  2OWO A;  1STN A;  1EU4 A;  1Q1E A;  4R8I A;  1L2F A;  2W03 A;  4IUU A;  1F2Y A;  4HIM A;  1GXD C;  3KF8 A;  5IWA L;  3F3F C;  2IPK D;  3VB9 A;  2CFM A;  2OTJ 1;  3HOX B;  5JEA H;  1EY4 A;  4GN3 B;  4O0A A;  2I5M X;  1TS2 A;  4E2W A;  4QCL A;  4DKA C;  1JWS D;  1OXS C;  3CC4 A;  1GHK A;  3PO3 H;  2Q8T A;  1KRL A;  3OIP A;  1F9Q A;  1YEZ A;  4MTN A;  1U5K A;  2N88 A;  1SSO A;  4IPG A;  1XMQ Q;  1STA A;  4JOI A;  1DOM A;  1ENC A;  4RFB A;  2JIR A;  1FGU A;  4DA2 A;  1TWC H;  3CMA Z;  2K04 A;  1SE3 A;  2NAP A;  3L7Z C;  2F0M A;  2OTJ A;  1EIH A;  1SYE A;  3S1N H;  2R92 H;  4A3F I;  3F2B A;  3QG1 A;  3M4P A;  2Z6K A;  1G29 1;  1S5E D;  1Y1V S;  3PUX A;  4C3I H;  4C3H H;  1JCK B;  4FF2 A;  2OTL 1;  4HJ9 A;  4WFN 3;  2WIN B;  4IUP A;  1HNZ Q;  1M1K C;  3K7A H;  1X6O A;  2HD3 A;  4A93 H;  4JI2 L;  2F4M A;  5A2Q L;  1MI2 A;  3KUP A;  2F0S A;  5D14 A;  2WB1 B;  5E4X A;  1ONL A;  5FLX L;  4OIK A;  3VR6 A;  1STB A;  3DMU A;  1B9N A;  4IPC A;  2QEJ C;  3KBG A;  1CSP A;  1Y1W H;  4A3K I;  4OGQ C;  2EDG A;  2A73 B;  5LHY 1;  1A6X A;  2Z4I A;  1PH6 A;  5FLX c;  3M4O B;  2G9D A;  2AKW B;  1PFN A;  2LS0 1;  4IFD J;  1D5Z C;  2OTL A;  4N8X 1;  5C44 B;  4A3E I;  1RCV D;  5IYB G;  3JAM L;  4MD8 A;  1RJT A;  2UXB Q;  3J81 j;  3EER A;  1KRS A;  1ASY A;  1BOS A;  1CHP D;  3JAM c;  3AFQ A;  4AQY Q;  1QVF Z;  3GV6 A;  1Z6H A;  1YJW 1;  2MHV A;  3HOU H;  4DNI A;  3K58 A;  1YHA A;  1YIJ 1;  2OQ0 A;  5FKA C;  3WOE A;  4H13 C;  1VF5 C;  2KHJ A;  2JYO A;  4P71 A;  3KIF A;  1YHQ 1;  2QA4 Z;  3GTO H;  2K01 A;  2VPY A;  3BYY B;  2ZTE A;  3MXN A;  3HOX H;  4LF8 Q;  3HKZ A;  2BE5 D;  4CBV A;  4E2Z A;  4DU9 A;  5IIF A;  2Q8I B;  1YJW A;  3CRL C;  4A3B G;  2RDG A;  4HTH A;  1YIJ A;  1DGS A;  4LF7 L;  1YNN C;  3I56 Z;  3G48 A;  5FLX f;  3Q23 A;  4NB8 A;  1YHQ A;  3KDF A;  4IN3 A;  5I6Y A;  4JI3 L;  4BBR G;  1WD1 A;  2F52 A;  2FFK B;  3M4O I;  3ZJY C;  5LL6 X;  1I50 H;  3A7L A;  1E2W A;  1HUM A;  1TWH I;  5DEH A;  1N32 Q;  5C44 I;  4EQO A;  4G57 A;  1G51 A;  4OHJ A;  1FGB D;  3JAM f;  2MUY A;  3I4N H;  3CF5 A;  2NVQ B;  2KVM A;  4R4I A;  4PZ6 A;  4DV3 L;  4HMI A;  1Q82 1;  4HJ5 A;  3I4M G;  1VMC A;  1DL6 A;  1HPC A;  4BA2 I;  1VMP A;  3ZYY X;  4KK7 A;  3SVM A;  1SN8 A;  1RQF A;  1Z7T A;  2K3R A;  3RNU A;  3H09 A;  1L1O A;  4DGZ A;  4TRD A;  1DJR D;  1FVI A;  3J80 E;  3A5U A;  2NZH A;  4RVG A;  3I8Z A;  3VTN A;  5EPJ A;  1VQJ A;  2JA9 A;  1EZ8 A;  2UUC L;  2K03 A;  4MNO A;  2QKI C;  4K8I A;  2I3C A;  1KNE A;  4ZKB B;  3J7A F;  3FQQ A;  4IFD I;  2WAC A;  5M3M G;  4K6L A;  4A3B B;  3CCJ 1;  1QXF A;  3I3C A;  4L5T A;  3OW2 Z;  1HR0 Q;  3CKI B;  4OO1 I;  1EY9 A;  1W2B Y;  2F0T A;  1JJC B;  2BA1 A;  3NTK A;  4K5X A;  1KQS A;  4A4I A;  1EWI A;  1WTQ A;  4HSP A;  1QVF Y;  1GOZ A;  2EIF A;  1QNU A;  2P5Z X;  3RZO H;  2AKL A;  1N33 L;  4ZRZ A;  3GTM H;  1HQM C;  1O80 A;  2NVQ I;  1KC8 1;  4RV9 A;  3FQM A;  4E32 A;  3CCJ A;  2UUB Q;  1TY2 A;  5I4D A;  3MON A;  3NHH A;  2FJ2 A;  2V1C C;  4LF9 L;  3I4M B;  1K9M 2;  4V0B A;  2O4X A;  3I70 A;  4ZUI A;  4DXF A;  2MO1 A;  3C46 A;  5IWA Q;  4N8F A;  2F0N A;  1PH9 A;  2BH8 A;  5ELN A;  3TP8 A;  1VQ6 Z;  3VMG A;  3KLW A;  2KJX A;  2OEO A;  2IT1 A;  3W1G A;  1OXU A;  1EOT A;  4GNX B;  4XQJ A;  1X0T A;  3PO3 S;  5FLM G;  1A3U A;  4O42 A;  2E2H I;  4BY7 B;  1SMX A;  2DY7 A;  2F0O A;  3S2H B;  2E2J I;  1B2T A;  4CDF C;  3S1Q B;  5M3M B;  3QR8 A;  4H7B A;  4GN4 B;  2FHT A;  2FMM A;  2K50 A;  1IBK L;  4FVM A;  1SFO B;  1U4M A;  2P3Y A;  2R3Z A;  4GNX C;  2R93 G;  1YNX A;  1OO9 B;  2AWN A;  4KN7 C;  1VQL Z;  1PYW D;  2O5J C;  1Q16 A;  3NBH B;  1LQL A;  3DWP A;  4X65 L;  1BCP D;  1UUP A;  4LFB L;  3NTI A;  2B29 A;  3GKQ A;  1Q46 A;  2KHI A;  1W6K A;  4A3C G;  3CMA 1;  3IRB A;  2R6G A;  4DR6 L;  5CV5 A;  2NZO A;  3CHB D;  4JI2 Q;  1PMR A;  3G7L A;  1FL0 A;  3C1F A;  4QTU A;  4DV1 L;  1VQ9 A;  2JA7 B;  1MGS A;  1C0A A;  4I7A A;  4DR1 L;  4KHP L;  1H9S B;  4A3B H;  1PLF A;  3K6O A;  3F3P C;  4HAE A;  2W04 A;  2MJ8 A;  2OOX B;  2VPW A;  1XYI A;  2HF1 A;  3NXW A;  3GTL B;  1NJI 1;  3M85 A;  3OW2 Y;  1HCZ A;  4CJ1 B;  3TDQ A;  4K5V A;  1Q1B A;  1VQC A;  1VQE A;  1X54 A;  1EU3 A;  2PCF B;  4OXP A;  4J6H A;  2O2L D;  3CD6 Z;  3U9S A;  3H15 A;  3ERQ A;  1XNR L;  2A68 C;  2B2V A;  3S2H I;  4KY6 A;  3G6J B;  1D8L A;  4R4C A;  1VQM 1;  1A8V A;  5GQO A;  2RCF A;  