3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4DV3Q 3GTJH 1Y14B 4PMWA 1YUAA 1XPOA 4C3IH 1PH4A 2E2JH 3KDFB 4JI6Q 4A3LG 2MO1A 4B3SL 1XMOQ 3L2PA 4O0AA 1YNXA 3H0GG 3KF6B 1Q46A 1IBML 1EQQA 3FKII 5LMNL 1PVOA 3U50C 1TWFI 3VMIA 1EQRA 1QUQB 2D0OA 3GTLH 1ASYA 3EN2A 2UUBQ 3AFPA 2E2JI 1MJCA 2LXJA 3NENA 3GTMH 1XNQQ 3PIOA 3S1NI 2UXCQ 3HOYG 2UUCQ 3Q87A 2MQHA 2ZTCA 3T1YQ 5IP9H 1PH2A 4DV6Q 4A3KG 1OXXK 3GTLI 3HOXG 3CCUA 4LF5Q 2OTJA 3PUVA 2VQEQ 2V1CC 1X55A 3ULPA 1CKMA 4B3MQ 2OQKA 1OXVA 3GTMI 5C4XI 1VQ4A 1ZB8A 3E9IA 2CFMA 1XNRL 3CMEA 4X66Q 4NBFA 5HY6A 3A0JA 3CCQA 4OX9Q 3M7NA 2P3YA 1A0IA 4JV5L 1HZBA 4KHPQ 4DR7Q 1HNWQ 3W1GA 1M90C 1IBKQ 2WAQG 2UXBQ 3M9BA 2VS1A 4K0KQ 1N34L 3G4SA 4YHHL 5IWAL 4H02A 1QVFA 4JBMA 3I4NG 2Q2HA 4PZ6A 3G48A 1XMQQ 3HOYH 2KCTA 4UP8A 3IRBA 4BBRH 1Z9FA 1HR0Q 4A3FH 3STBD 4LFBQ 4B3TL 1VQ6A 2VZAA 5GADC 4A3KH 3HOXH 1PA6A 3CC4A 4JI8L 3S1RH 4B3RQ 1X9NA 3PCOB 4NXNQ 2N78A 4JI5Q 4A76A 3GTGH 4GKKL 5AJ3Q 3HOYI 2ZJQA 1VQ9A 2N8NA 4A3FI 2AKWB 1NUIA 2VUMH 2DUDA 4A3KI 3HOXI 5FLXc 4DR4L 3PUXA 3MEFA 4A3IG 2JK8A 1IL2A 3S1RI 5IY0A 3T1HL 3CQZH 3PO3G 4X62L 1OTCA 3I55A 4LF7Q 1PFSA 3PSIA 5E7NA 4JI1Q 4Y7NH 3EIVA 3M4OH 3GTGI 3HFZB 2NVXH 1C0AA 3I4NH 1QZHA 2PI2A 1VQJA 3GTPH 4L5RC 3JAMi 1PH5A 1PH1A 5C0XG 4LUOA 2A8VA 2JR6A 4LFAQ 3CQZI 3I07A 3W1BA 1J5EL 2JA7H 4Y52H 4LUZA 3GD7A 4MH4A 4Y7NI 3M3YH 3HKZE 3M4OI 1VQBA 1VQIA 4DV1L 1EIYB 1UE1A 4LF4L 2NVXI 2YTVA 5IT9c 1X3EA 2BJOA 2ASBA 3I4NI 1Q82C 4NBAA 1K3RA 4DNIA 3GTPI 2Z0SA 4RMFA 1YBYA 2K5HA 4FDBA 1IYJB 2JA7I 1L1OA 4AIMA 3ESWA 3PF4A 3ULJA 1CKNA 4A3IH 3M3YI 4HIOA 2UU9L 2Q2UA 3PO3H 2YTYA 4GS3A 1B7YB 4DV5Q 4P71A 3SGIA 1N33L 1C9OA 1VQPA 1HNXQ 2BH8A 4BY7G 3PO2G 2OQ0A 2J6AA 1G291 4A3II 4DKAC 4NB9A 3PO3I 3K81C 4GNXA 2BA0A 1A62A 2C35B 3E0EA 1CKNB 1X65A 1X3GA 3K8AA 5K36G 4DK3C 1X54A 1PH6A 5M3MH 2JNYA 4POGA 2CWAA 4QGUA 4YY3Q 4HJ7A 1SE8A 2IHFA 1Y1VS 4YWLA 2PQAB 1VLAA 2K75A 3I7FA 2F4VQ 3F1ZA 4R4TA 5M5WH 1HJPA 1IZ6A 1X6OA 2QGQA 1BKBA 3CCEA 4GNXB 2ZJPA 3VMHA 3PIPA 3A5UA 1WFQA 3OTOQ 4HIKA 4L5TA 1USPA 1Z47A 3HKZG 1GD7A 4BXXH 2PMZE 2UXDQ 3ER0A 4BY7H 3PO2H 3AFQA 2UUAQ 1EYGA 1PH3A 3UDIA 2RBLA 3KDFA 4JI7L 4JBKA 2ATWA 1NTGA 2ES2A 4B3SQ 1WOCA 4QQBX 1L1OC 3S1MH 1N8RC 4A3DH 3S2HI 3HOUG 5IE8A 1IBMQ 4APVA 1VCIA 3KYHC 2H5XA 4JBJA 3JC66 4BBSG 4BXXI 5LMNQ 2E2II 4DR5Q 4BY7I 3PO2I 4MTNA 1QUQA 3S24A 4LF8Q 2KCMA 4KHZA 4LFCL 1USPB 4GN3B 3J7A5 1IBLL 2JA6G 1HR0W 4L5QA 4JG2A 2HHHL 3S1MI 4A3DI 4C3JH 1I3QH 4IPDA 2YU9H 5FLMH 1YJWA 4DV7L 4GNXC 3G6EA 4JI0L 3U4VA 3BZKA 3RN5A 1TWCH 4A3CG 1SFOH 4OO1I 1UE6A 3S1NH 4ME3A 4R1JA 4UP7A 3GTQH 4HIDA 4GOPA 3CCLA 2K52A 1I3QI 2YU9I 4JYAL 5FLMI 1XNRQ 2KENA 4LWCA 3HOUH 1GKHA 3K7AH 1YHQA 1TWCI 1UWVA 1SFOI 1Q8KA 5C4XH 1WCMH 5J3BA 1NJIC 4BBSH 3J80i 2L15A 3GTQI 5EAYA 1RIPA 3CPWA 2ZJRA 4OWWB 1YEZA 2YTXA 3CCSA 4P73A 2IT1A 4XTCS 3S17H 1N34Q 5IWAQ 4GOPB 1TFIA 1I6HI 3F2CA 3HOUI 4LF9L 2ID0A 3K7AI 3S1QH 3CCMA 3HOZG 1WCMI 4A3LH 4BBSI 4WJ4A 3PUZA 3H3VH 3H0GH 3S15H 4A3CH 4B3TQ 4NBEA 2HIXA 4JI8Q 3HOWG 3F2BA 3S17I 2JA5G 1JJCB 5GAHC 4R4IA 3H3VJ 2XGTA 4WJ3M 4A3JG 3S1QI 2OWOA 4A3LI 2CQOA 2JEAI 4DK6C 1D8LA 1BBUA 2DE5A 3H3VI 3HKSA 2NZOA 2R6GA 3H0GI 3S15I 1PYBA 4A3CI 4AYBE 3RLOA 2CCZA 1OXUA 4EQ5A 4KI0A 4LF6L 1UE5A 1FJGL 4JC0A 2FXQA 2Q2IA 1JMCA 3DLLA 3CC7A 1T9HA 1WI5A 1VQ7A 3I2ZA 1HNZL 1KRSA 1RLYA 1MIUA 4X62Q 1YJ9A 5GQOA 2LXKA 4EX5A 2VQFL 3W5OA 1S3OA 4X6AI 1CSPA 4R4CA 3CXCA 5DLQE 1P16A 4GOPC 3KFUA 3HOZH 3RNUA 3K80C 1JT8A 1WW9A 3PUWA 4P72A 1VQ5A 4OXPA 4X64Q 1J5EQ 4HIMA 4DV2L 1YHAA 4JBWA 3CCJA 1X3FA 2PI2E 3ZJYC 4DV1Q 4OWXB 2VY3A 4LF4Q 1K8GA 4NPSA 4A3JH 1PV4A 2KBNA 3HOZI 3TQYA 3CW2C 4NBCA 5FJ8G 4DR1L 4LFBL 1SRUA 3AQQA 3CPFA 2ZM6L 5M3FG 3ICEA 1YITA 1VQMA 4YWKA 2GVBA 3HOWI 2UU9Q 2JA5I 3M85A 3MXNB 4B3RL 2CKZB 4AQYQ 1Q12A 4JI2L 5IYBG 4NBDA 4A3JI 2JJQA 5M5XH 1KHIA 3ULLA 1N33Q 1A8VA 5ELOA 2AMCB 1E24A 2JS4A 3DM3A 3UDGA 5C44G 1KD1C 1BBWA 3Q8DA 4JOIC 4NXMQ 3L7ZC 1N9WA 1SROA 4YCWA 3OW2A 1X3ZA 2E2HH 4YCUA 2K5VA 4DR3Q 2QEXA 4JI4Q 2Q2TA 5LMUL 3BU2A 4AH6A 3LGJA 5FJ8H 1VQLA 1VQFA 4DR6L 5H1SE 5M3FH 1NBWA 1N36L 1HZCA 2PQAA 3I56A 3KF8B 3J81j 3PV0A 2A19A 4DUZL 4IJLA 5IP7G 4QIWE 1D7QA 2AHOB 2E2HI 1YJNA 4ALPA 3TREA 3GDEA 1EOVA 4UP9A 2RHQB 2E5LL 5GAGC 1Y1VG 3S16H 1PYSB 2EQSA 4DV4L 2WP8J 4OONA 1TWHH 3U58A 3CD6A 1E3PA 5C0XJ 3S14H 1KRTA 4X65L 2Z6KC 2K5RA 1HZAA 1SR3A 5JJIA 4NB8A 5C0XI 2WFWA 2D0PA 4GLAC 4HJ8A 4JI7Q 1PH7A 2OCEA 2Y0SE 3J80c 5BR8L 1E7ZA 2DE6A 1QYPA 3S16I 2EXDA 4DR2L 1LUZA 1G51A 2K14A 1B70B 2HT1A 1TWAI 1VQEA 3CCVA 4BA1I 4J15A 2HIVA 3HOVG 3A5ZB 1TWHI 3S14I 3KJOA 3S2HH 1VS0A 1N32L 1MKHA 1I50H 2R7ZG 4LFCQ 1VQHA 1O7IA 1IBLQ 2E2IH 1SN8A 3GO5A 1E1OA 3M4PA 2B63G 4GKJL 5IP7H 1YIJA 1EUJA 1XPUA 2HHHQ 1XJVA 1S40A 1UEBA 1HZ9A 4JCVE 3D6WA 1Y1VH 4DV0L 4DV7Q 1KL9A 1L0WA 4YY3L 1I50I 1AE3A 1I5FA 3G71A 1GO3E 2PNHA 2PK7A 4A4IA 1LTLA 1ASZA 2DGYA 4A3BG 5IP7I 3KOJA 3S2DH 4GLXA 3L0OA 3TRZA 1V43A 1C7YA 4JYAQ 3U4ZA 1Y1VI 2WAQE 1I94L 2KPIA 2ZTEA 1S72A 4QL5A 1AH9A 2XTIA 5IP9G 3HOVH 2QA4A 2NVTH 5GROA 4DUYL 3F8TA 2K5NA 5GAEC 2UUAL 2R7ZH 1DL6A 3GTMS 1VQNA 4IO9A 3S2DI 3TEHB 1U5KA 1KC8C 2B63H 3CCRA 3RLNA 3AEVA 2R7FA 1RL2A 1L2FA 1K9MC 4JI3L 5HGQA 3K0XA 3PGZA 4LF9Q 1K0RA 5JJKA 3EERA 3HOVI 1GVPA 4DR5L 2NVTI 4NB3A 1I6HH 4A75A 2Y0SG 4LF8L 3GTJI 2R7ZI 4GLVB 3UE1A 4P75A 1NMGA 1JJ2A 4JV5Q 1LM0A 5M5YH 2N3SA 4DV3L 2I0QA 1JJGA 2B63I 4A3BH 4C3HH 1SMXA 4R4OA 3UDFA 4NBHA 4KLKA 