3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4A3CH 2A19A 4DAMA 1EYGA 2RCNA 3CCRA 2E2II 3HKSA 4KI0A 2E2JI 4A3KI 3RZDH 3NBHB 2IX1A 4LF4Q 5C44G 1K8AC 1KHIA 4LF5L 5FJ8G 2K14A 2Q2TA 2DE7A 1J5EQ 2GVAA 3BZKA 3TS0A 3S2HI 2ALYB 3KJPA 4B3SL 3F1ZA 1XTDA 4JI7Q 1VQ7A 2RHSB 1YI2A 4DR6L 2D62A 4IFDG 4DV3L 1QVCA 3U50C 3Q87A 3SGIA 4L5RC 3EERA 4JYAL 1C9OA 1VQDA 3PO3I 1G51A 4AYBE 2ZTDA 4YCUA 1KRSA 1IBLQ 3S16H 3B6YA 2KBNA 3Q8DA 1HR0Q 4NB9A 4NXML 2NVQI 3G48A 2IT1A 3FKIG 4JC0A 4B3MQ 4X64Q 1TWAH 1KC8C 5FLMI 2UXBL 3KF8B 5FLXc 2CQOA 3I07A 1ASZA 3I56A 1OXSC 5JJIA 3E9IA 3TQYA 4GKJQ 3M7NA 3J7A5 3PO2I 1I50I 1XNRQ 3CMEA 4DAYB 2HF1A 2KENA 3GTLH 2CKZB 2VS1A 4JBWA 2HT1A 4JI6Q 3I4MG 4FDBA 2YYZA 4BBSG 3HKZE 3RZOI 2CFMA 4BA1I 1NE3A 4DK3C 3S1MH 3FHWA 2K5VA 1VQEA 3ERSX 1IBMQ 4LF9Q 1XMQQ 2C35B 1O7IA 3W1BA 2JA5H 4DR4Q 1D7QA 3HOYI 1WCMH 3GTPH 2NZHA 1UE7A 3STBC 1K83H 3MXNB 1XPRA 1K73C 4HIDA 1JB7A 3HOZI 2Z6KA 3TREA 4AQYQ 2HHHL 5GAHC 4TQUS 3GTKI 3H3VH 4GKKL 5IWAQ 4H02A 1FJGL 1K0RA 5GAEC 4DV6L 1PH8A 4QY7A 2PMZE 2OWOA 2VQFL 4X62L 2Y0SG 3UDFA 2OCEA 2B63G 5LMNQ 1EFWA 4WJ3M 1QVGA 4GN5A 2NVTH 2CWAA 1EWIA 1HZAA 4JI1Q 2VQEL 4C2MH 5M5YH 1N33Q 2JA7G 4TVAB 5C4XG 2ASBA 4JI2L 4LFCL 1QVFA 1W3SA 1HH2P 3MEFA 3PCOB 1EQRA 4MZ9A 2F4VQ 4RG1A 4APVA 2QEXA 4OWWB 1I6HI 4A3GG 3CC2A 2K4KA 1KRTA 1RLYA 1X3FA 1IYJB 4P74A 4DUZL 4BXXH 1E3PA 4UY8C 4JOIA 2JEAI 1VQAA 3HOWH 2HIVA 1VQLA 3VMGA 3S1RH 3M3YH 4OWXB 3U4ZA 4JI0L 4NBFA 4OO1I 3KOJA 4DR2Q 4LF7L 3RZOH 3M9BA 1VQPA 4NXNQ 3GTMI 1LM0A 4LUZA 3LUSA 4LUOA 1CKNA 4XX2A 1X3WA 1ML8A 1RO4A 2Z6KC 4JG2A 3I4NG 1YHBA 4IPCA 4R4TA 4JI5L 1FL0A 3PUYA 3I4MI 1JJ2A 3HOXI 4YY3L 4PZ6A 4JI8Q 3ICEA 1WOCA 1PA6A 3RN2A 3AQQA 5IP7G 5K36G 1PFTA 3HOZH 2UXDL 1DL6A 3LGJA 3NELA 1Y1WH 3CQZI 2RBLA 3I4OA 1PV4A 3K81C 1VS0A 3G71A 1GD7A 2R7ZG 4LFAL 2R7FA 2HIXA 3PUVA 1VQOA 4YWMA 5C0XJ 4DPGA 4DR7L 3CPFA 1TWFI 2F4MA 2R93G 4A3LG 1QUQB 4A3DH 4A93I 3A5UA 4JOIC 1R9TH 2UUAL 1Q7YC 5M3MH 4DV2Q 1N36L 1SFOI 4Y7NI 1A63A 1Q81C 1I6HH 5GAGC 5C4XI 3TRZA 1L1OA 1WFQA 3D31A 3D0FA 1E7ZA 3PIOA 4X65L 2IHEA 4LWCA 1GM5A 2VUMI 4DR1L 1YHQA 1JE5A 3U58A 3CPWA 4A3GI 3NENA 1SN8A 4HJ9A 1Q82C 4LF5Q 2N3SA 1L1OB 3GO5A 2MO0A 1N2FA 2J6AA 3T1HL 4BXXG 3G6EA 1UWVA 4A3JI 4A3EH 1QYPA 4B3SQ 2UXCQ 2Q2IA 4O2DA 2RF4A 3DLLA 1HZBA 4DR6Q 1ZB8A 4DV3Q 2HQLA 2AWNA 4JYAQ 4GLVB 1MJCA 1C7YA 1E1TA 2BH8A 4AYBG 4HJ5A 1DGSA 4IOAA 4NXMQ 4GOPA 2E5LL 4IJHA 3HOUH 1ZB9A 3HOVI 2BA1A 3KDFB 1HNZL 4A3IG 2AWOA 2AKLA 2JA6H 3K8AA 3EIVA 4BY1G 2KCMA 2EQSA 2MO1A 3GTGI 4GOPB 2ZTCA 3RLNA 3J81j 1X65A 4A3BG 1NBWA 1VQ9A 4LF6L 1Y1WG 1V43A 3M85A 2R92H 2VW9A 5JEAG 1IZ6A 3HKZG 1YHAA 3KYHC 1UE5A 1RIPA 2AMCB 2R7ZI 4R4IA 4QIWE 1L1OC 3K80C 1Y1VI 4B3RQ 2WAQE 4IO9A 4A93H 4A75A 3CCUA 3CCLA 3GTOH 5BR8L 1YZ6A 4BBRG 5C3EG 2K5RA 4DKAC 1V1QA 1YEZA 2HHHQ 4A3DG 2QA4A 3PSIA 4Y52H 1JJCB 4GKKQ 1V9PA 2LXJA 4NB3A 4EX5A 1FJGQ 1GVPA 4DV6Q 1U5KA 3CC4A 2IX0A 1TFIA 2VQFQ 4X62Q 4A3MH 4GLAC 3AFQA 2JA8G 3H15A 4A3JH 4DV1L 1N8RC 3H0GG 2GVBA 1EIYB 3S1QI 2I0QA 2F3IA 2VQEQ 4GOPC 1OXXK 2YTXA 4JI2Q 5IYCH 1N34L 5IP9I 3VDYA 2YU9H 4DK6C 4LFCQ 2I5HA 3PGZA 4OWTB 5IYDG 3ULPA 2EXDA 5AJ3L 3GCFA 1TWGI 1TXYA 1I3QH 4A3FH 3CCJA 2ZM6L 3T1YL 4A4IA 3S17H 4BY7G 2K50A 1G291 3WWVA 1PH2A 4DUZQ 2ID0A 3J80c 1TWHH 3JC66 4UP9A 4X6AI 2N49A 2E2IH 4JI0Q 3HOUG 4HJ7A 3CW2C 1PVOA 3S14I 2E2JH 5JJLA 2IHFA 2JA6G 4IFDJ 4A3KH 3GTJI 5C4JI 1YIJA 4BY1I 4LF7Q 4NPSA 1P8LA 4A3CG 1EIFA 1GKHA 4LF8L 4JBKA 4AIMA 4JI5Q 2MFIA 1OXVA 4A3BI 2B3GA 3NEMA 4JCVE 1Y1VH 2KHIA 5H1SE 4YY3Q 3U4VA 2R92G 3S2HH 1HNWL 3VMIA 2E8GA 1QZGA 1I94L 5C44I 4DV0L 4OONA 1NTGA 3HFZB 1PH9A 1SE8A 2UXDQ 2NZOA 2Z0SA 3PO3H 4C3JH 3J81c 4L5QA 1X54A 1EQQA 4IFDI 4GKJL 1CKMA 2NN6G 2K52A 5C3EI 3CF5A 4LFAQ 1X6OA 2WB1G 1Y14B 1KIXA 2NVQH 3I7FA 3EN2A 3UE0A 5FLMH 3KJOA 3RR5A 4DR3L 1FGUA 5LMUL 1FVIA 2K5HA 4DR7Q 1VQ5A 3PO2H 1I50H 3FKII 4YHHL 1VQKA 2CWPA 3S1NI 3GDEA 1KL9A 2K75A 2UUAQ 3BU2A 3H0GI 2IY5B 1VQBA 2UU9L 1MJEA 1N36Q 4KHZA 3F2CA 1TWGH 1VQMA 3JAMi 4DUYL 1YITA 1X9NA 2R7DA 5IYCG 3PUXA 3OTOL 4X65Q 1TWCI 4BBSI 4MNOA 4HJ8A 4DR1Q 3HOYH 1OXUA 5M3FH 5M5WH 1SMXA 1KD1C 4A3FG 1RL2A 1X3GA 1PH6A 4LFBL 3T1HQ 3GTQI 4X66Q 2JA5G 1PH7A 4OXPA 2H5XA 1XNQL 3GTKH 1WCMG 5JJKA 2PQAA 1LUZA 2UUBL 2MQHA 2DE6A 1HR0W 1MIUA 2OQKA 1QZHA 1QUQA 4DNIA 1Q8KA 2PQAB 2DUDA 4P75A 1JJGA 2JA9A 3W1GA 3BZCA 1XMOL 1NJIC 2E5LQ 1VQHA 2DE5A 3OYYA 2JS4A 2B63I 3RZDI 2YTVA 3JAMc 4JBJA 1HNZQ 4R4CA 3PIPA 4IJLA 1UEBA 2JA7I 4R4QA 4L5SA 3RLOA 1A8VA 4LF6Q 4A76A 4B3TL 1E22A 4JV5L 1OTCA 2BH2A 3ER0A 5EAYA 4L5TA 1K8GA 1NY4A 4DV7L 3RLFA 4AH6A 3CCSA 3FKIH 1EOVA 3S1NH 5FLMG 1VLAA 1CKOA 2JR6A 3S16I 4EQ5A 3HOWG 5BR8Q 4P71A 4JI3L 3GTMH 2WFWA 3F2DA 2Q2UA 3PO2G 2N78A 4JBMA 1USPB 3K7AI 1NUIA 4NOZA 5LMNW 3KF6A 3I4MH 3KDFA 2FXQA 3HOXH 1Q12A 1PH1A 4XTCS 3FP9A 1VQ8A 3H3VJ 3A74A 4K0KL 4POGA 1Q1BA 3I4NI 4R4OA 1G6PA 1B7YB 4QJFA 2MNAA 3KF6B 1IBKL 2ZJRA 3RN5A 2UXBQ 1A0IA 4DV1Q 3HOYG 1HZ9A 1U0LA 3CQZH 4GNXA 4YCVA 3J7ZC 5IP7I 1VQIA 3GD7A 1N34Q 3HOZG 1D8LA 4HJAA 1I5FA 3A5ZB 4NBEA 1LYLA 3M4QA 3CCQA 4DR5L 1WCMI 1XPUA 5AJ3Q 1YJWA 4GNXB 1K83I 3AFPA 5ELNA 2PI2A 2ZM6Q 3T1YQ 1S72A 3PF4A 4GN4B 1TWFH 2B63H 2L15A 3PO3S 1OXTA 4JI4L 3H3VI 5ELOA 2JEBI 3CC7A 1E1OA 2D0OA 1BVSA 4KHPL 3UDXA 2I5LX 1VQGA 4NBDA 1SFOH 2I5MX 2F4OA 4Y7NH 2JA7H 2R93I 1SR3A 5C4XH 4OX9L 3EBEA 2CCZA 1WW9A 4A3LI 4GLXA 2JQOA 3J80i 4HIOA 2NVTI 2UXCL 5M3MG 4HIMA 1PH5A 4QTUA 2VUMH 1IXRA 2JNYA 2D0PA 4PMWA 1HNXL 4LF8Q 2WP8J 1N32L 4RMFA 3PUWA 4A3GH 1P16A 2NVXI 3DM3A 2EIFA 5GROA 1SRUA 4IPDA 1HNWQ 1PFSA 1WYDA 1M90C 1I94Q 4DV0Q 2E2HI 1K3RA 4IOCA 1VQFA 2Q2HA 3E9HA 3STBD 3K7AH 5HY6A 4DV5L 4LW1A 2UUCL 4OO1G 3L0OA 4BXXI 2XGTA 4LUVA 1XPOA 1VQCA 4A3EG 4GNXC 3HOWI 3CD6A 1UE1A 3UDIA 4DV4L 4J15A 1MKHA 1BBWA 1HJPA 2AKWB 3S1RI 3M3YI 4YWKA 1YNXA 2ZJPA 1JT8A 5JEAJ 2OTLA 3I4NH 1W2BA 2LXKA 1GO3E 3HOVH 3J81i 3HOXG 1YJ9A 4DR3Q 5LMUQ 4QL5A 4YCWA 4LF4L 1BKBA 1E24A 4NBBA 1VQ4A 5J3BA 3L7ZC 3KLWA 1S40A 3BJUA 3GTGH 5IP7H 3S24A 4YHHQ 4ME3A 2AHOB 4UP7A 3K7UC 1L2FA 1J5EL 4B3RL 3CMAA 4A3II 2B29A 1KXLA 1NMGA 2UU9Q 4NBAA 4GN3B 4JI7L 4DUYQ 1AH9A 2R7ZH 3OTOQ 5M5XH 1YUAA 3KFUA 1X3EA 5GADC 2VZAA 1Y1WI 4C3HH 3CCVA 1B8AA 2YV5A 4UP8A 1IBLL 3CXCA 1H95A 1CUKA 1VCIA 1HR0L 4LFBQ 3M4OI 3VMHA 4IPHA 5IT9c 2R93H 3K0XA 4A3LH 4B3ML 4A93G 4X64L 2KHJA 1IL2A 1XNQQ 2OQ0A 1PYSB 2UUBQ 3AEVA 1C0AA 1Q86C 1KQSA 4MH4A 1LTLA 3OW2A 4BBRI 1XNRL 2NVXH 1J6QA 4GS3A 3F2BA 5DLQE 3S15I 4A3DI 2F52A 2NVYI 1BBUA 4PZ8A 4JI6L 1R9TI 3I2ZA 1VQJA 2VUMG 2PK7A 3GTMS 2YTYA 3F8TA 1XMOQ 1S3OA 3S1QH 4R1JA 2PI2E 4A3MG 2E2HH 2QGQA 1M1KC 1IBML 1PH3A 4LF9L 2ZJQA 2JA8I 5C0XG 1SROA 1XMQL 5IP9H 2JJQA 4DR4L 4A3JG 4MTNA 2DGYA 3M4PA 4PZ7A 2ES2A 1VQNA 3VB9A 3E0EA 4XIGS 4HIKA 4LNQA 4A3EI 4AQYL 4B3TQ 1Q1EA 4YWLA 1NMFA 2GN5A 4JV5Q 1PHJA 2BA0A 3W5OA 5IYBH 4NBCA 1HZCA 5IWAL 3UDGA 3ULJA 2Y0SE 4BA2I 1LQLA 4X6AH 1X55A 4QTTA 4DV7Q 4NB8A 2RHQB 4BY7I 1CSPA 3CCMA 2VNUD 5LMNL 3HOVG 4A3IH 3CAMA 3S14H 4QQBX 3S2DI 3GTJH 5C4JH 4BY1H 2VL6A 4JI3Q 1Z9FA 2LSSA 1CKNB 4JI1L 1A62A 1X3ZA 1N33L 3HOUI 2N8NA 2A1AA 1SLJA 2JA6I 4A3KG 4A3BH 3GKQA 1ASYA 2K5NA 2V1CC 3IRBA 4A3CI 3PUZA 2ATWA 2WB1E 2F4VL 4PG3A 1YJNA 4K0KQ 5C44H 4ALPA 3M4OH 5FJ8H 1X56A 2XTIA 4WJ4A 2JE6I 1K9MC 1IBKQ 1Y1VG 4P72A 5IY0A 1KAWA 2R92I 2ZTEA 1JMCA 2R6GA 1XJVA 4IPGA 2KPIA 3ZJYC 1Z47A 3ULLA 3TS2A 4BBRH 4O0AA 5C3EH 3PV0A 1VQ6A 3L2PA 3PF5A 3D6WA 3S15H 2BJOA 2NVYH 4DR5Q 3UE1A 1UE6A 4DR2L 3PO3G 1N9WA 3GTOI 1Q46A 1AE2A 1T9HA 4NXNL 5IE8A 4QGUA 2NN6I 1EUJA 1USPA 2JA8H 4Y52I 4JI4Q 2PNHA 3H0GH 4P73A 2WAQG 2VY3A 4KHPQ 4JI8L 4A3MI 1CSQA 4POFA 5C0XI 4OX9Q 4X66L 5IP9G 1TWAI 3AYHB 3CCEA 1PH4A 1YBYA 1TWCH 3A0JA 5IYDH 4BBSH 1HNXQ 5HGQA 1N32Q 2OTJA 4BY7H 3GTLI 2P3YA 3CP0A 2YU9I 4NBGA 2JK8A 3GTQH 1WI5A 1YVCA 4KLKA 1PYBA 5IYBG 3S2DH 2KCTA 4C3IH 5M3FG 1B70B 4NBHA 3S1MI 3TEHB 1I3QI 4A3FI 3S17I 2A8VA 1WJJA 4DV5Q 2UUCQ 3RNUA 1Y1VS 2JA5I 1AE3A 3I55A 3ESWA 5E7NA 1L0WA 3GTPI 4UPAA 1TWHI 4DV4Q 4DV2L 3G4SA 5GQOA 5CM2M
chains in the Genus database with same CATH superfamily
4A3CH 3CCJ1 4FXGC 4HMIA 2A19A 1ZYRC 3V2TA 1KTKA 4DAMA 3OW7A 1EYGA 2RCNA 3CCRA 2F0SA 2E2II 3MFYA 2AQ2B 3HKSA 4A3EB 1HPCA 5AN9F 1TY0A 3A7AB 1X32A 2JMOA 4KI0A 2E2JI 5G3LF 4O42A 1AFPA 4A3KI 3RZDH 5FLXE 3CRKC 1E2VA 5T6BA 3NBHB 2HCCA 1ICFB 1QNUA 2IX1A 2CQAA 1DONA 3NE5B 3K5NA 2B2YA 4QF4A 4LF4Q 5IGBA 3OMGA 1HFGA 1AW7A 1IW7C 1CM9A 3EJIA 2MGSA 1D2BA 5C44G 1K8AC 1KHIA 3BDLA 4LF5L 5FJ8G 1FDOA 1JOOA 5DM63 2K14A 2Q2TA 5IGCA 2DE7A 1J5EQ 3OPOA 3MZKB 2X6LA 2GVAA 3SK5A 3BZKA 3TS0A 3S2HI 2ALYB 4FF4A 1PTOH 3KJPA 4B3SL 4KKTA 5C3XA 2B39A 3NK9A 1I6VC 1EY4A 3F1ZA 1XTDA 1KD11 4IQZA 4JI7Q 4KKUA 1VQ7A 1MSGA 2RHSB 3HOUB 1AZQA 1YI2A 2BDNA 4DR6L 2D62A 4IFDG 1QVGY 1H9JA 4DV3L 3U9SA 2NN6H 5C4HA 1Q862 1QVCA 3U50C 2K04A 3Q87A 1EYDA 2F0JA 2JA6B 3SGIA 3K5LA 1SE3A 3TMEA 2JN4A 3C3LA 4L5RC 3EERA 4JYAL 1C9OA 1VQDA 2ZT9C 1R4QB 2R61A 2B2UA 5M9OA 2XN9C 3PO3I 3K57A 2L12A 4O1NA 1G51A 4AYBE 1PYWD 2ZTDA 2B2TC 4YCUA 2RDGA 1KRSA 1IBLQ 3S16H 3B6YA 2KBNA 3OWEB 3MC0B 1MGSA 1SYBA 3Q8DA 5CV9A 1HR0Q 5KNBA 1QVFY 4NB9A 1G2TA 3N52A 1H9KA 5EPKA 4NXML 2NVQI 1M1K2 3G48A 2IT1A 3FKIG 4DAYA 5G3LD 2R92B 1I4RA 3TE5B 4JC0A 4B3MQ 2E9HA 4X64Q 1TWAH 1KC8C 4IUQA 5FLMI 4KK7A 2UXBL 4OIJA 3KF8B 5FLXc 2KECA 2CQOA 4QUFA 2L9HA 3K58A 4U673 3I07A 1ASZA 3FRPB 1TWFB 3KLRA 2A6HC 3I56A 1OXSC 4TKOB 1BXTA 2M6NA 5JJIA 3E9IA 3TQYA 3M7NA 2QR1B 4GKJQ 3J7A5 2KUMA 1STBA 3PO2I 1NJI1 3FDTA 1I50I 1GUOA 1X3PA 4A93B 1XNRQ 3SEBA 3CMEA 4JW0A 4DAYB 2HF1A 5KNDA 2KENA 3GTLH 2CKZB 2VS1A 3CXCZ 1CT1D 4JBWA 2HT1A 4RGTA 4JI6Q 3GTOB 2ICEC 2DNCA 3I4MG 4FDBA 2YYZA 4BBSG 1ML0D 2MP1A 3HKZE 3RZOI 2CFMA 3BZDB 1RTNA 4BA1I 2BOSA 1NE3A 1VQ51 1MHWC 2NB0A 4DK3C 3S1MH 3FHWA 2K5VA 2KEDA 3X3MA 1VQEA 3ERSX 2XVSA 4WFN3 1XWEA 2V8JA 1NR2A 1IBMQ 1PZJD 3BVMA 4F7XA 4LF9Q 1VQK1 3NH4A 1AN8A 5K36H 1LTGD 3HZXA 4X3SA 1XMQQ 2DN8A 1KQSZ 2C35B 1HXYD 1O7IA 3W1BA 2JA5H 4DR4Q 3OW2Z 1D7QA 3HOYI 2B2YC 4A3MB 3D4WA 1GUNA 1WCMH 3GTPH 1I4XA 4XT3B 2NZHA 1UE7A 4NP5A 4HGYA 3QWUA 3WDNA 3STBC 2G2KA 1K83H 3IKJA 3MXNB 1YIT1 2JUBA 1XPRA 3T4NB 1K73C 4HIDA 4P2CB 4HMJA 4A3JB 1ESFA 1SIWA 1H9SA 1JB7A 3HOZI 2Z6KA 3TREA 4AQYQ 1L0XB 2HHHL 4K2KA 5GAHC 1VQ5Z 4TQUS 3GTKI 1HA6A 2LFUA 4RVGA 1PFMA 2EYJA 2PZTA 5CV4A 4IUTA 3H3VH 4GKKL 2F0NA 5IWAQ 1WTHA 4H02A 1FJGL 2V8IA 1K0RA 5GAEC 4DV6L 1PH8A 4QY7A 2YU9B 2PMZE 3MXGA 2OWOA 2VQFL 4X62L 2EPBA 2Y0SG 4N9PA 2D5DA 1BOSA 2OCEA 2ZXPA 4RVHA 2Z4IA 3UDFA 5LMNQ 1EFWA 2B63G 2B2UC 4WJ3M 4HN7A 1KNAA 1QVGA 3OIQA 4HR7B 1K9M2 2PZUA 2PQEA 4GN5A 2KA7A 2OT2A 1I3QB 4CL1A 2NVTH 1YITZ 1MSHA 3S17B 2CWAA 1WJ2A 3TSSA 5EBDA 4E30A 1LV9A 1EWIA 1WTRA 4S3SA 1HZAA 2H85A 4JI1Q 3N6RA 3HOVB 2VQEL 2PZWA 4C2MH 5M5YH 1LT6D 1N33Q 2JA7G 4ZUJA 1B3AA 4TVAB 2PCFB 5CR3A 3J7YW 2ASBA 1A3UA 5C4XG 1S5ED 4PQXA 4JI2L 1VMPA 3J80f 2AQ3B 3ND9A 5A35A 4LFCL 1QVFA 1F9SA 1W3SA 1HH2P 3MEFA 3PCOB 1EQRA 5C4ZA 1I4PA 4MZ9A 2F4VQ 2EYLA 4RG1A 2R6MA 4APVA 2QEXA 2E2JB 4OWWB 1I6HI 4A3KB 3I91A 3CC2A 4A3GG 2XWJB 2K4KA 1I4QA 1LTID 2Q8RE 2CW0D 1RLYA 1KRTA 5KIXA 1ENFA 4QUCA 3FPUB 1X3FA 3MTSA 1F2LA 1IYJB 4P74A 4DUZL 2QRDB 4BXXH 4CDDC 3KK7A 4NW2A 1E3PA 4UY8C 1BR9A 3W3AA 2TMPA 4JOIA 2JEAI 3AB9A 1VQAA 3HOWH 3P5JB 1F2YA 4JK1C 2HIVA 1VQLA 4RVFA 1Y1VB 3VMGA 3S1RH 3M3YH 4OWXB 3U4ZA 4ZCKA 2PM9A 3BS1A 4JI0L 4NBFA 3S2HB 4DFAA 3KOJA 4OO1I 4KHVA 1HQRD 1DOKA 3NDIA 4DR2Q 2RA4A 5IOCA 2B8FA 1YJNZ 1ET6A 2K32A 3ND8A 1DZ1A 1SEBD 3VR3A 2IX3A 4LF7L 4WJWA 3RZOH 3M9BA 1VQPA 4LK1C 4NXNQ 3GTMI 1LM0A 