4G7O C;  4XDX A;  3I4M H;  1PTO H;  5DM7 3;  1LTR D;  4JI5 L;  1FJG L;  3LX0 A;  4DUZ L;  2DE6 A;  4XXE A;  3FP9 A;  1X3Q A;  1AW7 A;  1EY7 A;  4DFA A;  2DN8 A;  1G91 A;  1I94 Q;  1D1K A;  2IX3 A;  1VQM A;  2KEN A;  1MJE A;  4ZQ3 A;  4DN4 M;  1TWA I;  5FO7 B;  4BY7 H;  2OQK A;  1MBY A;  3ESW A;  1HNX L;  4NBH A;  2BDN A;  4C3J G;  3S15 B;  2XN9 C;  4LF7 Q;  3ER0 A;  3GTQ H;  1AEX A;  3S1Q H;  1W2B A;  5M3M H;  1CKN A;  4CHT B;  1M1K 1;  3G6E A;  4DNR B;  4DR5 Q;  3HOY G;  4JI3 Q;  4X3U A;  2RDF A;  1FYC A;  4C1N K;  1SFO H;  1TFI A;  5DNF A;  1NBW A;  1GO3 E;  3GTL I;  3LGJ A;  3NK9 A;  3BS1 A;  2B2U C;  4A3J G;  1L0X B;  3CC2 1;  3D9X A;  1HUN A;  3I56 1;  1WCM I;  1FNW A;  4DR4 Q;  4OX9 L;  1ROD A;  1VQ8 Z;  4DV3 Q;  3K7U C;  1TXY A;  2B2T C;  2AUK A;  3L0O A;  2F3W A;  3K81 C;  2NVY I;  2KQ3 A;  1GUS A;  1NR2 A;  2PMZ E;  2WP8 J;  2F03 A;  2JA7 H;  5C5L A;  4OEM B;  4HGZ A;  1LTL A;  3ERO A;  1WD0 A;  3P5J B;  5C4X G;  1V1P A;  1GJX A;  3CC2 A;  1LTI D;  1CA5 A;  3I56 A;  4GLV B;  4H0L C;  5C4J B;  4LF5 Q;  4NPS A;  3EQL C;  3HKZ G;  2EQS A;  2DE5 A;  1VCI A;  3LWE A;  5J39 A;  2UUC Q;  4J1M A;  5T6B A;  2EJG C;  2RSO A;  2ZTD A;  4DAV A;  4KD3 A;  1M90 C;  3HG9 A;  1LYL A;  2K7V A;  4X3K A;  3J81 b;  5I6W A;  4ZCK A;  4X62 Q;  1WII A;  3S15 I;  5IP9 G;  1YVC A;  1G6P A;  3HOY B;  2EGT A;  1LT3 D;  1GUN A;  1KD1 C;  5E3F A;  2RSN A;  5IT9 b;  1SXT A;  3MVV A;  3DXJ C;  2YYZ A;  1XJV A;  3F2U A;  1NR4 A;  2BJO A;  5BN4 A;  3CXC A;  1ENF A;  4RGM A;  1X3G A;  1RTO A;  4R4T A;  4HMJ A;  4LF9 Q;  1QUQ A;  3BZC A;  2EY5 A;  3NH4 A;  1F2Z A;  2F0W A;  2K05 A;  1HRJ A;  1IYU A;  3FRP B;  5M5X B;  4A3D I;  5LMN W;  3K59 A;  1A2T A;  3T51 B;  3T53 B;  3GTP B;  3OW2 A;  1QE6 A;  5C4J I;  1E2V A;  3CCU 1;  3BG1 B;  1IW7 C;  2NN6 H;  1K8M A;  4TVA B;  4MD9 A;  2JS4 A;  2PNR C;  4JBW A;  5A2Q E;  3CCR Z;  3Q6S A;  4NKL A;  1VQ6 1;  4Z9C B;  4CDE C;  1A2U A;  1GD7 A;  3OIQ A;  4CKB A;  2Q2U A;  5FLX E;  2A74 C;  2LMC B;  1ML8 A;  2EXZ A;  1I4H A;  3MWY W;  3PO2 G;  5AN9 F;  4HED A;  1L0Y B;  3QIA A;  3MZL B;  3CCU A;  1CSQ A;  3D31 A;  2QDB A;  2KI7 B;  3KJO A;  1ILP A;  3R2T A;  2QLV B;  4X65 Q;  3J80 f;  4LFB Q;  1BF4 A;  3JAM E;  3HOW I;  2N8N A;  4XYQ A;  2NVT I;  1HTL D;  1VQ6 A;  2KCC A;  2B2W A;  2HIX A;  2F4O A;  1ZYR D;  1UEB A;  1B70 B;  3Q0A A;  4S1T A;  4AYB A;  1VQL 1;  4DV1 Q;  4GOP A;  1HJP A;  2KCT A;  1VQ7 Z;  1V43 A;  4DR1 Q;  4KHP Q;  1F9S A;  5E4W C;  1YJN Z;  4QIW E;  3GTP I;  4MON A;  3S2D B;  3HOY H;  3HGB A;  4O2D A;  3CQZ I;  1EY0 A;  4BBS I;  2CQO A;  3VR3 A;  1K83 B;  1B4O A;  1SE8 A;  3VMH A;  4R4O A;  4B3M L;  2OF1 A;  3WDN A;  2WV6 D;  4IUT A;  3M3Y H;  4M8A A;  1K28 A;  5JEA J;  4KTA A;  3H3V H;  4B08 A;  1MSG A;  1K8A 1;  1Y8N B;  2XWJ B;  1I6V C;  3X3M A;  1AZQ A;  4XT1 B;  1N8R C;  2D2C C;  4A3G B;  3OYY A;  3GO5 A;  3NWS A;  4HGY A;  1RL2 A;  2WFW A;  2D0O A;  4DUZ Q;  3D0F A;  1Q7Y C;  2E2D C;  4O1N A;  1G2S A;  5M5X H;  4X6A I;  1CKM A;  4KKU A;  5M9O A;  1UAP A;  5IE8 A;  5C4X H;  2A69 C;  5KGU A;  1KAW A;  4B9X A;  1CI3 M;  2L11 A;  2ZJP A;  4U67 3;  3UDI A;  2H4O A;  2IHE A;  3SGI A;  3TEH B;  1HNX Q;  1SNQ A;  2JA6 B;  1NSN S;  4A3L I;  1KL9 A;  2LFU A;  4RG1 A;  1SYF A;  4JC0 A;  3I55 1;  2N55 A;  1KNA A;  1XTC D;  2EOT A;  5IP9 H;  4A3M I;  1Q82 2;  1J6Q A;  1U4P A;  4DPG A;  4C2M H;  3R3O A;  4R4Q A;  2QIL A;  4DGL A;  5M3F B;  4UY8 C;  3PO3 B;  1X3E A;  2EYM A;  2EYJ A;  1QNK A;  4OX9 Q;  1JE5 A;  3K5N A;  1B1Z A;  1B9M A;  1ZB8 A;  1PVO A;  3K0X A;  3I55 A;  1TWC B;  4K5W A;  3MXP A;  3NWT A;  4R8N A;  1XPR A;  4A3G I;  2KUM A;  2Z9H A;  2F3I A;  2RKS A;  3PV0 A;  5EKK A;  4RHR A;  2EYO A;  1CQF A;  4A3F G;  3PCO B;  3S1N B;  2B2Y A;  2R92 B;  4CGY B;  2PQA A;  3CPW Y;  5T1G A;  1DM0 B;  1VQ8 1;  3CPF A;  4DUY L;  4IOA A;  1K3R A;  1PRT D;  2XRS D;  1NUI A;  3S2D H;  1AE3 A;  2KPI A;  4MRI A;  4C3I B;  3QJY A;  3K7A B;  1K83 H;  1H9R A;  4A93 B;  2XWB B;  3S1M B;  1RKN A;  1NP6 A;  1YJ9 Z;  1Q86 2;  3N6R A;  1SIW A;  3H0G G;  4A3K G;  2QDL A;  1X9N A;  2B63 I;  1Y1W B;  2Q2T A;  1VQ8 A;  4LK1 C;  1EYC A;  2TMP A;  1KC8 2;  1O7I A;  3PSI A;  5FJ8 G;  2L1B A;  3KLR A;  1JJ2 Y;  1JC7 A;  3PO2 H;  3K80 C;  3EIV A;  2DUD A;  3A54 A;  4QGU A;  4A3E G;  2Q2I A;  1HTP A;  1ZKO A;  1KLG D;  1XNQ L;  1IYV A;  