3GTKH 1XTDA 1CSQA 1GM5A 4JI6L 3J81i 2JA6H 1EFWA 1XMOL 3NELA 3JAMc 2RCNA 4BBRG 4NBBA 4YHHQ 4A3FG 3GKQA 3I4MG 2IY5B 1W2BA 2ALYB 4QY7A 1TXYA 2OTLA 2JQOA 2NVQH 2JA9A 4LF6Q 1K8AC 1FJGQ 4A3BI 1CKOA 2I5HA 4A3MG 1X56A 1HNZQ 3B6YA 3GTKI 2UUBL 2VQFQ 2NN6G 2JA6I 2JE6I 1SLJA 1E22A 5CM2M 2EIFA 2NZHA 4JOIA 1XNQL 4A3GG 3E9HA 5IP9I 2VUMG 3NBHB 2UXCL 2NVYH 4GKKQ 4X6AH 2UUCL 3BZCA 1FL0A 2NVQI 1EWIA 3AYHB 4POFA 2IHEA 4DAMA 3T1YL 3D31A 1EIFA 3UE0A 4DV6L 2F4OA 1KAWA 4L5SA 4DV2Q 1Y1WG 4DR4Q 4LNQA 4LF5L 3T1HQ 2VQEL 4IPCA 2F4MA 2IX0A 1MJEA 4R4QA 4B3ML 1M1KC 4XX2A 2CWPA 2NVYI 1Q1BA 3UDXA 4X66L 4DR1Q 4NBGA 3A74A 3RLFA 3GTOH 1E1TA 1A63A 2K4KA 2ZM6Q 1RO4A 2JA7G 4OX9L 3I4MH 1PHJA 2WB1E 1NY4A 1CUKA 4KHPL 1PH9A 2MNAA 4DR7L 4IPHA 1VQAA 1HNWL 4MNOA 1R9TH 2B3GA 4A3MH 3TS2A 2MO0A 3D0FA 1IBKL 4JI2Q 2N49A 1H95A 2UXBL 4K0KL 5C3EG 3HOWH 2JA5H 4BBRI 3GTOI 2DE7A 4A3GH 2VNUD 2Z6KA 3I4MI 1QVGA 1XMQL 2YV5A 1Q7YC 1YI2A 1HR0L 1R9TI 1PH8A 3FHWA 1JE5A 4A3MI 1J6QA 4BA2I 1HH2P 2F52A 4IPGA 1U0LA 1DGSA 4DPGA 5JEAG 3VMGA 1Y1WH 2NN6I 2HF1A 2K50A 4C2MH 2KHIA 4OWTB 1OXTA 2VW9A 1VQKA 4NXNL 1ML8A 4PG3A 1YHBA 5LMUQ 4JI5L 4A3GI 1LQLA 1Q81C 2VUMI 1UE7A 5AJ3L 1LYLA 1YZ6A 2RF4A 4LW1A 3PO3S 3FP9A 4IOCA 4DR6Q 4X64L 1FGUA 1N36Q 3PF5A 4DUZQ 1P8LA 1V9PA 3GCFA 1Y1WI 5C4JH 1WYDA 5ELNA 3K7UC 5LMNW 3F2DA 2GVAA 2E5LQ 4BY1G 4LF7L 3CMAA 4LUVA 4JI1L 4QJFA 3BJUA 2R93G 1WJJA 5C3EH 4AYBG 4NOZA 2D62A 5M3MG 1VQCA 2AWNA 2I5LX 4TVAB 4DV4Q 2JEBI 4O2DA 4PZ8A 4QTUA 4X65Q 4Y52I 2MFIA 5C4JI 2E8GA 4AQYL 1Q1EA 4LFAL 2R92G 1NE3A 4A93G 4GN4B 2A1AA 5BR8Q 3CP0A 4TQUS 3I4OA 4A3EG 1KQSA 1QVCA 4IFDG 1ZB9A 2LSSA 5C3EI 4DR2Q 3PUYA 2WB1G 3STBC 1X3WA 1TWGH 2F3IA 4HJAA 4BXXG 3NEMA 4UPAA 5IYBH 2R7DA 4GN5A 3OYYA 3RZDH 1N32Q 4NXML 2JA8G 1TWAH 1YVCA 2GN5A 1FVIA 1PFTA 5JEAJ 3VB9A 3H15A 2IX1A 1OXSC 1L1OB 5C44H 4GKJQ 3TS0A 2I5MX 4IOAA 4A3DG 4DAYB 2AKLA 3WWVA 4DR3L 3M4QA 1VQGA 2BH2A 4BY1H 4DV5L 1TWGI 4QTTA 4JI4L 1BVSA 1KXLA 4HJ9A 4DV0Q 1K73C 1IXRA 2R93H 2RHSB 1JB7A 1W3SA 3RR5A 3RZDI 1XPRA 4OO1G 5IYDG 3J7ZC 1V1QA 1Q86C 5IYCG 3FKIG 2B29A 1HNXL 3RN2A 3J81c 2HQLA 5C44I 3VDYA 1VQOA 4YWMA 2R92H 1NMFA 3CAMA 5FLMG 1KIXA 4A93H 3KJPA 2YYZA 3ERSX 4BY1I 4IJHA 4P74A 4UY8C 4A3EH 1I94Q 2KHJA 2R93I 2VL6A 4XIGS 3RZOH 1G6PA 3KLWA 1QZGA 1K83H 4DUYQ 1VQ8A 4JI0Q 2JA8H 4IFDJ 2R92I 1N2FA 4HJ5A 4A93I 4YCVA 4A3EI 3CF5A 2ZTDA 3KF6A 4IFDI 2F4VL 4JI3Q 2AWOA 1B8AA 5C4XG 1WCMG 3RZOI 5JJLA 1K83I 3OTOL 3CC2A 2BA1A 4RG1A 3EBEA 5IYDH 1AE2A 4MZ9A 3LUSA 5IYCH 3FKIH 2JA8I 1VQDA 4PZ7A 2UXDL 1TWFH
chains in the Genus database with same CATH superfamily
1B2TA 4DV3Q 4K6DA 3LWEA 1EY0A 1LTGD 4C1NK 1WJ2A 3GTJH 1STGA 1TU2B 1Y14B 4PMWA 1YUAA 1QVGY 3R2TA 1D5ZC 1XPOA 4C3IH 1PH4A 2KVMA 2E2JH 3KDFB 1Q7Y1 4UAIA 4JI6Q 4A3LG 2MO1A 4B3SL 4XQNA 1XMOQ 4DU9A 3L2PA 4O0AA 4BBRB 1YNXA 1LTID 1SE4A 1LTRD 3VTNA 1CT1D 2RDFA 3H0GG 4A3FB 3KF6B 3GTOB 1Q46A 1IBML 2Q8RE 3QG1A 3E5SA 1EQQA 3OIPA 2AUJD 3CCU1 3FKII 1TY2A 2AQ1B 2RDGA 3I4MB 2CW0D 5LMNL 1PVOA 3U50C 1TWFI 1LTTD 4DK1A 3S1RB 3VMIA 1R9TB 3Q6SA 5EPKA 1EQRA 3T53B 2K7VA 4FXKC 4CKCA 1QUQB 4ZLTF 1UNSA 1H9SB 3LWUA 4A3MB 2D0OA 3FQQA 1SEBD 4FF2A 3GTLH 1ASYA 2F0LA 3EN2A 2UUBQ 3AFPA 2E2JI 3I55Z 5FLXf 4IUTA 1MJCA 4DXFA 2YADA 2LXJA 3GTGB 4TNUA 2EE1A 2R61A 3NENA 1YNND 3RUZA 1X32A 1SMYC 1D5XC 2KOLA 4CBVA 3CCQ1 5COYA 1EY8A 3GTMH 5DM63 2VF1A 1XNQQ 4A3GB 3PIOA 3S1NI 1HUMA 1LT5D 4G7HC 2VUMB 1QOHA 2UXCQ 1SYBA 3E0JA 3HOYG 3DEPA 2UUCQ 3KIHA 3Q87A 5LL6S 2MQHA 1Q821 4RCOA 2ZTCA 3MWYW 5ELBA 3T1YQ 3NHHA 3P75A 1ZYRD 3KLSX 3OW7A 2O5IC 1BUVT 4MHEA 5IP9H 1PH2A 4DV6Q 1AN8A 4A3KG 1OXXK 3GTLI 3HOXG 3CCUA 1ET9A 1EY9A 2EJMA 2L12A 3NK9A 1Y1WB 3G4S1 1KLUD 5KIXA 4LF5Q 1BQQT 2OTJA 3PUVA 2VQEQ 2V1CC 1X55A 1CHQD 3A8KE 2SEBD 3ULPA 1CKMA 3GV3A 4B3MQ 2OQKA 1OXVA 3GTMI 5C4XI 1VQ4A 3GTPB 1ZB8A 2QKIC 3DWPA 1ZEQX 4CL1A 3E9IA 4J1MA 1JR0D 1KLGD 5LHY1 5EBCA 4RH6A 2CFMA 5NUCA 1EFID 1XNRL 3VR6A 1TS5A 3CMEA 4X66Q 1ENFA 5IT9f 4UDUC 4K2LA 3J80E 1VQ61 4Q0FA 4NBFA 1B3AA 1CA5A 1XXGA 5HY6A 4ABNA 3A0JA 3CCQA 2JA7B 3BG0B 4OX9Q 4R8NA 2PZUA 1KQSY 3M7NA 2P3YA 1A0IA 4JV5L 2R3ZA 2LFUA 1HZBA 5FOBB 4KHPQ 3V05A 1SIWA 1KNAA 3M3YB 1AEXA 4DR7Q 4IZ8A 1HNWQ 2BDNA 3W1GA 5A35A 5C4JB 2IL8A 3MA2B 2XRSD 4E30A 4DQYB 3AB9A 5EPLA 1M90C 1IBKQ 2WAQG 2UXBQ 4DGZA 4I7ZC 3D8GA 3M9BA 4ZYSA 5IGCA 3C1EA 2VS1A 4B9WA 4K0KQ 5C3EB 5ELFA 4OL7A 1N34L 3G4SA 4O42A 5D65A 4YHHL 1DXMA 4K5XA 5IWAL 4H02A 1QVFA 1FDIA 4GZYC 4JBMA 1STNA 1VQPZ 4J8QA 3I4NG 2Q2HA 1RDPD 4PZ6A 3G48A 1RNIA 1XMQQ 2EYOA 2Z9HA 3HOYH 2KCTA 1U4PA 4UP8A 3IRBA 4BBRH 1Z9FA 2RIQA 3F3PC 2X69A 2F0JA 1HR0Q 4A3FH 3STBD 1SNDA 5HURA 4LFBQ 3IAYA 4B3TL 3I551 2G2KA 1VQ6A 2VZAA 5GADC 3A7LA 4A3KH 1TS3A 3HOXH 1PA6A 1Q861 3BG1B 3CC4A 4JI8L 2PNRC 4ULLA 4AYBA 1PRTD 3L3OC 4RHRA 2RVLA 3S1RH 2DJGC 4KK7A 2RPRA 4DXGA 4E6IA 3OMGA 4FO2A 2K01A 4B3RQ 1X9NA 1TWGB 2FHTA 3PCOB 4NXNQ 2PCFB 4R8IA 2N78A 4JI5Q 4A76A 1TS2A 2F3VA 2NN6H 3GTGH 4K5WA 4F8MA 5JJZA 4GKKL 1LABA 5AJ3Q 3VYTA 3C1FA 3MXGA 3RZDB 3BDOA 3HOYI 2ZJQA 5CV8A 1VQ9A 2N8NA 2OOYB 3SE0A 2F0EA 2VPZA 4A3FI 2MPMA 2AKWB 1NUIA 3KLSA 3X3NA 2VUMH 1IL8A 2DUDA 5C44B 4A3KI 4C56C 3HOXI 4EQOA 1KC82 5FLXc 4DR4L 3PUXA 3MEFA 3URYA 1EYAA 4A3IG 2JK8A 1IL2A 2WB1A 3S1RI 1HXYD 2LMCB 3IFTA 3Q22A 5IY0A 3T1HL 3CQZH 1LT6D 3PO3G 2RQXA 4CDCC 2I3CA 5T6BA 4FP5D 4X62L 3IL8A 3KIFA 1OTCA 1Z7TA 3I55A 4BY1B 4LF7Q 1PFSA 3PSIA 3CCEZ 4UHVA 5E7NA 4JI1Q 3NH8A 4Y7NH 3EIVA 