4LUZA 2DY7A 3S2DB 3LUSA 1BCPB 1PFBA 1WD1A 4LUOA 4DF7A 2O4HA 3FVQA 3CCS1 1CKNA 4XX2A 1X3WA 1ML8A 1RO4A 2Z6KC 4TSSA 4C3JB 3PO3B 2YADA 4JG2A 3K5MA 2F0WA 3I4NG 1YHBA 1CI3M 4IPCA 1EYCA 2ICIA 4R4TA 4JI5L 1FL0A 3J7A4 5EPJA 4I65A 2WAQA 3PUYA 3I4MI 4RHSA 1JJ2A 2GTHA 3J81f 4J8QA 3MAQA 5K5PA 3HOXI 4YY3L 4PZ6A 2JIPA 4JI8Q 2IV2X 4LJZC 3CHBD 2NVQB 4ME5A 1WTOA 3ICEA 4OIKA 3TN2A 1WOCA 1PA6A 3RN2A 3C2PA 1X0TA 3AQQA 4OHJA 1A15A 4CJ1B 1GUWA 1KNEA 4C1NK 3T51B 5IP7G 5K36G 1PFTA 1BCPD 3HOZH 2WAQB 2UXDL 2JIQA 1DL6A 3LGJA 4HEDA 2EZVA 2MPMA 1B1ZA 4QCLA 3NELA 1Y1WH 3CQZI 2RBLA 3CCSZ 3I4OA 1I50B 1DM0B 1PV4A 3R2TA 3K81C 1M901 1KLGD 1VQ81 1VS0A 5C5MA 3G71A 1GD7A 2LIYA 1EY7A 1F2MA 2R7ZG 1KDAA 4LFAL 1S4ZA 2JP1A 2KEEA 1P9NA 2R7FA 2HIXA 2K7VA 1TWGB 2SOBA 3PUVA 4C3HG 2Q8IB 4CKEA 3OIPA 1VQOA 4MHEA 5HGTA 4YWMA 1DJRD 1SYDA 1V1PA 1OO9B 4L63B 5C0XJ 1EU3A 1XXGA 4IN3A 4E6IA 1TS2A 2GU2A 4DPGA 4DR7L 2QLVB 5DNFA 1RHPA 3LWUA 1SAPA 3CPFA 1TWFI 1K8A2 2DY8A 2F0DA 2SNMA 2F4MA 2R93G 3HOYB 1JQYD 5M3FB 5T67A 5M5WB 4A3LG 2OOYB 1QUQB 2B2VA 3DXJC 4A3DH 1SSOA 4A93I 5AFWA 5L37A 2VPZA 3A5UA 1VQ8Z 4JOIC 2XRSD 3K0YA 3MEHA 1D1KA 1R9TH 2UUAL 1Q7YC 5M3MH 4DV2Q 5C5LA 3J80L 1S721 1N36L 1SFOI 4CGYB 4Y7NI 3NHHA 5BN4A 1Q81C 1A63A 1DCZA 5GAGC 1I6HH 1UNSA 5C4XI 3TRZA 3I73A 4I7AA 5FO8B 1L1OA 1BBXC 3GTKB 1WFQA 1CA5A 2TSSA 3D31A 3D0FA 1E7ZA 3A8IE 3PIOA 4X65L 3TDQA 3MWYW 3CC71 2IHEA 2CH4W 4LWCA 2Z9HA 1GM5A 3R93A 4EQOA 2VUMI 5DM73 3IF8A 3VA7A 3F3FC 4DR1L 2QDLA 1VF5C 1YHQA 1JE5A 3U58A 2SEBD 2Z6BA 3RUZA 3CPWA 3P1HA 4KY5A 3GQBA 4RHRA 4A3GI 4CJ0B 3NENA 1ONLA 1SN8A 2A68D 4HJ9A 4RA8A 1Q82C 1XTCD 4LF5Q 2A74C 2N3SA 2EYMA 1L1OB 3G6JB 3GO5A 4C1NI 2MO0A 1N2FA 2J6AA 4E31A 3T1HL 1CHPD 4KV6A 3VYTA 4BXXG 2NTTA 3CU7A 3G6EA 1S72Z 1KC82 1UWVA 4A3JI 4A3EH 1QYPA 3SDZA 4B3SQ 5C44B 2UXCQ 2Q2IA 1RO2A 4E2YA 4O2DA 2RF4A 3DLLA 3IX0A 4IALA 1HZBA 4DR6Q 1ZB8A 4DV3Q 4PMCA 1Y8OB 2G5DA 2CHBD 2PMZA 2HQLA 3JAMf 3CC7Z 2MHVA 4CHTB 3LX0A 3DM1A 2AWNA 3VR4A 1AA6A 4JYAQ 2VPXA 3C46A 1KDBA 4N9TA 4GLVB 1LABA 1QCBD 1U4MA 4RWSC 4KD4A 1MJCA 2M00A 2RKSA 2K33A 1PRTF 1NSNS 1C7YA 3D4DA 3IFUA 1E1TA 2BH8A 4AYBG 3J81L 1QWYA 1Q861 3J80b 4HJ5A 1DGSA 4IOAA 4KTAA 4NXMQ 4GOPA 1EZ8A 3EQLC 2E5LL 1QILA 3HGBA 4IJHA 5HURA 3HOUH 3A7LA 1ZB9A 3HOVI 2BA1A 5I4DA 3QR8A 3KDFB 1HNZL 4A3IG 2AWOA 1FDIA 1CHQD 2AKLA 5JVG3 2JA6H 3OSOA 3NBHA 3CD61 3K8AA 3EIVA 4BY1G 1LTRD 3MXPA 4HH4A 2KCMA 2A68C 2EQSA 1EWCA 1BF4A 3FKIB 3VR2A 2F4IA 4MN3A 2MO1A 5I9PA 4FF1A 4RS4A 3GTGI 4GOPB 3S1NB 1O80A 2OTL1 2ZTCA 5C6AA 1K732 1M1K1 3RLNA 1A3TA 4RV9A 1QE6A 3J81j 2B2VC 4IUNA 4KN7C 1EYAA 2QKIC 1E2ZA 1X65A 4H0LC 4A3BG 1PRTB 1YJ91 1NBWA 2FJ2A 4XQQA 5CC4A 1LTSD 1VQ9A 3GTMB 4LF6L 1Y1WG 1V43A 5T1IA 3M85A 3D8GA 2R92H 4CBVA 2VW9A 5JEAG 1IZ6A 1CFMA 3TZUA 1VQ41 2V8KA 3TZDA 3HKZG 1YHAA 3KYHC 1UE5A 1RIPA 2AMCB 1FNWA 2R7ZI 4R4IA 4QIWE 1L1OC 3K5OA 1PZID 3I56Z 3I4MB 1NUCA 3CD6Z 4IUPA 2KVMA 1H9RA 3HOXB 3CMA1 1SNMA 2HDLA 3K6OA 4KJNA 1CQVA 2JSOA 2HD3A 3K80C 1Y1VI 4B3RQ 1AEXA 2WAQE 4RGNA 4IO9A 4EGVA 4A93H 1Z02A 5COYA 2K5QA 3D2LA 4A75A 3HRZC 1GHJA 4JVZA 2F0TA 1PRTD 3CCUA 3CCLA 2E76C 2OTLZ 3U9OA 5D1PA 4DAPA 3GTOH 1W2BZ 4RCOA 3T16A 5BR8L 1YNJC 2F0PA 1SYEA 2BCOA 2K1BA 1YZ6A 4BBRG 3J81b 1YJ9Z 5C3EG 3GV3A 2K5RA 4DKAC 2H4OA 2R3ZA 1ILPA 1V1QA 1YEZA 2QCPX 2WKDA 2QA4A 2HHHQ 4A3DG 3PSIA 3CQZB 2ENBA 1VQ4Z 4R9WA 3J80E 3R3OA 4Y52H 1JJCB 3CCV1 4GKKQ 1V9PA 3KF8A 5KEEA 1T5XD 2LXJA 2NBFA 3FEWX 4NB3A 4EX5A 1FJGQ 1GVPA 4DV6Q 1U5KA 3CC4A 1RNIA 3CMAZ 2IX0A 1QXFA 1TFIA 3TDHB 2VQFQ 4X62Q 4A3MH 3A54A 4GLAC 3QB3A 1GUGA 3AFQA 2F0HA 2QREB 1GJXA 1JC7A 2JA8G 5C0XH 3E5SA 3NQTA 2AQ1B 1BDOA 3TBIB 2F0MA 2JIOA 3H15A 1JOQA 1WTWA 4A3JH 2ZXRA 3BDCA 1NAPA 4DV1L 1SNQA 1N8RC 1Z03A 4CKCA 3H0GG 2GVBA 3F2BA 1EIYB 2VXWA 3S1QI 1K8MA 4CDEC 2B63B 3A8KE 2I0QA 2F3IA 5D65A 4G7ZC 1O7YA 2VQEQ 4GOPC 1OXXK 1ESRA 2K28A 3PMFA 4XYOA 2YTXA 1IYUA 3CCVZ 2EJFC 4JI2Q 2RHBA 5IYCH 1N34L 5IP9I 4IZ8A 3VDYA 1K9M1 1PRTC 4DK6C 4F88A 2YU9H 1B44D 4LFCQ 2I5HA 2PO4A 3PGZA 3JAML 4FP5D 1SFOB 1B50A 2L1BA 4Y7NB 4OWTB 1B9NA 1B2TA 3C1EA 2AUKA 2RCFA 3GP7A 5EKLA 2AUJD 5IYDG 2K5DA 3ULPA 2JA7B 2P28A 4ZAIA 2EXDA 2W03A 3GCFA 1QVGZ 4V0BA 1TWGI 5AJ3L 5C4XB 5ELBA 1TXYA 1I3QH 4A3FH 1UAPA 3CCJA 5F2DA 2ZM6L 4A4IA 3T1YL 3S17H 3MXNA 4EQNA 4BY7G 4HAEA 2K50A 2WIIB 1G291 3WWVA 1PH2A 1YNND 2VUMB 4DUZQ 3NH8A 1FNVA 1U9RA 2EGTA 3D4RA 3ZYYX 2ID0A 2A73B 3J81E 4NDXA 3J80c 2F0VA 4J1MA 4KN4C 1XYIA 1HRJA 4C3IG 4A3GB 1TQOA 1TWHH 1W6JA 3JC66 4UP9A 4X6AI 4K8JA 1QVFZ 4RCNA 4FXDA 2M48A 1VQN1 2PYKA 2WV6D 2XRQD 1JJ2Y 2KQ3A 2N49A 2E2IH 3ONAB 4JI0Q 1PFNA 3HOUG 1IYVA 1ZKOA 4HJ7A 3CW2C 2QEXZ 4RGMA 1PVOA 3S14I 2E2JH 5JJLA 4EVOA 2IHFA 2JA6G 5ELCA 4IFDJ 1D5ZC 4A3KH 3GTJI 1Y8NB 5C4JI 1YIJA 4BY1I 3KBXA 1DOLA 2SNSA 4LF7Q 3FQQA 5CORA 2ZAEB 3KIFA 4NPSA 1P8LA 3K7AB 3LNNA 1CTMA 4H44C 1KRLA 1W6KA 1EIFA 1GKHA 2PW5A 2X69A 4A3CG 1K28A 4OGQC 3G7LA 4LF8L 3CCM1 4JBKA 4AIMA 5JPMC 1WTQA 4JI5Q 2MFIA 2LS01 1OXVA 4A3BI 2B3GA 3VR6A 2DJFC 3NEMA 4JCVE 1Y1VH 5LHY1 2KHIA 5H1SE 3K59A 3Q22A 4YY3Q 4DQYB 2O2LD 3U4VA 2R92G 5CBAE 1VQNZ 3JAMb 3S2HH 2JYOA 1HNWL 2L4NA 4CDCC 3VMIA 4BS9A 2E74C 3I4NB 2E8GA 1LO5D 3KLSX 3DEPA 1QZGA 1I94L 5C44I 3IFDA 4DV0L 4ZQ3A 1BO0A 2CVRA 2RPRA 3F3PC 5I2YA 4OONA 1D5XC 2L5TA 1VQPZ 2EY5A 3NWTA 4MD8A 1NTGA 2CH4A 3HFZB 1PH9A 1SE8A 1E0BA 3SK4A 3PIO3 2UXDQ 2WINB 1IKMA 2NZOA 2Z0SA 1G6ZA 1SBBB 1LLRD 3PO3H 4C3JH 1HTLD 2M2LA 1M4VA 4R8IA 3GTGB 3CCMZ 1Q7Y2 3J81c 2IWHA 4RH6A 4L5QA 1X54A 2KJXA 5LL6X 1WZNA 3SE0A 1EQQA 4IFDI 4GKJL 1YJN1 1CKMA 2NN6G 1SYGA 1O7LA 4XT1B 4ZKBB 1ENAA 2K52A 5C3EI 3NTIA 1Q812 3CF5A 3DHQA 1S5CD 4LFAQ 3T56B 1X6OA 4CDFC 2WB1G 1Y14B 1KIXA 4RKLA 1GXDC 4RAUC 2NVQH 5I6YA 3I7FA 1BCPF 1RCVD 3EN2A 4IURA 1Q8IA 1JB3A 2O5JC 1HQMC 2MUYA 3UE0A 5FLMH 5IGEA 3KJOA 2BE5D 3RR5A 4DR3L 2RQXA 2R7ZB 3KUPA 1FGUA 5J1ZA 1FVIA 5LMUL 2K5HA 3P75A 2GA4B 4L8JA 5M5XB 4DR7Q 1SE2A 1VQ5A 4HCEA 4TNUA 1TR5A 4H13C 1VQ61 3NFZA 3H09A 3PO2H 4C3HB 4ILWA 1Q822 1I50H 3DWPA 3FKII 2EVBA 2Z8LA 1D5MC 4YHHL 2P5ZX 1VQKA 3NSWA 4WRDA 2CWPA 4X3TA 3G71Z 3NDJA 3S1NI 3GDEA 3AU7A 5IGGA 3CPWY 1KL9A 2K75A 2UUAQ 3BU2A 3H0GI 1RTOA 2IY5B 1MI2A 1VQBA 4HCSA 2UU9L 4UHVA 1MJEA 1N36Q 1XX8A 3A56A 4KHZA 1F9PA 2R93B 3F2CA 1DOMA 1TWGH 1VQMA 4NMZA 5IT9f 2W04A 1VQOZ 1K8A1 1ZEQX 3JAMi 1F9RA 2QEJC 4MD9A 4DUYL 1YITA 1X9NA 1LT3D 2R7DA 5IYCG 3PUXA 3JAME 5CV5A 2MJ8A 3OTOL 4X65Q 3BYTB 3BG3A 2HU9A 1TWCI 3FMCA 1ILQA 1YHQ1 4BBSI 4MNOA 4HJ8A 4DR1Q 1VQ6Z 3HOYH 1OXUA 1JWUD 3C1FA 4CKBA 5M5WH 5M3FH 2J7ZA 3VTNA 1SMXA 3MVVA 1KD1C 2NVXB 4BWGB 1RDPD 3HG9A 4A3FG 2CW0C 1RL2A 1X3GA 1WTPA 3A8JE 5EJWA 1CZWA 4C56C 1PH6A 2A6ED 4LFBL 1SNPA 1GUTA 3T1HQ 3SK6A 3GTQI 3CCE1 1EY9A 2V4DA 4X66Q 2IZ4A 2JA5G 1PH7A 2HCIA 1FYCA 4OXPA 1UEAB 3S1QB 1RJTA 1FGBD 4KMUC 1SNDA 2H5XA 1XNQL 2E2HB 1GUSA 3GTKH 1WCMG 2IZ3A 4FNFA 5JJKA 1VMCA 5IGDA 3BYYB 2PQAA 2E7ZA 1V1OA 1LUZA 2OTJ1 2UUBL 3MZ5A 2MQHA 3BG1B 1S5DD 3BDOA 3NP8A 2DE6A 3VYSA 1HR0W 3VR5A 1HFNA 1Z6HA 1YHQZ 1K0SA 2RBMA 1SE4A 1MIUA 1HHVA 3UI2A 1KC81 2OQKA 3EEDA 3NUCA 1QZHA 2KOLA 1QUQA 5KGUA 4DNIA 1Q8KA 1STNA 2PQAB 3OMCA 2E75C 2DUDA 3IFTA 3RD4A 4P75A 2HUGA 1JJGA 2JA9A 1VF7A 3W1GA 3CCEZ 3BZCA 2PPBC 1SYCA 1XMOL 4ABNA 4ZUIA 1NJIC 5A2Qf 2QDBA 5EGTA 2E5LQ 1VQHA 2DE5A 3OYYA 2JS4A 4PNYA 2B63I 3RZDI 4DK1A 1Y8PB 2YTVA 3JAMc 3IR7A 3I551 4JBJA 1EEFD 1HNZQ 2OTJZ 1QF8A 1A2UA 4R4CA 3G4S1 2EY1A 2IW3A 5I9OA 1RQFA 4Q5VA 3PIPA 4IJLA 3OWFA 2A6EC 3CCR1 4IUVA 1UEBA 1JORA 3URYA 4IFDH 1F2ZA 3H91A 5CV8A 1BCPC 3NXWA 4A3IB 3S14B 2JA7I 1HUMA 4R4QA 4M1UB 4L5SA 3GTJB 3RLOA 5C4JB 1A8VA 4BY1B 2FMCA 2EY6A 2EYOA 3MONA 3IL8A 2C9OA 1JE4A 4LF6Q 4FO2A 4OELB 4A76A 4B3TL 1E22A 4LMQD 4JV5L 4JPBW 1OTCA 1JWSD 2F0KA 3CRLC 2BH2A 3ER0A 5EAYA 1HTPA 4L5TA 3I55Z 4DGLA 1K731 4A3BB 3F2UA 1K8GA 1NY4A 4Q0FA 4DV7L 3RLFA 4AH6A 4V190 3CCSA 4LAAA 3G4SZ 3FKIH 3DUZA 4RGOS 1EOVA 4OO1H 5D3IB 2EXZA 3S1NH 5LL6S 5FLMG 3CCRZ 1VLAA 3HKZB 3S9WA 4NH1C 1YUKA 2V45A 2QRCB 2XSCA 4ULLA 1CKOA 1D1IA 3I8ZA 2JR6A 1N8R2 1VQ71 3S16I 3T4AC 4EQ5A 4KKSA 1YI21 2D9UA 1A6XA 3M4OB 2K3RA 4DNRB 1PZKD 3KIHA 3HOWG 5ISRA 5BR8Q 4P71A 4JI3L 4XYQA 5BN5A 2WFWA 3GTMH 1TVXA 3F2DA 2Q2UA 3PO2G 2N78A 4JBMA 1USPB 3K7AI 1NUIA 1ZYRD 1QG7A 4NOZA 3QWNA 5LMNW 1C4QA 1PXUA 5IT9L 2LMCB 1WD0A 1EU4A 2VF1A 4DA2A 1EY8A 3KF6A 5KRUA 3I4MH 3KDFA 1HCZA 4UAIA 2FXQA 2RDFA 4BBRB 3HOXH 1Q12A 1B3QA 1ZXTA 2NAPA 5C3EB 3KBGA 2F0UA 2KCNA 4XQNA 4XDXA 1PH1A 3S15B 5J22A 2NVYB 1IW7D 3M4YA 4XTCS 3FP9A 1VQ8A 3H3VJ 4YIJA 3A74A 4K0KL 1TY2A 2G9DA 4POGA 1Q1BA 3WOEA 3I4NI 4R4OA 1Y69U 4N8FA 1G6PA 1B7YB 4QJFA 1VQ7Z 1YI2Z 1JOKA 2C5CA 2MNAA 5CBEE 1EY0A 3KF6B 2FFKB 2ZJRA 3RN5A 1WVLA 1U4LA 1A0IA 4DV1Q 1IBKL 2UXBQ 1JWHC 1ZH1A 2EE1A 3I561 3HOYG 1HZ9A 1U0LA 1WTVA 3Q23A 1TIID 3CQZH 4GNXA 2JA8B 3Q0AA 1B9MA 1JICA 4YCVA 3CME1 4OL7A 1JCKB 3J7ZC 2GTIA 5IP7I 1VQIA 3GD7A 1N34Q 2XWBB 2G9HD 1D8LA 4KY6A 4B9XA 4HJAA 3HOZG 1I5FA 3H0GB 1X3QA 3A5ZB 4NBEA 1PDQA 2K03A 3EA6A 1STHA 1LYLA 3M4QA 3CCQA 4DR5L 1WCMI 5JJZA 1XPUA 5FK9C 4K5XA 1Z01A 1S5FD 5AJ3Q 1YJWA 4GNXB 1K83I 3MZLB 3AFPA 1II3A 1KDCA 2PI2A 5ELNA 5IIFA 3Q6SA 2ZM6Q 3T1YQ 1S72A 3I3CA 3PF4A 4GN4B 1TWCB 1AZPA 1TWFH 2EDGA 2B63H 2NZ1D 1QOHA 2L15A 4BBSB 3PO3S 4U68A 1LTAD 2BDOA 1EIHA 1OXTA 1SNOA 5A2QL 1RODA 4JI4L 3X3NA 5IT9b 1SXTA 4GZYC 3H3VI 2B2WA 4ID6A 2JEBI 5ELOA 3CC7A 3CMEZ 1K8OA 3MA2B 1E1OA 5EPLA 3SR1A 5KNCA 4BY7B 2D0OA 1BVSA 4KHPL 3UDXA 5FOBB 2F1MA 1EQVA 1VQGA 2I5LX 2A6HD 4NBDA 2LKVA 1SFOH 2I5MX 3GTQB 2FINB 2F4OA 3VYUA 4Y7NH 2I46A 2O53A 2JA7H 2LEXA 2R93I 1SR3A 3ERQA 3V96A 5C4XH 4OX9L 3EBEA 2CCZA 5E4XA 3QJYA 3P7JA 1WW9A 3VA5A 4A3LI 3A55A 1YIJ1 2L55A 2OF1A 2JQOA 3J80i 4DNTB 4HIOA 5D1OA 4GLXA 3CCJZ 2NVTI 3CXCY 4NKLA 1S7MA 5T1GA 2N88A 2UXCL 3QOJA 4EQPA 5M3MG 4S1TA 4HIMA 3SXHA 1PH5A 4QTUA 2VUMH 1IXRA 2JNYA 2D0PA 4PMWA 3GTPB 4XQJA 5CV7A 2Y0SA 4E32A 1SNCA 1HNXL 1LT4D 2JIRA 1RKNA 4LF8Q 2WP8J 1N32L 4RMFA 3PUWA 4A3GH 2LFNA 1P16A 2NVXI 3DM3A 5LL6f 4QMGA 4G7HC 2EIFA 3BVZA 5D1OB 1EEID 5E1FA 2FMMA 1KQSY 5GROA 1PTOF 5C3WA 1FNUA 3RMHA 3OW2Y 4HTHA 1SRUA 1VDZA 4E2WA 4IPDA 1HNWQ 1PFSA 4M8AA 1WYDA 4EWCA 4K14A 2Y0SB 2EYHA 4WORA 5FO7B 5FO9B 4DAVA 2F0OA 5JOBA 3NTKA 1M90C 2VPYA 1I94Q 4DV0Q 3MXUA 3RZDB 3J7AF 2JIMA 1YIJZ 2E2HI 1K3RA 4IOCA 1D6EC 1G8ZD 1VQFA 2Q2HA 1TU2B 3E9HA 4Z9CB 3STBD 1NCVA 3K7AH 5HY6A 4DV5L 3CKIB 4J6HA 4LW1A 2UUCL 1O78A 4OO1G 3L0OA 4BXXI 2XGTA 1SMYD 3QOLA 4LUVA 1XPOA 1Y8CA 1VQCA 4A3EG 2L11A 1STEA 5A2Qb 5IGFA 4GNXC 3HOWI 3CD6A 1UE1A 2QEX1 4PMBA 3BG0B 1CK1A 4J15A 1MKHA 3UDIA 2JXMB 4DV4L 1BBWA 2WB1A 1HJPA 5BN3A 1EQTA 3CC21 2AKWB 3S1RI 3M3YI 4B08A 2F03A 4YWKA 2F0LA 4DGZA 1YNXA 5IT9E 2ZJPA 1JT8A 5CMDA 1S5BD 1TKWB 1LTTD 1PTOB 5JEAJ 5CV6A 2OTLA 3I4NH 1CQFA 1E2WA 1W2BA 2LXKA 5I2XA 1UUPA 1GO3E 5JPNC 3ITPA 3J81i 3HOVH 5J39A 5EKIA 3HOXG 1YJ9A 4RFBA 4DR3Q 2I07B 1Q7Y1 5EKKA 5LMUQ 4QL5A 4YCWA 4LF4L 1BKBA 1ET9A 4E2XA 2OEOA 2WB1B 1VQL1 1KD12 1E24A 4NBBA 1VQ4A 5J3BA 1Q811 1RF2D 3L7ZC 2D2CC 3KLWA 1BUVT 1S40A 2DJGC 3BJUA 3GTGH 5IP7H 4UDUC 3S24A 1A3VA 4YHHQ 4ME3A 3TP5A 2AHOB 4UP7A 3K7UC 1C8CA 1L2FA 3KLSA 5DEHA 3DEOA 1J5EL 4B3RL 3S16B 3CMAA 2B2WC 4A3II 1PTOD 1U4PA 2B29A 3TP8A 1DD2A 1KXLA 1B4OA 4HSVA 3CC2Z 1NMGA 1TT2A 3PQIA 1VQP1 1SJED 2UU9Q 1WTXA 4NBAA 1VQM1 1HUNA 2FHTA 4FXKC 4GN3B 4K5WA 1G91A 1RO0A 1L0YB 4JI7L 2I3CA 1TWAB 4DUYQ 4I7ZC 4DK0A 5IODA 1Q821 3BVGA 1SMYC 4PV1C 1AH9A 1F77A 2R7ZH 1R4PB 2EOTA 3OTOQ 1EL0A 1RD9D 5M5XH 2EYFA 5FLXf 1YUAA 2F0FA 4MD7A 4QB4A 3NTHA 3MFGA 1U4RA 3KFUA 1X3EA 