3N52 A;  3PO3 I;  1H9K A;  1KHI A;  2CH4 A;  3NP8 A;  4GLA C;  3TQY A;  3BYT B;  2V8I A;  4FF4 A;  2RCN A;  5J3B A;  3PUW A;  3QOJ A;  3CU7 A;  1B44 D;  1TWC I;  2K5H A;  3WOF A;  3HOU B;  1OXX K;  5CV4 A;  1HHV A;  1Y14 B;  2JA6 H;  3S1N I;  3IR7 A;  2Q4Z A;  1QVG Z;  2R92 I;  4DAY A;  4ZKC B;  4S3S A;  3GD7 A;  3A8J E;  3GTO B;  1SJE D;  1DZ1 A;  1S7M A;  4X64 Q;  2UUA L;  4RH6 A;  3U50 C;  5C0X G;  1RO0 A;  1EFW A;  2F4V L;  2JA5 G;  1HQR D;  1UE7 A;  5AFW A;  4DV4 L;  1EIY B;  3K7A I;  1N34 Q;  4CKE A;  3GP7 A;  4QB4 A;  5M3F H;  4A93 I;  4JYA L;  5BR8 L;  1VQA A;  2EJM A;  4B3R L;  1BUV T;  1WW9 A;  1Q8I A;  4HJA A;  1EOV A;  1S40 A;  1JWM D;  1JOQ A;  3H0G B;  5FK9 C;  1Y1W I;  3DWQ A;  4GKJ L;  1LO5 D;  1ESR A;  1AZP A;  4PQX A;  3OW7 A;  1BNZ A;  1I50 B;  2A6E C;  4FXG C;  1QYP A;  4NBC A;  5EGT A;  1BQQ T;  3UE1 A;  5M5W B;  1O7Z A;  3BG3 A;  4UP9 A;  2R7F A;  1CZW A;  3I4N B;  1JWU D;  1X3F A;  1KD1 1;  2WAQ A;  2G5D A;  3V2T A;  3DLL A;  2HT1 A;  1NJI 2;  1O7L A;  3HOU I;  3S1M H;  2RVL A;  5D1O A;  2H85 A;  1II3 A;  2RQX A;  2ID0 A;  3U4V A;  1FDO A;  2MFI A;  5KNC A;  2KBN A;  3Q24 A;  3GTO I;  1GKH A;  3IFT A;  3K5O A;  1K73 1;  1AN8 A;  1EEF D;  3HOX I;  1ET6 A;  4MIU A;  4AIM A;  4POG A;  1CT1 D;  1JQY D;  2MNA A;  2XGT A;  1IKL A;  2NBF A;  4Q5V A;  4YY3 L;  4KHZ A;  1D1I A;  1RO2 A;  1Z01 A;  3SK8 A;  1XMO L;  1G8Z D;  2N78 A;  3FEW X;  1KDC A;  4PV1 C;  1YI2 Z;  2PQE A;  1IW7 D;  1YIT 1;  2IX1 A;  4DF7 A;  2UU9 L;  5D3I B;  4G7H C;  4F7X A;  3ONA B;  4JI6 Q;  3I2Z A;  3C1E A;  5LMN L;  4L5S A;  3CPW A;  1AA6 A;  4HID A;  3CCQ Z;  2SEB D;  1LTS D;  3IFD A;  1I50 I;  2RIQ A;  1DOL A;  1JB3 A;  4E2X A;  4N9P A;  1PDQ A;  3RZO B;  4JCV E;  1SE4 A;  3W2D A;  4GKK L;  4XIG S;  2JNY A;  3GTM B;  1HNW Q;  3I4N I;  1YIT A;  1M1K 2;  1ESF A;  1SYG A;  1QVG Y;  1LTT D;  3CME 1;  3G71 1;  3NBI A;  3QB3 A;  3BVZ A;  4JI4 Q;  5CV9 A;  4JBM A;  1IHZ A;  2K75 A;  1CK1 A;  3OPO A;  3TME A;  3PF5 A;  1HFG A;  5A2Q f;  3LUS A;  1VQK Z;  2K5W A;  5D65 A;  3FMC A;  2VUG A;  2Z0S A;  2C5C A;  5JVH 3;  3H0G H;  1JJ2 A;  1WI5 A;  2QF7 A;  1H9M A;  1SNC A;  4B3T L;  3RZD B;  3NEM A;  2EY1 A;  3J7A 5;  5FJ8 H;  4Y52 H;  3W1B A;  3K57 A;  3SEB A;  3CME A;  3G71 A;  4RWS C;  2VF1 A;  5M5W H;  1VQP 1;  1EIF A;  4KD4 A;  5AJ3 L;  3NEL A;  3AFP A;  1O78 A;  4QUC A;  5EBD A;  3MA2 B;  4IQZ A;  4DR2 L;  3KFU A;  3CCV Z;  3JC6 6;  1SRU A;  1VQ4 Z;  5JPN C;  5C6A A;  4DXG A;  2QGQ A;  1YUK A;  4CKC A;  1QVC A;  1SND A;  3GTK H;  3KF6 B;  4ABN A;  1HA6 A;  3I91 A;  3RZO I;  4OWW B;  1VQP A;  5CYU A;  1VQ5 Z;  3GTM I;  2F3V A;  3HZX A;  2L9H A;  2JQO A;  2BH2 A;  2CW0 C;  5C0X H;  1ICF B;  3HOV G;  2UXC L;  3CAM A;  4A3I G;  5EKL A;  1CTM A;  2ES2 A;  1Q7Y 1;  2LY7 A;  2JA5 H;  1NCV A;  1PFS A;  2K5V A;  5LL6 f;  2A6H C;  1K9M C;  3BZD B;  1HH2 P;  3KJP A;  2V45 A;  2LFN A;  1PH3 A;  4C56 C;  4BBR B;  3SK5 A;  3TZU A;  3C3L A;  1YJ9 1;  2QRC B;  4CJ2 C;  2VW9 A;  1XNQ Q;  1Q86 1;  3GTJ H;  2FIN B;  3E9H A;  1K8O A;  5LMU L;  1EQV A;  3SDZ A;  4R9W A;  5KYI A;  1DON A;  4QMG A;  3ERS X;  4PG3 A;  2SNS A;  1EIG A;  1VS0 A;  4J15 A;  5IT9 L;  4NBG A;  3GDE A;  1PTO B;  2L55 A;  1KRT A;  3CC7 Z;  3BVG A;  4OON A;  5COY A;  5CV7 A;  1R9T H;  1USP A;  5IT9 c;  2PM9 A;  1YJ9 A;  2K14 A;  3BG0 B;  4YWM A;  1Q90 A;  1YNJ C;  1TQO A;  1X3W A;  3T1Y L;  2AMC B;  2MP1 A;  1WZN A;  3RZD H;  2PW5 A;  4DV4 Q;  2EYH A;  2P28 A;  1PTO C;  4EQ5 A;  4JYA Q;  4NH1 C;  5BR8 Q;  1EFI D;  3IX0 A;  5IYB H;  3EN2 A;  2VL6 A;  4B3R Q;  1H9J A;  2RA4 A;  5IP7 G;  3QOL A;  2UXD L;  3OSO A;  3MAQ A;  3GTQ B;  4A3B I;  3T1H L;  2X69 A;  4NB9 A;  2FXQ A;  4GKJ Q;  4FYD A;  2E5L L;  2NUC A;  1TWG H;  3T56 B;  4RA8 A;  4NFR A;  3D4D A;  1WCM G;  1QVG A;  2PMZ B;  2G9H D;  2B39 A;  4CL1 A;  2F0J A;  3G4S Z;  1PTO F;  1WOC A;  2YTX A;  2YU9 B;  4NXN L;  3I4M I;  1F9P A;  3P20 A;  1MIU A;  5T67 A;  1Q81 1;  2C35 B;  4WRD A;  2WKC A;  3K0Y A;  5I2X A;  1PFM A;  2J4X A;  1HZB A;  2R7Z G;  2Y0S A;  4IO9 A;  5A2Q b;  3B6Y A;  1JOR A;  5EPK A;  4AYB E;  2JR6 A;  4BBR H;  5FLX b;  2DGY A;  4JK1 C;  1K8A 2;  2YAD A;  3CMA A;  4YY3 Q;  1F2M A;  4HSV A;  4Q0F A;  3L3O C;  2OZK A;  1S72 Z;  5C3E G;  1PZJ D;  2D9U A;  4BY7 I;  4I7Z C;  4WJW A;  1EY8 A;  2BOS A;  3R8B A;  3GTQ I;  3NFZ A;  3S1Q I;  5HGT