3M4OH 2R93B 3SK6A 4AYBB 3GTGI 4V190 2ZT9C 5M3MB 3HFZB 5CV6A 5FK9C 2NVXH 1C0AA 1ET6A 2EYPA 3NWSA 4XYQA 2X6GA 1BOSA 2SDFA 3I4NH 3T16A 1TIID 1HA5A 1QZHA 1N8R1 2M48A 2PI2A 1PRTB 3PIP3 1VQJA 1SJED 2KA7A 3GTPH 2DY8A 1DOMA 4L5RC 3JAMb 1I4HA 2L4NA 3DM1A 1Q8IA 3JAMi 3MC0B 3H09A 1PH1A 5IGEA 1PH5A 5C0XG 4LUOA 1D2BA 2A8VA 3IX0A 2JR6A 3A54A 4XXEA 5M5WB 4LFAQ 3CQZI 3I07A 3W1BA 1J5EL 2JA7H 2R92B 4A93B 1AZQA 2E74C 2K5WA 4Y52H 4ZRZA 2Q8IB 1FNVA 4LUZA 3GD7A 4A3EB 3W3AA 5E1FA 4MH4A 4Y7NI 3M3YH 3HKZE 5ELDA 3M4OI 3FPUB 4ZUIA 1VQBA 1KAAA 1VQIA 3HZXA 4DV1L 3K6OA 4RHSA 1EIYB 1VQP1 1UE1A 2QILA 2WB1B 4LF4L 2NVXI 2YTVA 5IT9c 1X3EA 2BJOA 1TQOA 2ASBA 1FR3A 3J7A4 3I4NI 1Q82C 4NBAA 1K3RA 4K5VA 4DNIA 3GTPI 2Z0SA 1K83B 1F9SA 5CV7A 1G2TA 4RMFA 1QWYA 1K8A2 2JA8B 3CC2Z 2KJXA 3SDZA 1YBYA 1V8QA 1H9MA 1B44D 2K5HA 4FDBA 1IYJB 3JAME 5KEEA 4PV1C 2JA7I 1L1OA 4AIMA 1K8OA 3ESWA 4CJ1B 1QE6A 2RHBA 3PF4A 3ULJA 1CKNA 4HCSA 4A3DB 4A3IH 3IKJA 3M3YI 4HIOA 2UU9L 5KYIA 2Q2UA 3PO3H 2YTYA 4GS3A 1B7YB 1KTKA 2KQ3A 3NDJA 5JVG3 1F77A 4DV5Q 4P71A 2D5DA 3SGIA 5HGTA 1K3BC 5M9OA 2F1MA 1N33L 1G91A 3EEDA 3G6EZ 1C9OA 2JIMA 1JJ2Y 2RBMA 3FKIB 1VQPA 5J39A 1HNXQ 5CBEE 3A55A 5DNFA 2VXWA 2B8FA 1U4LA 2BH8A 4DAVA 1Y8PB 2B2YA 4BY7G 1DYQA 1PRTC 3PO2G 1WVLA 5I9PA 2OQ0A 2BDOA 2J6AA 5KNBA 1G291 3QOLA 4A3II 4DKAC 2QR1B 1I3QB 3CCE1 4C3IB 4NB9A 2E2JB 3PO3I 4RKLA 3K81C 4GNXA 2BA0A 3J80L 1A62A 5T67A 2XSCA 4F87A 2C35B 1M1K2 1S4ZA 3E0EA 4DA2A 4RA8A 5EKKA 1CKNB 1X65A 4KJNA 1PTOB 5C3WA 1TWCB 1X3GA 3K8AA 2VB3X 4IUUA 1PDQA 5EPJA 3S1NB 5T64A 3TP5A 4RVHA 2L11A 5K36G 2Z4HA 1E0BA 4DK3C 2KEEA 2XWBB 3GTQB 2F0WA 4HSVA 1X54A 1PH6A 5M3MH 2JNYA 4POGA 2CWAA 1SJHD 1MGSA 1VF7A 1Y8CA 4YY3Q 4QGUA 4HJ7A 3PQIA 2O4HA 4MD7A 1SE8A 2IHFA 5EBDA 2Z6BA 3GTLB 1Y1VS 1ML0D 1VDZA 4TSSA 4YWLA 2PQAB 1F2YA 2F0NA 3Q24A 1VLAA 2K75A 4ODGA 3I7FA 1K8MA 1JQYD 4CHTB 1SYDA 1EY4A 2NYZD 2F4VQ 2PM9A 2OTJZ 1MHWC 5IIFA 1QG7A 3D2LA 1ESRA 3F1ZA 4R4TA 2F4IA 5M5WH 1HJPA 1IZ6A 1X6OA 2EY6A 2QGQA 1BKBA 3GTMB 5C4XB 1WCMB 3CCEA 4GNXB 3CCMZ 3F3FC 1ZH1A 2A68C 2L55A 1DOKA 1STYA 4H13C 1VQ4Z 3VMHA 3PIPA 4JW0A 3A5UA 1M901 1F9QA 1M8AA 3G6JB 3J7YW 1WTVA 1EYDA 1WFQA 4V0BA 3OTOQ 3CMEZ 4HIKA 1Q7Y2 3QR8A 3DXJC 4L5TA 1USPA 4NW2A 3ND8A 1Z47A 3CCQZ 3HKZG 1GD7A 5JAVA 4BXXH 3K5NA 2PMZE 1HFGA 3SK5A 2QDLA 2UXDQ 3ER0A 3OSOA 5A2Qb 4BY7H 3NP8A 1S5DD 1QVFY 3PO2H 4E2XA 1KDCA 3NE5B 3AFQA 4FXGC 2UUAQ 3A8JE 1IYUA 1EYGA 1UAPA 4E32A 3VA7A 4EGVA 3UDIA 1PH3A 2RBLA 3KDFA 4JI7L 4JBKA 3S1QB 1EIGA 2ATWA 2ZAEB 3FPPA 1NTGA 4IQZA 2ES2A 4B3SQ 2HDLA 1WOCA 3G6E1 1Q812 4QQBX 5D1PA 1L1OC 3S1MH 1N8RC 4A3DH 1C48A 3S2HI 1TT2A 3G4SZ 3HOUG 3EA6A 1EOTA 5IE8A 4IN3A 2DNCA 4HAEA 1IBMQ 1II3A 4APVA 1VCIA 4XT1B 4KMUC 3NWTA 1S5FD 2IZ3A 3KYHC 2H5XA 4KN4C 4JBJA 3JC66 4BBSG 1JOQA 5K36H 5ISRA 4BXXI 1L0YB 2V8IA 3KLRA 2E2II 1QNUA 4YIJA 5LMNQ 4DR5Q 3NPPA 1G8ZD 4BY7I 4C3HG 3PO2I 2FMMA 1GUTA 1QUQA 4MTNA 3S24A 4LF8Q 4OO1H 2V4DA 5CC4A 2KCMA 1X0TA 4EQNA 1H9KA 1VQ7Z 4KHZA 4LFCL 2E76C 2OOXB 1USPB 4GN3B 4PMBA 1VQ6Z 3J7A5 1IBLL 3EFXD 4IUNA 4XQQA 2JA6G 1HR0W 1PYWD 3CC4Z 1LV9A 4L5QA 2NVXB 4JG2A 4EQPA 2B2YC 2HHHL 3S1MI 4A3DI 4C3JH 3A56A 4LAAA 5D1OB 3TZUA 1I3QH 4IPDA 5IOCA 1B9NA 2YU9H 2B2TA 3BYYB 5FLMH 3QO2A 1YJWA 1EY6A 4DV7L 2QW7A 4P2CB 4GNXC 3HOYB 2HU9A 2Z4IA 1V1PA 5IT9E 3G6EA 4JI0L 3U4VA 1W6KA 2EYMA 4NDXA 3BZKA 3RN5A 1VQ9Z 1PTOH 1TWCH 4A3CG 1HPCA 1SFOH 4OO1I 3TSSA 2WAQA 1UE6A 3SR1A 1DONA 3S1NH 2ICEC 4BWGB 4ZCKA 4ME3A 4A3KB 3HOXB 4RFBA 2CHBD 3I73A 4R1JA 4UP7A 3GTQH 3MVVA 2H85A 4HIDA 2OTJ1 2K03A 2OEOA 4GOPA 1ILQA 3CCLA 2K52A 3IR7A 2N88A 2RA4A 3CCM1 3WOFA 3KUPA 1I3QI 1VQ41 2YU9I 2K5QA 4JYAL 5FLMI 3VR5A 3JAML 3E3XA 3CME1 3QWUA 3CKIB 1XNRQ 3K5LA 2KENA 4LWCA 4XDXA 3HOUH 5T1IA 4FF4A 1GKHA 3K7AH 2XVSA 2HDMA 2EOTA 4ILWA 1YHQA 1TWCI 1UWVA 1CA6A 1SFOI 3J80b 1Q8KA 1TKWB 5C4XH 1WCMH 5J3BA 1E2ZA 1NJIC 4BBSH 3J80i 5DAUA 3A7AB 3DWQA 1YITZ 2L15A 3GTQI 2X6LA 1VQMZ 1V1PB 2NWGA 2RKSA 3HS0C 3D3RA 5EAYA 4L6TB 3CQZB 1RIPA 3CPWA 1PZKD 2WAQB 2ZJRA 4OWWB 4F88A 5D3IB 2P28A 4HTHA 2PZTA 1YEZA 2YTXA 4P73A 3CCSA 2IT1A 5I4DA 4Y7NB 4XTCS 3M4OB 3NFZA 1K732 5FO8B 3S17H 1N34Q 1XWEA 2K1BA 2JXMB 2MJ8A 4X3KA 5IWAQ 1TFIA 4HGYA 4GOPB 1I6HI 1F9RA 2RSOA 3HOUI 1FGBD 4N8X1 3F2CA 4LF9L 2EY5A 4L8JA 1MD2D 2ID0A 3K7AI 3I4NB 3S1QH 3CCMA 3HRZC 1MSGA 3HOZG 1WCMI 3J7AF 4A3LH 4BBSI 3Q0AA 2LKVA 2EYHA 4WJ4A 3PUZA 1I4QA 3H3VH 3M7GA 1VQ71 3H6MA 1L0XB 4XYOA 3H0GH 3S15H 4A3CH 1CQFA 5EQ0A 4B3TQ 4NBEA 5J22A 1GJXA 2HIXA 3CC41 1FYCA 3IF8A 2JSOA 3KBGA 3NTIA 3I8ZA 4RCNA 4CDEC 2OT2A 4JI8Q 2NTTA 2IJ0A 4KY7A 5M5XB 3HOWG 3F2BA 1H9JA 3S17I 2SOBA 1I4RA 2JA5G 2TMPA 1JJCB 4RVDA 4ID6A 3J81E 5GAHC 2KHSA 1WD1A 4R4IA 3H3VJ 2XGTA 4WJ3M 3TZDA 3FEWX 5E4WC 1E2VA 2EJFC 4A3JG 3S1QI 2OWOA 4DNRB 1DJRD 3C2PA 2NAPA 4A3LI 2CQOA 5JPMC 1VQ91 2JEAI 4DK6C 2LY7A 1D8LA 4U68A 1BBUA 4FYDA 2DE5A 3T51B 3H3VI 4OELB 2WV6D 1VQ51 2EYLA 3D4DA 3HKSA 1VQLZ 2B2WA 2NZOA 2R6GA 2GTIA 3H0GI 3S15I 1PYBA 4QCLA 3BYTB 4A3CI 4K8IA 2F0QA 4AYBE 3T4NB 4DAPA 3RLOA 1EZ8A 1YUKA 3I70A 1LLRD 1OO9B 3BDCA 2CCZA 2B2TC 1HQRD 1OXUA 4EQ5A 1A2TA 4KI0A 4WJWA 4LF6L 1UE5A 1A2UA 3C3LA 4JC0A 1FJGL 4A3IB 3TE5B 2FXQA 2Q2IA 1JMCA 3DLLA 3CC7A 1T9HA 1WI5A 1VQ7A 2KI7B 3PO3B 3I2ZA 1HNZL 1KRSA 1RLYA 1C8CA 1CK1A 1F2ZA 1MIUA 2JIOA 2KCNA 4X62Q 1YJ9A 2O53A 5GQOA 2LXKA 4WORA 5E3FA 1PZJD 4WFN3 2E7ZA 4B9XA 4EX5A 2VQFL 3O13A 1IKMA 3W5OA 1S3OA 2VPXA 1GUSA 2MUYA 5CV5A 