5GADC 1VQLZ 2VZAA 1EIGA 1Y1WI 4C3HH 4IUUA 4KY7A 2NTSA 3HEJA 1EWHA 3H6MA 1EOTA 1VQKZ 3PIP3 5ELDA 3L9AX 1J8IA 3CCVA 1STGA 1I4HA 3W2DA 1B8AA 2YV5A 1C48A 4UP8A 3GTLB 1IBLL 3NBIA 3CXCA 1H95A 1CUKA 1VCIA 1A2TA 1FD7D 1H9SB 1YNNC 1HR0L 1NJI2 4LFBQ 1T5EA 5A2QE 3M4OI 2Q51A 3VMHA 4IPHA 5IT9c 2RVLA 2R93H 1IHZA 3K0XA 2XIWA 4H7BA 4A3LH 1VQMZ 4B3ML 3EROA 4G4KA 3S1MB 4A93G 4X64L 2KHJA 3MHBA 4A3FB 1IL2A 4K5VA 1XNQQ 2EJGC 2OQ0A 1PYSB 2UUBQ 1SDFA 3AEVA 3G711 4G7OC 1C0AA 2VUGA 3FPPA 5E3FA 2F0IA 1Q86C 1KQSA 2JA5B 4MH4A 1ICWA 1JJ2Z 1LTLA 3EFXD 3OW2A 4BBRI 3R8BA 1M8AA 1PTOC 1XNRL 1MD2D 1PMRA 2NVXH 3TP6A 2F0GA 1J6QA 1WCMB 2K01A 2OXPA 3QG1A 4FVMA 4GS3A 3S15I 5DLQE 1TWHB 4A3DI 2X6GA 4CJ2C 2F52A 3J7AV 2NVYI 1EFID 4ZYSA 1BBUA 4PZ8A 1VQO1 4FYDA 4JI6L 1R9TI 1K83B 3I2ZA 1VQJA 2VUMG 2E2IB 5D3DA 2PK7A 3GTMS 2YTYA 1EY5A 2RDHA 1J9OA 3F8TA 1XMOQ 1S3OA 3S1QH 4R1JA 2PI2E 2F0EA 4A3MG 2E2HH 2QGQA 3AMUA 1M1KC 1IBML 1KABA 1PH3A 4LF9L 1PLFA 3R2IA 2ZJQA 4E33A 2QKDA 2JA8I 5C0XG 1SROA 4ZKCB 1XMQL 1STYA 1Q16A 2KCCA 2K6AA 3I90A 4XXEA 2JJQA 5IP9H 2O4XA 4DR4L 1G2SA 4A3JG 4ZLTF 4MTNA 2DGYA 2QILA 4ZK9B 5EBCA 3M4PA 1LTBD 4PZ7A 2ES2A 3IAYA 1STAA 2NVTB 3NWSA 1VQNA 3VB9A 5EQ0A 3E0EA 4XIGS 2K05A 4MTKA 4HIKA 4C3IB 4LNQA 4A3EI 4AQYL 2HDMA 4G57A 4B3TQ 3DWQA 1Q1EA 2Q4ZA 4YWLA 1NMFA 3FQMA 2GN5A 4JV5Q 1PHJA 2BA0A 4N8X1 4C2MB 5M5YB 3W5OA 5IYBH 4NBCA 1EY6A 1DYQA 1HZCA 5IWAL 3UDGA 3ULJA 2Y0SE 4BA2I 1ENCA 1LQLA 4X6AH 1X55A 4QTTA 4ZRZA 4DV7Q 4NB8A 2RHQB 4BY7I 4L6TB 1CSPA 3T53B 2XNAC 3CCMA 2VNUD 3G6E1 1BQQT 5LMNL 4MIUA 3HOVG 3O13A 2BE5C 4A3IH 3CAMA 3SVMA 3S14H 4QQBX 2QF7A 3E6ZX 3S2DI 2A5HA 3GTJH 2Z1CA 3P20A 4KJOA 5C4JH 1TS5A 4MXUA 4BY1H 5CGKA 2VL6A 4X3UA 3HP3A 4JI3Q 5ELEA 1Z9FA 2PW7A 4QIWB 2KI7B 2LSSA 1NNXA 2KHSA 1CKNB 2SDFA 4JI1L 1A62A 3V05A 2VPWA 1X3ZA 2RT9A 1N33L 3HOUI 3DWAA 2F3VA 2N8NA 2DNEA 2A1AA 4R8NA 5TSSA 1KLUD 2VB2X 3EVQA 1LACA 3CPWZ 2JA6I 1SLJA 2LY7A 5E4WC 3GKQA 4A3KG 3HOWB 4A3BH 3D9XA 1K3BC 3OOCA 4AYBA 1N8R1 3PO2B 4DXFA 4OEMB 3S1RB 3M3YB 5T64A 4DU9A 5FLXL 1ASYA 3NQIA 2K5NA 5JEAH 2V1CC 3NH5A 3IRBA 4A3CI 1QNKA 3PUZA 2ATWA 2NUCA 2WB1E 2F4VL 3G6EZ 3VYRA 4PG3A 2B8GA 2WKCA 1YJNA 4K0KQ 5C44H 4ALPA 3GV6A 3D6CA 3LWEA 3M4OH 3H3VC 4RVDA 4TRDA 5FJ8H 1X56A 3RZOB 2XTIA 5KYLA 4WJ4A 2JE6I 2EY2A 1F9QA 1K9MC 1IBKQ 1Y1VG 3E0JA 1CA6A 4P72A 4K2LA 2A69D 5IY0A 1KAWA 1AP0A 4AYBB 2R92I 2ZTEA 1FR3A 1JMCA 2PNRC 4F8MA 2IL8A 3HS0C 2EYPA 1GOZA 2R6GA 3H94A 1XJVA 3OHXC 1H9MA 1GHKA 2F0QA 4IPGA 2KPIA 3ZJYC 1Z47A 2N55A 3ULLA 3TS2A 4BBRH 4O0AA 5C3EH 3PV0A 1VQ6A 3L2PA 1I4GA 2NWGA 3CCQ1 4E2ZA 3PF5A 1JWMD 4MONA 1IL8A 3D6WA 2Z4HA 3S15H 1IKLA 5JAVA 2BJOA 1VQ91 1SYFA 2NVYH 4K6DA 4DR5Q 3UE1A 4HSPA 1B53A 1UE6A 1QJOA 2RSOA 4DR2L 1YJW1 3PO3G 1DXMA 1N9WA 4C3JG 1V1PB 4FF3A 3SHLA 1HA5A 4FF2A 3HKZA 4KD3A 4X3KA 5ELFA 3GTOI 1Q46A 1Z7TA 3HOZB 1AE2A 1T9HA 4NXNL 5JVH3 5IE8A 4B9WA 4QGUA 2NN6I 1BNZA 4NFRA 1TS4A 5FKAC 2J4XA 1EUJA 2IPKD 5KYIA 1USPA 1Y1WB 2JA8H 4DXGA 2M9VA 2ZXOA 3I4LA 2L0CA 4Y52I 1NP6A 4JI4Q 2PNHA 3NPPA 3CCU1 3CCL1 3D3RA 1MBYA 1Q90A 3DMUA 3H0GH 4P73A 2RIQA 2O5IC 2WAQG 2VY3A 4KHPQ 2WACA 4JI8L 5FLXb 3CCQZ 4A3MI 1KAAA 1M902 1CSQA 4DN4M 1VQ9Z 4POFA 1CZGA 1YJWZ 2QA41 5C0XI 4OX9Q 2A69C 3SK8A 1JR0D 4X66L 3E3XA 5IP9G 1TWAI 3AYHB 2E2DC 1V8QA 1SJHD 3CCEA 1PH4A 1YBYA 1TWCH 3A0JA 2F3WA 1LT5D 5IYDH 3CC41 4BBSH 1HNXQ 2OOXB 3QO2A 2B2TA 1NR4A 3WOFA 5D14A 5HGQA 1N32Q 2OTJA 4A3DB 2QW7A 4BY7H 1R9TB 2V3VA 3CCUZ 3CCLZ 3GTLI 2P3YA 3CP0A 2YU9I 5M3MB 5I6WA 4NBGA 3T13A 1TS3A 2JK8A 3GTQH 1Q3LA 5DAUA 1WI5A 2VB3X 2RSNA 2EJMA 2OZKA 1YVCA 2H1EA 4KLKA 1O7ZA 1PYBA 5IYBG 3S2DH 1I6HB 2KCTA 3M7GA 4C3IH 5M3FG 3I72A 1B70B 4NBHA 2QA4Z 3S1MI 3TEHB 1EZ6A 2HQEA 1I3QI 4A3FI 4K6LA 2K5WA 3S17I 2PMZB 3TP7A 4RKBA 2A8VA 1W2BY 2J0TD 3I70A 4MRIA 1WJJA 1QB5D 4DV5Q 4ODGA 1YNJD 2NYZD 2UUCQ 3RNUA 3L3OC 5NUCA 1Y1VS 2Q8TA 2JA5I 3CC4Z 1AE3A 4F87A 4HGZA 3I55A 3ESWA 5E7NA 3QIAA 1L0WA 3GTPI 3Q24A 4UPAA 1TWHI 5CYUA 2IJ0A 2AYDA 1WIIA 4DV4Q 4K8IA 4DV2L 3G4SA 5GQOA 5CM2M
chains in the Genus database with same CATH topology
4A3CH 3CCJ1 2A19A 4DAMA 1EYGA 2RCNA 3CCRA 2E2II 3HKSA 5AN9F 2JMOA 4KI0A 2E2JI 4A3KI 3RZDH 5T6BA 3NBHB 2IX1A 4LF4Q 5C44G 1K8AC 1KHIA 4LF5L 5FJ8G 2K14A 2Q2TA 2DE7A 1J5EQ 3MZKB 2GVAA 3BZKA 3TS0A 3S2HI 2ALYB 3KJPA 4B3SL 3F1ZA 1XTDA 1KD11 4JI7Q 1VQ7A 2RHSB 1YI2A 4DR6L 2D62A 4IFDG 1QVGY 4DV3L 1Q862 1QVCA 3U50C 3Q87A 3SGIA 4L5RC 3EERA 4JYAL 1C9OA 1VQDA 3PO3I 1G51A 4AYBE 2ZTDA 4YCUA 1KRSA 1IBLQ 3S16H 3B6YA 2KBNA 3Q8DA 1HR0Q 1QVFY 4NB9A 4NXML 2NVQI 1M1K2 3G48A 2IT1A 3FKIG 4JC0A 3TE5B 4B3MQ 2E9HA 4X64Q 1TWAH 1KC8C 5FLMI 2UXBL 3KF8B 5FLXc 2CQOA 3I07A 1ASZA 3I56A 1OXSC 2M6NA 5JJIA 3E9IA 3TQYA 3M7NA 2QR1B 4GKJQ 3J7A5 3PO2I 1NJI1 1I50I 1XNRQ 3CMEA 4DAYB 2HF1A 2KENA 3GTLH 2CKZB 2VS1A 3CXCZ 4JBWA 2HT1A 4JI6Q 3I4MG 4FDBA 2YYZA 4BBSG 3HKZE 3RZOI 2CFMA 4BA1I 1NE3A 1VQ51 4DK3C 3S1MH 3FHWA 2K5VA 1VQEA 3ERSX 2V8JA 1IBMQ 4LF9Q 1VQK1 3NH4A 1XMQQ 1KQSZ 2C35B 1O7IA 3W1BA 2JA5H 4DR4Q 3OW2Z 1D7QA 3HOYI 1WCMH 3GTPH 2NZHA 1UE7A 4HGYA 3QWUA 3STBC 2G2KA 1K83H 3MXNB 1YIT1 2JUBA 1XPRA 3T4NB 1K73C 4HIDA 1JB7A 3HOZI 2Z6KA 3TREA 4AQYQ 2HHHL 5GAHC 1VQ5Z 4TQUS 3GTKI 2LFUA 4RVGA 3H3VH 4GKKL 5IWAQ 4H02A 1FJGL 2V8IA 1K0RA 5GAEC 4DV6L 1PH8A 4QY7A 2PMZE 2OWOA 2VQFL 4X62L 2Y0SG 3UDFA 2OCEA 4RVHA 2B63G 5LMNQ 1EFWA 4WJ3M 1QVGA 1K9M2 4GN5A 2NVTH 4CL1A 1YITZ 2CWAA 4E30A 1EWIA 1HZAA 2H85A 4JI1Q 2VQEL 4C2MH 5M5YH 1N33Q 2JA7G 4TVAB 5C4XG 2ASBA 4JI2L 3J80f 4LFCL 1QVFA 1W3SA 1HH2P 3MEFA 3PCOB 1EQRA 4MZ9A 2F4VQ 4RG1A 2R6MA 4APVA 2QEXA 4OWWB 1I6HI 4A3GG 3CC2A 2K4KA 1KRTA 1RLYA 1X3FA 1IYJB 4P74A 4DUZL 2QRDB 4BXXH 1E3PA 4UY8C 4JOIA 2JEAI 1VQAA 3HOWH 3P5JB 2HIVA 1VQLA 4RVFA 3VMGA 3S1RH 3M3YH 4OWXB 3U4ZA 2PM9A 4JI0L 4NBFA 4OO1I 3KOJA 3NDIA 4DR2Q 1YJNZ 4LF7L 3RZOH 3M9BA 1VQPA 4NXNQ 3GTMI 1LM0A 4LUZA 3LUSA 4LUOA 2O4HA 3CCS1 1CKNA 4XX2A 1X3WA 1ML8A 1RO4A 2Z6KC 2YADA 4JG2A 3I4NG 1YHBA 4IPCA 4R4TA 4JI5L 1FL0A 3J7A4 2WAQA 3PUYA 3I4MI 1JJ2A 2GTHA 3J81f 3HOXI 4YY3L 4PZ6A 4JI8Q 3ICEA 1WOCA 1PA6A 3RN2A 1X0TA 3AQQA 5IP7G 5K36G 1PFTA 3HOZH 2UXDL 1DL6A 3LGJA 1Y1WH 3NELA 3CQZI 2RBLA 3CCSZ 3I4OA 1PV4A 3K81C 1M901 1VQ81 1VS0A 3G71A 1GD7A 2LIYA 2R7ZG 4LFAL 1P9NA 2R7FA 2HIXA 3PUVA 1VQOA 4YWMA 5C0XJ 2GU2A 4DPGA 4DR7L 2QLVB 3CPFA 1TWFI 1K8A2 2F4MA 2R93G 4A3LG 5T67A 2OOYB 1QUQB 4A3DH 4A93I 3A5UA 1VQ8Z 4JOIC 1R9TH 2UUAL 1Q7YC 5M3MH 4DV2Q 1S721 1N36L 1SFOI 4Y7NI 1A63A 1Q81C 1I6HH 5GAGC 5C4XI 3TRZA 1L1OA 1WFQA 3D31A 3D0FA 1E7ZA 3PIOA 4X65L 3CC71 2IHEA 4LWCA 1GM5A 2VUMI 3IF8A 4DR1L 3F3FC 1YHQA 1JE5A 3U58A 3CPWA 4A3GI 3NENA 1SN8A 4HJ9A 1Q82C 4LF5Q 2N3SA 1L1OB 3GO5A 2MO0A 1N2FA 2J6AA 4E31A 3T1HL 4BXXG 3G6EA 1S72Z 1KC82 1UWVA 4A3JI 4A3EH 1QYPA 4B3SQ 2UXCQ 2Q2IA 1RO2A 4E2YA 4O2DA 2RF4A 3DLLA 3IX0A 1HZBA 4DR6Q 1ZB8A 4DV3Q 2PMZA 2HQLA 3JAMf 3CC7Z 2AWNA 4JYAQ 4GLVB 1MJCA 1C7YA 3IFUA 1E1TA 2BH8A 4AYBG 1Q861 3J80b 4HJ5A 1DGSA 4IOAA 4NXMQ 4GOPA 2E5LL 4IJHA 3HOUH 1ZB9A 3HOVI 2BA1A 3KDFB 1HNZL 4A3IG 2AWOA 2AKLA 2JA6H 3CD61 3K8AA 3EIVA 4BY1G 4HH4A 2KCMA 2EQSA 2MO1A 4RS4A 3GTGI 4GOPB 2OTL1 2ZTCA 1K732 1M1K1 3RLNA 4RV9A 3J81j 1X65A 4A3BG 1YJ91 1NBWA 1VQ9A 4LF6L 1Y1WG 1V43A 3M85A 2R92H 2VW9A 5JEAG 1IZ6A 1VQ41 2V8KA 3HKZG 1YHAA 3KYHC 1UE5A 1RIPA 2AMCB 2R7ZI 4R4IA 4QIWE 1L1OC 3I56Z 3CD6Z 3CMA1 3K80C 1Y1VI 4B3RQ 2WAQE 4IO9A 4A93H 1Z02A 4A75A 3CCUA 3CCLA 2OTLZ 5D1PA 3GTOH 1W2BZ 5BR8L 1YZ6A 4BBRG 3J81b 1YJ9Z 5C3EG 2K5RA 4DKAC 1V1QA 1YEZA 2HHHQ 4A3DG 2QA4A 3PSIA 1VQ4Z 4Y52H 1JJCB 3CCV1 4GKKQ 1V9PA 2LXJA 4NB3A 4EX5A 1FJGQ 1GVPA 4DV6Q 1U5KA 3CC4A 1RNIA 3CMAZ 2IX0A 3TDHB 1TFIA 2VQFQ 4X62Q 4A3MH 4GLAC 3AFQA 2QREB 2JA8G 3H15A 4A3JH 4DV1L 1N8RC 1Z03A 3H0GG 2GVBA 1EIYB 3S1QI 2I0QA 2F3IA 2VQEQ 4GOPC 1OXXK 2YTXA 4JI2Q 3CCVZ 5IYCH 1N34L 2RHBA 5IP9I 3VDYA 1K9M1 2YU9H 4DK6C 4LFCQ 2I5HA 3PGZA 4OWTB 5IYDG 3ULPA 2P28A 2EXDA 2W03A 3GCFA 1QVGZ 5AJ3L 1TWGI 1TXYA 1I3QH 4A3FH 3CCJA 2ZM6L 3T1YL 4A4IA 3S17H 4BY7G 2K50A 1G291 3WWVA 1PH2A 4DUZQ 3NH8A 2EGTA 2ID0A 3J80c 1TWHH 3JC66 4UP9A 4X6AI 1QVFZ 2M48A 1VQN1 1JJ2Y 2N49A 2E2IH 4JI0Q 3HOUG 4HJ7A 3CW2C 2QEXZ 1PVOA 3S14I 2E2JH 5JJLA 2IHFA 2JA6G 4IFDJ 4A3KH 3GTJI 5C4JI 1YIJA 4BY1I 4LF7Q 3FQQA 2ZAEB 3KIFA 4NPSA 1P8LA 4A3CG 1KRLA 1EIFA 1GKHA 4LF8L 3CCM1 4JBKA 4AIMA 4JI5Q 2MFIA 1OXVA 4A3BI 2B3GA 3NEMA 4JCVE 1Y1VH 2KHIA 5H1SE 4YY3Q 4DQYB 3U4VA 2R92G 1VQNZ 3JAMb 3S2HH 1HNWL 3VMIA 2E8GA 1QZGA 1I94L 5C44I 4DV0L 2RPRA 3F3PC 4OONA 1VQPZ 4MD8A 1NTGA 3HFZB 1PH9A 1SE8A 2UXDQ 2NZOA 2Z0SA 3PO3H 4C3JH 3CCMZ 1Q7Y2 3J81c 4L5QA 1X54A 1EQQA 4IFDI 4GKJL 1YJN1 1CKMA 2NN6G 2K52A 5C3EI 1Q812 3CF5A 4LFAQ 1X6OA 2WB1G 1Y14B 1KIXA 2NVQH 3I7FA 3EN2A 3UE0A 5FLMH 3KJOA 3RR5A 4DR3L 1FGUA 5LMUL 1FVIA 2K5HA 4DR7Q 1VQ5A 4TNUA 1VQ61 3NFZA 3PO2H 1Q822 1I50H 3FKII 4YHHL 1VQKA 2CWPA 3G71Z 3NDJA 3S1NI 3GDEA 3CPWY 1KL9A 2K75A 2UUAQ 3BU2A 3H0GI 2IY5B 1VQBA 2UU9L 1MJEA 1N36Q 4KHZA 3F2CA 1TWGH 1VQMA 5IT9f 2W04A 1VQOZ 1K8A1 3JAMi 4MD9A 4DUYL 1YITA 1X9NA 2R7DA 5IYCG 3PUXA 3OTOL 4X65Q 2HU9A 1TWCI 1YHQ1 4BBSI 4MNOA 4HJ8A 4DR1Q 1VQ6Z 3HOYH 1OXUA 5M3FH 5M5WH 3VTNA 1SMXA 1KD1C 4A3FG 1RL2A 1X3GA 1PH6A 4LFBL 3T1HQ 3GTQI 3CCE1 4X66Q 2IZ4A 2JA5G 1PH7A 4OXPA 2H5XA 1XNQL 3GTKH 1WCMG 2IZ3A 5JJKA 2PQAA 1LUZA 2OTJ1 2UUBL 2MQHA 3BG1B 2DE6A 1HR0W 1YHQZ 1MIUA 1KC81 2OQKA 3EEDA 1QZHA 1QUQA 4DNIA 1Q8KA 2PQAB 2DUDA 4P75A 1JJGA 2JA9A 3W1GA 3CCEZ 3BZCA 1XMOL 1NJIC 5A2Qf 2E5LQ 1VQHA 2DE5A 3OYYA 2JS4A 2B63I 3RZDI 4DK1A 2YTVA 3JAMc 3I551 4JBJA 1HNZQ 2OTJZ 1QF8A 4R4CA 3G4S1 1RQFA 3PIPA 4IJLA 3CCR1 1UEBA 2JA7I 4R4QA 4L5SA 3RLOA 1A8VA 3MONA 4LF6Q 4A76A 4B3TL 1E22A 4JV5L 1OTCA 2BH2A 3ER0A 5EAYA 4L5TA 3I55Z 4DGLA 1K731 1K8GA 1NY4A 4DV7L 3RLFA 4AH6A 3CCSA 3G4SZ 3FKIH 1EOVA 3S1NH 5FLMG 3CCRZ 1VLAA 4NH1C 1YUKA 2QRCB 1CKOA 2JR6A 1N8R2 1VQ71 3S16I 4EQ5A 1YI21 2K3RA 3KIHA 3HOWG 5BR8Q 4P71A 4JI3L 3GTMH 2WFWA 3F2DA 2Q2UA 3PO2G 2N78A 4JBMA 1USPB 3K7AI 1NUIA 4NOZA 5LMNW 2VF1A 3KF6A 3I4MH 3KDFA 2FXQA 3HOXH 1Q12A 1PH1A 4XTCS 3FP9A 1VQ8A 3H3VJ 3A74A 4K0KL 4POGA 1Q1BA 3I4NI 4R4OA 1G6PA 1B7YB 4QJFA 1VQ7Z 1YI2Z 2MNAA 3KF6B 3RN5A 2ZJRA 1IBKL 2UXBQ 1A0IA 4DV1Q 1JWHC 1ZH1A 3HOYG 3I561 1HZ9A 1U0LA 3CQZH 4GNXA 4YCVA 3CME1 3J7ZC 2GTIA 5IP7I 1VQIA 3GD7A 1N34Q 3HOZG 1D8LA 4HJAA 1I5FA 3A5ZB 4NBEA 1LYLA 3M4QA 3CCQA 4DR5L 1WCMI 1XPUA 1Z01A 5AJ3Q 1YJWA 4GNXB 1K83I 3MZLB 3AFPA 5ELNA 2PI2A 2ZM6Q 3T1YQ 1S72A 3PF4A 4GN4B 1TWFH 2B63H 2L15A 3PO3S 1OXTA 4JI4L 5IT9b 3H3VI 5ELOA 2JEBI 3CC7A 3CMEZ 1E1OA 2D0OA 1BVSA 4KHPL 3UDXA 2I5LX 1VQGA 4NBDA 1SFOH 2I5MX 2F4OA 4Y7NH 2O53A 2JA7H 2R93I 1SR3A 5C4XH 4OX9L 3EBEA 2CCZA 1WW9A 4A3LI 4GLXA 1YIJ1 2JQOA 3J80i 4HIOA 5D1OA 3CCJZ 2NVTI 3CXCY 1S7MA 2UXCL 5M3MG 4S1TA 4HIMA 1PH5A 4QTUA 2VUMH 1IXRA 2JNYA 2D0PA 4PMWA 2Y0SA 4E32A 1HNXL 4LF8Q 2WP8J 1N32L 4RMFA 3PUWA 4A3GH 1P16A 2NVXI 3DM3A 5LL6f 2EIFA 5D1OB 1KQSY 5GROA 3OW2Y 1SRUA 4E2WA 4IPDA 1HNWQ 1PFSA 1WYDA 4EWCA 1M90C 1I94Q 4DV0Q 1YIJZ 2E2HI 1K3RA 4IOCA 1VQFA 2Q2HA 3E9HA 3STBD 3K7AH 5HY6A 4DV5L 4LW1A 2UUCL 4OO1G 3L0OA 4BXXI 2XGTA 4LUVA 1XPOA 1VQCA 4A3EG 5A2Qb 4GNXC 3HOWI 3CD6A 1UE1A 2QEX1 3UDIA 3BG0B 4DV4L 4J15A 1MKHA 1BBWA 2WB1A 1HJPA 3CC21 2AKWB 3S1RI 3M3YI 4YWKA 1YNXA 2ZJPA 1JT8A 5JEAJ 2OTLA 3I4NH 1W2BA 2LXKA 1GO3E 3HOVH 3J81i 3HOXG 1YJ9A 4DR3Q 1Q7Y1 5LMUQ 4QL5A 4YCWA 4LF4L 1BKBA 4E2XA 1VQL1 1KD12 1E24A 4NBBA 1VQ4A 5J3BA 1Q811 3L7ZC 3KLWA 1S40A 3BJUA 3GTGH 5IP7H 3S24A 4YHHQ 4ME3A 2AHOB 4UP7A 3K7UC 1L2FA 1J5EL 4B3RL 3CMAA 4A3II 2B29A 