A;  1RTN A;  1OXT A;  4J8Q A;  3JAM b;  4MXU A;  5LMN Q;  3RMH A;  3TRE A;  1SFO I;  3J81 i;  1YI2 1;  4KJO A;  4QF4 A;  3OOC A;  4L5R C;  2R93 B;  4E31 A;  1SRO A;  3KK7 A;  3UDX A;  2Q51 A;  4BA1 I;  3CCQ 1;  2WAQ G;  3HOV H;  3W3A A;  4A3I H;  4E6I A;  2QA4 1;  2JA7 I;  2QCP X;  1IXR A;  1T5X D;  4TQU S;  4RKB A;  4HIK A;  1R4P B;  2FMC A;  1K3B C;  2E2I B;  2M6N A;  3VA5 A;  2R7Z B;  4HJ8 A;  1WTH A;  1Y1V G;  3KF8 B;  4LF6 L;  4B3T Q;  1QVF A;  3S17 B;  5I2Y A;  3CCL Z;  1U9R A;  2ICI A;  3CCQ A;  3R93 A;  3CCE Z;  1EYG A;  1YBY A;  1VLA A;  4DV2 L;  3S14 H;  4MD7 A;  5C3E B;  1ET9 A;  2JN4 A;  2MPM A;  2QA4 A;  5AJ3 Q;  2H1E A;  2CQA A;  1LT4 D;  2R6M A;  1Q12 A;  4PMB A;  4BY1 G;  4F87 A;  2YU9 H;  3STB C;  2PO4 A;  1JB7 A;  3MZ5 A;  2V4D A;  3SK4 A;  4M1U B;  1U4L A;  1QWY A;  2JP1 A;  2PNH A;  3NEN A;  5A35 A;  3KIH A;  3CCM Z;  1S5B D;  4P75 A;  3QO2 A;  3QWU A;  5G3L F;  3HOW G;  5K36 G;  4OIJ A;  1TWF H;  2VZA A;  4DV7 L;  3H3V J;  1VQN Z;  4FXD A;  1CA6 A;  3AMU A;  2UXC Q;  4JOI C;  3SK6 A;  3LWU A;  1KLU D;  4QIW B;  4CDD C;  1ILQ A;  5J22 A;  4KV6 A;  2WB1 A;  1R4Q B;  3NH5 A;  5FLM H;  3F2D A;  2VPX A;  2O5I C;  3CW2 C;  3HEJ A;  5IP7 H;  4JG2 A;  4C3J B;  4HH4 A;  2Z6K C;  4F88 A;  3F2C A;  4I65 A;  4BBS G;  2HUG A;  1YNN D;  2NN6 I;  2M9V A;  2SNM A;  2R93 H;  2CCZ A;  2ZXP A;  4YWL A;  2QEX Z;  4YCU A;  3S9W A;  5LMU Q;  5K5P A;  4A3J B;  1X56 A;  1Y8O B;  1N33 Q;  1JWH C;  4E2Y A;  3GTM S;  1IYJ B;  4UP8 A;  2RHQ B;  2VUM G;  4EQP A;  4BXX G;  3M3Y B;  2JUB A;  4EQN A;  3U4Z A;  4LF4 L;  3RLN A;  1X55 A;  5D1P A;  4A3C H;  3EJI A;  1I4G A;  2K4K A;  2TSS A;  3CP0 A;  3J7Y W;  3V05 A;  2HCI A;  3RN5 A;  4V19 0;  4X66 L;  1UE5 A;  4BY1 B;  1KXL A;  1DD2 A;  4X3S A;  4JI1 L;  2IL8 A;  4N9T A;  3CC4 Z;  5EJW A;  3SE0 A;  1TY0 A;  3MFY A;  2E2I H;  1I4Q A;  2CKZ B;  2R7Z H;  5D3D A;  3TS0 A;  5C4X B;  5T64 A;  4OWT B;  4GS3 A;  3H3V C;  3S16 H;  1XPO A;  3S17 H;  3CC7 1;  1TR5 A;  3MXN B;  1M90 2;  1SBB B;  3HKZ B;  2AUJ D;  4AH6 A;  3TSS A;  2JEB I;  2OTJ Z;  3VMI A;  2LXK A;  1WTR A;  2PZW A;  5C3E H;  3OTO L;  2UXD Q;  4IUN A;  3T1H Q;  4MHE A;  2E76 C;  4ME3 A;  1QZH A;  1OTC A;  4RVH A;  1IBK Q;  3HOZ G;  1KD1 2;  4ULL A;  3KDF B;  3HOY I;  4FF1 A;  4C2M B;  2J6A A;  3FKI G;  1S3O A;  3A5Z B;  3CC7 A;  4ZAI A;  3E3X A;  2L0C A;  2EXD A;  4FXK C;  3A56 A;  2K32 A;  3MFG A;  2Z6B A;  2JMO A;  3M3Y I;  4DR6 Q;  1ZH1 A;  1XMQ L;  1K73 2;  1WTO A;  2RT9 A;  2EYF A;  2H5X A;  3H3V I;  2HHH L;  1WVL A;  1XX8 A;  4NXN Q;  2WII B;  1ML0 D;  4UHV A;  3D8G A;  3RLF A;  4ILW A;  2DNE A;  2PZU A;  1HFN A;  2OTL Z;  1P16 A;  2OT2 A;  2ENB A;  2BE5 C;  4C3J H;  2K33 A;  2WAQ E;  4ODG A;  1RHP A;  3G4S 1;  3AQQ A;  5C4X I;  2JA8 G;  1L1O B;  1W3S A;  1Y1V H;  2EY6 A;  5JAV A;  4ME5 A;  2E8G A;  4DAP A;  2ASB A;  1Z47 A;  2K52 A;  4UDU C;  1I4X A;  4A3J H;  3GQB A;  4YIJ A;  1VQL A;  1EZ6 A;  1WJ2 A;  1DYQ A;  2O53 A;  1XNR Q;  4R1J A;  2K28 A;  4DR7 L;  2M2L A;  2B63 G;  2XTI A;  2N49 A;  1L1O C;  3CCS Z;  1PZK D;  4NBB A;  3OMG A;  2L4N A;  2MGS A;  5IP9 I;  4BY1 H;  1S72 1;  3G4S A;  2O4H A;  3PO2 B;  1JR0 D;  1CHQ D;  1CQV A;  2NZ1 D;  5JVG 3;  5HUR A;  2EVB A;  4JI5 Q;  1FJG Q;  3CD6 1;  1XTD A;  1YJW Z;  2F1M A;  4TKO B;  1YIJ Z;  2Q2H A;  4LFA L;  1NTG A;  2GVA A;  2KOL A;  2I0Q A;  3EA6 A;  2CHB D;  1YHB A;  3BZK A;  1I6H H;  3D4W A;  1PV4 A;  1N36 L;  1QF8 A;  5FO9 B;  5IOD A;  1EY6 A;  1KIX A;  3R2I A;  1B3Q A;  2F0V A;  1S72 A;  2HQL A;  4FDB A;  4RCN A;  1GUG A;  4JI8 L;  2GA4 B;  2AYD A;  4KY5 A;  3CD6 A;  4K8J A;  2Y0S G;  5F2D A;  3I4L A;  2NVX H;  3GTG H;  3VR2 A;  3S2D I;  1ENA A;  4C3H G;  2VQF L;  4GNX A;  3P75 A;  1VQB A;  2JE6 I;  2BDO A;  1SYD A;  1K83 I;  1JIC A;  1I3Q H;  3Q22 A;  4RAU C;  2QRD B;  4DV2 Q;  3TS2 A;  2VY3 A;  1PHJ A;  4QQB X;  3MEH A;  1SR3 A;  1PYS B;  2VUM H;  4BXX H;  1STG A;  1TS5 A;  3M4Q A;  3CCL 1;  2AQ1 B;  5FOB B;  4RGO S;  1X3P A;  2A68 D;  4XYO A;  3PO2 I;  1Q7Y 2;  1D6E C;  1UWV A;  1KC8 C;  4KMU C;  3NBH A;  1I4P A;  2MQH A;  1N32 L;  3ITP A;  4DV7 Q;  2ALY B;  1IL8 A;  3VR5 A;  5BN3 A;  5DM6 3;  2F4I A;  1NMG A;  2ICE C;  1TS4 A;  2E7Z A;  3AYH B;  4L63 B;  3CCM 1;  3K5M A;  4KI0 A;  1KQS Z;  5IT9 E;  1EYA A;  3URY A;  1GM5 A;  2F0I A;  3ULJ A;  1H9S A;  1Y8P B;  3P7J A;  2JA6 