4X6AI 3EJIA 1H9RA 3CRLC 1CSPA 4R4CA 2DN8A 3P1HA 2HD3A 3CXCA 5DLQE 1P16A 3X3MA 4GOPC 3KFUA 3CD6Z 4KV6A 2XNAC 1EWCA 5IODA 1YIT1 5J1ZA 3HOZH 3RNUA 3K80C 1VQM1 1UEAB 5DM73 1JT8A 3GV6A 1RJTA 1WW9A 2K33A 3I3CA 3MXNA 3PUWA 1PRTF 4P72A 1VQ5A 4OXPA 2F0PA 4X64Q 3MXUA 3DMUA 1J5EQ 4HIMA 1CFMA 1MBYA 2F0GA 1B50A 4DV2L 1YHAA 4JBWA 1RCVD 3TP8A 1BDOA 2RDHA 5CMDA 1PFNA 3CCJA 1X3FA 1U4RA 2PI2E 2O2LD 3ZJYC 4DV1Q 2Z8LA 4OWXB 2VY3A 2B39A 2AUKA 1K9M2 3OPOA 5ELEA 4E2ZA 4LF4Q 3J80f 1JOKA 1K8GA 4NPSA 3CCVZ 1GUWA 2F0SA 4A3JH 1QNKA 3OMCA 1PV4A 3E6ZX 2KBNA 3HOZI 5A2QL 3SHLA 3TQYA 3MXPA 3CW2C 4ZKCB 2IWHA 4NBCA 5FJ8G 4DR1L 2HCCA 1A6XA 1BBXC 1BF4A 3MTSA 1NR2A 4LFBL 1SRUA 3AQQA 3ZYYX 1TS4A 3CPFA 2ZM6L 5M3FG 1YNJC 3ICEA 5KNDA 2QDBA 2EXZA 2WKDA 2A68D 1YITA 3FQMA 3D4RA 1LT4D 3H94A 1VQMA 4YWKA 4G57A 1YIJZ 2GVBA 3HOWI 2UU9Q 2JA5I 5IT9L 3M85A 2PQEA 3MXNB 4B3RL 2CKZB 4AQYQ 1Q12A 4JI2L 2QEX1 1LACA 5FKAC 5IYBG 3FDTA 1SYFA 4NBDA 1HTLD 4K14A 4A3JI 2Q4ZA 2JJQA 3S2HB 1VQL1 5M5XH 1KHIA 3ULLA 1N33Q 1JWHC 1A8VA 2WINB 1RQFA 3FMCA 5ELOA 3HG9A 2AYDA 2AMCB 4XQJA 1R4QB 3NTKA 3I561 1E24A 1J8IA 1CQVA 2EVBA 4IURA 2JS4A 3KF8A 2E2IB 1IYVA 1TR5A 3DM3A 3UDGA 2QRCB 1K28A 2PYKA 1A3TA 1VF5C 5C44G 1KD1C 1BBWA 4BY7B 1EY7A 3Q8DA 4JOIC 3PO2B 1YJN1 1W6JA 4NXMQ 3TP7A 3L7ZC 3BVZA 1N9WA 1SROA 4ZAIA 4KY5A 1PTOD 1WD0A 2B2WC 4G7OC 4HSPA 3TP6A 4YCWA 3D6CA 1U4MA 3OW2A 4J6HA 3OWEB 1X3ZA 2E2HH 5C4HA 4YCUA 3S1MB 2K5VA 3MEHA 1S72Z 3PMFA 3LNNA 3QJYA 4DR3Q 2B2UA 1KC81 4NH1C 3CD61 2NZ1D 1JWMD 1WTQA 2EYJA 1S5CD 3HKZA 4C1NI 1IKLA 4DN4M 5I2XA 4RGTA 2QEXA 4JI4Q 2Q2TA 2QREB 1YJWZ 3P5JB 5LMUL 3FVQA 2QA4Z 3BU2A 4AH6A 3G7LA 2G9DA 2O4XA 1O7YA 1PTOF 4E2WA 2JYOA 3LGJA 1CHPD 5FJ8H 1VQLA 2JMOA 4MTKA 3I72A 1VQFA 4N9TA 4DR6L 4ZUJA 5H1SE 1EQTA 5M3FH 1NBWA 3DUZA 1M902 3BVGA 1HZCA 1N36L 1X3PA 2PQAA 3I56A 3M4YA 3KF8B 3BG3A 2G5DA 3K5OA 2E2DC 3J81j 3PV0A 2SNMA 2A19A 2A74C 1KRLA 4DUZL 4IJLA 5IP7G 2WIIB 3C46A 3K0YA 4QIWE 3SXHA 1NJI1 3T4AC 1D7QA 2AHOB 2MP1A 2E2HI 3CCRZ 1EU4A 1ICWA 2A6EC 4IUPA 5C0XH 4ALPA 1YJNA 4C3JB 4PMCA 3CCV1 3CCLZ 3TREA 4KKSA 3GDEA 1S5BD 5EKLA 2YU9B 1EOVA 4UP9A 4MRIA 2RHQB 4KN7C 2E5LL 5GAGC 1Y1VG 2K6AA 3S16H 4NP5A 1HCZA 1PZID 2OF1A 1PYSB 2L5TA 1GOZA 1I4GA 3LX0A 1SFOB 3NSWA 2EQSA 5KGUA 4DV4L 2WP8J 4OONA 1TWHH 5IGBA 1YHQZ 2JP1A 3U58A 3CD6A 5JOBA 1RTNA 1E3PA 3HKZB 3J81L 5C0XJ 3S14H 2JIQA 1AW7A 1KRTA 4X65L 1YIJ1 1CZWA 2Z6KC 2K5RA 1BCPB 2GTHA 1HZAA 4LMQD 1SR3A 5JJIA 1Q3LA 4NB8A 3GP7A 5C0XI 2WFWA 2D0PA 3CPWZ 4GLAC 4HJ8A 1K8A1 4IALA 2Q51A 4JI7Q 1U9RA 1PH7A 2OCEA 4HCEA 2IW3A 2Y0SE 4ZK9B 3J80c 5BR8L 2C5CA 5FLXb 3CCSZ 1Z01A 1E7ZA 1JWSD 2DE6A 3OIQA 1QYPA 1STAA 1K0SA 3S16I 4FF1A 2EXDA 3NH5A 4OHJA 1EQVA 1LUZA 3A8IE 4PQXA 4DR2L 3HOUB 1I6HB 1MI2A 3ITPA 1DCZA 1G51A 2K14A 1B70B 3G711 3K7AB 4KD4A 4LJZC 2GU2A 5FO7B 2HT1A 1TWAI 1VQEA 1B9MA 3PIO3 3CCVA 4BA1I 2F0KA 2HIVA 2LS01 4J15A 3A5ZB 3HOVG 4BBSB 1TWHI 3S9WA 3K5MA 1W2BZ 5AN9F 3JAMf 3S14I 2DNEA 1Y69U 3KJOA 2OTLZ 1MSHA 3S2HH 3N6RA 1VS0A 2M00A 1D5MC 1GHKA 3N52A 1N32L 4C3HB 1MKHA 1I50H 2R7ZG 4LFCQ 1VQHA 4C3IG 2IPKD 1KABA 1O7IA 1IBLQ 2E2IH 1SN8A 4OEMB 2VPWA 3VYRA 1AA6A 3I4LA 1A3VA 3GO5A 2JA6B 3R8BA 1E1OA 2HQEA 3M4PA 2B63G 2FJ2A 4GKJL 1S721 1BO0A 1D6EC 3QOJA 5IP7H 3S17B 1YIJA 5G3LD 1EUJA 1XPUA 4ZKBB 2HHHQ 5D1OA 1XJVA 1S40A 1UEBA 1IW7C 1HZ9A 3TN2A 3NQIA 1BNZA 1YJW1 2QA41 4JCVE 3D6WA 5FLXE 4QF4A 1SXTA 1JWUD 4MN3A 1Y1VH 4CKEA 4DV0L 2LEXA 4DV7Q 4B08A 2NVQB 4H7BA 1KL9A 1L0WA 3TDHB 3H0GB 3S15B 5IT9b 3UI2A 4YY3L 3VYSA 1I50I 4KTAA 1VMCA 5G3LF 1AE3A 3I91A 4FF3A 1I5FA 3G71A 1PTOC 2M6NA 1GO3E 2PNHA 2PK7A 2B2UC 4A4IA 1XTCD 4I65A 1LTLA 1ASZA 5BN3A 3BZDB 1J9OA 2DGYA 3CCR1 4MONA 3CXCY 1CM9A 4A3BG 3CCL1 5IP7I 3KOJA 2V8KA 3S2DH 3CC7Z 1GUGA 4GLXA 1BCPC 3L0OA 2Z1CA 3DWAA 3TRZA 1V43A 1TVXA 1YJ9Z 4N8FA 1C7YA 4JYAQ 3U4ZA 5CV4A 1Q822 4TRDA 5LL6f 1Y1VI 2WAQE 1RODA 1I94L 2KPIA 2ZTEA 1S72A 5E4XA 2I07B 4QL5A 2KEDA 2MHVA 1YHQ1 1FNUA 2A6HD 1AH9A 2XTIA 3CXCZ 2RT9A 1HQMC 5IP9G 5KYLA 5AFWA 3VR2A 3DHQA 3HOVH 2NTSA 5EGTA 1EWHA 2QA4A 3TDQA 2NVTH 3R2IA 3F2UA 4QUFA 3SVMA 5GROA 2MGSA 4DUYL 1E2WA 1Z6HA 3F8TA 4CJ0B 2K5NA 2WACA 5GAEC 2BE5C 2UUAL 2R7ZH 1SNCA 1DL6A 3GTMS 1NUCA 1UUPA 2ZXPA 2F0UA 4IO9A 1VQ5Z 3S2DI 1VQNA 4BS9A 1SNOA 3EVQA 3TEHB 3VR4A 2P5ZX 1QCBD 5I6YA 3CCS1 2E75C 2E9HA 4K6LA 1U5KA 1KC8C 2B63H 2J7ZA 2CH4A 1ONLA 1WTRA 2XIWA 1A15A 3CCRA 3RLNA 1WTPA 2R7FA 3AEVA 3I90A 1RL2A 3CCJZ 1L2FA 2A69D 2LIYA 1K9MC 4JI3L 5HGQA 2PMZB 1NCVA 3P7JA 4DGLA 3K0XA 3PGZA 3BS1A 4HGZA 5I9OA 1K0RA 4LF9Q 1JE4A 1QJOA 5JJKA 3D4WA 2OTL1 3TMEA 3HOZB 1EL0A 3EERA 3HOVI 1GVPA 4DR5L 1QVGZ 2NVTI 1V1OA 1SAPA 4NB3A 1HA6A 2DY7A 1RKNA 3TBIB 4A75A 1I6HH 2F3WA 2Y0SG 3ERQA 4MIUA 4LF8L 1YI2Z 3H3VC 1S7MA 1Q811 3GTJI 2R7ZI 4GLVB 3UE1A 4Z9CB 4P75A 1NMGA 2PO4A 1JJ2A 4JV5Q 5EKIA 2PW5A 1LM0A 1RTOA 2I46A 5M5YH 2N3SA 4DV3L 2I0QA 1JJGA 2B63I 4QUCA 4A3BH 2J4XA 3HOWB 1B4OA 4C3HH 2M2LA 2JA5B 2QRDB 1SMXA 1TY0A 4R4OA 2JIPA 3IFUA 1KD11 3UDFA 5EJWA 3K57A 1SBBB 4KD3A 4NBHA 4KLKA 3GTKH 3NDIA 1YNJD 3CHBD 3J81b 4S1TA 1VQKZ 1QXFA 1CSQA 1XTDA 3OOCA 3NBHA 5L37A 1GM5A 4A3JB 4JI6L 3J81i 2JA6H 1EFWA 1XMOL 3NELA 4X3SA 4TKOB 3JAMc 2RCNA 4BBRG 4NBBA 2V8JA 3NH4A 4YHHQ 4KJOA 1T5XD 4A3FG 1D1KA 1WIIA 5IGFA 1A3UA 1Q862 2JIRA 1F9PA 3OW2Y 3GKQA 3I4MG 2PZWA 2F0FA 2IY5B 1W2BA 3VA5A 2L9HA 2CVRA 1RO2A 2EZVA 2ALYB 5A2Qf 1TXYA 2SNSA 4QY7A 2OTLA 2JQOA 1PFBA 2NVQH 2JA9A 1M4VA 4LF6Q 