1KXLA 3CC2Z 1NMGA 1VQP1 2UU9Q 4NBAA 1VQM1 4GN3B 1RO0A 4JI7L 2I3CA 4DUYQ 1Q821 1AH9A 2R7ZH 3OTOQ 5M5XH 5FLXf 1YUAA 4MD7A 3KFUA 1X3EA 5GADC 1VQLZ 2VZAA 1Y1WI 4C3HH 1VQKZ 3CCVA 1B8AA 2YV5A 4UP8A 1IBLL 3CXCA 1H95A 1CUKA 1VCIA 1HR0L 1NJI2 4LFBQ 3M4OI 2Q51A 3VMHA 4IPHA 5IT9c 2R93H 3K0XA 4A3LH 1VQMZ 4B3ML 4A93G 4X64L 2KHJA 1IL2A 1XNQQ 2OQ0A 1PYSB 2UUBQ 3AEVA 3G711 1C0AA 2VUGA 1Q86C 1KQSA 4MH4A 1JJ2Z 1LTLA 3OW2A 4BBRI 1XNRL 2NVXH 1J6QA 4GS3A 3F2BA 5DLQE 3S15I 4A3DI 2F52A 2NVYI 1BBUA 4PZ8A 1VQO1 4JI6L 1R9TI 3I2ZA 1VQJA 2VUMG 2PK7A 3GTMS 2YTYA 3F8TA 1XMOQ 1S3OA 3S1QH 4R1JA 2PI2E 4A3MG 2E2HH 2QGQA 1M1KC 1IBML 1PH3A 4LF9L 2ZJQA 4E33A 2QKDA 2JA8I 5C0XG 1SROA 1XMQL 5IP9H 2JJQA 4DR4L 4A3JG 4MTNA 2DGYA 3M4PA 4PZ7A 2ES2A 1VQNA 3VB9A 3E0EA 4XIGS 4HIKA 4LNQA 4A3EI 4AQYL 4B3TQ 1Q1EA 2Q4ZA 4YWLA 1NMFA 3FQMA 2GN5A 4JV5Q 1PHJA 2BA0A 3W5OA 5IYBH 4NBCA 1HZCA 5IWAL 3UDGA 3ULJA 2Y0SE 4BA2I 1LQLA 4X6AH 1X55A 4QTTA 4DV7Q 4NB8A 2RHQB 4BY7I 1CSPA 3CCMA 2VNUD 3G6E1 5LMNL 3HOVG 4A3IH 3CAMA 3S14H 4QQBX 3S2DI 3GTJH 5C4JH 4MXUA 4BY1H 2VL6A 4JI3Q 1Z9FA 2KI7B 2LSSA 1CKNB 4JI1L 1A62A 1X3ZA 2RT9A 1N33L 3HOUI 2N8NA 2A1AA 1SLJA 3CPWZ 2JA6I 4A3KG 4A3BH 3GKQA 3D9XA 4AYBA 1N8R1 5T64A 1ASYA 2K5NA 2V1CC 3NH5A 3IRBA 4A3CI 3PUZA 2ATWA 2WB1E 2F4VL 3G6EZ 4PG3A 1YJNA 4K0KQ 5C44H 4ALPA 3M4OH 4RVDA 5FJ8H 1X56A 2XTIA 4WJ4A 2JE6I 1K9MC 1IBKQ 1Y1VG 4P72A 5IY0A 1KAWA 2R92I 2ZTEA 1JMCA 2R6GA 1XJVA 4IPGA 2KPIA 3ZJYC 1Z47A 3ULLA 3TS2A 4BBRH 4O0AA 5C3EH 3PV0A 1VQ6A 3L2PA 3CCQ1 4E2ZA 3PF5A 4MONA 3D6WA 3S15H 1VQ91 2BJOA 2NVYH 4DR5Q 3UE1A 1UE6A 4DR2L 1YJW1 3PO3G 1N9WA 3HKZA 3GTOI 1Q46A 1AE2A 1T9HA 4NXNL 5IE8A 4QGUA 2NN6I 4NFRA 1EUJA 1USPA 2JA8H 4Y52I 1NP6A 4JI4Q 2PNHA 3CCU1 3CCL1 4P73A 3H0GH 2RIQA 2WAQG 2VY3A 4KHPQ 4JI8L 5FLXb 3CCQZ 4A3MI 1M902 1CSQA 1VQ9Z 4POFA 1YJWZ 2QA41 5C0XI 4OX9Q 4X66L 5IP9G 1TWAI 3AYHB 3CCEA 1PH4A 1YBYA 1TWCH 3A0JA 5IYDH 3CC41 4BBSH 1HNXQ 2OOXB 5HGQA 1N32Q 2OTJA 4BY7H 3CCUZ 3CCLZ 3GTLI 2P3YA 3CP0A 2YU9I 4NBGA 2JK8A 3GTQH 1WI5A 2OZKA 1YVCA 4KLKA 1PYBA 5IYBG 3S2DH 2KCTA 4C3IH 5M3FG 1B70B 4NBHA 2QA4Z 3S1MI 3TEHB 1I3QI 4A3FI 3S17I 2A8VA 1W2BY 4MRIA 1WJJA 4DV5Q 2UUCQ 3RNUA 1Y1VS 2JA5I 3CC4Z 1AE3A 4HGZA 3I55A 3ESWA 5E7NA 1L0WA 3GTPI 4UPAA 1TWHI 1WIIA 4DV4Q 4DV2L 3G4SA 5GQOA 5CM2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C H;  2A19 A;  4DAM A;  1EYG A;  2RCN A;  3CCR A;  2E2I I;  3HKS A;  4KI0 A;  2E2J I;  4A3K I;  3RZD H;  3NBH B;  2IX1 A;  4LF4 Q;  5C44 G;  1K8A C;  1KHI A;  4LF5 L;  5FJ8 G;  2K14 A;  2Q2T A;  2DE7 A;  1J5E Q;  2GVA A;  3BZK A;  3TS0 A;  3S2H I;  2ALY B;  3KJP A;  4B3S L;  3F1Z A;  1XTD A;  4JI7 Q;  1VQ7 A;  2RHS B;  1YI2 A;  4DR6 L;  2D62 A;  4IFD G;  4DV3 L;  1QVC A;  3U50 C;  3Q87 A;  3SGI A;  4L5R C;  3EER A;  4JYA L;  1C9O A;  1VQD A;  3PO3 I;  1G51 A;  4AYB E;  2ZTD A;  4YCU A;  1KRS A;  1IBL Q;  3S16 H;  3B6Y A;  2KBN A;  3Q8D A;  1HR0 Q;  4NB9 A;  4NXM L;  2NVQ I;  3G48 A;  2IT1 A;  3FKI G;  4JC0 A;  4B3M Q;  4X64 Q;  1TWA H;  1KC8 C;  5FLM I;  2UXB L;  3KF8 B;  5FLX c;  2CQO A;  3I07 A;  1ASZ A;  3I56 A;  1OXS C;  5JJI A;  3E9I A;  3TQY A;  4GKJ Q;  3M7N A;  3J7A 5;  3PO2 I;  1I50 I;  1XNR Q;  3CME A;  4DAY B;  2HF1 A;  2KEN A;  3GTL H;  2CKZ B;  2VS1 A;  4JBW A;  2HT1 A;  4JI6 Q;  3I4M G;  4FDB A;  2YYZ A;  4BBS G;  3HKZ E;  3RZO I;  2CFM A;  4BA1 I;  1NE3 A;  4DK3 C;  3S1M H;  3FHW A;  2K5V A;  1VQE A;  3ERS X;  1IBM Q;  4LF9 Q;  1XMQ Q;  2C35 B;  1O7I A;  3W1B A;  2JA5 H;  4DR4 Q;  1D7Q A;  3HOY I;  1WCM H;  3GTP H;  2NZH A;  1UE7 A;  3STB C;  1K83 H;  3MXN B;  1XPR A;  1K73 C;  4HID A;  1JB7 A;  3HOZ I;  2Z6K A;  3TRE A;  4AQY Q;  2HHH L;  5GAH C;  4TQU S;  3GTK I;  3H3V H;  4GKK L;  5IWA Q;  4H02 A;  1FJG L;  1K0R A;  5GAE C;  4DV6 L;  1PH8 A;  4QY7 A;  2PMZ E;  2OWO A;  2VQF L;  4X62 L;  2Y0S G;  3UDF A;  2OCE A;  2B63 G;  5LMN Q;  1EFW A;  4WJ3 M;  1QVG A;  4GN5 A;  2NVT H;  2CWA A;  1EWI A;  1HZA A;  4JI1 Q;  2VQE L;  4C2M H;  5M5Y H;  1N33 Q;  2JA7 G;  4TVA B;  5C4X G;  2ASB A;  4JI2 L;  4LFC L;  1QVF A;  1W3S A;  1HH2 P;  3MEF A;  3PCO B;  1EQR A;  4MZ9 A;  2F4V Q;  4RG1 A;  4APV A;  2QEX A;  4OWW B;  1I6H I;  4A3G G;  3CC2 A;  2K4K A;  1KRT A;  1RLY A;  1X3F A;  1IYJ B;  4P74 A;  4DUZ L;  4BXX H;  1E3P A;  4UY8 C;  4JOI A;  2JEA I;  1VQA A;  3HOW H;  2HIV A;  1VQL A;  3VMG A;  3S1R H;  3M3Y H;  4OWX B;  3U4Z A;  4JI0 L;  4NBF A;  4OO1 I;  3KOJ A;  4DR2 Q;  4LF7 L;  3RZO H;  3M9B A;  1VQP A;  4NXN Q;  3GTM I;  1LM0 A;  4LUZ A;  3LUS A;  4LUO A;  1CKN A;  4XX2 A;  1X3W A;  1ML8 A;  1RO4 A;  2Z6K C;  4JG2 A;  3I4N G;  1YHB A;  4IPC A;  4R4T A;  4JI5 L;  1FL0 A;  3PUY A;  3I4M I;  1JJ2 A;  3HOX I;  4YY3 L;  4PZ6 A;  4JI8 Q;  3ICE A;  1WOC A;  1PA6 A;  3RN2 A;  3AQQ A;  5IP7 G;  5K36 G;  1PFT A;  3HOZ H;  2UXD L;  1DL6 A;  3LGJ A;  3NEL A;  1Y1W H;  3CQZ I;  2RBL A;  3I4O A;  1PV4 A;  3K81 C;  1VS0 A;  3G71 A;  1GD7 A;  2R7Z G;  4LFA L;  2R7F A;  2HIX A;  3PUV A;  1VQO A;  4YWM A;  5C0X J;  4DPG A;  4DR7 L;  3CPF A;  1TWF I;  2F4M A;  2R93 G;  4A3L G;  1QUQ B;  4A3D H;  4A93 I;  3A5U A;  4JOI C;  1R9T H;  2UUA L;  1Q7Y C;  5M3M H;  4DV2 Q;  1N36 L;  1SFO I;  4Y7N I;  1A63 A;  1Q81 C;  1I6H H;  5GAG C;  5C4X I;  3TRZ A;  1L1O A;  1WFQ A;  3D31 A;  3D0F A;  1E7Z A;  3PIO A;  4X65 L;  2IHE A;  4LWC A;  1GM5 A;  2VUM I;  4DR1 L;  1YHQ A;  1JE5 A;  3U58 A;  3CPW A;  4A3G I;  3NEN A;  1SN8 A;  4HJ9 A;  1Q82 C;  4LF5 Q;  2N3S A;  1L1O B;  3GO5 A;  2MO0 A;  1N2F A;  2J6A A;  3T1H L;  4BXX G;  3G6E A;  1UWV A;  4A3J I;  4A3E H;  1QYP A;  4B3S Q;  2UXC Q;  2Q2I A;  4O2D A;  2RF4 A;  3DLL A;  1HZB A;  4DR6 Q;  1ZB8 A;  4DV3 Q;  2HQL A;  2AWN A;  4JYA Q;  4GLV B;  1MJC A;  1C7Y A;  1E1T A;  2BH8 A;  4AYB G;  4HJ5 A;  1DGS A;  4IOA A;  4NXM Q;  4GOP A;  2E5L L;  4IJH A;  3HOU H;  1ZB9 A;  3HOV I;  2BA1 A;  3KDF B;  1HNZ L;  4A3I G;  2AWO A;  2AKL A;  2JA6 H;  3K8A A;  3EIV A;  4BY1 G;  2KCM A;  2EQS A;  2MO1 A;  3GTG I;  4GOP B;  2ZTC A;  3RLN A;  3J81 j;  1X65 A;  4A3B G;  1NBW A;  1VQ9 A;  4LF6 L;  1Y1W G;  1V43 A;  3M85 A;  2R92 H;  2VW9 A;  5JEA G;  1IZ6 A;  3HKZ G;  1YHA A;  3KYH C;  1UE5 A;  1RIP A;  2AMC B;  2R7Z I;  4R4I A;  4QIW E;  1L1O C;  3K80 C;  1Y1V I;  4B3R Q;  2WAQ E;  4IO9 A;  4A93 H;  4A75 A;  3CCU A;  3CCL A;  3GTO H;  5BR8 L;  1YZ6 A;  4BBR G;  5C3E G;  2K5R A;  4DKA C;  1V1Q A;  1YEZ A;  2HHH Q;  4A3D G;  2QA4 A;  3PSI A;  4Y52 H;  1JJC B;  4GKK Q;  1V9P A;  2LXJ A;  4NB3 A;  4EX5 A;  1FJG Q;  1GVP A;  4DV6 Q;  1U5K A;  3CC4 A;  2IX0 A;  1TFI A;  2VQF Q;  4X62 Q;  4A3M H;  4GLA C;  3AFQ A;  2JA8 G;  3H15 A;  4A3J H;  4DV1 L;  1N8R C;  3H0G G;  2GVB A;  1EIY B;  3S1Q I;  2I0Q A;  2F3I A;  2VQE Q;  4GOP C;  1OXX K;  2YTX A;  4JI2 Q;  5IYC H;  1N34 L;  5IP9 I;  3VDY A;  2YU9 H;  4DK6 C;  4LFC Q;  2I5H A;  3PGZ A;  4OWT B;  5IYD G;  3ULP A;  2EXD A;  5AJ3 L;  3GCF A;  1TWG I;  1TXY A;  1I3Q H;  4A3F H;  3CCJ A;  2ZM6 L;  3T1Y L;  4A4I A;  3S17 H;  4BY7 G;  2K50 A;  1G29 1;  3WWV A;  1PH2 A;  4DUZ Q;  2ID0 A;  3J80 c;  1TWH H;  3JC6 6;  4UP9 A;  4X6A I;  2N49 A;  2E2I H;  4JI0 Q;  3HOU G;  4HJ7 A;  3CW2 C;  1PVO A;  3S14 I;  2E2J H;  5JJL A;  2IHF A;  2JA6 G;  4IFD J;  4A3K H;  3GTJ I;  5C4J I;  1YIJ A;  4BY1 I;  4LF7 Q;  4NPS A;  1P8L A;  4A3C G;  1EIF A;  1GKH A;  4LF8 L;  4JBK A;  4AIM A;  4JI5 Q;  2MFI A;  1OXV A;  4A3B I;  2B3G A;  3NEM A;  4JCV E;  1Y1V H;  2KHI A;  5H1S E;  4YY3 Q;  3U4V A;  2R92 G;  3S2H H;  1HNW L;  3VMI A;  2E8G A;  1QZG A;  1I94 L;  5C44 I;  4DV0 L;  4OON A;  1NTG A;  3HFZ B;  1PH9 A;  1SE8 A;  2UXD Q;  2NZO A;  2Z0S A;  3PO3 H;  4C3J H;  3J81 c;  4L5Q A;  1X54 A;  1EQQ A;  4IFD I;  4GKJ L;  1CKM A;  2NN6 G;  2K52 A;  5C3E I;  3CF5 A;  4LFA Q;  1X6O A;  2WB1 G;  1Y14 B;  1KIX A;  2NVQ H;  3I7F A;  3EN2 A;  3UE0 A;  5FLM H;  3KJO A;  3RR5 A;  4DR3 L;  1FGU A;  5LMU L;  1FVI A;  2K5H A;  4DR7 Q;  1VQ5 A;  3PO2 H;  1I50 H;  3FKI I;  4YHH L;  1VQK A;  2CWP A;  3S1N I;  3GDE A;  1KL9 A;  2K75 A;  2UUA Q;  3BU2 A;  3H0G I;  2IY5 B;  1VQB A;  2UU9 L;  1MJE A;  1N36 Q;  4KHZ A;  3F2C A;  1TWG H;  1VQM A;  3JAM i;  4DUY L;  1YIT A;  1X9N A;  2R7D A;  5IYC G;  3PUX A;  3OTO L;  4X65 Q;  1TWC I;  4BBS I;  4MNO A;  4HJ8 A;  4DR1 Q;  3HOY H;  1OXU A;  5M3F H;  5M5W H;  1SMX A;  1KD1 C;  4A3F G;  1RL2 A;  1X3G A;  1PH6 A;  4LFB L;  3T1H Q;  3GTQ I;  4X66 Q;  2JA5 G;  1PH7 A;  4OXP A;  2H5X A;  1XNQ L;  3GTK H;  1WCM G;  5JJK A;  2PQA A;  1LUZ A;  2UUB L;  2MQH A;  2DE6 A;  1HR0 W;  1MIU A;  2OQK A;  1QZH A;  1QUQ A;  4DNI A;  1Q8K A;  2PQA B;  2DUD A;  4P75 A;  1JJG A;  2JA9 A;  3W1G A;  3BZC A;  1XMO L;  1NJI C;  2E5L Q;  1VQH A;  2DE5 A;  3OYY A;  2JS4 A;  2B63 I;  3RZD I;  2YTV A;  3JAM c;  4JBJ A;  1HNZ Q;  4R4C A;  3PIP A;  4IJL A;  1UEB A;  2JA7 I;  4R4Q A;  4L5S A;  3RLO A;  1A8V A;  4LF6 Q;  4A76 A;  4B3T L;  1E22 A;  4JV5 L;  1OTC A;  2BH2 A;  3ER0 A;  5EAY A;  4L5T A;  1K8G A;  1NY4 A;  4DV7 L;  3RLF A;  4AH6 A;  3CCS A;  3FKI H;  1EOV A;  3S1N H;  5FLM G;  1VLA A;  1CKO A;  2JR6 A;  3S16 I;  4EQ5 A;  3HOW G;  5BR8 Q;  4P71 A;  4JI3 L;  3GTM H;  2WFW A;  3F2D A;  2Q2U A;  3PO2 G;  2N78 A;  4JBM A;  1USP B;  3K7A I;  1NUI A;  4NOZ A;  5LMN W;  3KF6 A;  3I4M H;  3KDF A;  2FXQ A;  3HOX H;  1Q12 A;  1PH1 A;  4XTC S;  3FP9 A;  1VQ8 A;  3H3V J;  3A74 A;  4K0K L;  4POG A;  1Q1B A;  3I4N I;  4R4O A;  1G6P A;  1B7Y B;  4QJF A;  2MNA A;  3KF6 B;  1IBK L;  2ZJR A;  3RN5 A;  2UXB Q;  1A0I A;  4DV1 Q;  3HOY G;  1HZ9 A;  1U0L A;  3CQZ H;  4GNX A;  4YCV A;  3J7Z C;  5IP7 I;  1VQI A;  3GD7 A;  1N34 Q;  3HOZ G;  1D8L A;  4HJA A;  1I5F A;  3A5Z B;  4NBE A;  1LYL A;  3M4Q A;  3CCQ A;  4DR5 L;  1WCM I;  1XPU A;  5AJ3 Q;  1YJW A;  4GNX B;  1K83 I;  3AFP A;  5ELN A;  2PI2 A;  2ZM6 Q;  3T1Y Q;  1S72 A;  3PF4 A;  4GN4 B;  1TWF H;  2B63 H;  2L15 A;  3PO3 S;  1OXT A;  4JI4 L;  3H3V I;  5ELO A;  2JEB I;  3CC7 A;  1E1O A;  2D0O A;  1BVS A;  4KHP L;  3UDX A;  2I5L X;  1VQG A;  4NBD A;  1SFO H;  2I5M X;  2F4O A;  4Y7N H;  2JA7 H;  2R93 I;  1SR3 A;  5C4X H;  4OX9 L;  3EBE A;  2CCZ A;  1WW9 A;  4A3L I;  4GLX A;  2JQO A;  3J80 i;  4HIO A;  2NVT I;  2UXC L;  5M3M G;  4HIM A;  1PH5 A;  4QTU A;  2VUM H;  1IXR A;  2JNY A;  2D0P A;  4PMW A;  1HNX L;  4LF8 Q;  2WP8 J;  1N32 L;  4RMF A;  3PUW A;  4A3G H;  1P16 A;  2NVX I;  3DM3 A;  2EIF A;  5GRO A;  1SRU A;  4IPD A;  1HNW Q;  1PFS A;  1WYD A;  1M90 C;  1I94 Q;  4DV0 Q;  2E2H I;  1K3R A;  4IOC A;  1VQF A;  2Q2H A;  3E9H A;  3STB D;  3K7A H;  5HY6 A;  4DV5 L;  4LW1 A;  2UUC L;  4OO1 G;  3L0O A;  4BXX I;  2XGT A;  4LUV A;  1XPO A;  1VQC A;  4A3E G;  4GNX C;  3HOW I;  3CD6 A;  1UE1 A;  3UDI A;  4DV4 L;  4J15 A;  1MKH A;  1BBW A;  1HJP A;  2AKW B;  3S1R I;  3M3Y I;  4YWK A;  1YNX A;  2ZJP A;  1JT8 A;  5JEA J;  2OTL A;  3I4N H;  1W2B A;  2LXK A;  1GO3 E;  3HOV H;  3J81 i;  3HOX G;  1YJ9 A;  4DR3 Q;  5LMU Q;  4QL5 A;  4YCW A;  4LF4 L;  1BKB A;  1E24 A;  4NBB A;  1VQ4 A;  5J3B A;  3L7Z C;  3KLW A;  1S40 A;  3BJU A;  3GTG H;  5IP7 H;  3S24 A;  4YHH Q;  4ME3 A;  2AHO B;  4UP7 A;  3K7U C;  1L2F A;  1J5E L;  4B3R L;  3CMA A;  4A3I I;  2B29 A;  1KXL A;  1NMG A;  2UU9 Q;  4NBA A;  4GN3 B;  4JI7 L;  4DUY Q;  1AH9 A;  2R7Z H;  3OTO Q;  5M5X H;  1YUA A;  3KFU A;  1X3E