I;  4KKT A;  2LSS A;  1B53 A;  4H44 C;  4XT3 B;  1VQN 1;  1KTK A;  4Y7N H;  2RBM A;  2JIO A;  3I72 A;  2IZ4 A;  3HOZ H;  5E7N A;  3CCJ Z;  5CGK A;  2KED A;  1BCP B;  1D2B A;  3FKI H;  4HN7 A;  3V96 A;  1QG7 A;  3H6M A;  3CCM A;  4IUQ A;  1K0R A;  1STY A;  2B8G A;  2F0E A;  1TT2 A;  3D6C A;  2IWH A;  4LF4 Q;  2DJF C;  4RGT A;  3OMC A;  5ELF A;  4PZ7 A;  4P73 A;  3D2L A;  2OCE A;  3I4O A;  3ULL A;  1PH7 A;  3J80 b;  4YCV A;  2XIW A;  3NTH A;  4RKL A;  2I5H A;  4X66 Q;  2QEX 1;  2M00 A;  3AU7 A;  5M5Y B;  1BCP C;  4JI1 Q;  3OHX C;  1WTV A;  1WTP A;  4IPH A;  4H02 A;  4RGN A;  4A3F B;  1A0I A;  2XVS A;  2V8K A;  1B8A A;  4PMW A;  1E0B A;  3S1R H;  1PZI D;  4POF A;  1J9O A;  4QY7 A;  1TVX A;  4ZUJ A;  1C8C A;  2B2V C;  2OOY B;  2JA8 H;  3S24 A;  5IGC A;  4DNT B;  2B2U A;  2X6L A;  4DK0 A;  2UUB L;  2DNC A;  4TSS A;  3NQI A;  2JIM A;  2RPR A;  3S1M I;  2WB1 G;  1ZEQ X;  2J7Z A;  3OTO Q;  2QEX A;  5IGD A;  1KAB A;  2QW7 A;  2V3V A;  4GLX A;  1NJI C;  2B2T A;  1J5E L;  2K5R A;  4NBD A;  1VQG A;  1VQF A;  3EVQ A;  4FF3 A;  2B63 H;  4A3K B;  5C0X J;  3OWF A;  1CKN B;  5GRO A;  1M90 1;  4XQN A;  1LTG D;  1SNP A;  2E75 C;  4APV A;  4DK3 C;  5COR A;  1BCP F;  5C44 G;  5JJI A;  3CCR 1;  4KY7 A;  4MZ9 A;  1VQ9 Z;  1Q81 2;  1HXY D;  1JOK A;  2WKD A;  3IKJ A;  1Y8C A;  3M7G A;  4A3E B;  1UNS A;  5C4H A;  4JV5 L;  1EYD A;  1I5F A;  3FPP A;  5GAH C;  4EX5 A;  1OXV A;  2JIQ A;  1MHW C;  1FNV A;  1K8G A;  4LJZ C;  2ZXR A;  1F77 A;  4IPD A;  2C9O A;  4LMQ D;  2HHH Q;  3NH8 A;  3UDG A;  4B3S L;  1JMC A;  1B50 A;  2F0U A;  2PYK A;  3DM1 A;  2AHO B;  4HCE A;  4OWX B;  2VQE L;  3GTK B;  2NB0 A;  1WFQ A;  1STH A;  2PK7 A;  4KJN A;  4ZLT F;  3NQT A;  3CCR A;  1ZB9 A;  1KQS Y;  3E9I A;  1V1P B;  5J1Z A;  3A8K E;  5LL6 S;  4NOZ A;  4OEL B;  3E0E A;  1VQ7 1;  1E3P A;  3C2P A;  1S5D D;  3VYU A;  2JA5 B;  2Y0S E;  4IFD G;  1YJN 1;  3L2P A;  4B3M Q;  3D3R A;  5C3W A;  4DR7 Q;  1DXM A;  2N3S A;  3ND9 A;  4OO1 G;  5IYD G;  3H0G I;  2E74 C;  1CUK A;  4L6T B;  5E1F A;  4A75 A;  1A3T A;  4LUZ A;  3PF4 A;  5ELE A;  5M5Y H;  1Z03 A;  1VQM Z;  4Y52 I;  1LT5 D;  1NY4 A;  2ZJQ A;  1VQ7 A;  1TWH B;  2NTS A;  4A3F H;  1SYB A;  3ICE A;  3GTJ B;  1P8L A;  2ZJR A;  2I46 A;  4LFA Q;  2VB3 X;  4G7Z C;  1YJN A;  5H1S E;  4UPA A;  3CCS 1;  1W2B Z;  1GVP A;  1IL2 A;  1BBU A;  2F0L A;  4RMF A;  3FDT A;  3G6E Z;  2A1A A;  2I07 B;  3AEV A;  4DR3 L;  1N36 Q;  2KEC A;  4RCO A;  1ICW A;  4AYB G;  4MH4 A;  1WTW A;  3P1H A;  4IAL A;  2AWO A;  1QUQ B;  3QWN A;  3GTK I;  1R9T B;  4JI8 Q;  4CDC C;  2K5N A;  2GN5 A;  4HR7 B;  4JBJ A;  2NYZ D;  4A3K H;  1UEA B;  2L12 A;  1Z9F A;  1BVS A;  1M4V A;  2VQF Q;  1AP0 A;  3TDH B;  3CCS A;  2EZV A;  1K0S A;  5HGQ A;  3HFZ B;  3BJU A;  4PNY A;  5C4Z A;  2F0P A;  5IGE A;  5C0X I;  3DUZ A;  3DM3 A;  2JA5 I;  4K2L A;  5GAE C;  1I94 L;  4A3E H;  2ZM6 L;  3PIP 3;  3F8T A;  2HQE A;  2PI2 A;  3MC0 B;  5BN5 A;  3CC2 Z;  1W6J A;  4DR5 L;  4A76 A;  1TWG B;  5KIX A;  1RD9 D;  2K6A A;  1S5C D;  4P72 A;  5C5M A;  4DUY Q;  1NAP A;  4L8J A;  5I9P A;  3GTJ I;  3D6W A;  3DWA A;  3K8A A;  5CMD A;  2F0K A;  3GV3 A;  1N8R 1;  3L9A X;  1Q8K A; 
#chains in the Genus database with same CATH homology
 4DR4 L;  4RVD A;  3J7A 4;  1NE3 A;  3A0J A;  1AE2 A;  5JJL A;  1PA6 A;  1PH8 A;  3J7Z C;  4GOP B;  1R9T I;  3CXC Z;  2RHB A;  3PIP A;  2A8V A;  1L0W A;  3RZD I;  2WB1 E;  4LF5 L;  3M4O H;  1UE6 A;  4XTC S;  1HZ9 A;  1BKB A;  1TWH H;  1VQH A;  4E33 A;  5C44 H;  4GOP C;  4BY7 G;  2E9H A;  3J81 c;  4JI0 L;  4X62 L;  3W5O A;  2B3G A;  1TWG I;  2RBL A;  4RS4 A;  3EBE A;  1VQD A;  4HJ7 A;  2YV5 A;  1IBM L;  4IOC A;  3JAM i;  2UUA Q;  2MO0 A;  2F4V Q;  2M48 A;  2IHF A;  2JA7 G;  3CCU Z;  1J5E Q;  4WJ4 A;  5IYD H;  3MEF A;  2YTY A;  1CKO A;  1AH9 A;  4BBR I;  3J81 f;  1T9H A;  1QZG A;  3PUY A;  1K8A C;  3FHW A;  1MJC A;  4JV5 Q;  1E24 A;  4UP7 A;  2VS1 A;  2NVQ H;  4NXM L;  2LXJ A;  5CM2 M;  4B3S Q;  3TRZ A;  5IT9 f;  1VQ9 1;  1VQO Z;  4E30 A;  2QRE B;  2VQE Q;  5IY0 A;  3A74 A;  2PQA B;  4KLK A;  4P74 A;  2JEA I;  1XMO Q;  3HOV I;  3CXC Y;  1IBL L;  4A3I I;  4DAM A;  2E2H H;  2UU9 Q;  2E2J H;  1NMF A;  4JBK A;  4LWC A;  1LM0 A;  2NN6 G;  3ULP A;  3I07 A;  1RLY A;  1PH5 A;  1PYB A;  4GKK Q;  3S14 I;  4DV0 L;  4IJH A;  4DV5 L;  1XPU A;  1C7Y A;  4DR3 Q;  3KOJ A;  2YU9 I;  1HZC A;  2YTV A;  4YWK