3CC71 1K8AC 1FJGQ 4IUVA 4C2MB 4A3BI 1CKOA 2I5HA 4A3MG 1X56A 1FNWA 2ZXRA 5D14A 1SNMA 1YJ91 1HNZQ 2AQ3B 4IUQA 3B6YA 3ND9A 3GTKI 2UUBL 2ZXOA 4RKBA 4K2KA 2VPYA 1LTSD 3CMAZ 1Z03A 4S3SA 1O78A 5CBAE 3OW2Z 2NN6G 2VQFQ 2JA6I 2JE6I 2QEJC 4QMGA 1O7ZA 2F0HA 5FO9B 3AU7A 5T1GA 3WOEA 1SLJA 2BCOA 1Y8OB 3SK8A 3RD4A 1E22A 3MONA 3BVMA 5CM2M 4KKUA 2ZJPA 2EIFA 2NZHA 1PFMA 4JOIA 1XNQL 1Z02A 4A3GG 4KKTA 4QB4A 3E9HA 5IP9I 2VUMG 2QEXZ 3NBHB 4HH4A 2UXCL 2NVYH 4RWSC 4GKKQ 4X6AH 2UUCL 5I2YA 3BZCA 1FL0A 2NVQI 3W2DA 1EWIA 2AQ2B 2C9OA 2PW7A 3AYHB 4POFA 2IHEA 4DAMA 3EROA 3T1YL 3D31A 5BN5A 1EIFA 3H91A 3BDLA 3UE0A 4DV6L 1RHPA 5KRUA 1HTPA 3I56Z 2F4OA 1R4PB 2G9HD 2NB0A 1KAWA 4L5SA 4RV9A 2D9UA 4DV2Q 1JORA 3CCJ1 1Y1WG 4HEDA 2K05A 4E2YA 2E2HB 4DR4Q 5C5MA 1KQSZ 4LNQA 1ICFB 4LF5L 1N8R2 1YJNZ 4X3UA 2A6HC 3T1HQ 2VQEL 4IPCA 2F4MA 1C4QA 2IX0A 2K32A 1MJEA 1NSNS 3SK4A 1DOLA 4XT3B 2D2CC 4R4QA 4B3ML 2W03A 3HEJA 1O7LA 1M1KC 1AP0A 1GXDC 3D9XA 4XX2A 2CWPA 2NVYI 3IFDA 1YI21 1Q1BA 2V3VA 3UDXA 4X66L 4DR1Q 2R6MA 4NBGA 2A6ED 3A74A 4OIJA 3RLFA 3RMHA 3VYUA 4MXUA 1XX8A 1E1TA 3NBIA 3GTOH 1K731 2F0VA 1A63A 2K4KA 5K5PA 2ZM6Q 5M3FB 1RO4A 2JA7G 4OX9L 3I4MH 3MZ5A 1PHJA 2WB1E 4DF7A 1NY4A 1CUKA 1GHJA 3SEBA 4KHPL 1LO5D 5FLXL 1EEID 2FFKB 3QWNA 3QB3A 3ONAB 2OZKA 5KNCA 2B2VA 1PH9A 5C3XA 2MNAA 4DR7L 1PXUA 4IPHA 1VQAA 1HNWL 1GUOA 2A69C 4MNOA 4DFAA 5IGGA 1PLFA 1R9TH 2B3GA 4A3MH 3TS2A 2MO0A 1VQK1 3D0FA 2EY1A 2K28A 4R9WA 3NUCA 1IBKL 2W04A 4FNFA 3DEOA 4N9PA 2N49A 4JI2Q 1H95A 2UXBL 1I6VC 1I4XA 2CW0C 3U9SA 3V96A 5BN4A 3S16B 3OHXC 4K0KL 2EYFA 5C3EG 1SYGA 3HOWH 1LTAD 4ZQ3A 2JA5H 4BBRI 1TWAB 2F0TA 1STHA 3MAQA 2A73B 1WTXA 1TWHB 3GTOI 2NBFA 2H1EA 2DE7A 4FVMA 4A3GH 1CZGA 1VMPA 2Z6KA 3S14B 2VNUD 3K58A 3I4MI 1QVGA 3FRPB 1XMQL 2YV5A 2EGTA 1S5ED 1YNNC 1ZKOA 1Q7YC 1EY5A 1PMRA 2DJFC 1YI2A 1HR0L 1BXTA 1HUNA 5CORA 2ICIA 1R9TI 1PH8A 2KCCA 3FHWA 1JE5A 4A3MI 1VQOZ 2XRQD 1J6QA 3T56B 3CMA1 3J81f 4BA2I 1SE3A 4ME5A 2K3RA 1HH2P 1XYIA 2F52A 4IPGA 1U0LA 1DGSA 2QF7A 4DPGA 2EPBA 5JEAG 3VMGA 2KUMA 1Y1WH 1KDBA 1SNQA 2NN6I 5JVH3 2HF1A 1ZXTA 2K50A 4C2MH 1IHZA 2KHIA 4OWTB 5IGDA 1OXTA 1ZYRC 2VW9A 1EZ6A 4KY6A 1VQKA 4MD9A 4NXNL 5C4ZA 1ML8A 2F0DA 4PG3A 1YHBA 5LMUQ 4JI5L 1NJI2 3CU7A 3P20A 1G6ZA 4A3GI 1JC7A 5CGKA 1LQLA 1Q81C 2VUMI 1UE7A 1Q90A 5D3DA 5AJ3L 2F03A 1LYLA 1YZ6A 1EU3A 2RF4A 3EQLC 1VQ8Z 4LW1A 3MZLB 1HHVA 3PO3S 1AZPA 1I50B 3FP9A 3R3OA 1ESFA 4IOCA 2BOSA 4DR6Q 2WKCA 1IW7D 2A5HA 2HUGA 2RSNA 4X64L 2EJGC 3QIAA 1FGUA 1ILPA 3G71Z 1N36Q 5CR3A 1LT3D 3PF5A 4FXDA 1KDAA 4DUZQ 1P8LA 2HCIA 1V9PA 5LL6X 3GCFA 1T5EA 1JOOA 1Y1WI 1EYCA 3KBXA 4LK1C 1P9NA 4M8AA 1WYDA 5C4JH 1AFPA 2ENBA 2M9VA 3K7UC 5ELNA 4EWCA 1G2SA 5LMNW 3F2DA 4RVFA 2GVAA 3R93A 4BY1G 2E5LQ 3RZOB 4LF7L 2LFNA 3CMAA 2K04A 4O1NA 4LUVA 1Y1VB 4JI1L 4CJ2C 4QJFA 1JCKB 5C6AA 1B3QA 5ELCA 4M1UB 3BJUA 2R93G 1WJJA 4OIKA 3T13A 5C3EH 4AYBG 4NOZA 2D62A 3NQTA 5M3MG 1VQCA 2AWNA 1LTBD 1QF8A 2I5LX 3GQBA 4TVAB 2F0OA 4DV4Q 4H44C 1BCPD 2JEBI 4O2DA 4PZ8A 1SDFA 1K9M1 2F0MA 4QTUA 4X65Q 4Y52I 1KNEA 3WDNA 2MFIA 4DAYA 2VUGA 3U9OA 1NP6A 4F7XA 4JK1C 3S2DB 5C4JI 1RD9D 2E8GA 4JVZA 1VQNZ 4JPBW 1Q1EA 4RGOS 4I7AA 4AQYL 4LFAL 2R92G 3MZKB 2QCPX 1CTMA 1NE3A 4A93G 4CDFC 4GN4B 2RCFA 2A1AA 2O5JC 1DM0B 2JN4A 5BR8Q 3CP0A 4TQUS 1BCPF 3I4OA 1NAPA 1ENAA 4A3EG 5JEAH 4HN7A 1KQSA 1QVCA 4IFDG 1ZB9A 2LSSA 5C3EI 4DR2Q 4EVOA 3PUYA 1HRJA 2BE5D 2WB1G 3STBC 1RF2D 2B2VC 1F2LA 4PNYA 1X3QA 1X3WA 1TWGH 2F3IA 3HOVB 2QLVB 4CKBA 4HJAA 4BXXG 3NEMA 4UPAA 5IYBH 2NVTB 1TWFB 1WTHA 2R7DA 4GN5A 3OYYA 1SNPA 2QKDA 3CPWY 3RZDH 1Y8NB 4K8JA 1N32Q 1QILA 1VQO1 4NXML 5DEHA 3GTJB 2JA8G 1WZNA 1TWAH 2R7ZB 1YVCA 2FMCA 2GN5A 1FVIA 2L0CA 3MFGA 1EIHA 4NMZA 1PFTA 5JEAJ 2TSSA 3VB9A 4RAUC 3H15A 2IX1A 4HR7B 1O80A 1OXSC 3MFYA 4MD8A 1JJ2Z 3L9AX 1L1OB 5C44H 2B63B 1B53A 4GKJQ 3TS0A 4CDDC 1NNXA 2I5MX 3MHBA 4IOAA 4RGNA 3V2TA 4A3DG 2XWJB 4DAYB 2AKLA 3WWVA 4DR3L 1W2BY 1SSOA 2PPBC 3M4QA 3AMUA 1VQGA 1STEA 2FINB 3HGBA 2L1BA 2K5DA 2BH2A 4BY1H 4DV5L 1TWGI 4QTTA 4JI4L 2F0IA 2J0TD 1BVSA 4DK0A 2EY2A 1VQ81 1KXLA 4HJ9A 4DV0Q 1K73C 1IXRA 4HMJA 1NR4A 2RHSB 1JB7A 2R93H 1W3SA 1F2MA 3HP3A 3RR5A 1B1ZA 1WTWA 1D1IA 3RZDI 1XPRA 1SMYD 5IYDG 3J7ZC 4CGYB 4OO1G 1JB3A 1V1QA 1Q86C 5IYCG 3FKIG 2B29A 1HNXL 3RN2A 1SYEA 2GA4B 3J81c 2HQLA 3CCUZ 5M5YB 3Q23A 5I6WA 5C44I 1STBA 3J7AV 4A3BB 4NFRA 3VDYA 4L63B 2XN9C 2NUCA 4C3JG 1VQOA 2IX3A 2CQAA 3GTKB 4YWMA 1RO0A 1NMFA 2R92H 3CAMA 5FLMG 1KIXA 4A93H 3KJPA 2KECA 2YYZA 3ERSX 4BY1I 3NTHA 3VR3A 4RGMA 4IJHA 4P74A 4UY8C 4A3EH 2IV2X 1I94Q 4G7ZC 3CC21 4IFDH 2KHJA 2R93I 2Y0SA 2VL6A 1DZ1A 1SE2A 4XIGS 1WTOA 4RS4A 2JUBA 3RZOH 4QIWB 3OWFA 1G6PA 3KLWA 4HMIA 1QZGA 2VB2X 1K83H 4DUYQ 1VQ8A 1QB5D 4RVGA 4H0LC 4JI0Q 3CRKC 5CV9A 1VQN1 2V45A 1M1K1 1BR9A 2JA8H 4U673 1HFNA 2H4OA 1FD7D 2N55A 4IFDJ 1ENCA 2R92I 1DD2A 4G4KA 1N2FA 1I4PA 4HJ5A 4A93I 4YCVA 4NKLA 2EDGA 4WRDA 1EEFD 4E31A 4A3EI 4KHVA 2ZTDA 3CF5A 3KF6A 2PMZA 3NXWA 4IFDI 2F4VL 4JI3Q 1GUNA 4DNTB 1QVFZ 2AWOA 5JPNC 1B8AA 5C5LA 1JICA 5C4XG 3KK7A 1WCMG 1CI3M 4OGQC 2NVYB 3RZOI 1SYCA 2IZ4A 1KD12 2OXPA 5TSSA 4E33A 1FDOA 5JJLA 5F2DA 1K83I 4X3TA 3OTOL 3CC2A 2BA1A 2Y0SB 1H9SA 3EBEA 4RG1A 2CH4W 5CYUA 2Q8TA 1AE2A 4MZ9A 5IYDH 3LUSA 5IYCH 3FKIH 2JA8I 1VQDA 3K59A 2B8GA 1Q16A 5A2QE 4PZ7A 2UXDL 1TWFH 4Q5VA
chains in the Genus database with same CATH topology