A;  5GAD C;  2VZA A;  1Y1W I;  4C3H H;  3CCV A;  1B8A A;  2YV5 A;  4UP8 A;  1IBL L;  3CXC A;  1H95 A;  1CUK A;  1VCI A;  1HR0 L;  4LFB Q;  3M4O I;  3VMH A;  4IPH A;  5IT9 c;  2R93 H;  3K0X A;  4A3L H;  4B3M L;  4A93 G;  4X64 L;  2KHJ A;  1IL2 A;  1XNQ Q;  2OQ0 A;  1PYS B;  2UUB Q;  3AEV A;  1C0A A;  1Q86 C;  1KQS A;  4MH4 A;  1LTL A;  3OW2 A;  4BBR I;  1XNR L;  2NVX H;  1J6Q A;  4GS3 A;  3F2B A;  5DLQ E;  3S15 I;  4A3D I;  2F52 A;  2NVY I;  1BBU A;  4PZ8 A;  4JI6 L;  1R9T I;  3I2Z A;  1VQJ A;  2VUM G;  2PK7 A;  3GTM S;  2YTY A;  3F8T A;  1XMO Q;  1S3O A;  3S1Q H;  4R1J A;  2PI2 E;  4A3M G;  2E2H H;  2QGQ A;  1M1K C;  1IBM L;  1PH3 A;  4LF9 L;  2ZJQ A;  2JA8 I;  5C0X G;  1SRO A;  1XMQ L;  5IP9 H;  2JJQ A;  4DR4 L;  4A3J G;  4MTN A;  2DGY A;  3M4P A;  4PZ7 A;  2ES2 A;  1VQN A;  3VB9 A;  3E0E A;  4XIG S;  4HIK A;  4LNQ A;  4A3E I;  4AQY L;  4B3T Q;  1Q1E A;  4YWL A;  1NMF A;  2GN5 A;  4JV5 Q;  1PHJ A;  2BA0 A;  3W5O A;  5IYB H;  4NBC A;  1HZC A;  5IWA L;  3UDG A;  3ULJ A;  2Y0S E;  4BA2 I;  1LQL A;  4X6A H;  1X55 A;  4QTT A;  4DV7 Q;  4NB8 A;  2RHQ B;  4BY7 I;  1CSP A;  3CCM A;  2VNU D;  5LMN L;  3HOV G;  4A3I H;  3CAM A;  3S14 H;  4QQB X;  3S2D I;  3GTJ H;  5C4J H;  4BY1 H;  2VL6 A;  4JI3 Q;  1Z9F A;  2LSS A;  1CKN B;  4JI1 L;  1A62 A;  1X3Z A;  1N33 L;  3HOU I;  2N8N A;  2A1A A;  1SLJ A;  2JA6 I;  4A3K G;  4A3B H;  3GKQ A;  1ASY A;  2K5N A;  2V1C C;  3IRB A;  4A3C I;  3PUZ A;  2ATW A;  2WB1 E;  2F4V L;  4PG3 A;  1YJN A;  4K0K Q;  5C44 H;  4ALP A;  3M4O H;  5FJ8 H;  1X56 A;  2XTI A;  4WJ4 A;  2JE6 I;  1K9M C;  1IBK Q;  1Y1V G;  4P72 A;  5IY0 A;  1KAW A;  2R92 I;  2ZTE A;  1JMC A;  2R6G A;  1XJV A;  4IPG A;  2KPI A;  3ZJY C;  1Z47 A;  3ULL A;  3TS2 A;  4BBR H;  4O0A A;  5C3E H;  3PV0 A;  1VQ6 A;  3L2P A;  3PF5 A;  3D6W A;  3S15 H;  2BJO A;  2NVY H;  4DR5 Q;  3UE1 A;  1UE6 A;  4DR2 L;  3PO3 G;  1N9W A;  3GTO I;  1Q46 A;  1AE2 A;  1T9H A;  4NXN L;  5IE8 A;  4QGU A;  2NN6 I;  1EUJ A;  1USP A;  2JA8 H;  4Y52 I;  4JI4 Q;  2PNH A;  3H0G H;  4P73 A;  2WAQ G;  2VY3 A;  4KHP Q;  4JI8 L;  4A3M I;  1CSQ A;  4POF A;  5C0X I;  4OX9 Q;  4X66 L;  5IP9 G;  1TWA I;  3AYH B;  3CCE A;  1PH4 A;  1YBY A;  1TWC H;  3A0J A;  5IYD H;  4BBS H;  1HNX Q;  5HGQ A;  1N32 Q;  2OTJ A;  4BY7 H;  3GTL I;  2P3Y A;  3CP0 A;  2YU9 I;  4NBG A;  2JK8 A;  3GTQ H;  1WI5 A;  1YVC A;  4KLK A;  1PYB A;  5IYB G;  3S2D H;  2KCT A;  4C3I H;  5M3F G;  1B70 B;  4NBH A;  3S1M I;  3TEH B;  1I3Q I;  4A3F I;  3S17 I;  2A8V A;  1WJJ A;  4DV5 Q;  2UUC Q;  3RNU A;  1Y1V S;  2JA5 I;  1AE3 A;  3I55 A;  3ESW A;  5E7N A;  1L0W A;  3GTP I;  4UPA A;  1TWH I;  4DV4 Q;  4DV2 L;  3G4S A;  5GQO A;  5CM2 M; 
#chains in the Genus database with same CATH topology
 4A3C H;  3CCJ 1;  4FXG C;  4HMI A;  2A19 A;  1ZYR C;  3V2T A;  1KTK A;  4DAM A;  3OW7 A;  1EYG A;  2RCN A;  3CCR A;  2F0S A;  2E2I I;  3MFY A;  2AQ2 B;  3HKS A;  4A3E B;  1HPC A;  5AN9 F;  1TY0 A;  3A7A B;  1X32 A;  2JMO A;  4KI0 A;  2E2J I;  5G3L F;  4O42 A;  1AFP A;  4A3K I;  3RZD H;  5FLX E;  3CRK C;  1E2V A;  5T6B A;  3NBH B;  2HCC A;  1ICF B;  1QNU A;  2IX1 A;  2CQA A;  1DON A;  3NE5 B;  3K5N A;  2B2Y A;  4QF4 A;  4LF4 Q;  5IGB A;  3OMG A;  1HFG A;  1AW7 A;  1IW7 C;  1CM9 A;  3EJI A;  2MGS A;  1D2B A;  5C44 G;  1K8A C;  1KHI A;  3BDL A;  4LF5 L;  5FJ8 G;  1FDO A;  1JOO A;  5DM6 3;  2K14 A;  2Q2T A;  5IGC A;  2DE7 A;  1J5E Q;  3OPO A;  3MZK B;  2X6L A;  2GVA A;  3SK5 A;  3BZK A;  3TS0 A;  3S2H I;  2ALY B;  4FF4 A;  1PTO H;  3KJP A;  4B3S L;  4KKT A;  5C3X A;  2B39 A;  3NK9 A;  1I6V C;  1EY4 A;  3F1Z A;  1XTD A;  1KD1 1;  4IQZ A;  4JI7 Q;  4KKU A;  1VQ7 A;  1MSG A;  2RHS B;  3HOU B;  1AZQ A;  1YI2 A;  2BDN A;  4DR6 L;  2D62 A;  4IFD G;  1QVG Y;  1H9J A;  4DV3 L;  3U9S A;  2NN6 H;  5C4H A;  1Q86 2;  1QVC A;  3U50 C;  2K04 A;  3Q87 A;  1EYD A;  2F0J A;  2JA6 B;  3SGI A;  3K5L A;  1SE3 A;  3TME A;  2JN4 A;  3C3L A;  4L5R C;  3EER A;  4JYA L;  1C9O A;  1VQD A;  2ZT9 C;  1R4Q B;  2R61 A;  2B2U A;  5M9O A;  2XN9 C;  3PO3 I;  3K57 A;  2L12 A;  4O1N A;  1G51 A;  4AYB E;  1PYW D;  2ZTD A;  2B2T C;  4YCU A;  2RDG A;  1KRS A;  1IBL Q;  3S16 H;  3B6Y A;  2KBN A;  3OWE B;  3MC0 B;  1MGS A;  1SYB A;  3Q8D A;  5CV9 A;  1HR0 Q;  5KNB A;  1QVF Y;  4NB9 A;  1G2T A;  3N52 A;  1H9K A;  5EPK A;  4NXM L;  2NVQ I;  1M1K 2;  3G48 A;  2IT1 A;  3FKI G;  4DAY A;  5G3L D;  2R92 B;  1I4R A;  3TE5 B;  4JC0 A;  4B3M Q;  2E9H A;  4X64 Q;  1TWA H;  1KC8 C;  4IUQ A;  5FLM I;  4KK7 A;  2UXB L;  4OIJ A;  3KF8 B;  5FLX c;  2KEC A;  2CQO A;  4QUF A;  2L9H A;  3K58 A;  4U67 3;  3I07 A;  1ASZ A;  3FRP B;  1TWF B;  3KLR A;  2A6H C;  3I56 A;  1OXS C;  4TKO B;  1BXT A;  2M6N A;  5JJI A;  3E9I A;  3TQY A;  3M7N A;  2QR1 B;  4GKJ Q;  3J7A 5;  2KUM A;  1STB A;  3PO2 I;  1NJI 1;  3FDT A;  1I50 I;  1GUO A;  1X3P A;  4A93 B;  1XNR Q;  3SEB A;  3CME A;  4JW0 A;  4DAY B;  2HF1 A;  5KND A;  2KEN A;  3GTL H;  2CKZ B;  2VS1 A;  3CXC Z;  1CT1 D;  4JBW A;  2HT1 A;  4RGT A;  4JI6 Q;  3GTO B;  2ICE C;  2DNC A;  3I4M G;  4FDB A;  2YYZ A;  4BBS G;  1ML0 D;  2MP1 A;  3HKZ E;  3RZO I;  2CFM A;  3BZD B;  1RTN A;  4BA1 I;  2BOS A;  1NE3 A;  1VQ5 1;  1MHW C;  2NB0 A;  4DK3 C;  3S1M H;  3FHW A;  2K5V A;  2KED A;  3X3M A;  1VQE A;  3ERS X;  2XVS A;  4WFN 3;  1XWE A;  2V8J A;  1NR2 A;  1IBM Q;  1PZJ D;  3BVM A;  4F7X A;  4LF9 Q;  1VQK 1;  3NH4 A;  1AN8 A;  5K36 H;  1LTG D;  3HZX A;  4X3S A;  1XMQ Q;  2DN8 A;  1KQS Z;  2C35 B;  1HXY D;  1O7I A;  3W1B A;  2JA5 H;  4DR4 Q;  3OW2 Z;  1D7Q A;  3HOY I;  2B2Y C;  4A3M B;  3D4W A;  1GUN A;  1WCM H;  3GTP H;  1I4X A;  4XT3 B;  2NZH A;  1UE7 A;  4NP5 A;  4HGY A;  3QWU A;  3WDN A;  3STB C;  2G2K A;  1K83 H;  3IKJ A;  3MXN B;  1YIT 1;  2JUB A;  1XPR A;  3T4N B;  1K73 C;  4HID A;  4P2C B;  4HMJ A;  4A3J B;  1ESF A;  1SIW A;  1H9S A;  1JB7 A;  3HOZ I;  2Z6K A;  3TRE A;  4AQY Q;  1L0X B;  2HHH L;  4K2K A;  5GAH C;  1VQ5 Z;  4TQU S;  3GTK I;  1HA6 A;  2LFU A;  4RVG A;  1PFM A;  2EYJ A;  2PZT A;  5CV4 A;  4IUT A;  3H3V H;  4GKK L;  2F0N A;  5IWA Q;  1WTH A;  4H02 A;  1FJG L;  2V8I A;  1K0R A;  5GAE C;  4DV6 L;  1PH8 A;  4QY7 A;  2YU9 B;  2PMZ E;  3MXG A;  2OWO A;  2VQF L;  4X62 L;  2EPB A;  2Y0S G;  4N9P A;  2D5D A;  1BOS A;  2OCE A;  2ZXP A;  4RVH A;  2Z4I A;  3UDF A;  5LMN Q;  1EFW A;  2B63 G;  2B2U C;  4WJ3 M;  4HN7 A;  1KNA A;  1QVG A;  3OIQ A;  4HR7 B;  1K9M 2;  2PZU A;  2PQE A;  4GN5 A;  2KA7 A;  2OT2 A;  1I3Q B;  4CL1 A;  2NVT H;  1YIT Z;  1MSH A;  3S17 B;  2CWA A;  1WJ2 A;  3TSS A;  5EBD A;  4E30 A;  1LV9 A;  1EWI A;  1WTR A;  4S3S A;  1HZA A;  2H85 A;  4JI1 Q;  3N6R A;  3HOV B;  2VQE L;  2PZW A;  4C2M H;  5M5Y H;  1LT6 D;  1N33 Q;  2JA7 G;  4ZUJ A;  1B3A A;  4TVA B;  2PCF B;  5CR3 A;  3J7Y W;  2ASB A;  1A3U A;  5C4X G;  1S5E D;  4PQX A;  4JI2 L;  1VMP A;  3J80 f;  2AQ3 B;  3ND9 A;  5A35 A;  4LFC L;  1QVF A;  1F9S A;  1W3S A;  1HH2 P;  3MEF A;  3PCO B;  1EQR A;  5C4Z A;  1I4P A;  4MZ9 A;  2F4V Q;  2EYL A;  4RG1 A;  2R6M A;  4APV A;  2QEX A;  2E2J B;  4OWW B;  1I6H I;  4A3K B;  3I91 A;  3CC2 A;  4A3G G;  2XWJ B;  2K4K A;  1I4Q A;  1LTI D;  2Q8R E;  2CW0 D;  1RLY A;  1KRT A;  5KIX A;  1ENF A;  4QUC A;  3FPU B;  1X3F A;  3MTS A;  1F2L A;  1IYJ B;  4P74 A;  4DUZ L;  2QRD B;  4BXX H;  4CDD C;  3KK7 A;  4NW2 A;  1E3P A;  4UY8 C;  1BR9 A;  3W3A A;  2TMP A;  4JOI A;  2JEA I;  3AB9 A;  1VQA A;  3HOW H;  3P5J B;  1F2Y A;  4JK1 C;  2HIV A;  1VQL A;  4RVF A;  1Y1V B;  3VMG A;  3S1R H;  3M3Y H;  4OWX B;  3U4Z A;  4ZCK A;  2PM9 A;  3BS1 A;  4JI0 L;  4NBF A;  3S2H B;  4DFA A;  3KOJ A;  4OO1 I;  4KHV A;  1HQR D;  1DOK A;  3NDI A;  4DR2 Q;  2RA4 A;  5IOC A;  2B8F A;  1YJN Z;  1ET6 A;  2K32 A;  3ND8 A;  1DZ1 A;  1SEB D;  3VR3 A;  2IX3 A;  4LF7 L;  4WJW A;  3RZO H;  3M9B A;  1VQP A;  4LK1 C;  4NXN Q;  3GTM I;  1LM0 A;  4LUZ A;  2DY7 A;  3S2D B;  3LUS A;  1BCP B;  1PFB A;  1WD1 A;  4LUO A;  4DF7 A;  2O4H A;  3FVQ A;  3CCS 1;  1CKN A;  4XX2 A;  1X3W A;  1ML8 A;  1RO4 A;  2Z6K C;  4TSS A;  4C3J B;  3PO3 B;  2YAD A;  4JG2 A;  3K5M A;  2F0W A;  3I4N G;  1YHB A;  1CI3 M;  4IPC A;  1EYC A;  2ICI A;  4R4T A;  4JI5 L;  1FL0 A;  3J7A 4;  5EPJ A;  4I65 A;  2WAQ A;  3PUY A;  3I4M I;  4RHS A;  1JJ2 A;  2GTH A;  3J81 f;  4J8Q A;  3MAQ A;  5K5P A;  3HOX I;  4YY3 L;  4PZ6 A;  2JIP A;  4JI8 Q;  2IV2 X;  4LJZ C;  3CHB D;  2NVQ B;  4ME5 A;  1WTO A;  3ICE A;  4OIK A;  3TN2 A;  1WOC A;  1PA6 A;  3RN2 A;  3C2P A;  1X0T A;  3AQQ A;  4OHJ A;  1A15 A;  4CJ1 B;  1GUW A;  1KNE A;  4C1N K;  3T51 B;  5IP7 G;  5K36 G;  1PFT A;  1BCP D;  3HOZ H;  2WAQ B;  2UXD L;  2JIQ A;  1DL6 A;  3LGJ A;  4HED A;  2EZV A;  2MPM A;  1B1Z A;  4QCL A;  3NEL A;  1Y1W H;  3CQZ I;  2RBL A;  3CCS Z;  3I4O A;  1I50 B;  1DM0 B;  1PV4 A;  3R2T A;  3K81 C;  1M90 1;  1KLG D;  1VQ8 1;  1VS0 A;  5C5M A;  3G71 A;  1GD7 A;  2LIY A;  1EY7 A;  1F2M A;  2R7Z G;  1KDA A;  4LFA L;  1S4Z A;  2JP1 A;  2KEE A;  1P9N A;  2R7F A;  2HIX A;  2K7V A;  1TWG B;  2SOB A;  3PUV A;  4C3H G;  2Q8I B;  4CKE A;  3OIP A;  1VQO A;  4MHE A;  5HGT A;  4YWM A;  1DJR D;  1SYD A;  1V1P A;  1OO9 B;  4L63 B;  5C0X J;  1EU3 A;  1XXG A;  4IN3 A;  4E6I A;  1TS2 A;  2GU2 A;  4DPG A;  4DR7 L;  2QLV B;  5DNF A;  1RHP A;  3LWU A;  1SAP A;  3CPF A;  1TWF I;  1K8A 2;  2DY8 A;  2F0D A;  2SNM A;  2F4M A;  2R93 G;  3HOY B;  1JQY D;  5M3F B;  5T67 A;  5M5W B;  4A3L G;  2OOY B;  1QUQ B;  2B2V A;  3DXJ C;  4A3D H;  1SSO A;  4A93 I;  5AFW A;  5L37 A;  2VPZ A;  3A5U A;  1VQ8 Z;  4JOI C;  2XRS D;  3K0Y A;  3MEH A;  1D1K A;  1R9T H;  2UUA L;  1Q7Y C;  5M3M H;  4DV2 Q;  5C5L A;  3J80 L;  1S72 1;  1N36 L;  1SFO I;  4CGY B;  4Y7N I;  3NHH A;  5BN4 A;  1Q81 C;  1A63 A;  1DCZ A;  5GAG C;  1I6H H;  1UNS A;  5C4X I;  3TRZ A;  3I73 A;  4I7A A;  5FO8 B;  1L1O A;  1BBX C;  3GTK B;  1WFQ A;  1CA5 A;  2TSS A;  3D31 A;  3D0F A;  1E7Z A;  3A8I E;  3PIO A;  4X65 L;  3TDQ A;  3MWY W;  3CC7 1;  2IHE A;  2CH4 W;  4LWC A;  2Z9H A;  1GM5 A;  3R93 A;  4EQO A;  2VUM I;  5DM7 3;  3IF8 A;  3VA7 A;  3F3F C;  4DR1 L;  2QDL A;  1VF5 C;  1YHQ A;  1JE5 A;  3U58 A;  2SEB D;  2Z6B A;  3RUZ A;  3CPW A;  3P1H A;  4KY5 A;  3GQB A;  4RHR A;  4A3G I;  4CJ0 B;  3NEN A;  1ONL A;  1SN8 A;  2A68 D;  4HJ9 A;  4RA8 A;  1Q82 C;  1XTC D;  4LF5 Q;  2A74 C;  2N3S A;  2EYM A;  1L1O B;  3G6J B;  3GO5 A;  4C1N I;  2MO0 A;  1N2F A;  2J6A A;  4E31 A;  3T1H L;  1CHP D;  4KV6 A;  3VYT A;  4BXX G;  2NTT A;  3CU7 A;  3G6E A;  1S72 Z;  1KC8 2;  1UWV A;  4A3J I;  4A3E H;  1QYP A;  3SDZ A;  4B3S Q;  5C44 B;  2UXC Q;  2Q2I A;  1RO2 A;  4E2Y A;  4O2D A;  2RF4 A;  3DLL A;  3IX0 A;  4IAL A;  1HZB A;  4DR6 Q;  1ZB8 A;  4DV3 Q;  4PMC A;  1Y8O B;  2G5D A;  2CHB D;  2PMZ A;  2HQL A;  3JAM f;  3CC7 Z;  2MHV A;  4CHT B;  3LX0 A;  3DM1 A;  2AWN A;  3VR4 A;  1AA6 A;  4JYA Q;  2VPX A;  3C46 A;  1KDB A;  4N9T A;  4GLV B;  1LAB A;  1QCB D;  1U4M A;  4RWS C;  4KD4 A;  1MJC A;  2M00 A;  2RKS A;  2K33 A;  1PRT F;  1NSN S;  1C7Y A;  3D4D A;  3IFU A;  1E1T A;  2BH8 A;  4AYB G;  3J81 L;  1QWY A;  1Q86 1;  3J80 b;  4HJ5 A;  1DGS A;  4IOA A;  4KTA A;  4NXM Q;  4GOP A;  1EZ8 A;  3EQL C;  2E5L L;  1QIL A;  3HGB A;  4IJH A;  5HUR A;  3HOU H;  3A7L A;  1ZB9 A;  3HOV I;  2BA1 A;  5I4D A;  3QR8 A;  3KDF B;  1HNZ L;  4A3I G;  2AWO