A;  2IX0 A;  1YI2 A;  4A3D G;  3UDF A;  1HR0 W;  3G6E 1;  4DAY B;  1IZ6 A;  1TWF I;  5HY6 A;  2RF4 A;  3I55 Z;  1VQK 1;  2JJQ A;  2ZM6 Q;  1A62 A;  5FLM I;  3I7F A;  3M9B A;  3MZK B;  4DR2 Q;  4PZ8 A;  5IP7 I;  3S2H H;  4LNQ A;  1BBW A;  3PGZ A;  2BA0 A;  3KYH C;  4K0K L;  1YZ6 A;  2GVB A;  2R93 I;  4YHH L;  1VQK A;  2GTH A;  1PH2 A;  3CCV 1;  2QKD A;  2GU2 A;  3U58 A;  1VQ4 1;  3PIO A;  4JI7 L;  1PFT A;  4A3C I;  3RN2 A;  2QR1 B;  1TWA H;  3Q87 A;  1VQ5 1;  5D1O B;  5IYC G;  3NDJ A;  2E2I I;  1UE1 A;  2R7Z I;  3CCV A;  4LUO A;  3BU2 A;  3S16 I;  3S17 I;  1VQ4 A;  3GTL H;  1LUZ A;  1JJG A;  4DQY B;  4JI0 Q;  5JJK A;  5DLQ E;  5C3E I;  1WCM H;  1E7Z A;  2HIV A;  1MKH A;  1VQ5 A;  1E1T A;  2NVY H;  2A19 A;  3EED A;  4LFC L;  1E22 A;  1D7Q A;  1IBM Q;  3WWV A;  3T1Y Q;  4DV6 L;  1PH1 A;  2G2K A;  3J80 c;  3Q8D A;  4A3L G;  1K73 C;  1C9O A;  2R7D A;  3S15 H;  2E5L Q;  4A3M G;  1E1O A;  3GCF A;  2JK8 A;  3RR5 A;  4HIO A;  1Y1V I;  4X64 L;  5GAG C;  1VQI A;  1K9M 1;  4QTT A;  3VDY A;  4RVF A;  4A3J I;  1N34 L;  1EUJ A;  1H95 A;  2CWA A;  1B7Y B;  4NXM Q;  2RHS B;  4TNU A;  2I5L X;  4LW1 A;  5GAD C;  4A3G G;  4BY1 I;  1EQR A;  4WJ3 M;  3KF6 A;  3PUZ A;  1YUA A;  1RNI A;  1N2F A;  4IJL A;  4A3D H;  4NBA A;  5C4J H;  1VQO 1;  1JT8 A;  1I6H I;  1IBL Q;  3CPW Z;  1HNZ L;  3PUV A;  2JA6 G;  4LUV A;  2ATW A;  1RO4 A;  2NVX I;  4NBF A;  1YIT Z;  3GTG I;  3RLO A;  5JEA G;  1WYD A;  1U0L A;  1VQO A;  1Q82 C;  5M3F G;  1I3Q I;  3PO3 G;  4DV0 Q;  2L15 A;  1N9W A;  3HOW H;  2UXB L;  4DV5 Q;  1YHQ Z;  1JJ2 Z;  2NVT H;  2VUM I;  4BXX I;  4ALP A;  2KCM A;  4AQY L;  1RIP A;  4JI6 L;  2HU9 A;  1X65 A;  3CME Z;  3NDI A;  1P9N A;  3G71 Z;  1EQQ A;  2R92 G;  1HZA A;  1USP B;  3J80 i;  5IYC H;  2DE7 A;  4LF6 Q;  3GTP H;  1V1Q A;  1HNW L;  3CQZ H;  4LF8 L;  2ZAE B;  4BBS H;  5EAY A;  5ELO A;  4A93 G;  4JI4 L;  4QJF A;  1Y1W G;  4Y7N I;  3HKZ E;  1N8R 2;  3TE5 B;  1Q86 C;  1VQP Z;  4L5Q A;  3CCE 1;  4K0K Q;  3HOZ I;  2ZTC A;  4YHH Q;  3FKI I;  2PI2 E;  3HKS A;  1PH4 A;  2PMZ A;  4X6A H;  4NB3 A;  2LIY A;  4YCW A;  2IZ3 A;  4JI7 Q;  3F1Z A;  1SLJ A;  3CCL A;  3HOU G;  1Z02 A;  1WJJ A;  4DK1 A;  3UE0 A;  3CCE A;  4A3L H;  4QL5 A;  4NBE A;  1V9P A;  3HOX G;  3S1R I;  4A3M H;  4DK6 C;  3T4N B;  2JA8 I;  2VNU D;  1A63 A;  2CWP A;  1ASZ A;  1VQN A;  3M7N A;  2D0P A;  1HR0 L;  4A3G H;  2GTI A;  2V8J A;  4LFC Q;  3IF8 A;  3IFU A;  4GN5 A;  3STB D;  3I4N G;  4XX2 A;  4DV6 Q;  1Q81 C;  2D62 A;  4EWC A;  2IY5 B;  1X3Z A;  3CC4 1;  2OWO A;  1Q1E A;  1L2F A;  2W03 A;  4HIM A;  5IWA L;  3F3F C;  3VB9 A;  2CFM A;  2OTJ 1;  4GN3 B;  4O0A A;  2I5M X;  4E2W A;  4DKA C;  1OXS C;  3CC4 A;  3PO3 H;  1KRL A;  1YEZ A;  4MTN A;  1U5K A;  4IPG A;  1XMQ Q;  4JOI A;  1FGU A;  1TWC H;  3CMA Z;  3L7Z C;  2OTJ A;  3S1N H;  2R92 H;  4A3F I;  3F2B A;  3M4P A;  2Z6K A;  1G29 1;  1Y1V S;  3PUX A;  4C3I H;  4C3H H;  2OTL 1;  4HJ9 A;  1HNZ Q;  1M1K C;  3K7A H;  1X6O A;  4A93 H;  4JI2 L;  2F4M A;  4IPC A;  1CSP A;  1Y1W H;  4A3K I;  1PH6 A;  5FLX c;  2AKW B;  4IFD J;  2OTL A;  4A3E I;  5IYB G;  4MD8 A;  2UXB Q;  3J81 j;  3EER A;  1KRS A;  1ASY A;  3JAM c;  3AFQ A;  4AQY Q;  1QVF Z;  1YJW 1;  3HOU H;  4DNI A;  1YHA A;  1YIJ 1;  2OQ0 A;  2KHJ A;  4P71 A;  3KIF A;  1YHQ 1;  2QA4 Z;  3GTO H;  2ZTE A;  3HOX H;  4LF8 Q;  3HKZ A;  4E2Z A;  1YJW A;  4A3B G;  1YIJ A;  1DGS A;  4LF7 L;  3I56 Z;  3G48 A;  5FLX f;  4NB8 A;  1YHQ A;  3KDF A;  4JI3 L;  4BBR G;  2F52 A;  3M4O I;  3ZJY C;  1I50 H;  1TWH I;  1N32 Q;  5C44 I;  1G51 A;  3JAM f;  3I4N H;  3CF5 A;  4R4I A;  4PZ6 A;  4DV3 L;  1Q82 1;  4HJ5 A;  3I4M G;  1DL6 A;  4BA2 I;  1SN8 A;  1RQF A;  2K3R A;  3RNU A;  1L1O A;  1FVI A;  3A5U A;  2NZH A;  4RVG A;  3VTN A;  1VQJ A;  2JA9 A;  2UUC L;  4MNO A;  2I3C A;  4IFD I;  3FQQ A;  5M3M G;  3CCJ 1;  4L5T A;  3OW2 Z;  1HR0 Q;  4OO1 I;  1W2B Y;  1JJC B;  2BA1 A;  1KQS A;  4A4I A;  1EWI A;  1QVF Y;  2EIF A;  3RZO H;  2AKL A;  1N33 L;  3GTM H;  2NVQ I;  1KC8 1;  4RV9 A;  3FQM A;  4E32 A;  3CCJ A;  2UUB Q;  3MON A;  2V1C C;  4LF9 L;  1K9M 2;  2MO1 A;  5IWA Q;  1PH9 A;  2BH8 A;  5ELN A;  1VQ6 Z;  3VMG A;  3KLW A;  2IT1 A;  3W1G A;  1OXU A;  4GNX B;  1X0T A;  3PO3 S;  5FLM G;  2E2H I;  1SMX A;  2E2J I;  4GN4 B;  2K50 A;  1IBK L;  4GNX C;  2P3Y A;  2R93 G;  1YNX A;  2AWN A;  1VQL Z;  3NBH B;  1LQL A;  4X65 L;  4LFB L;  2B29 A;  