4DV3Q 3GTJH 1Y14B 4PMWA 1YUAA 1QVGY 1XPOA 4C3IH 1PH4A 2E2JH 3KDFB 1Q7Y1 4JI6Q 4A3LG 2MO1A 4B3SL 1XMOQ 3L2PA 4O0AA 1YNXA 3VTNA 3H0GG 3KF6B 1Q46A 1IBML 1EQQA 3CCU1 3FKII 5LMNL 1PVOA 3U50C 1TWFI 4DK1A 3VMIA 1EQRA 1QUQB 2D0OA 3FQQA 3GTLH 1ASYA 3EN2A 2UUBQ 3AFPA 2E2JI 3I55Z 5FLXf 1MJCA 2YADA 2LXJA 4TNUA 3NENA 3CCQ1 3GTMH 1XNQQ 2VF1A 3PIOA 3S1NI 2UXCQ 3HOYG 2UUCQ 3KIHA 3Q87A 2MQHA 1Q821 2ZTCA 3T1YQ 5IP9H 1PH2A 4DV6Q 4A3KG 1OXXK 3GTLI 3HOXG 3CCUA 3G4S1 4LF5Q 2OTJA 3PUVA 2VQEQ 2V1CC 1X55A 3ULPA 1CKMA 4B3MQ 2OQKA 1OXVA 3GTMI 5C4XI 1VQ4A 1ZB8A 4CL1A 3E9IA 2CFMA 1XNRL 3CMEA 4X66Q 5IT9f 1VQ61 4NBFA 5HY6A 3A0JA 3CCQA 3BG0B 4OX9Q 1KQSY 3M7NA 2P3YA 1A0IA 4JV5L 2LFUA 1HZBA 4KHPQ 4DR7Q 1HNWQ 3W1GA 4E30A 4DQYB 1M90C 1IBKQ 2WAQG 2UXBQ 3M9BA 2VS1A 4K0KQ 1N34L 3G4SA 4YHHL 5IWAL 4H02A 1QVFA 4JBMA 3I4NG 1VQPZ 2Q2HA 4PZ6A 3G48A 1RNIA 1XMQQ 3HOYH 2KCTA 4UP8A 3IRBA 4BBRH 1Z9FA 2RIQA 3F3PC 1HR0Q 4A3FH 3STBD 4LFBQ 4B3TL 3I551 2G2KA 1VQ6A 2VZAA 5GADC 4A3KH 3HOXH 1PA6A 1Q861 3BG1B 3CC4A 4JI8L 4AYBA 3S1RH 2RPRA 4B3RQ 1X9NA 3PCOB 4NXNQ 2N78A 4JI5Q 4A76A 3GTGH 4GKKL 5AJ3Q 3HOYI 2ZJQA 1VQ9A 2N8NA 2OOYB 4A3FI 2AKWB 1NUIA 2VUMH 2DUDA 4A3KI 3HOXI 1KC82 5FLXc 4DR4L 3PUXA 3MEFA 4A3IG 2JK8A 1IL2A 2WB1A 3S1RI 5IY0A 3T1HL 3CQZH 3PO3G 2I3CA 5T6BA 4X62L 1OTCA 3KIFA 3I55A 4LF7Q 1PFSA 3PSIA 3CCEZ 5E7NA 4JI1Q 3NH8A 4Y7NH 3EIVA 3M4OH 3GTGI 3HFZB 2NVXH 1C0AA 3I4NH 1QZHA 1N8R1 2M48A 2PI2A 1VQJA 3GTPH 4L5RC 3JAMb 3JAMi 1PH5A 1PH1A 5C0XG 4LUOA 2A8VA 3IX0A 2JR6A 4LFAQ 3CQZI 3I07A 3W1BA 1J5EL 2JA7H 4Y52H 4LUZA 3GD7A 4MH4A 4Y7NI 3M3YH 3HKZE 3M4OI 1VQBA 1VQIA 4DV1L 1EIYB 1VQP1 1UE1A 4LF4L 2NVXI 2YTVA 5IT9c 1X3EA 2BJOA 2ASBA 3J7A4 3I4NI 1Q82C 4NBAA 1K3RA 4DNIA 3GTPI 2Z0SA 4RMFA 1K8A2 3CC2Z 1YBYA 2K5HA 4FDBA 1IYJB 2JA7I 1L1OA 4AIMA 3ESWA 2RHBA 3PF4A 3ULJA 1CKNA 4A3IH 3M3YI 4HIOA 2UU9L 2Q2UA 3PO3H 2YTYA 4GS3A 1B7YB 3NDJA 4DV5Q 4P71A 3SGIA 1N33L 3EEDA 3G6EZ 1C9OA 1JJ2Y 1VQPA 1HNXQ 2BH8A 4BY7G 3PO2G 2OQ0A 2J6AA 1G291 4A3II 4DKAC 2QR1B 3CCE1 4NB9A 3PO3I 3K81C 4GNXA 2BA0A 1A62A 5T67A 3E0EA 2C35B 1M1K2 1CKNB 1X65A 1X3GA 3K8AA 5T64A 4RVHA 5K36G 4DK3C 1X54A 1PH6A 5M3MH 2JNYA 4POGA 2CWAA 4QGUA 4YY3Q 4HJ7A 2O4HA 4MD7A 1SE8A 2IHFA 1Y1VS 4YWLA 2PQAB 1VLAA 2K75A 3I7FA 2F4VQ 2PM9A 2OTJZ 3F1ZA 4R4TA 5M5WH 1HJPA 1IZ6A 1X6OA 2QGQA 1BKBA 3CCEA 4GNXB 3CCMZ 3F3FC 1ZH1A 2ZJPA 1VQ4Z 3VMHA 3PIPA 3A5UA 1M901 1WFQA 3OTOQ 3CMEZ 4HIKA 1Q7Y2 4L5TA 1USPA 1Z47A 3CCQZ 3HKZG 1GD7A 4BXXH 2PMZE 2UXDQ 3ER0A 5A2Qb 4BY7H 1QVFY 3PO2H 4E2XA 3AFQA 2UUAQ 1EYGA 4E32A 1PH3A 3UDIA 2RBLA 3KDFA 4JI7L 4JBKA 2ATWA 2ZAEB 1NTGA 2ES2A 4B3SQ 1WOCA 3G6E1 1Q812 4QQBX 5D1PA 1L1OC 3S1MH 1N8RC 4A3DH 3S2HI 3G4SZ 3HOUG 5IE8A 1IBMQ 4APVA 1VCIA 2IZ3A 3KYHC 2H5XA 4JBJA 3JC66 4BBSG 4BXXI 2V8IA 5LMNQ 2E2II 4DR5Q 4BY7I 3PO2I 4MTNA 1QUQA 3S24A 4LF8Q 2KCMA 1X0TA 1VQ7Z 4KHZA 4LFCL 2OOXB 1USPB 4GN3B 1VQ6Z 3J7A5 1IBLL 2JA6G 1HR0W 3CC4Z 4L5QA 4JG2A 2HHHL 3S1MI 4A3DI 4C3JH 5D1OB 1I3QH 4IPDA 2YU9H 5FLMH 1YJWA 4DV7L 4GNXC 2HU9A 3G6EA 4JI0L 3U4VA 3BZKA 3RN5A 1VQ9Z 1TWCH 4A3CG 1SFOH 4OO1I 2WAQA 1UE6A 3S1NH 4ME3A 4R1JA 4UP7A 3GTQH 2H85A 4HIDA 2OTJ1 4GOPA 3CCLA 2K52A 3CCM1 1I3QI 1VQ41 2YU9I 4JYAL 5FLMI 3CME1 3QWUA 1XNRQ 2KENA 4LWCA 3HOUH 1GKHA 3K7AH 1YHQA 1TWCI 1UWVA 1SFOI 3J80b 1Q8KA 5C4XH 1WCMH 5J3BA 1NJIC 4BBSH 3J80i 1YITZ 2L15A 3GTQI 1VQMZ 5EAYA 1RIPA 3CPWA 2ZJRA 4OWWB 2P28A 1YEZA 2YTXA 3CCSA 4P73A 2IT1A 4XTCS 3NFZA 1K732 3S17H 1N34Q 5IWAQ 4GOPB 1TFIA 4HGYA 1I6HI 3F2CA 3HOUI 4LF9L 2ID0A 3K7AI 3S1QH 3CCMA 3HOZG 1WCMI 4A3LH 4BBSI 4WJ4A 3PUZA 3H3VH 1VQ71 3H0GH 3S15H 4A3CH 4B3TQ 4NBEA 2HIXA 3CC41 3IF8A 4JI8Q 3HOWG 3F2BA 3S17I 2JA5G 1JJCB 4RVDA 5GAHC 4R4IA 3H3VJ 2XGTA 4WJ3M 4A3JG 3S1QI 2OWOA 4A3LI 2CQOA 1VQ91 2JEAI 4DK6C 1D8LA 1BBUA 2DE5A 3H3VI 1VQ51 3HKSA 1VQLZ 2NZOA 2R6GA 2GTIA 3H0GI 3S15I 1PYBA 4A3CI 4AYBE 3T4NB 3RLOA 1YUKA 2CCZA 1OXUA 4EQ5A 4KI0A 4LF6L 1UE5A 1FJGL 4JC0A 3TE5B 2FXQA 2Q2IA 1JMCA 3DLLA 3CC7A 1T9HA 1WI5A 1VQ7A 2KI7B 3I2ZA 1HNZL 1KRSA 1RLYA 1MIUA 4X62Q 1YJ9A 2O53A 5GQOA 2LXKA 4EX5A 2VQFL 3W5OA 1S3OA 4X6AI 1CSPA 4R4CA 3CXCA 5DLQE 1P16A 4GOPC 3KFUA 3CD6Z 1YIT1 3HOZH 3RNUA 3K80C 1VQM1 1JT8A 1WW9A 3PUWA 4P72A 1VQ5A 4OXPA 4X64Q 1J5EQ 4HIMA 4DV2L 1YHAA 4JBWA 3CCJA 1X3FA 2PI2E 3ZJYC 4DV1Q 4OWXB 2VY3A 1K9M2 4E2ZA 4LF4Q 3J80f 1K8GA 4NPSA 3CCVZ 4A3JH 1PV4A 2KBNA 3HOZI 3TQYA 3CW2C 4NBCA 5FJ8G 4DR1L 4LFBL 1SRUA 3AQQA 3CPFA 2ZM6L 5M3FG 3ICEA 1YITA 3FQMA 1VQMA 4YWKA 1YIJZ 2GVBA 3HOWI 2UU9Q 2JA5I 3M85A 3MXNB 4B3RL 2CKZB 4AQYQ 1Q12A 4JI2L 2QEX1 5IYBG 4NBDA 4A3JI 2Q4ZA 2JJQA 1VQL1 5M5XH 1KHIA 3ULLA 1N33Q 1JWHC 1A8VA 1RQFA 5ELOA 2AMCB 3I561 1E24A 2JS4A 3DM3A 3UDGA 2QRCB 5C44G 1KD1C 1BBWA 3Q8DA 4JOIC 1YJN1 4NXMQ 3L7ZC 1N9WA 1SROA 4YCWA 3OW2A 1X3ZA 2E2HH 4YCUA 2K5VA 1S72Z 4DR3Q 1KC81 4NH1C 3CD61 3HKZA 2QEXA 4JI4Q 2Q2TA 2QREB 1YJWZ 3P5JB 5LMUL 2QA4Z 3BU2A 4AH6A 4E2WA 3LGJA 5FJ8H 1VQLA 2JMOA 1VQFA 4DR6L 5H1SE 5M3FH 1NBWA 1M902 1N36L 1HZCA 2PQAA 3I56A 3KF8B 3J81j 3PV0A 2A19A 1KRLA 4DUZL 4IJLA 5IP7G 4QIWE 1NJI1 1D7QA 2AHOB 2E2HI 3CCRZ 1YJNA 4ALPA 3CCV1 3CCLZ 3TREA 3GDEA 1EOVA 4UP9A 4MRIA 2RHQB 2E5LL 5GAGC 1Y1VG 3S16H 1PYSB 2EQSA 4DV4L 2WP8J 4OONA 1TWHH 1YHQZ 3U58A 3CD6A 1E3PA 5C0XJ 3S14H 1KRTA 4X65L 1YIJ1 2Z6KC 2K5RA 1HZAA 2GTHA 1SR3A 5JJIA 4NB8A 5C0XI 2WFWA 2D0PA 3CPWZ 4GLAC 4HJ8A 1K8A1 2Q51A 4JI7Q 1PH7A 2OCEA 2Y0SE 3J80c 5BR8L 5FLXb 3CCSZ 1Z01A 1E7ZA 2DE6A 1QYPA 3S16I 2EXDA 3NH5A 4DR2L 1LUZA 1G51A 2K14A 1B70B 3G711 2HT1A 2GU2A 