A;  1FDI A;  1CHQ D;  2AKL A;  5JVG 3;  2JA6 H;  3OSO A;  3NBH A;  3CD6 1;  3K8A A;  3EIV A;  4BY1 G;  1LTR D;  3MXP A;  4HH4 A;  2KCM A;  2A68 C;  2EQS A;  1EWC A;  1BF4 A;  3FKI B;  3VR2 A;  2F4I A;  4MN3 A;  2MO1 A;  5I9P A;  4FF1 A;  4RS4 A;  3GTG I;  4GOP B;  3S1N B;  1O80 A;  2OTL 1;  2ZTC A;  5C6A A;  1K73 2;  1M1K 1;  3RLN A;  1A3T A;  4RV9 A;  1QE6 A;  3J81 j;  2B2V C;  4IUN A;  4KN7 C;  1EYA A;  2QKI C;  1E2Z A;  1X65 A;  4H0L C;  4A3B G;  1PRT B;  1YJ9 1;  1NBW A;  2FJ2 A;  4XQQ A;  5CC4 A;  1LTS D;  1VQ9 A;  3GTM B;  4LF6 L;  1Y1W G;  1V43 A;  5T1I A;  3M85 A;  3D8G A;  2R92 H;  4CBV A;  2VW9 A;  5JEA G;  1IZ6 A;  1CFM A;  3TZU A;  1VQ4 1;  2V8K A;  3TZD A;  3HKZ G;  1YHA A;  3KYH C;  1UE5 A;  1RIP A;  2AMC B;  1FNW A;  2R7Z I;  4R4I A;  4QIW E;  1L1O C;  3K5O A;  1PZI D;  3I56 Z;  3I4M B;  1NUC A;  3CD6 Z;  4IUP A;  2KVM A;  1H9R A;  3HOX B;  3CMA 1;  1SNM A;  2HDL A;  3K6O A;  4KJN A;  1CQV A;  2JSO A;  2HD3 A;  3K80 C;  1Y1V I;  4B3R Q;  1AEX A;  2WAQ E;  4RGN A;  4IO9 A;  4EGV A;  4A93 H;  1Z02 A;  5COY A;  2K5Q A;  3D2L A;  4A75 A;  3HRZ C;  1GHJ A;  4JVZ A;  2F0T A;  1PRT D;  3CCU A;  3CCL A;  2E76 C;  2OTL Z;  3U9O A;  5D1P A;  4DAP A;  3GTO H;  1W2B Z;  4RCO A;  3T16 A;  5BR8 L;  1YNJ C;  2F0P A;  1SYE A;  2BCO A;  2K1B A;  1YZ6 A;  4BBR G;  3J81 b;  1YJ9 Z;  5C3E G;  3GV3 A;  2K5R A;  4DKA C;  2H4O A;  2R3Z A;  1ILP A;  1V1Q A;  1YEZ A;  2QCP X;  2WKD A;  2QA4 A;  2HHH Q;  4A3D G;  3PSI A;  3CQZ B;  2ENB A;  1VQ4 Z;  4R9W A;  3J80 E;  3R3O A;  4Y52 H;  1JJC B;  3CCV 1;  4GKK Q;  1V9P A;  3KF8 A;  5KEE A;  1T5X D;  2LXJ A;  2NBF A;  3FEW X;  4NB3 A;  4EX5 A;  1FJG Q;  1GVP A;  4DV6 Q;  1U5K A;  3CC4 A;  1RNI A;  3CMA Z;  2IX0 A;  1QXF A;  1TFI A;  3TDH B;  2VQF Q;  4X62 Q;  4A3M H;  3A54 A;  4GLA C;  3QB3 A;  1GUG A;  3AFQ A;  2F0H A;  2QRE B;  1GJX A;  1JC7 A;  2JA8 G;  5C0X H;  3E5S A;  3NQT A;  2AQ1 B;  1BDO A;  3TBI B;  2F0M A;  2JIO A;  3H15 A;  1JOQ A;  1WTW A;  4A3J H;  2ZXR A;  3BDC A;  1NAP A;  4DV1 L;  1SNQ A;  1N8R C;  1Z03 A;  4CKC A;  3H0G G;  2GVB A;  3F2B A;  1EIY B;  2VXW A;  3S1Q I;  1K8M A;  4CDE C;  2B63 B;  3A8K E;  2I0Q A;  2F3I A;  5D65 A;  4G7Z C;  1O7Y A;  2VQE Q;  4GOP C;  1OXX K;  1ESR A;  2K28 A;  3PMF A;  4XYO A;  2YTX A;  1IYU A;  3CCV Z;  2EJF C;  4JI2 Q;  2RHB A;  5IYC H;  1N34 L;  5IP9 I;  4IZ8 A;  3VDY A;  1K9M 1;  1PRT C;  4DK6 C;  4F88 A;  2YU9 H;  1B44 D;  4LFC Q;  2I5H A;  2PO4 A;  3PGZ A;  3JAM L;  4FP5 D;  1SFO B;  1B50 A;  2L1B A;  4Y7N B;  4OWT B;  1B9N A;  1B2T A;  3C1E A;  2AUK A;  2RCF A;  3GP7 A;  5EKL A;  2AUJ D;  5IYD G;  2K5D A;  3ULP A;  2JA7 B;  2P28 A;  4ZAI A;  2EXD A;  2W03 A;  3GCF A;  1QVG Z;  4V0B A;  1TWG I;  5AJ3 L;  5C4X B;  5ELB A;  1TXY A;  1I3Q H;  4A3F H;  1UAP A;  3CCJ A;  5F2D A;  2ZM6 L;  4A4I A;  3T1Y L;  3S17 H;  3MXN A;  4EQN A;  4BY7 G;  4HAE A;  2K50 A;  2WII B;  1G29 1;  3WWV A;  1PH2 A;  1YNN D;  2VUM B;  4DUZ Q;  3NH8 A;  1FNV A;  1U9R A;  2EGT A;  3D4R A;  3ZYY X;  2ID0 A;  2A73 B;  3J81 E;  4NDX A;  3J80 c;  2F0V A;  4J1M A;  4KN4 C;  1XYI A;  1HRJ A;  4C3I G;  4A3G B;  1TQO A;  1TWH H;  1W6J A;  3JC6 6;  4UP9 A;  4X6A I;  4K8J A;  1QVF Z;  4RCN A;  4FXD A;  2M48 A;  1VQN 1;  2PYK A;  2WV6 D;  2XRQ D;  1JJ2 Y;  2KQ3 A;  2N49 A;  2E2I H;  3ONA B;  4JI0 Q;  1PFN A;  3HOU G;  1IYV A;  1ZKO A;  4HJ7 A;  3CW2 C;  2QEX Z;  4RGM A;  1PVO A;  3S14 I;  2E2J H;  5JJL A;  4EVO A;  2IHF A;  2JA6 G;  5ELC A;  4IFD J;  1D5Z C;  4A3K H;  3GTJ I;  1Y8N B;  5C4J I;  1YIJ A;  4BY1 I;  3KBX A;  1DOL A;  2SNS A;  4LF7 Q;  3FQQ A;  5COR A;  2ZAE B;  3KIF A;  4NPS A;  1P8L A;  3K7A B;  3LNN A;  1CTM A;  4H44 C;  1KRL A;  1W6K A;  1EIF A;  1GKH A;  2PW5 A;  2X69 A;  4A3C G;  1K28 A;  4OGQ C;  3G7L A;  4LF8 L;  3CCM 1;  4JBK A;  4AIM A;  5JPM C;  1WTQ A;  4JI5 Q;  2MFI A;  2LS0 1;  1OXV A;  4A3B I;  2B3G A;  3VR6 A;  2DJF C;  3NEM A;  4JCV E;  1Y1V H;  5LHY 1;  2KHI A;  5H1S E;  3K59 A;  3Q22 A;  4YY3 Q;  4DQY B;  2O2L D;  3U4V A;  2R92 G;  5CBA E;  1VQN Z;  3JAM b;  3S2H H;  2JYO A;  1HNW L;  2L4N A;  4CDC C;  3VMI A;  4BS9 A;  2E74 C;  3I4N B;  2E8G A;  1LO5 D;  3KLS X;  3DEP A;  1QZG A;  1I94 L;  5C44 I;  3IFD A;  4DV0 L;  4ZQ3 A;  1BO0 A;  2CVR A;  2RPR A;  3F3P C;  5I2Y A;  4OON A;  1D5X C;  2L5T A;  1VQP Z;  2EY5 A;  3NWT A;  4MD8 A;  1NTG A;  2CH4 A;  3HFZ B;  1PH9 A;  1SE8 A;  1E0B A;  3SK4 A;  3PIO 3;  2UXD Q;  2WIN B;  1IKM A;  2NZO A;  2Z0S A;  1G6Z A;  1SBB B;  1LLR D;  3PO3 H;  4C3J H;  1HTL D;  2M2L A;  1M4V A;  4R8I A;  3GTG B;  3CCM Z;  1Q7Y 2;  3J81 c;  2IWH A;  4RH6 A;  4L5Q A;  1X54 A;  2KJX A;  5LL6 X;  1WZN A;  3SE0 A;  1EQQ A;  4IFD I;  4GKJ L;  1YJN 1;  1CKM A;  2NN6 G;  1SYG A;  1O7L A;  4XT1 B;  4ZKB B;  1ENA A;  2K52 A;  5C3E I;  3NTI A;  1Q81 2;  3CF5 A;  3DHQ A;  1S5C D;  4LFA Q;  3T56 B;  1X6O A;  4CDF C;  2WB1 G;  1Y14 B;  1KIX A;  4RKL A;  1GXD C;  4RAU C;  2NVQ H;  5I6Y A;  3I7F A;  1BCP F;  1RCV D;  3EN2 A;  4IUR A;  1Q8I A;  1JB3 A;  2O5J C;  1HQM C;  2MUY A;  3UE0 A;  5FLM H;  5IGE A;  3KJO A;  2BE5 D;  3RR5 A;  4DR3 L;  2RQX A;  2R7Z B;  3KUP A;  1FGU A;  5J1Z A;  1FVI A;  5LMU L;  2K5H A;  3P75 A;  2GA4 B;  4L8J A;  5M5X B;  4DR7 Q;  1SE2 A;  1VQ5 A;  4HCE A;  4TNU A;  1TR5 A;  4H13 C;  1VQ6 1;  3NFZ A;  3H09 A;  3PO2 H;  4C3H B;  4ILW A;  1Q82 2;  1I50 H;  3DWP A;  3FKI I;  2EVB A;  2Z8L A;  1D5M C;  4YHH L;  2P5Z X;  1VQK A;  3NSW A;  4WRD A;  2CWP A;  4X3T A;  3G71 Z;  3NDJ A;  3S1N I;  3GDE A;  3AU7 A;  5IGG A;  3CPW Y;  1KL9 A;  2K75 A;  2UUA Q;  3BU2 A;  3H0G I;  1RTO A;  2IY5 B;  1MI2 A;  1VQB A;  4HCS A;  2UU9 L;  4UHV A;  1MJE A;  1N36 Q;  1XX8 A;  3A56 A;  4KHZ A;  1F9P A;  2R93 B;  3F2C A;  1DOM A;  1TWG H;  1VQM A;  4NMZ A;  5IT9 f;  2W04 A;  1VQO Z;  1K8A 1;  1ZEQ X;  3JAM i;  1F9R A;  2QEJ C;  4MD9 A;  4DUY L;  1YIT A;  1X9N A;  1LT3 D;  2R7D A;  5IYC G;  3PUX A;  3JAM E;  5CV5 A;  2MJ8 A;  3OTO L;  4X65 Q;  3BYT B;  3BG3 A;  2HU9 A;  1TWC I;  3FMC A;  1ILQ A;  1YHQ 1;  4BBS I;  4MNO A;  4HJ8 A;  4DR1 Q;  1VQ6 Z;  3HOY H;  1OXU A;  1JWU D;  3C1F A;  4CKB A;  5M5W H;  5M3F H;  2J7Z A;  3VTN A;  1SMX A;  3MVV A;  1KD1 C;  2NVX B;  4BWG B;  1RDP D;  3HG9 A;  4A3F G;  2CW0 C;  1RL2 A;  1X3G A;  1WTP A;  3A8J E;  5EJW A;  1CZW A;  4C56 C;  1PH6 A;  2A6E D;  4LFB L;  1SNP A;  1GUT A;  3T1H Q;  3SK6 A;  3GTQ I;  3CCE 1;  1EY9 A;  2V4D A;  4X66 Q;  2IZ4 A;  2JA5 G;  1PH7 A;  2HCI A;  1FYC A;  4OXP A;  1UEA B;  3S1Q B;  1RJT A;  1FGB D;  4KMU C;  1SND A;  2H5X A;  1XNQ L;  2E2H B;  1GUS A;  3GTK H;  1WCM G;  2IZ3 A;  4FNF A;  5JJK A;  1VMC A;  5IGD A;  3BYY B;  2PQA A;  2E7Z A;  1V1O A;  1LUZ A;  2OTJ 1;  2UUB L;  3MZ5 A;  2MQH A;  3BG1 B;  1S5D D;  3BDO A;  3NP8 A;  2DE6 A;  3VYS A;  1HR0 W;  3VR5 A;  1HFN A;  1Z6H A;  1YHQ Z;  1K0S A;  2RBM A;  1SE4 A;  1MIU A;  1HHV A;  3UI2 A;  1KC8 1;  2OQK A;  3EED A;  3NUC A;  1QZH A;  2KOL A;  1QUQ A;  5KGU A;  4DNI A;  1Q8K A;  1STN A;  2PQA B;  3OMC A;  2E75 C;  2DUD A;  3IFT A;  3RD4 A;  4P75 A;  2HUG A;  1JJG A;  2JA9 A;  1VF7 A;  3W1G A;  3CCE Z;  3BZC A;  2PPB C;  1SYC A;  1XMO L;  4ABN A;  4ZUI A;  1NJI C;  5A2Q f;  2QDB A;  5EGT A;  2E5L Q;  1VQH A;  2DE5 A;  3OYY A;  2JS4 A;  4PNY A;  2B63 I;  3RZD I;  4DK1 A;  1Y8P B;  2YTV A;  3JAM c;  3IR7 A;  3I55 1;  4JBJ A;  1EEF D;  1HNZ Q;  2OTJ Z;  1QF8 A;  1A2U A;  4R4C A;  3G4S 1;  2EY1 A;  2IW3 A;  5I9O A;  1RQF A;  4Q5V A;  3PIP A;  4IJL A;  3OWF A;  2A6E C;  3CCR 1;  4IUV A;  1UEB A;  1JOR A;  3URY A;  4IFD H;  1F2Z A;  3H91 A;  5CV8 A;  1BCP C;  3NXW A;  4A3I B;  3S14 B;  2JA7 I;  1HUM A;  4R4Q A;  4M1U B;  4L5S A;  3GTJ B;  3RLO A;  5C4J B;  1A8V A;  4BY1 B;  2FMC A;  2EY6 A;  2EYO A;  3MON A;  3IL8 A;  2C9O A;  1JE4 A;  4LF6 Q;  4FO2 A;  4OEL B;  4A76 A;  4B3T L;  1E22 A;  4LMQ D;  4JV5 L;  4JPB W;  1OTC A;  1JWS D;  2F0K A;  3CRL C;  2BH2 A;  3ER0 A;  5EAY A;  1HTP A;  4L5T A;  3I55 Z;  4DGL A;  1K73 1;  4A3B B;  3F2U A;  1K8G A;  1NY4 A;  4Q0F A;  4DV7 L;  3RLF A;  4AH6 A;  4V19 0;  3CCS A;  4LAA A;  3G4S Z;  3FKI H;  3DUZ A;  4RGO S;  1EOV A;  4OO1 H;  5D3I B;  2EXZ A;  3S1N H;  5LL6 S;  5FLM G;  3CCR Z;  1VLA A;  3HKZ B;  3S9W A;  4NH1 C;  1YUK A;  2V45 A;  2QRC B;  2XSC A;  4ULL A;  1CKO A;  1D1I A;  3I8Z A;  2JR6 A;  1N8R 2;  1VQ7 1;  3S16 I;  3T4A C;  4EQ5 A;  4KKS A;  1YI2 1;  2D9U A;  1A6X A;  3M4O B;  2K3R A;  4DNR B;  1PZK D;  3KIH A;  3HOW G;  5ISR A;  5BR8 Q;  4P71 A;  4JI3 L;  4XYQ A;  5BN5 A;  2WFW A;  3GTM H;  1TVX A;  3F2D A;  2Q2U A;  3PO2 G;  2N78 A;  4JBM A;  1USP B;  3K7A I;  1NUI A;  1ZYR D;  1QG7 A;  4NOZ A;  3QWN A;  5LMN W;  1C4Q A;  1PXU A;  5IT9 L;  2LMC B;  1WD0 A;  1EU4 A;  2VF1 A;  4DA2 A;  1EY8 A;  3KF6 A;  5KRU A;  3I4M H;  3KDF A;  1HCZ A;  4UAI A;  2FXQ A;  2RDF A;  4BBR B;  3HOX H;  1Q12 A;  1B3Q A;  1ZXT A;  2NAP A;  5C3E B;  3KBG A;  2F0U A;  2KCN A;  4XQN A;  4XDX A;  1PH1 A;  3S15 B;  5J22 A;  2NVY B;  1IW7 D;  3M4Y A;  4XTC S;  3FP9 A;  1VQ8 A;  3H3V J;  4YIJ A;  3A74 A;  4K0K L;  1TY2 A;  2G9D A;  4POG A;  1Q1B A;  3WOE A;  3I4N I;  4R4O A;  1Y69 U;  4N8F A;  1G6P A;  1B7Y B;  4QJF A;  1VQ7 Z;  1YI2 Z;  1JOK A;  2C5C A;  2MNA A;  5CBE E;  1EY0 A;  3KF6 B;  2FFK B;  2ZJR A;  3RN5 A;  1WVL A;  1U4L A;  1A0I A;  4DV1 Q;  1IBK L;  2UXB Q;  1JWH C;  1ZH1 A;  2EE1 A;  3I56 1;  3HOY G;  1HZ9 A;  1U0L A;  1WTV A;  3Q23 A;  1TII D;  3CQZ H;  4GNX A;  2JA8 B;  3Q0A A;  1B9M A;  1JIC A;  4YCV A;  3CME 1;  4OL7 A;  1JCK B;  3J7Z C;  2GTI A;  5IP7 I;  1VQI A;  3GD7 A;  1N34 Q;  2XWB B;  2G9H D;  1D8L A;  4KY6 A;  4B9X A;  4HJA A;  3HOZ G;  1I5F A;  3H0G B;  1X3Q A;  3A5Z B;  4NBE A;  1PDQ A;  2K03 A;  3EA6 A;  1STH A;  1LYL A;  3M4Q A;  3CCQ A;  4DR5 L;  1WCM I;  5JJZ A;  1XPU A;  5FK9 C;  4K5X A;  1Z01 A;  1S5F D;  5AJ3 Q;  1YJW A;  4GNX B;  1K83 I;  3MZL B;  3AFP A;  1II3 A;  1KDC A;  2PI2 A;  5ELN A;  5IIF A;  3Q6S A;  2ZM6 Q;  3T1Y Q;  1S72 A;  3I3C A;  3PF4 A;  4GN4 B;  1TWC B;  1AZP A;  1TWF H;  2EDG A;  2B63 H;  2NZ1 D;  1QOH A;  2L15 A;  4BBS B;  3PO3 S;  4U68 A;  1LTA D;  2BDO A;  1EIH A;  1OXT A;  1SNO A;  5A2Q L;  1ROD A;  4JI4 L;  3X3N A;  5IT9 b;  1SXT A;  4GZY C;  3H3V I;  2B2W A;  4ID6 A;  2JEB I;  5ELO A;  3CC7 A;  3CME Z;  1K8O A;  3MA2 B;  1E1O A;  5EPL A;  3SR1 A;  5KNC A;  4BY7 B;  2D0O A;  1BVS A;  4KHP L;  3UDX A;  5FOB B;  2F1M A;  1EQV A;  1VQG A;  2I5L X;  2A6H D;  4NBD A;  2LKV A;  1SFO H;  2I5M X;  3GTQ B;  2FIN B;  2F4O A;  3VYU A;  4Y7N H;  2I46 A;  2O53 A;  2JA7 H;  2LEX A;  2R93 I;  1SR3 A;  3ERQ A;  3V96 A;  5C4X H;  4OX9 L;  3EBE A;  2CCZ A;  5E4X A;  3QJY A;  3P7J A;  1WW9 A;  3VA5 A;  4A3L I;  3A55 A;  1YIJ 1;  2L55 A;  2OF1 A;  2JQO A;  3J80 i;  4DNT B;  4HIO A;  5D1O A;  4GLX A;  3CCJ Z;  2NVT I;  3CXC Y;  4NKL A;  1S7M A;  5T1G A;  2N88 A;  2UXC L;  3QOJ A;  4EQP A;  5M3M G;  4S1T A;  4HIM A;  3SXH A;  1PH5 A;  4QTU A;  2VUM H;  1IXR A;  2JNY A;  2D0P A;  4PMW A;  3GTP B;  4XQJ A;  5CV7 A;  2Y0S A;  4E32 A;  1SNC A;  1HNX L;  1LT4 D;  2JIR A;  1RKN A;  4LF8 Q;  2WP8 J;  1N32 L;  4RMF A;  3PUW A;  4A3G H;  2LFN A;  1P16 A;  2NVX I;  3DM3 A;  5LL6 f;  4QMG A;  4G7H C;  2EIF A;  3BVZ A;  5D1O B;  1EEI D;  5E1F A;  