3GKQ A;  1Q46 A;  2KHI A;  4A3C G;  3CMA 1;  3IRB A;  2R6G A;  4DR6 L;  2NZO A;  4JI2 Q;  1FL0 A;  4QTU A;  4DV1 L;  1VQ9 A;  1C0A A;  4DR1 L;  4KHP L;  4A3B H;  3F3P C;  2W04 A;  2OOX B;  2HF1 A;  1NJI 1;  3M85 A;  3OW2 Y;  1Q1B A;  1VQC A;  1VQE A;  1X54 A;  4OXP A;  3CD6 Z;  3H15 A;  1XNR L;  3S2H I;  1D8L A;  4R4C A;  1VQM 1;  1A8V A;  5GQO A;  3I4M H;  4JI5 L;  1FJG L;  4DUZ L;  2DE6 A;  3FP9 A;  1I94 Q;  1VQM A;  2KEN A;  1MJE A;  1TWA I;  4BY7 H;  2OQK A;  1HNX L;  3ESW A;  4NBH A;  4LF7 Q;  3ER0 A;  3GTQ H;  3S1Q H;  1W2B A;  5M3M H;  1CKN A;  1M1K 1;  3G6E A;  4DR5 Q;  3HOY G;  4JI3 Q;  1SFO H;  1TFI A;  1NBW A;  1GO3 E;  3GTL I;  3LGJ A;  4A3J G;  3CC2 1;  3D9X A;  3I56 1;  1WCM I;  4DR4 Q;  4OX9 L;  1VQ8 Z;  4DV3 Q;  3K7U C;  1TXY A;  3L0O A;  3K81 C;  2NVY I;  2PMZ E;  2WP8 J;  2JA7 H;  4HGZ A;  1LTL A;  3P5J B;  5C4X G;  3CC2 A;  3I56 A;  4GLV B;  4LF5 Q;  4NPS A;  3HKZ G;  2EQS A;  2DE5 A;  1VCI A;  2UUC Q;  5T6B A;  2ZTD A;  1M90 C;  1LYL A;  3J81 b;  4X62 Q;  1WII A;  3S15 I;  5IP9 G;  1YVC A;  1G6P A;  2EGT A;  1KD1 C;  5IT9 b;  2YYZ A;  1XJV A;  2BJO A;  3CXC A;  1X3G A;  4R4T A;  4LF9 Q;  1QUQ A;  3BZC A;  3NH4 A;  4A3D I;  5LMN W;  3OW2 A;  5C4J I;  3CCU 1;  3BG1 B;  4TVA B;  4MD9 A;  2JS4 A;  4JBW A;  3CCR Z;  1VQ6 1;  1GD7 A;  2Q2U A;  1ML8 A;  3PO2 G;  5AN9 F;  3MZL B;  3CCU A;  1CSQ A;  3D31 A;  2KI7 B;  3KJO A;  2QLV B;  4X65 Q;  3J80 f;  4LFB Q;  3HOW I;  2N8N A;  2NVT I;  1VQ6 A;  2HIX A;  2F4O A;  1UEB A;  1B70 B;  4S1T A;  4AYB A;  1VQL 1;  4DV1 Q;  4GOP A;  1HJP A;  2KCT A;  1VQ7 Z;  1V43 A;  4DR1 Q;  4KHP Q;  1YJN Z;  4QIW E;  3GTP I;  4MON A;  3HOY H;  4O2D A;  3CQZ I;  4BBS I;  2CQO A;  1SE8 A;  3VMH A;  4R4O A;  4B3M L;  3M3Y H;  5JEA J;  3H3V H;  1K8A 1;  1N8R C;  3OYY A;  3GO5 A;  4HGY A;  1RL2 A;  2WFW A;  2D0O A;  4DUZ Q;  3D0F A;  1Q7Y C;  5M5X H;  4X6A I;  1CKM A;  5IE8 A;  5C4X H;  1KAW A;  2ZJP A;  3UDI A;  2IHE A;  3SGI A;  3TEH B;  1HNX Q;  4A3L I;  1KL9 A;  2LFU A;  4RG1 A;  4JC0 A;  3I55 1;  5IP9 H;  4A3M I;  1Q82 2;  1J6Q A;  4DPG A;  4C2M H;  4R4Q A;  4DGL A;  4UY8 C;  1X3E A;  4OX9 Q;  1JE5 A;  1ZB8 A;  1PVO A;  3K0X A;  3I55 A;  1XPR A;  4A3G I;  3PV0 A;  2F3I A;  4A3F G;  3PCO B;  2PQA A;  3CPW Y;  1VQ8 1;  3CPF A;  4DUY L;  4IOA A;  1K3R A;  1NUI A;  3S2D H;  1AE3 A;  2KPI A;  4MRI A;  1K83 H;  1NP6 A;  1YJ9 Z;  1Q86 2;  3H0G G;  4A3K G;  1X9N A;  2B63 I;  2Q2T A;  1VQ8 A;  1KC8 2;  1O7I A;  3PSI A;  5FJ8 G;  1JJ2 Y;  3PO2 H;  3K80 C;  3EIV A;  2DUD A;  4QGU A;  4A3E G;  2Q2I A;  1XNQ L;  3PO3 I;  1KHI A;  4GLA C;  3TQY A;  2V8I A;  2RCN A;  5J3B A;  3PUW A;  1TWC I;  2K5H A;  1OXX K;  1Y14 B;  2JA6 H;  3S1N I;  2R92 I;  2Q4Z A;  1QVG Z;  3GD7 A;  1S7M A;  4X64 Q;  2UUA L;  3U50 C;  5C0X G;  1RO0 A;  1EFW A;  2F4V L;  2JA5 G;  1UE7 A;  4DV4 L;  1EIY B;  3K7A I;  1N34 Q;  4JYA L;  5M3F H;  4A93 I;  5BR8 L;  1VQA A;  4B3R L;  1WW9 A;  4HJA A;  1EOV A;  1S40 A;  1Y1W I;  4GKJ L;  1QYP A;  4NBC A;  3UE1 A;  4UP9 A;  2R7F A;  1X3F A;  1KD1 1;  2WAQ A;  3DLL A;  2HT1 A;  1NJI 2;  3HOU I;  3S1M H;  5D1O A;  2H85 A;  2ID0 A;  3U4V A;  2MFI A;  2KBN A;  3GTO I;  1GKH A;  1K73 1;  3HOX I;  4POG A;  4AIM A;  2MNA A;  2XGT A;  4YY3 L;  4KHZ A;  1RO2 A;  1Z01 A;  1XMO L;  2N78 A;  1YI2 Z;  1YIT 1;  2IX1 A;  2UU9 L;  4JI6 Q;  3I2Z A;  5LMN L;  4L5S A;  3CPW A;  4HID A;  3CCQ Z;  1I50 I;  2RIQ A;  4E2X A;  4JCV E;  4GKK L;  4XIG S;  2JNY A;  1HNW Q;  3I4N I;  1YIT A;  1M1K 2;  1QVG Y;  3CME 1;  3G71 1;  4JI4 Q;  4JBM A;  2K75 A;  3PF5 A;  5A2Q f;  3LUS A;  1VQK Z;  2VUG A;  2Z0S A;  3H0G H;  1JJ2 A;  1WI5 A;  4B3T L;  3NEM A;  3J7A 5;  5FJ8 H;  4Y52 H;  3W1B A;  3CME A;  3G71 A;  2VF1 A;  5M5W H;  1VQP 1;  1EIF A;  5AJ3 L;  3NEL A;  3AFP A;  4DR2 L;  3KFU A;  3CCV Z;  3JC6 6;  1SRU A;  1VQ4 Z;  2QGQ A;  1YUK A;  1QVC A;  3GTK H;  3KF6 B;  3RZO I;  4OWW B;  1VQP A;  1VQ5 Z;  3GTM I;  2JQO A;  2BH2 A;  3HOV G;  2UXC L;  3CAM A;  4A3I G;  2ES2 A;  1Q7Y 1;  2JA5 H;  1PFS A;  2K5V A;  5LL6 f;  1K9M C;  1HH2 P;  3KJP A;  1PH3 A;  1YJ9 1;  2QRC B;  2VW9 A;  1XNQ Q;  1Q86 1;  3GTJ H;  3E9H A;  5LMU L;  3ERS X;  4PG3 A;  1VS0 A;  4J15 A;  4NBG A;  3GDE A;  1KRT A;  3CC7 Z;  4OON A;  1R9T H;  1USP A;  5IT9 c;  2PM9 A;  1YJ9 A;  2K14 A;  3BG0 B;  4YWM A;  1X3W A;  3T1Y L;  2AMC B;  3RZD H;  4DV4 Q;  2P28 A;  