1TWAI 1VQEA 3CCVA 4BA1I 4J15A 2HIVA 3HOVG 3A5ZB 1TWHI 1W2BZ 5AN9F 3JAMf 3S14I 3KJOA 2OTLZ 3S2HH 1VS0A 1N32L 1MKHA 1I50H 2R7ZG 4LFCQ 1VQHA 1O7IA 1IBLQ 2E2IH 1SN8A 3GO5A 1E1OA 3M4PA 2B63G 4GKJL 1S721 5IP7H 1YIJA 1EUJA 1XPUA 2HHHQ 5D1OA 1XJVA 1S40A 1UEBA 1HZ9A 1YJW1 2QA41 4JCVE 3D6WA 1Y1VH 4DV0L 4DV7Q 1KL9A 1L0WA 3TDHB 5IT9b 4YY3L 1I50I 1AE3A 1I5FA 3G71A 2M6NA 1GO3E 2PNHA 2PK7A 4A4IA 1LTLA 1ASZA 2DGYA 3CCR1 4MONA 3CXCY 4A3BG 3CCL1 5IP7I 3KOJA 2V8KA 3S2DH 3CC7Z 4GLXA 3L0OA 3TRZA 1V43A 1YJ9Z 1C7YA 4JYAQ 3U4ZA 1Q822 5LL6f 1Y1VI 2WAQE 1I94L 2KPIA 2ZTEA 1S72A 4QL5A 1YHQ1 1AH9A 2XTIA 3CXCZ 2RT9A 5IP9G 3HOVH 2QA4A 2NVTH 5GROA 4DUYL 3F8TA 2K5NA 5GAEC 2UUAL 2R7ZH 1DL6A 3GTMS 1VQNA 4IO9A 1VQ5Z 3S2DI 3TEHB 3CCS1 2E9HA 1U5KA 1KC8C 2B63H 3CCRA 3RLNA 3AEVA 2R7FA 1RL2A 3CCJZ 1L2FA 2LIYA 1K9MC 4JI3L 5HGQA 4DGLA 3K0XA 3PGZA 4HGZA 4LF9Q 1K0RA 5JJKA 2OTL1 3EERA 3HOVI 1GVPA 4DR5L 1QVGZ 2NVTI 4NB3A 1I6HH 4A75A 2Y0SG 4LF8L 1YI2Z 1S7MA 1Q811 3GTJI 2R7ZI 4GLVB 3UE1A 4P75A 1NMGA 1JJ2A 4JV5Q 1LM0A 5M5YH 2N3SA 4DV3L 2I0QA 1JJGA 2B63I 4A3BH 4C3HH 2QRDB 1SMXA 4R4OA 3IFUA 1KD11 3UDFA 4NBHA 4KLKA 3GTKH 3NDIA 3J81b 4S1TA 1VQKZ 1XTDA 1CSQA 1GM5A 4JI6L 3J81i 2JA6H 1EFWA 1XMOL 3NELA 3JAMc 2RCNA 4BBRG 4NBBA 2V8JA 3NH4A 4YHHQ 4A3FG 1WIIA 1Q862 3OW2Y 3GKQA 3I4MG 2IY5B 1W2BA 1RO2A 2ALYB 5A2Qf 1TXYA 4QY7A 2OTLA 2JQOA 2NVQH 2JA9A 4LF6Q 3CC71 1K8AC 1FJGQ 4A3BI 1CKOA 2I5HA 4A3MG 1X56A 1YJ91 1HNZQ 3B6YA 3GTKI 2UUBL 3CMAZ 1Z03A 2VQFQ 3OW2Z 2NN6G 2JA6I 2JE6I 1SLJA 1E22A 3MONA 5CM2M 2EIFA 2NZHA 4JOIA 1XNQL 1Z02A 4A3GG 3E9HA 5IP9I 2VUMG 2QEXZ 3NBHB 4HH4A 2UXCL 2NVYH 4GKKQ 4X6AH 2UUCL 3BZCA 1FL0A 2NVQI 1EWIA 3AYHB 4POFA 2IHEA 4DAMA 3T1YL 3D31A 1EIFA 3UE0A 4DV6L 3I56Z 2F4OA 1KAWA 4L5SA 4RV9A 4DV2Q 3CCJ1 1Y1WG 4E2YA 4DR4Q 1KQSZ 4LNQA 4LF5L 1N8R2 1YJNZ 3T1HQ 2VQEL 4IPCA 2F4MA 2IX0A 1MJEA 4R4QA 4B3ML 2W03A 1M1KC 3D9XA 4XX2A 2CWPA 2NVYI 1YI21 1Q1BA 3UDXA 4X66L 4DR1Q 2R6MA 4NBGA 3A74A 3RLFA 4MXUA 3GTOH 1E1TA 1K731 1A63A 2K4KA 2ZM6Q 1RO4A 2JA7G 4OX9L 3I4MH 1PHJA 2WB1E 1NY4A 1CUKA 4KHPL 1PH9A 2OZKA 2MNAA 4DR7L 4IPHA 1VQAA 1HNWL 4MNOA 1R9TH 2B3GA 4A3MH 3TS2A 2MO0A 1VQK1 3D0FA 1IBKL 2W04A 4JI2Q 2N49A 1H95A 2UXBL 4K0KL 5C3EG 3HOWH 2JA5H 4BBRI 3GTOI 2DE7A 4A3GH 2VNUD 2Z6KA 3I4MI 1QVGA 1XMQL 2YV5A 2EGTA 1Q7YC 1YI2A 1HR0L 1R9TI 1PH8A 3FHWA 1JE5A 4A3MI 1VQOZ 1J6QA 3CMA1 3J81f 4BA2I 2K3RA 1HH2P 2F52A 4IPGA 1U0LA 1DGSA 4DPGA 5JEAG 3VMGA 1Y1WH 2NN6I 2HF1A 2K50A 4C2MH 2KHIA 4OWTB 1OXTA 2VW9A 1VQKA 4MD9A 4NXNL 1ML8A 4PG3A 1YHBA 5LMUQ 4JI5L 1NJI2 4A3GI 1LQLA 1Q81C 2VUMI 1UE7A 5AJ3L 1LYLA 1YZ6A 2RF4A 1VQ8Z 4LW1A 3MZLB 3PO3S 3FP9A 4IOCA 4DR6Q 4X64L 1FGUA 3G71Z 1N36Q 3PF5A 4DUZQ 1P8LA 1V9PA 3GCFA 1Y1WI 1P9NA 5C4JH 1WYDA 5ELNA 3K7UC 4EWCA 5LMNW 3F2DA 4RVFA 2GVAA 2E5LQ 4BY1G 4LF7L 3CMAA 4LUVA 4JI1L 4QJFA 3BJUA 2R93G 1WJJA 5C3EH 4AYBG 4NOZA 2D62A 5M3MG 1VQCA 2AWNA 1QF8A 2I5LX 4TVAB 4DV4Q 2JEBI 4O2DA 4PZ8A 1K9M1 4QTUA 4X65Q 4Y52I 2MFIA 2VUGA 1NP6A 5C4JI 2E8GA 1VQNZ 4AQYL 1Q1EA 4LFAL 2R92G 3MZKB 1NE3A 4A93G 4GN4B 2A1AA 5BR8Q 3CP0A 4TQUS 3I4OA 4A3EG 1KQSA 1QVCA 4IFDG 1ZB9A 2LSSA 5C3EI 4DR2Q 3PUYA 2WB1G 3STBC 1X3WA 1TWGH 2F3IA 2QLVB 4HJAA 4BXXG 3NEMA 4UPAA 5IYBH 2R7DA 4GN5A 3OYYA 2QKDA 3CPWY 3RZDH 1N32Q 4NXML 1VQO1 2JA8G 1TWAH 1YVCA 2GN5A 1FVIA 1PFTA 5JEAJ 3VB9A 3H15A 2IX1A 1OXSC 4MD8A 1JJ2Z 1L1OB 5C44H 4GKJQ 3TS0A 2I5MX 4IOAA 4A3DG 4DAYB 2AKLA 3WWVA 4DR3L 1W2BY 3M4QA 1VQGA 2BH2A 4BY1H 4DV5L 1TWGI 4QTTA 4JI4L 1BVSA 1VQ81 1KXLA 4HJ9A 4DV0Q 1K73C 1IXRA 2RHSB 2R93H 1JB7A 1W3SA 3RR5A 3RZDI 1XPRA 4OO1G 5IYDG 3J7ZC 1V1QA 1Q86C 5IYCG 3FKIG 2B29A 1HNXL 3RN2A 3J81c 2HQLA 3CCUZ 5C44I 4NFRA 3VDYA 1VQOA 4YWMA 1RO0A 1NMFA 2R92H 3CAMA 5FLMG 1KIXA 4A93H 3KJPA 2YYZA 3ERSX 4BY1I 4IJHA 4P74A 4UY8C 4A3EH 1I94Q 3CC21 2KHJA 2R93I 2Y0SA 2VL6A 4XIGS 4RS4A 2JUBA 3RZOH 1G6PA 3KLWA 1QZGA 1K83H 4DUYQ 1VQ8A 4RVGA 4JI0Q 1VQN1 1M1K1 2JA8H 4IFDJ 2R92I 1N2FA 4HJ5A 4A93I 4YCVA 4E31A 4A3EI 3CF5A 2ZTDA 3KF6A 2PMZA 4IFDI 2F4VL 4JI3Q 1QVFZ 2AWOA 1B8AA 5C4XG 1WCMG 3RZOI 2IZ4A 1KD12 4E33A 5JJLA 1K83I 3OTOL 3CC2A 2BA1A 4RG1A 3EBEA 5IYDH 1AE2A 4MZ9A 3LUSA 5IYCH 3FKIH 2JA8I 1VQDA 4PZ7A 2UXDL 1TWFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 Q;  3GTJ H;  1Y14 B;  4PMW A;  1YUA A;  1XPO A;  4C3I H;  1PH4 A;  2E2J H;  3KDF B;  4JI6 Q;  4A3L G;  2MO1 A;  4B3S L;  1XMO Q;  3L2P A;  4O0A A;  1YNX A;  3H0G G;  3KF6 B;  1Q46 A;  1IBM L;  1EQQ A;  3FKI I;  5LMN L;  1PVO A;  3U50 C;  1TWF I;  3VMI A;  1EQR A;  1QUQ B;  2D0O A;  3GTL H;  1ASY A;  3EN2 A;  2UUB Q;  3AFP A;  2E2J I;  1MJC A;  2LXJ A;  3NEN A;  3GTM H;  1XNQ Q;  3PIO A;  3S1N I;  2UXC Q;  3HOY G;  2UUC Q;  3Q87 A;  2MQH A;  2ZTC A;  3T1Y Q;  5IP9 H;  1PH2 A;  4DV6 Q;  4A3K G;  1OXX K;  3GTL I;  3HOX G;  3CCU A;  4LF5 Q;  2OTJ A;  3PUV A;  2VQE Q;  2V1C C;  1X55 A;  3ULP A;  1CKM A;  4B3M Q;  2OQK A;  1OXV A;  3GTM I;  5C4X I;  1VQ4 A;  1ZB8 A;  3E9I A;  2CFM A;  1XNR L;  3CME A;  4X66 Q;  4NBF A;  5HY6 A;  3A0J A;  3CCQ A;  4OX9 Q;  3M7N A;  2P3Y A;  1A0I A;  4JV5 L;  1HZB A;  4KHP Q;  4DR7 Q;  1HNW Q;  3W1G A;  1M90 C;  1IBK Q;  2WAQ G;  2UXB Q;  3M9B A;  2VS1 A;  4K0K Q;  1N34 L;  3G4S A;  4YHH L;  5IWA L;  4H02 A;  1QVF A;  4JBM A;  3I4N G;  2Q2H A;  4PZ6 A;  3G48 A;  1XMQ Q;  3HOY H;  2KCT A;  4UP8 A;  3IRB A;  4BBR H;  1Z9F A;  1HR0 Q;  4A3F H;  3STB D;  4LFB