2FMM A;  1KQS Y;  5GRO A;  1PTO F;  5C3W A;  1FNU A;  3RMH A;  3OW2 Y;  4HTH A;  1SRU A;  1VDZ A;  4E2W A;  4IPD A;  1HNW Q;  1PFS A;  4M8A A;  1WYD A;  4EWC A;  4K14 A;  2Y0S B;  2EYH A;  4WOR A;  5FO7 B;  5FO9 B;  4DAV A;  2F0O A;  5JOB A;  3NTK A;  1M90 C;  2VPY A;  1I94 Q;  4DV0 Q;  3MXU A;  3RZD B;  3J7A F;  2JIM A;  1YIJ Z;  2E2H I;  1K3R A;  4IOC A;  1D6E C;  1G8Z D;  1VQF A;  2Q2H A;  1TU2 B;  3E9H A;  4Z9C B;  3STB D;  1NCV A;  3K7A H;  5HY6 A;  4DV5 L;  3CKI B;  4J6H A;  4LW1 A;  2UUC L;  1O78 A;  4OO1 G;  3L0O A;  4BXX I;  2XGT A;  1SMY D;  3QOL A;  4LUV A;  1XPO A;  1Y8C A;  1VQC A;  4A3E G;  2L11 A;  1STE A;  5A2Q b;  5IGF A;  4GNX C;  3HOW I;  3CD6 A;  1UE1 A;  2QEX 1;  4PMB A;  3BG0 B;  1CK1 A;  4J15 A;  1MKH A;  3UDI A;  2JXM B;  4DV4 L;  1BBW A;  2WB1 A;  1HJP A;  5BN3 A;  1EQT A;  3CC2 1;  2AKW B;  3S1R I;  3M3Y I;  4B08 A;  2F03 A;  4YWK A;  2F0L A;  4DGZ A;  1YNX A;  5IT9 E;  2ZJP A;  1JT8 A;  5CMD A;  1S5B D;  1TKW B;  1LTT D;  1PTO B;  5JEA J;  5CV6 A;  2OTL A;  3I4N H;  1CQF A;  1E2W A;  1W2B A;  2LXK A;  5I2X A;  1UUP A;  1GO3 E;  5JPN C;  3ITP A;  3J81 i;  3HOV H;  5J39 A;  5EKI A;  3HOX G;  1YJ9 A;  4RFB A;  4DR3 Q;  2I07 B;  1Q7Y 1;  5EKK A;  5LMU Q;  4QL5 A;  4YCW A;  4LF4 L;  1BKB A;  1ET9 A;  4E2X A;  2OEO A;  2WB1 B;  1VQL 1;  1KD1 2;  1E24 A;  4NBB A;  1VQ4 A;  5J3B A;  1Q81 1;  1RF2 D;  3L7Z C;  2D2C C;  3KLW A;  1BUV T;  1S40 A;  2DJG C;  3BJU A;  3GTG H;  5IP7 H;  4UDU C;  3S24 A;  1A3V A;  4YHH Q;  4ME3 A;  3TP5 A;  2AHO B;  4UP7 A;  3K7U C;  1C8C A;  1L2F A;  3KLS A;  5DEH A;  3DEO A;  1J5E L;  4B3R L;  3S16 B;  3CMA A;  2B2W C;  4A3I I;  1PTO D;  1U4P A;  2B29 A;  3TP8 A;  1DD2 A;  1KXL A;  1B4O A;  4HSV A;  3CC2 Z;  1NMG A;  1TT2 A;  3PQI A;  1VQP 1;  1SJE D;  2UU9 Q;  1WTX A;  4NBA A;  1VQM 1;  1HUN A;  2FHT A;  4FXK C;  4GN3 B;  4K5W A;  1G91 A;  1RO0 A;  1L0Y B;  4JI7 L;  2I3C A;  1TWA B;  4DUY Q;  4I7Z C;  4DK0 A;  5IOD A;  1Q82 1;  3BVG A;  1SMY C;  4PV1 C;  1AH9 A;  1F77 A;  2R7Z H;  1R4P B;  2EOT A;  3OTO Q;  1EL0 A;  1RD9 D;  5M5X H;  2EYF A;  5FLX f;  1YUA A;  2F0F A;  4MD7 A;  4QB4 A;  3NTH A;  3MFG A;  1U4R A;  3KFU A;  1X3E A;  5GAD C;  1VQL Z;  2VZA A;  1EIG A;  1Y1W I;  4C3H H;  4IUU A;  4KY7 A;  2NTS A;  3HEJ A;  1EWH A;  3H6M A;  1EOT A;  1VQK Z;  3PIP 3;  5ELD A;  3L9A X;  1J8I A;  3CCV A;  1STG A;  1I4H A;  3W2D A;  1B8A A;  2YV5 A;  1C48 A;  4UP8 A;  3GTL B;  1IBL L;  3NBI A;  3CXC A;  1H95 A;  1CUK A;  1VCI A;  1A2T A;  1FD7 D;  1H9S B;  1YNN C;  1HR0 L;  1NJI 2;  4LFB Q;  1T5E A;  5A2Q E;  3M4O I;  2Q51 A;  3VMH A;  4IPH A;  5IT9 c;  2RVL A;  2R93 H;  1IHZ A;  3K0X A;  2XIW A;  4H7B A;  4A3L H;  1VQM Z;  4B3M L;  3ERO A;  4G4K A;  3S1M B;  4A93 G;  4X64 L;  2KHJ A;  3MHB A;  4A3F B;  1IL2 A;  4K5V A;  1XNQ Q;  2EJG C;  2OQ0 A;  1PYS B;  2UUB Q;  1SDF A;  3AEV A;  3G71 1;  4G7O C;  1C0A A;  2VUG A;  3FPP A;  5E3F A;  2F0I A;  1Q86 C;  1KQS A;  2JA5 B;  4MH4 A;  1ICW A;  1JJ2 Z;  1LTL A;  3EFX D;  3OW2 A;  4BBR I;  3R8B A;  1M8A A;  1PTO C;  1XNR L;  1MD2 D;  1PMR A;  2NVX H;  3TP6 A;  2F0G A;  1J6Q A;  1WCM B;  2K01 A;  2OXP A;  3QG1 A;  4FVM A;  4GS3 A;  3S15 I;  5DLQ E;  1TWH B;  4A3D I;  2X6G A;  4CJ2 C;  2F52 A;  3J7A V;  2NVY I;  1EFI D;  4ZYS A;  1BBU A;  4PZ8 A;  1VQO 1;  4FYD A;  4JI6 L;  1R9T I;  1K83 B;  3I2Z A;  1VQJ A;  2VUM G;  2E2I B;  5D3D A;  2PK7 A;  3GTM S;  2YTY A;  1EY5 A;  2RDH A;  1J9O A;  3F8T A;  1XMO Q;  1S3O A;  3S1Q H;  4R1J A;  2PI2 E;  2F0E A;  4A3M G;  2E2H H;  2QGQ A;  3AMU A;  1M1K C;  1IBM L;  1KAB A;  1PH3 A;  4LF9 L;  1PLF A;  3R2I A;  2ZJQ A;  4E33 A;  2QKD A;  2JA8 I;  5C0X G;  1SRO A;  4ZKC B;  1XMQ L;  1STY A;  1Q16 A;  2KCC A;  2K6A A;  3I90 A;  4XXE A;  2JJQ A;  5IP9 H;  2O4X A;  4DR4 L;  1G2S A;  4A3J G;  4ZLT F;  4MTN A;  2DGY A;  2QIL A;  4ZK9 B;  5EBC A;  3M4P A;  1LTB D;  4PZ7 A;  2ES2 A;  3IAY A;  1STA A;  2NVT B;  3NWS A;  1VQN A;  3VB9 A;  5EQ0 A;  3E0E A;  4XIG S;  2K05 A;  4MTK A;  4HIK A;  4C3I B;  4LNQ A;  4A3E I;  4AQY L;  2HDM A;  4G57 A;  4B3T Q;  3DWQ A;  1Q1E A;  2Q4Z A;  4YWL A;  1NMF A;  3FQM A;  2GN5 A;  4JV5 Q;  1PHJ A;  2BA0 A;  4N8X 1;  4C2M B;  5M5Y B;  3W5O A;  5IYB H;  4NBC A;  1EY6 A;  1DYQ A;  1HZC A;  5IWA L;  3UDG A;  3ULJ A;  2Y0S E;  4BA2 I;  1ENC A;  1LQL A;  4X6A H;  1X55 A;  4QTT A;  4ZRZ A;  4DV7 Q;  4NB8 A;  2RHQ B;  4BY7 I;  4L6T B;  1CSP A;  3T53 B;  2XNA C;  3CCM A;  2VNU D;  3G6E 1;  1BQQ T;  5LMN L;  4MIU A;  3HOV G;  3O13 A;  2BE5 C;  4A3I H;  3CAM A;  3SVM A;  3S14 H;  4QQB X;  2QF7 A;  3E6Z X;  3S2D I;  2A5H A;  3GTJ H;  2Z1C A;  3P20 A;  4KJO A;  5C4J H;  1TS5 A;  4MXU A;  4BY1 H;  5CGK A;  2VL6 A;  4X3U A;  3HP3 A;  4JI3 Q;  5ELE A;  1Z9F A;  2PW7 A;  4QIW B;  2KI7 B;  2LSS A;  1NNX A;  2KHS A;  1CKN B;  2SDF A;  4JI1 L;  1A62 A;  3V05 A;  2VPW A;  1X3Z A;  2RT9 A;  1N33 L;  3HOU I;  3DWA A;  2F3V A;  2N8N A;  2DNE A;  2A1A A;  4R8N A;  5TSS A;  1KLU D;  2VB2 X;  3EVQ A;  1LAC A;  3CPW Z;  2JA6 I;  1SLJ A;  2LY7 A;  5E4W C;  3GKQ A;  4A3K G;  3HOW B;  4A3B H;  3D9X A;  1K3B C;  3OOC A;  4AYB A;  1N8R 1;  3PO2 B;  4DXF A;  4OEM B;  3S1R B;  3M3Y B;  5T64 A;  4DU9 A;  5FLX L;  1ASY A;  3NQI A;  2K5N A;  5JEA H;  2V1C C;  3NH5 A;  3IRB A;  4A3C I;  1QNK A;  3PUZ A;  2ATW A;  2NUC A;  2WB1 E;  2F4V L;  3G6E Z;  3VYR A;  4PG3 A;  2B8G A;  2WKC A;  1YJN A;  4K0K Q;  5C44 H;  4ALP A;  3GV6 A;  3D6C A;  3LWE A;  3M4O H;  3H3V C;  4RVD A;  4TRD A;  5FJ8 H;  1X56 A;  3RZO B;  2XTI A;  5KYL A;  4WJ4 A;  2JE6 I;  2EY2 A;  1F9Q A;  1K9M C;  1IBK Q;  1Y1V G;  3E0J A;  1CA6 A;  4P72 A;  4K2L A;  2A69 D;  5IY0 A;  1KAW A;  1AP0 A;  4AYB B;  2R92 I;  2ZTE A;  1FR3 A;  1JMC A;  2PNR C;  4F8M A;  2IL8 A;  3HS0 C;  2EYP A;  1GOZ A;  2R6G A;  3H94 A;  1XJV A;  3OHX C;  1H9M A;  1GHK A;  2F0Q A;  4IPG A;  2KPI A;  3ZJY C;  1Z47 A;  2N55 A;  3ULL A;  3TS2 A;  4BBR H;  4O0A A;  5C3E H;  3PV0 A;  1VQ6 A;  3L2P A;  1I4G A;  2NWG A;  3CCQ 1;  4E2Z A;  3PF5 A;  1JWM D;  4MON A;  1IL8 A;  3D6W A;  2Z4H A;  3S15 H;  1IKL A;  5JAV A;  2BJO A;  1VQ9 1;  1SYF A;  2NVY H;  4K6D A;  4DR5 Q;  3UE1 A;  4HSP A;  1B53 A;  1UE6 A;  1QJO A;  2RSO A;  4DR2 L;  1YJW 1;  3PO3 G;  1DXM A;  1N9W A;  4C3J G;  1V1P B;  4FF3 A;  3SHL A;  1HA5 A;  4FF2 A;  3HKZ A;  4KD3 A;  4X3K A;  5ELF A;  3GTO I;  1Q46 A;  1Z7T A;  3HOZ B;  1AE2 A;  1T9H A;  4NXN L;  5JVH 3;  5IE8 A;  4B9W A;  4QGU A;  2NN6 I;  1BNZ A;  4NFR A;  1TS4 A;  5FKA C;  2J4X A;  1EUJ A;  2IPK D;  5KYI A;  1USP A;  1Y1W B;  2JA8 H;  4DXG A;  2M9V A;  2ZXO A;  3I4L A;  2L0C A;  4Y52 I;  1NP6 A;  4JI4 Q;  2PNH A;  3NPP A;  3CCU 1;  3CCL 1;  3D3R A;  1MBY A;  1Q90 A;  3DMU A;  3H0G H;  4P73 A;  2RIQ A;  2O5I C;  2WAQ G;  2VY3 A;  4KHP Q;  2WAC A;  4JI8 L;  5FLX b;  3CCQ Z;  4A3M I;  1KAA A;  1M90 2;  1CSQ A;  4DN4 M;  1VQ9 Z;  4POF A;  1CZG A;  1YJW Z;  2QA4 1;  5C0X I;  4OX9 Q;  2A69 C;  3SK8 A;  1JR0 D;  4X66 L;  3E3X A;  5IP9 G;  1TWA I;  3AYH B;  2E2D C;  1V8Q A;  1SJH D;  3CCE A;  1PH4 A;  1YBY A;  1TWC H;  3A0J A;  2F3W A;  1LT5 D;  5IYD H;  3CC4 1;  4BBS H;  1HNX Q;  2OOX B;  3QO2 A;  2B2T A;  1NR4 A;  3WOF A;  5D14 A;  5HGQ A;  1N32 Q;  2OTJ A;  4A3D B;  2QW7 A;  4BY7 H;  1R9T B;  2V3V A;  3CCU Z;  3CCL Z;  3GTL I;  2P3Y A;  3CP0 A;  2YU9 I;  5M3M B;  5I6W A;  4NBG A;  3T13 A;  1TS3 A;  2JK8 A;  3GTQ H;  1Q3L A;  5DAU A;  1WI5 A;  2VB3 X;  2RSN A;  2EJM A;  2OZK A;  1YVC A;  2H1E A;  4KLK A;  1O7Z A;  1PYB A;  5IYB G;  3S2D H;  1I6H B;  2KCT A;  3M7G A;  4C3I H;  5M3F G;  3I72 A;  1B70 B;  4NBH A;  2QA4 Z;  3S1M I;  3TEH B;  1EZ6 A;  2HQE A;  1I3Q I;  4A3F I;  4K6L A;  2K5W A;  3S17 I;  2PMZ B;  3TP7 A;  4RKB A;  2A8V A;  1W2B Y;  2J0T D;  3I70 A;  4MRI A;  1WJJ A;  1QB5 D;  4DV5 Q;  4ODG A;  1YNJ D;  2NYZ D;  2UUC Q;  3RNU A;  3L3O C;  5NUC A;  1Y1V S;  2Q8T A;  2JA5 I;  3CC4 Z;  1AE3 A;  4F87 A;  4HGZ A;  3I55 A;  3ESW A;  5E7N A;  3QIA A;  1L0W A;  3GTP I;  3Q24 A;  4UPA A;  1TWH I;  5CYU A;  2IJ0 A;  2AYD A;  1WII A;  4DV4 Q;  4K8I A;  4DV2 L;  3G4S A;  5GQO A;  5CM2 M; 
#chains in the Genus database with same CATH homology
 4A3C H;  3CCJ 1;  2A19 A;  4DAM A;  1EYG A;  2RCN A;  3CCR A;  2E2I I;  3HKS A;  5AN9 F;  2JMO A;  4KI0 A;  2E2J I;  4A3K I;  3RZD H;  5T6B A;  3NBH B;  2IX1 A;  4LF4 Q;  5C44 G;  1K8A C;  1KHI A;  4LF5 L;  5FJ8 G;  2K14 A;  2Q2T A;  2DE7 A;  1J5E Q;  3MZK B;  2GVA A;  3BZK A;  3TS0 A;  3S2H I;  2ALY B;  3KJP A;  4B3S L;  3F1Z A;  1XTD A;  1KD1 1;  4JI7 Q;  1VQ7 A;  2RHS B;  1YI2 A;  4DR6 L;  2D62 A;  4IFD G;  1QVG Y;  4DV3 L;  1Q86 2;  1QVC A;  3U50 C;  3Q87 A;  3SGI A;  4L5R C;  3EER A;  4JYA L;  1C9O A;  1VQD A;  3PO3 I;  1G51 A;  4AYB E;  2ZTD A;  4YCU A;  1KRS A;  1IBL Q;  3S16 H;  3B6Y A;  2KBN A;  3Q8D A;  1HR0 Q;  1QVF Y;  4NB9 A;  4NXM L;  2NVQ I;  1M1K 2;  3G48 A;  2IT1 A;  3FKI G;  4JC0 A;  3TE5 B;  4B3M Q;  2E9H A;  4X64 Q;  1TWA H;  1KC8 C;  5FLM I;  2UXB L;  3KF8 B;  5FLX c;  2CQO A;  3I07 A;  1ASZ A;  3I56 A;  1OXS C;  2M6N A;  5JJI A;  3E9I A;  3TQY A;  3M7N A;  2QR1 B;  4GKJ Q;  3J7A 5;  3PO2 I;  1NJI 1;  1I50 I;  1XNR Q;  3CME A;  4DAY B;  2HF1 A;  2KEN A;  3GTL H;  2CKZ B;  2VS1 A;  3CXC Z;  4JBW A;  2HT1 A;  4JI6 Q;  3I4M G;  4FDB A;  2YYZ A;  4BBS G;  3HKZ E;  3RZO I;  2CFM A;  4BA1 I;  1NE3 A;  1VQ5 1;  4DK3 C;  3S1M H;  3FHW A;  2K5V A;  1VQE A;  3ERS X;  2V8J A;  1IBM Q;  4LF9 Q;  1VQK 1;  3NH4 A;  1XMQ Q;  1KQS Z;  2C35 B;  1O7I A;  3W1B A;  2JA5 H;  4DR4 Q;  3OW2 Z;  1D7Q A;  3HOY I;  1WCM H;  3GTP H;  2NZH A;  1UE7 A;  4HGY A;  3QWU A;  3STB C;  2G2K A;  1K83 H;  3MXN B;  1YIT 1;  2JUB A;  1XPR A;  3T4N B;  1K73 C;  4HID A;  1JB7 A;  3HOZ I;  2Z6K A;  3TRE A;  4AQY Q;  2HHH L;  5GAH C;  1VQ5 Z;  4TQU S;  3GTK I;  2LFU A;  4RVG A;  3H3V H;  4GKK L;  5IWA Q;  4H02 A;  1FJG L;  2V8I A;  1K0R A;  5GAE C;  4DV6 L;  1PH8 A;  4QY7 A;  2PMZ E;  2OWO A;  2VQF L;  4X62 L;  2Y0S G;  3UDF A;  2OCE A;  4RVH A;  2B63 G;  5LMN Q;  1EFW A;  4WJ3 M;  1QVG A;  1K9M 2;  4GN5 A;  2NVT H;  4CL1 A;  1YIT Z;  2CWA A;  4E30 A;  1EWI A;  1HZA A;  2H85 A;  4JI1 Q;  2VQE L;  4C2M H;  5M5Y H;  1N33 Q;  2JA7 G;  4TVA B;  5C4X G;  2ASB A;  4JI2 L;  3J80 f;  4LFC L;  1QVF A;  1W3S A;  1HH2 P;  3MEF A;  3PCO B;  1EQR A;  4MZ9 A;  2F4V Q;  4RG1 A;  2R6M A;  4APV A;  2QEX A;  4OWW B;  1I6H I;  4A3G G;  3CC2 A;  2K4K A;  1KRT A;  1RLY A;  1X3F A;  1IYJ B;  4P74 A;  4DUZ L;  2QRD B;  4BXX H;  1E3P A;  4UY8 C;  4JOI A;  2JEA I;  1VQA A;  3HOW H;  3P5J B;  2HIV A;  1VQL A;  4RVF A;  3VMG A;  3S1R H;  3M3Y H;  4OWX B;  3U4Z A;  2PM9 A;  4JI0 L;  4NBF A;  4OO1 I;  3KOJ A;  3NDI A;  4DR2 Q;  1YJN Z;  4LF7 L;  3RZO H;  3M9B A;  1VQP A;  4NXN Q;  3GTM I;  1LM0 A;  4LUZ A;  3LUS A;  4LUO A;  2O4H A;  3CCS 1;  1CKN A;  4XX2 A;  1X3W A;  1ML8 A;  1RO4 A;  2Z6K C;  2YAD A;  4JG2 A;  3I4N G;  1YHB A;  4IPC A;  4R4T A;  4JI5 L;  1FL0 A;  3J7A 4;  2WAQ A;  3PUY A;  3I4M I;  1JJ2 A;  2GTH A;  3J81 f;  3HOX I;  4YY3 L;  4PZ6 A;  4JI8 Q;  3ICE A;  1WOC A;  1PA6 A;  3RN2 A;  1X0T A;  3AQQ A;  5IP7 G;  5K36 G;  1PFT A;  3HOZ H;  2UXD L;  1DL6 A;  3LGJ A;  1Y1W H;  3NEL A;  3CQZ I;  2RBL A;  3CCS Z;  3I4O A;  1PV4 A;  3K81 C;  1M90 