4EQ5 A;  4JYA Q;  4NH1 C;  5BR8 Q;  3IX0 A;  5IYB H;  3EN2 A;  2VL6 A;  4B3R Q;  5IP7 G;  2UXD L;  4A3B I;  3T1H L;  4NB9 A;  2FXQ A;  4GKJ Q;  2E5L L;  1TWG H;  4NFR A;  1WCM G;  1QVG A;  4CL1 A;  3G4S Z;  1WOC A;  2YTX A;  4NXN L;  3I4M I;  1MIU A;  5T67 A;  1Q81 1;  2C35 B;  1HZB A;  2R7Z G;  2Y0S A;  4IO9 A;  5A2Q b;  3B6Y A;  4AYB E;  2JR6 A;  4BBR H;  5FLX b;  2DGY A;  1K8A 2;  2YAD A;  3CMA A;  4YY3 Q;  2OZK A;  1S72 Z;  5C3E G;  4BY7 I;  3GTQ I;  3NFZ A;  3S1Q I;  1OXT A;  3JAM b;  4MXU A;  5LMN Q;  3TRE A;  1SFO I;  3J81 i;  1YI2 1;  4L5R C;  4E31 A;  1SRO A;  3UDX A;  2Q51 A;  4BA1 I;  3CCQ 1;  2WAQ G;  3HOV H;  4A3I H;  2QA4 1;  2JA7 I;  1IXR A;  4TQU S;  4HIK A;  2M6N A;  4HJ8 A;  1Y1V G;  3KF8 B;  4LF6 L;  4B3T Q;  1QVF A;  3CCL Z;  3CCQ A;  3CCE Z;  1EYG A;  1YBY A;  1VLA A;  4DV2 L;  3S14 H;  4MD7 A;  2QA4 A;  5AJ3 Q;  2R6M A;  1Q12 A;  4BY1 G;  2YU9 H;  3STB C;  1JB7 A;  2PNH A;  3NEN A;  3KIH A;  3CCM Z;  4P75 A;  3QWU A;  3HOW G;  5K36 G;  1TWF H;  2VZA A;  4DV7 L;  3H3V J;  1VQN Z;  2UXC Q;  4JOI C;  2WB1 A;  3NH5 A;  5FLM H;  3F2D A;  3CW2 C;  5IP7 H;  4JG2 A;  4HH4 A;  2Z6K C;  3F2C A;  4BBS G;  2NN6 I;  2R93 H;  2CCZ A;  4YWL A;  2QEX Z;  4YCU A;  5LMU Q;  1X56 A;  1N33 Q;  1JWH C;  4E2Y A;  3GTM S;  1IYJ B;  4UP8 A;  2RHQ B;  2VUM G;  4BXX G;  2JUB A;  4LF4 L;  3U4Z A;  3RLN A;  1X55 A;  5D1P A;  4A3C H;  2K4K A;  3CP0 A;  3RN5 A;  1KXL A;  4X66 L;  1UE5 A;  4JI1 L;  3CC4 Z;  2E2I H;  2CKZ B;  2R7Z H;  3TS0 A;  5T64 A;  4OWT B;  4GS3 A;  3S16 H;  1XPO A;  3S17 H;  3CC7 1;  3MXN B;  1M90 2;  4AH6 A;  2JEB I;  2OTJ Z;  3VMI A;  2LXK A;  5C3E H;  3OTO L;  2UXD Q;  3T1H Q;  4ME3 A;  1QZH A;  1OTC A;  4RVH A;  1IBK Q;  3HOZ G;  1KD1 2;  3KDF B;  3HOY I;  2J6A A;  3FKI G;  1S3O A;  3A5Z B;  3CC7 A;  2EXD A;  4DR6 Q;  2JMO A;  3M3Y I;  1ZH1 A;  1XMQ L;  1K73 2;  2RT9 A;  2H5X A;  3H3V I;  2HHH L;  4NXN Q;  3RLF A;  2OTL Z;  1P16 A;  4C3J H;  2WAQ E;  3G4S 1;  3AQQ A;  5C4X I;  2JA8 G;  1L1O B;  1W3S A;  1Y1V H;  2E8G A;  2ASB A;  1Z47 A;  2K52 A;  4A3J H;  1VQL A;  2O53 A;  1XNR Q;  4R1J A;  4DR7 L;  2B63 G;  2XTI A;  2N49 A;  1L1O C;  3CCS Z;  4NBB A;  5IP9 I;  4BY1 H;  1S72 1;  3G4S A;  2O4H A;  4JI5 Q;  1FJG Q;  3CD6 1;  1XTD A;  1YJW Z;  1YIJ Z;  2Q2H A;  4LFA L;  1NTG A;  2GVA A;  2I0Q A;  1YHB A;  3BZK A;  1I6H H;  1PV4 A;  1N36 L;  1QF8 A;  1KIX A;  1S72 A;  2HQL A;  4FDB A;  4JI8 L;  3CD6 A;  2Y0S G;  2NVX H;  3GTG H;  3S2D I;  2VQF L;  4GNX A;  1VQB A;  2JE6 I;  1K83 I;  1I3Q H;  2QRD B;  4DV2 Q;  3TS2 A;  2VY3 A;  1PHJ A;  4QQB X;  1SR3 A;  1PYS B;  2VUM H;  4BXX H;  3M4Q A;  3CCL 1;  3PO2 I;  1Q7Y 2;  1UWV A;  1KC8 C;  2MQH A;  1N32 L;  4DV7 Q;  2ALY B;  1NMG A;  3AYH B;  3CCM 1;  4KI0 A;  1KQS Z;  1GM5 A;  3ULJ A;  2JA6 I;  2LSS A;  1VQN 1;  4Y7N H;  2IZ4 A;  3HOZ H;  5E7N A;  3CCJ Z;  3FKI H;  3CCM A;  1K0R A;  4LF4 Q;  4PZ7 A;  4P73 A;  2OCE A;  3I4O A;  3ULL A;  1PH7 A;  3J80 b;  4YCV A;  2I5H A;  4X66 Q;  2QEX 1;  4JI1 Q;  4IPH A;  4H02 A;  1A0I A;  2V8K A;  1B8A A;  4PMW A;  3S1R H;  4POF A;  4QY7 A;  2OOY B;  2JA8 H;  3S24 A;  2UUB L;  2RPR A;  3S1M I;  2WB1 G;  3OTO Q;  2QEX A;  4GLX A;  1NJI C;  1J5E L;  2K5R A;  4NBD A;  1VQG A;  1VQF A;  2B63 H;  5C0X J;  1CKN B;  5GRO A;  1M90 1;  4APV A;  4DK3 C;  5C44 G;  5JJI A;  3CCR 1;  4MZ9 A;  1VQ9 Z;  1Q81 2;  4JV5 L;  1I5F A;  5GAH C;  4EX5 A;  1OXV A;  1K8G A;  4IPD A;  2HHH Q;  3NH8 A;  3UDG A;  4B3S L;  1JMC A;  4OWX B;  2VQE L;  2AHO B;  1WFQ A;  2PK7 A;  3CCR A;  1ZB9 A;  1KQS Y;  3E9I A;  4NOZ A;  3E0E A;  1VQ7 1;  1E3P A;  2Y0S E;  4IFD G;  1YJN 1;  3L2P A;  4B3M Q;  4DR7 Q;  2N3S A;  4OO1 G;  5IYD G;  3H0G I;  1CUK A;  4A75 A;  4LUZ A;  3PF4 A;  5M5Y H;  1Z03 A;  1VQM Z;  4Y52 I;  1NY4 A;  2ZJQ A;  1VQ7 A;  4A3F H;  3ICE A;  1P8L A;  2ZJR A;  4LFA Q;  1YJN A;  5H1S E;  4UPA A;  3CCS 1;  1W2B Z;  1GVP A;  1IL2 A;  1BBU A;  4RMF A;  3G6E Z;  2A1A A;  3AEV A;  4DR3 L;  1N36 Q;  4AYB G;  4MH4 A;  2AWO A;  1QUQ B;  3GTK I;  4JI8 Q;  2K5N A;  2GN5 A;  4JBJ A;  4A3K H;  1Z9F A;  1BVS A;  2VQF Q;  3TDH B;  3CCS A;  5HGQ A;  3HFZ B;  3BJU A;  5C0X I;  3DM3 A;  2JA5 I;  5GAE C;  1I94 L;  4A3E H;  2ZM6 L;  3F8T A;  2PI2 A;  3CC2 Z;  4DR5 L;  4A76 A;  4P72 A;  4DUY Q;  3GTJ I;  3D6W A;  3K8A A;  1N8R 1;  1Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...