1;  1VQ8 1;  1VS0 A;  3G71 A;  1GD7 A;  2LIY A;  2R7Z G;  4LFA L;  1P9N A;  2R7F A;  2HIX A;  3PUV A;  1VQO A;  4YWM A;  5C0X J;  2GU2 A;  4DPG A;  4DR7 L;  2QLV B;  3CPF A;  1TWF I;  1K8A 2;  2F4M A;  2R93 G;  4A3L G;  5T67 A;  2OOY B;  1QUQ B;  4A3D H;  4A93 I;  3A5U A;  1VQ8 Z;  4JOI C;  1R9T H;  2UUA L;  1Q7Y C;  5M3M H;  4DV2 Q;  1S72 1;  1N36 L;  1SFO I;  4Y7N I;  1A63 A;  1Q81 C;  1I6H H;  5GAG C;  5C4X I;  3TRZ A;  1L1O A;  1WFQ A;  3D31 A;  3D0F A;  1E7Z A;  3PIO A;  4X65 L;  3CC7 1;  2IHE A;  4LWC A;  1GM5 A;  2VUM I;  3IF8 A;  4DR1 L;  3F3F C;  1YHQ A;  1JE5 A;  3U58 A;  3CPW A;  4A3G I;  3NEN A;  1SN8 A;  4HJ9 A;  1Q82 C;  4LF5 Q;  2N3S A;  1L1O B;  3GO5 A;  2MO0 A;  1N2F A;  2J6A A;  4E31 A;  3T1H L;  4BXX G;  3G6E A;  1S72 Z;  1KC8 2;  1UWV A;  4A3J I;  4A3E H;  1QYP A;  4B3S Q;  2UXC Q;  2Q2I A;  1RO2 A;  4E2Y A;  4O2D A;  2RF4 A;  3DLL A;  3IX0 A;  1HZB A;  4DR6 Q;  1ZB8 A;  4DV3 Q;  2PMZ A;  2HQL A;  3JAM f;  3CC7 Z;  2AWN A;  4JYA Q;  4GLV B;  1MJC A;  1C7Y A;  3IFU A;  1E1T A;  2BH8 A;  4AYB G;  1Q86 1;  3J80 b;  4HJ5 A;  1DGS A;  4IOA A;  4NXM Q;  4GOP A;  2E5L L;  4IJH A;  3HOU H;  1ZB9 A;  3HOV I;  2BA1 A;  3KDF B;  1HNZ L;  4A3I G;  2AWO A;  2AKL A;  2JA6 H;  3CD6 1;  3K8A A;  3EIV A;  4BY1 G;  4HH4 A;  2KCM A;  2EQS A;  2MO1 A;  4RS4 A;  3GTG I;  4GOP B;  2OTL 1;  2ZTC A;  1K73 2;  1M1K 1;  3RLN A;  4RV9 A;  3J81 j;  1X65 A;  4A3B G;  1YJ9 1;  1NBW A;  1VQ9 A;  4LF6 L;  1Y1W G;  1V43 A;  3M85 A;  2R92 H;  2VW9 A;  5JEA G;  1IZ6 A;  1VQ4 1;  2V8K A;  3HKZ G;  1YHA A;  3KYH C;  1UE5 A;  1RIP A;  2AMC B;  2R7Z I;  4R4I A;  4QIW E;  1L1O C;  3I56 Z;  3CD6 Z;  3CMA 1;  3K80 C;  1Y1V I;  4B3R Q;  2WAQ E;  4IO9 A;  4A93 H;  1Z02 A;  4A75 A;  3CCU A;  3CCL A;  2OTL Z;  5D1P A;  3GTO H;  1W2B Z;  5BR8 L;  1YZ6 A;  4BBR G;  3J81 b;  1YJ9 Z;  5C3E G;  2K5R A;  4DKA C;  1V1Q A;  1YEZ A;  2HHH Q;  4A3D G;  2QA4 A;  3PSI A;  1VQ4 Z;  4Y52 H;  1JJC B;  3CCV 1;  4GKK Q;  1V9P A;  2LXJ A;  4NB3 A;  4EX5 A;  1FJG Q;  1GVP A;  4DV6 Q;  1U5K A;  3CC4 A;  1RNI A;  3CMA Z;  2IX0 A;  3TDH B;  1TFI A;  2VQF Q;  4X62 Q;  4A3M H;  4GLA C;  3AFQ A;  2QRE B;  2JA8 G;  3H15 A;  4A3J H;  4DV1 L;  1N8R C;  1Z03 A;  3H0G G;  2GVB A;  1EIY B;  3S1Q I;  2I0Q A;  2F3I A;  2VQE Q;  4GOP C;  1OXX K;  2YTX A;  4JI2 Q;  3CCV Z;  5IYC H;  1N34 L;  2RHB A;  5IP9 I;  3VDY A;  1K9M 1;  2YU9 H;  4DK6 C;  4LFC Q;  2I5H A;  3PGZ A;  4OWT B;  5IYD G;  3ULP A;  2P28 A;  2EXD A;  2W03 A;  3GCF A;  1QVG Z;  5AJ3 L;  1TWG I;  1TXY A;  1I3Q H;  4A3F H;  3CCJ A;  2ZM6 L;  3T1Y L;  4A4I A;  3S17 H;  4BY7 G;  2K50 A;  1G29 1;  3WWV A;  1PH2 A;  4DUZ Q;  3NH8 A;  2EGT A;  2ID0 A;  3J80 c;  1TWH H;  3JC6 6;  4UP9 A;  4X6A I;  1QVF Z;  2M48 A;  1VQN 1;  1JJ2 Y;  2N49 A;  2E2I H;  4JI0 Q;  3HOU G;  4HJ7 A;  3CW2 C;  2QEX Z;  1PVO A;  3S14 I;  2E2J H;  5JJL A;  2IHF A;  2JA6 G;  4IFD J;  4A3K H;  3GTJ I;  5C4J I;  1YIJ A;  4BY1 I;  4LF7 Q;  3FQQ A;  2ZAE B;  3KIF A;  4NPS A;  1P8L A;  4A3C G;  1KRL A;  1EIF A;  1GKH A;  4LF8 L;  3CCM 1;  4JBK A;  4AIM A;  4JI5 Q;  2MFI A;  1OXV A;  4A3B I;  2B3G A;  3NEM A;  4JCV E;  1Y1V H;  2KHI A;  5H1S E;  4YY3 Q;  4DQY B;  3U4V A;  2R92 G;  1VQN Z;  3JAM b;  3S2H H;  1HNW L;  3VMI A;  2E8G A;  1QZG A;  1I94 L;  5C44 I;  4DV0 L;  2RPR A;  3F3P C;  4OON A;  1VQP Z;  4MD8 A;  1NTG A;  3HFZ B;  1PH9 A;  1SE8 A;  2UXD Q;  2NZO A;  2Z0S A;  3PO3 H;  4C3J H;  3CCM Z;  1Q7Y 2;  3J81 c;  4L5Q A;  1X54 A;  1EQQ A;  4IFD I;  4GKJ L;  1YJN 1;  1CKM A;  2NN6 G;  2K52 A;  5C3E I;  1Q81 2;  3CF5 A;  4LFA Q;  1X6O A;  2WB1 G;  1Y14 B;  1KIX A;  2NVQ H;  3I7F A;  3EN2 A;  3UE0 A;  5FLM H;  3KJO A;  3RR5 A;  4DR3 L;  1FGU A;  5LMU L;  1FVI A;  2K5H A;  4DR7 Q;  1VQ5 A;  4TNU A;  1VQ6 1;  3NFZ A;  3PO2 H;  1Q82 2;  1I50 H;  3FKI I;  4YHH L;  1VQK A;  2CWP A;  3G71 Z;  3NDJ A;  3S1N I;  3GDE A;  3CPW Y;  1KL9 A;  2K75 A;  2UUA Q;  3BU2 A;  3H0G I;  2IY5 B;  1VQB A;  2UU9 L;  1MJE A;  1N36 Q;  4KHZ A;  3F2C A;  1TWG H;  1VQM A;  5IT9 f;  2W04 A;  1VQO Z;  1K8A 1;  3JAM i;  4MD9 A;  4DUY L;  1YIT A;  1X9N A;  2R7D A;  5IYC G;  3PUX A;  3OTO L;  4X65 Q;  2HU9 A;  1TWC I;  1YHQ 1;  4BBS I;  4MNO A;  4HJ8 A;  4DR1 Q;  1VQ6 Z;  3HOY H;  1OXU A;  5M3F H;  5M5W H;  3VTN A;  1SMX A;  1KD1 C;  4A3F G;  1RL2 A;  1X3G A;  1PH6 A;  4LFB L;  3T1H Q;  3GTQ I;  3CCE 1;  4X66 Q;  2IZ4 A;  2JA5 G;  1PH7 A;  4OXP A;  2H5X A;  1XNQ L;  3GTK H;  1WCM G;  2IZ3 A;  5JJK A;  2PQA A;  1LUZ A;  2OTJ 1;  2UUB L;  2MQH A;  3BG1 B;  2DE6 A;  1HR0 W;  1YHQ Z;  1MIU A;  1KC8 1;  2OQK A;  3EED A;  1QZH A;  1QUQ A;  4DNI A;  1Q8K A;  2PQA B;  2DUD A;  4P75 A;  1JJG A;  2JA9 A;  3W1G A;  3CCE Z;  3BZC A;  1XMO L;  1NJI C;  5A2Q f;  2E5L Q;  1VQH A;  2DE5 A;  3OYY A;  2JS4 A;  2B63 I;  3RZD I;  4DK1 A;  2YTV A;  3JAM c;  3I55 1;  4JBJ A;  1HNZ Q;  2OTJ Z;  1QF8 A;  4R4C A;  3G4S 1;  1RQF A;  3PIP A;  4IJL A;  3CCR 1;  1UEB A;  2JA7 I;  4R4Q A;  4L5S A;  3RLO A;  1A8V A;  3MON A;  4LF6 Q;  4A76 A;  4B3T L;  1E22 A;  4JV5 L;  1OTC A;  2BH2 A;  3ER0 A;  5EAY A;  4L5T A;  3I55 Z;  4DGL A;  1K73 1;  1K8G A;  1NY4 A;  4DV7 L;  3RLF A;  4AH6 A;  3CCS A;  3G4S Z;  3FKI H;  1EOV A;  3S1N H;  5FLM G;  3CCR Z;  1VLA A;  4NH1 C;  1YUK A;  2QRC B;  1CKO A;  2JR6 A;  1N8R 2;  1VQ7 1;  3S16 I;  4EQ5 A;  1YI2 1;  2K3R A;  3KIH A;  3HOW G;  5BR8 Q;  4P71 A;  4JI3 L;  3GTM H;  2WFW A;  3F2D A;  2Q2U A;  3PO2 G;  2N78 A;  4JBM A;  1USP B;  3K7A I;  1NUI A;  4NOZ A;  5LMN W;  2VF1 A;  3KF6 A;  3I4M H;  3KDF A;  2FXQ A;  3HOX H;  1Q12 A;  1PH1 A;  4XTC S;  3FP9 A;  1VQ8 A;  3H3V J;  3A74 A;  4K0K L;  4POG A;  1Q1B A;  3I4N I;  4R4O A;  1G6P A;  1B7Y B;  4QJF A;  1VQ7 Z;  1YI2 Z;  2MNA A;  3KF6 B;  3RN5 A;  2ZJR A;  1IBK L;  2UXB Q;  1A0I A;  4DV1 Q;  1JWH C;  1ZH1 A;  3HOY G;  3I56 1;  1HZ9 A;  1U0L A;  3CQZ H;  4GNX A;  4YCV A;  3CME 1;  3J7Z C;  2GTI A;  5IP7 I;  1VQI A;  3GD7 A;  1N34 Q;  3HOZ G;  1D8L A;  4HJA A;  1I5F A;  3A5Z B;  4NBE A;  1LYL A;  3M4Q A;  3CCQ A;  4DR5 L;  1WCM I;  1XPU A;  1Z01 A;  5AJ3 Q;  1YJW A;  4GNX B;  1K83 I;  3MZL B;  3AFP A;  5ELN A;  2PI2 A;  2ZM6 Q;  3T1Y Q;  1S72 A;  3PF4 A;  4GN4 B;  1TWF H;  2B63 H;  2L15 A;  3PO3 S;  1OXT A;  4JI4 L;  5IT9 b;  3H3V I;  5ELO A;  2JEB I;  3CC7 A;  3CME Z;  1E1O A;  2D0O A;  1BVS A;  4KHP L;  3UDX A;  2I5L X;  1VQG A;  4NBD A;  1SFO H;  2I5M X;  2F4O A;  4Y7N H;  2O53 A;  2JA7 H;  2R93 I;  1SR3 A;  5C4X H;  4OX9 L;  3EBE A;  2CCZ A;  1WW9 A;  4A3L I;  4GLX A;  1YIJ 1;  2JQO A;  3J80 i;  4HIO A;  5D1O A;  3CCJ Z;  2NVT I;  3CXC Y;  1S7M A;  2UXC L;  5M3M G;  4S1T A;  4HIM A;  1PH5 A;  4QTU A;  2VUM H;  1IXR A;  2JNY A;  2D0P A;  4PMW A;  2Y0S A;  4E32 A;  1HNX L;  4LF8 Q;  2WP8 J;  1N32 L;  4RMF A;  3PUW A;  4A3G H;  1P16 A;  2NVX I;  3DM3 A;  5LL6 f;  2EIF A;  5D1O B;  1KQS Y;  5GRO A;  3OW2 Y;  1SRU A;  4E2W A;  4IPD A;  1HNW Q;  1PFS A;  1WYD A;  4EWC A;  1M90 C;  1I94 Q;  4DV0 Q;  1YIJ Z;  2E2H I;  1K3R A;  4IOC A;  1VQF A;  2Q2H A;  3E9H A;  3STB D;  3K7A H;  5HY6 A;  4DV5 L;  4LW1 A;  2UUC L;  4OO1 G;  3L0O A;  4BXX I;  2XGT A;  4LUV A;  1XPO A;  1VQC A;  4A3E G;  5A2Q b;  4GNX C;  3HOW I;  3CD6 A;  1UE1 A;  2QEX 1;  3UDI A;  3BG0 B;  4DV4 L;  4J15 A;  1MKH A;  1BBW A;  2WB1 A;  1HJP A;  3CC2 1;  2AKW B;  3S1R I;  3M3Y I;  4YWK A;  1YNX A;  2ZJP A;  1JT8 A;  5JEA J;  2OTL A;  3I4N H;  1W2B A;  2LXK A;  1GO3 E;  3HOV H;  3J81 i;  3HOX G;  1YJ9 A;  4DR3 Q;  1Q7Y 1;  5LMU Q;  4QL5 A;  4YCW A;  4LF4 L;  1BKB A;  4E2X A;  1VQL 1;  1KD1 2;  1E24 A;  4NBB A;  1VQ4 A;  5J3B A;  1Q81 1;  3L7Z C;  3KLW A;  1S40 A;  3BJU A;  3GTG H;  5IP7 H;  3S24 A;  4YHH Q;  4ME3 A;  2AHO B;  4UP7 A;  3K7U C;  1L2F A;  1J5E L;  4B3R L;  3CMA A;  4A3I I;  2B29 A;  1KXL A;  3CC2 Z;  1NMG A;  1VQP 1;  2UU9 Q;  4NBA A;  1VQM 1;  4GN3 B;  1RO0 A;  4JI7 L;  2I3C A;  4DUY Q;  1Q82 1;  1AH9 A;  2R7Z H;  3OTO Q;  5M5X H;  5FLX f;  1YUA A;  4MD7 A;  3KFU A;  1X3E A;  5GAD C;  1VQL Z;  2VZA A;  1Y1W I;  4C3H H;  1VQK Z;  3CCV A;  1B8A A;  2YV5 A;  4UP8 A;  1IBL L;  3CXC A;  1H95 A;  1CUK A;  1VCI A;  1HR0 L;  1NJI 2;  4LFB Q;  3M4O I;  2Q51 A;  3VMH A;  4IPH A;  5IT9 c;  2R93 H;  3K0X A;  4A3L H;  1VQM Z;  4B3M L;  4A93 G;  4X64 L;  2KHJ A;  1IL2 A;  1XNQ Q;  2OQ0 A;  1PYS B;  2UUB Q;  3AEV A;  3G71 1;  1C0A A;  2VUG A;  1Q86 C;  1KQS A;  4MH4 A;  1JJ2 Z;  1LTL A;  3OW2 A;  4BBR I;  1XNR L;  2NVX H;  1J6Q A;  4GS3 A;  3F2B A;  5DLQ E;  3S15 I;  4A3D I;  2F52 A;  2NVY I;  1BBU A;  4PZ8 A;  1VQO 1;  4JI6 L;  1R9T I;  3I2Z A;  1VQJ A;  2VUM G;  2PK7 A;  3GTM S;  2YTY A;  3F8T A;  1XMO Q;  1S3O A;  3S1Q H;  4R1J A;  2PI2 E;  4A3M G;  2E2H H;  2QGQ A;  1M1K C;  1IBM L;  1PH3 A;  4LF9 L;  2ZJQ A;  4E33 A;  2QKD A;  2JA8 I;  5C0X G;  1SRO A;  1XMQ L;  5IP9 H;  2JJQ A;  4DR4 L;  4A3J G;  4MTN A;  2DGY A;  3M4P A;  4PZ7 A;  2ES2 A;  1VQN A;  3VB9 A;  3E0E A;  4XIG S;  4HIK A;  4LNQ A;  4A3E I;  4AQY L;  4B3T Q;  1Q1E A;  2Q4Z A;  4YWL A;  1NMF A;  3FQM A;  2GN5 A;  4JV5 Q;  1PHJ A;  2BA0 A;  3W5O A;  5IYB H;  4NBC A;  1HZC A;  5IWA L;  3UDG A;  3ULJ A;  2Y0S E;  4BA2 I;  1LQL A;  4X6A H;  1X55 A;  4QTT A;  4DV7 Q;  4NB8 A;  2RHQ B;  4BY7 I;  1CSP A;  3CCM A;  2VNU D;  3G6E 1;  5LMN L;  3HOV G;  4A3I H;  3CAM A;  3S14 H;  4QQB X;  3S2D I;  3GTJ H;  5C4J H;  4MXU A;  4BY1 H;  2VL6 A;  4JI3 Q;  1Z9F A;  2KI7 B;  2LSS A;  1CKN B;  4JI1 L;  1A62 A;  1X3Z A;  2RT9 A;  1N33 L;  3HOU I;  2N8N A;  2A1A A;  1SLJ A;  3CPW Z;  2JA6 I;  4A3K G;  4A3B H;  3GKQ A;  3D9X A;  4AYB A;  1N8R 1;  5T64 A;  1ASY A;  2K5N A;  2V1C C;  3NH5 A;  3IRB A;  4A3C I;  3PUZ A;  2ATW A;  2WB1 E;  2F4V L;  3G6E Z;  4PG3 A;  1YJN A;  4K0K Q;  5C44 H;  4ALP A;  3M4O H;  4RVD A;  5FJ8 H;  1X56 A;  2XTI A;  4WJ4 A;  2JE6 I;  1K9M C;  1IBK Q;  1Y1V G;  4P72 A;  5IY0 A;  1KAW A;  2R92 I;  2ZTE A;  1JMC A;  2R6G A;  1XJV A;  4IPG A;  2KPI A;  3ZJY C;  1Z47 A;  3ULL A;  3TS2 A;  4BBR H;  4O0A A;  5C3E H;  3PV0 A;  1VQ6 A;  3L2P A;  3CCQ 1;  4E2Z A;  3PF5 A;  4MON A;  3D6W A;  3S15 H;  1VQ9 1;  2BJO A;  2NVY H;  4DR5 Q;  3UE1 A;  1UE6 A;  4DR2 L;  1YJW 1;  3PO3 G;  1N9W A;  3HKZ A;  3GTO I;  1Q46 A;  1AE2 A;  1T9H A;  4NXN L;  5IE8 A;  4QGU A;  2NN6 I;  4NFR A;  1EUJ A;  1USP A;  2JA8 H;  4Y52 I;  1NP6 A;  4JI4 Q;  2PNH A;  3CCU 1;  3CCL 1;  4P73 A;  3H0G H;  2RIQ A;  2WAQ G;  2VY3 A;  4KHP Q;  4JI8 L;  5FLX b;  3CCQ Z;  4A3M I;  1M90 2;  1CSQ A;  1VQ9 Z;  4POF A;  1YJW Z;  2QA4 1;  5C0X I;  4OX9 Q;  4X66 L;  5IP9 G;  1TWA I;  3AYH B;  3CCE A;  1PH4 A;  1YBY A;  1TWC H;  3A0J A;  5IYD H;  3CC4 1;  4BBS H;  1HNX Q;  2OOX B;  5HGQ A;  1N32 Q;  2OTJ A;  4BY7 H;  3CCU Z;  3CCL Z;  3GTL I;  2P3Y A;  3CP0 A;  2YU9 I;  4NBG A;  2JK8 A;  3GTQ H;  1WI5 A;  2OZK A;  1YVC A;  4KLK A;  1PYB A;  5IYB G;  3S2D H;  2KCT A;  4C3I H;  5M3F G;  1B70 B;  4NBH A;  2QA4 Z;  3S1M I;  3TEH B;  1I3Q I;  4A3F I;  3S17 I;  2A8V A;  1W2B Y;  4MRI A;  1WJJ A;  4DV5 Q;  2UUC Q;  3RNU A;  1Y1V S;  2JA5 I;  3CC4 Z;  1AE3 A;  4HGZ A;  3I55 A;  3ESW A;  5E7N A;  1L0W A;  3GTP I;  4UPA A;  1TWH I;  1WII A;  4DV4 Q;  4DV2 L;  3G4S A;  5GQO A;  5CM2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...