Q;  4B3T L;  1VQ6 A;  2VZA A;  5GAD C;  4A3K H;  3HOX H;  1PA6 A;  3CC4 A;  4JI8 L;  3S1R H;  4B3R Q;  1X9N A;  3PCO B;  4NXN Q;  2N78 A;  4JI5 Q;  4A76 A;  3GTG H;  4GKK L;  5AJ3 Q;  3HOY I;  2ZJQ A;  1VQ9 A;  2N8N A;  4A3F I;  2AKW B;  1NUI A;  2VUM H;  2DUD A;  4A3K I;  3HOX I;  5FLX c;  4DR4 L;  3PUX A;  3MEF A;  4A3I G;  2JK8 A;  1IL2 A;  3S1R I;  5IY0 A;  3T1H L;  3CQZ H;  3PO3 G;  4X62 L;  1OTC A;  3I55 A;  4LF7 Q;  1PFS A;  3PSI A;  5E7N A;  4JI1 Q;  4Y7N H;  3EIV A;  3M4O H;  3GTG I;  3HFZ B;  2NVX H;  1C0A A;  3I4N H;  1QZH A;  2PI2 A;  1VQJ A;  3GTP H;  4L5R C;  3JAM i;  1PH5 A;  1PH1 A;  5C0X G;  4LUO A;  2A8V A;  2JR6 A;  4LFA Q;  3CQZ I;  3I07 A;  3W1B A;  1J5E L;  2JA7 H;  4Y52 H;  4LUZ A;  3GD7 A;  4MH4 A;  4Y7N I;  3M3Y H;  3HKZ E;  3M4O I;  1VQB A;  1VQI A;  4DV1 L;  1EIY B;  1UE1 A;  4LF4 L;  2NVX I;  2YTV A;  5IT9 c;  1X3E A;  2BJO A;  2ASB A;  3I4N I;  1Q82 C;  4NBA A;  1K3R A;  4DNI A;  3GTP I;  2Z0S A;  4RMF A;  1YBY A;  2K5H A;  4FDB A;  1IYJ B;  2JA7 I;  1L1O A;  4AIM A;  3ESW A;  3PF4 A;  3ULJ A;  1CKN A;  4A3I H;  3M3Y I;  4HIO A;  2UU9 L;  2Q2U A;  3PO3 H;  2YTY A;  4GS3 A;  1B7Y B;  4DV5 Q;  4P71 A;  3SGI A;  1N33 L;  1C9O A;  1VQP A;  1HNX Q;  2BH8 A;  4BY7 G;  3PO2 G;  2OQ0 A;  2J6A A;  1G29 1;  4A3I I;  4DKA C;  4NB9 A;  3PO3 I;  3K81 C;  4GNX A;  2BA0 A;  1A62 A;  2C35 B;  3E0E A;  1CKN B;  1X65 A;  1X3G A;  3K8A A;  5K36 G;  4DK3 C;  1X54 A;  1PH6 A;  5M3M H;  2JNY A;  4POG A;  2CWA A;  4QGU A;  4YY3 Q;  4HJ7 A;  1SE8 A;  2IHF A;  1Y1V S;  4YWL A;  2PQA B;  1VLA A;  2K75 A;  3I7F A;  2F4V Q;  3F1Z A;  4R4T A;  5M5W H;  1HJP A;  1IZ6 A;  1X6O A;  2QGQ A;  1BKB A;  3CCE A;  4GNX B;  2ZJP A;  3VMH A;  3PIP A;  3A5U A;  1WFQ A;  3OTO Q;  4HIK A;  4L5T A;  1USP A;  1Z47 A;  3HKZ G;  1GD7 A;  4BXX H;  2PMZ E;  2UXD Q;  3ER0 A;  4BY7 H;  3PO2 H;  3AFQ A;  2UUA Q;  1EYG A;  1PH3 A;  3UDI A;  2RBL A;  3KDF A;  4JI7 L;  4JBK A;  2ATW A;  1NTG A;  2ES2 A;  4B3S Q;  1WOC A;  4QQB X;  1L1O C;  3S1M H;  1N8R C;  4A3D H;  3S2H I;  3HOU G;  5IE8 A;  1IBM Q;  4APV A;  1VCI A;  3KYH C;  2H5X A;  4JBJ A;  3JC6 6;  4BBS G;  4BXX I;  5LMN Q;  2E2I I;  4DR5 Q;  4BY7 I;  3PO2 I;  4MTN A;  1QUQ A;  3S24 A;  4LF8 Q;  2KCM A;  4KHZ A;  4LFC L;  1USP B;  4GN3 B;  3J7A 5;  1IBL L;  2JA6 G;  1HR0 W;  4L5Q A;  4JG2 A;  2HHH L;  3S1M I;  4A3D I;  4C3J H;  1I3Q H;  4IPD A;  2YU9 H;  5FLM H;  1YJW A;  4DV7 L;  4GNX C;  3G6E A;  4JI0 L;  3U4V A;  3BZK A;  3RN5 A;  1TWC H;  4A3C G;  1SFO H;  4OO1 I;  1UE6 A;  3S1N H;  4ME3 A;  4R1J A;  4UP7 A;  3GTQ H;  4HID A;  4GOP A;  3CCL A;  2K52 A;  1I3Q I;  2YU9 I;  4JYA L;  5FLM I;  1XNR Q;  2KEN A;  4LWC A;  3HOU H;  1GKH A;  3K7A H;  1YHQ A;  1TWC I;  1UWV A;  1SFO I;  1Q8K A;  5C4X H;  1WCM H;  5J3B A;  1NJI C;  4BBS H;  3J80 i;  2L15 A;  3GTQ I;  5EAY A;  1RIP A;  3CPW A;  2ZJR A;  4OWW B;  1YEZ A;  2YTX A;  3CCS A;  4P73 A;  2IT1 A;  4XTC S;  3S17 H;  1N34 Q;  5IWA Q;  4GOP B;  1TFI A;  1I6H I;  3F2C A;  3HOU I;  4LF9 L;  2ID0 A;  3K7A I;  3S1Q H;  3CCM A;  3HOZ G;  1WCM I;  4A3L H;  4BBS I;  4WJ4 A;  3PUZ A;  3H3V H;  3H0G H;  3S15 H;  4A3C H;  4B3T Q;  4NBE A;  2HIX A;  4JI8 Q;  3HOW G;  3F2B A;  3S17 I;  2JA5 G;  1JJC B;  5GAH C;  4R4I A;  3H3V J;  2XGT A;  4WJ3 M;  4A3J G;  3S1Q I;  2OWO A;  4A3L I;  2CQO A;  2JEA I;  4DK6 C;  1D8L A;  1BBU A;  2DE5 A;  3H3V I;  3HKS A;  2NZO A;  2R6G A;  3H0G I;  3S15 I;  1PYB A;  4A3C I;  4AYB E;  3RLO A;  2CCZ A;  1OXU A;  4EQ5 A;  4KI0 A;  4LF6 L;  1UE5 A;  1FJG L;  4JC0 A;  2FXQ A;  2Q2I A;  1JMC A;  3DLL A;  3CC7 A;  1T9H A;  1WI5 A;  1VQ7 A;  3I2Z A;  1HNZ L;  1KRS A;  1RLY A;  1MIU A;  4X62 Q;  1YJ9 A;  5GQO A;  2LXK A;  4EX5 A;  2VQF L;  3W5O A;  1S3O A;  4X6A I;  1CSP A;  4R4C A;  3CXC A;  5DLQ E;  1P16 A;  4GOP C;  3KFU A;  3HOZ H;  3RNU A;  3K80 C;  1JT8 A;  1WW9 A;  3PUW A;  4P72 A;  1VQ5 A;  4OXP A;  4X64 Q;  1J5E Q;  4HIM A;  4DV2 L;  1YHA A;  4JBW A;  3CCJ A;  1X3F A;  2PI2 E;  3ZJY C;  4DV1 Q;  4OWX B;  2VY3 A;  4LF4 Q;  1K8G A;  4NPS A;  4A3J H;  1PV4 A;  2KBN A;  3HOZ I;  3TQY A;  3CW2 C;  4NBC A;  5FJ8 G;  4DR1 L;  4LFB L;  1SRU A;  3AQQ A;  3CPF A;  2ZM6 L;  5M3F G;  3ICE A;  1YIT A;  1VQM A;  4YWK A;  2GVB A;  3HOW I;  2UU9 Q;  2JA5 I;  3M85 A;  3MXN B;  4B3R L;  2CKZ B;  4AQY Q;  1Q12 A;  4JI2 L;  5IYB G;  4NBD A;  4A3J I;  2JJQ A;  5M5X H;  1KHI A;  3ULL A;  1N33 Q;  1A8V A;  5ELO A;  2AMC B;  1E24 A;  2JS4 A;  3DM3 A;  3UDG A;  5C44 G;  1KD1 C;  1BBW A;  3Q8D A;  4JOI C;  4NXM Q;  3L7Z C;  1N9W A;  1SRO A;  4YCW A;  3OW2 A;  1X3Z A;  2E2H H;  4YCU A;  2K5V A;  4DR3 Q;  2QEX A;  4JI4 Q;  2Q2T A;  5LMU L;  3BU2 A;  4AH6 A;  3LGJ A;  5FJ8 H;  1VQL A;  1VQF A;  4DR6 L;  5H1S E;  5M3F H;  1NBW A;  1N36 L;  1HZC A;  2PQA A;  3I56 A;  3KF8 B;  3J81 j;  3PV0 A;  2A19 A;  4DUZ L;  4IJL A;  5IP7 G;  4QIW E;  1D7Q A;  2AHO B;  2E2H I;  1YJN A;  4ALP A;  3TRE A;  3GDE A;  1EOV A;  4UP9 A;  2RHQ B;  2E5L L;  5GAG C;  1Y1V G;  3S16 H;  1PYS B;  2EQS A;  4DV4 L;  2WP8 J;  4OON A;  1TWH H;  3U58 A;  3CD6 A;  1E3P A;  5C0X J;  3S14 H;  1KRT A;  4X65 L;  2Z6K C;  2K5R A;  1HZA A;  1SR3 A;  5JJI A;  4NB8 A;  5C0X I;  2WFW A;  2D0P A;  4GLA C;  4HJ8 A;  4JI7 Q;  1PH7 A;  2OCE A;  2Y0S E;  3J80 c;  5BR8 L;  1E7Z A;  2DE6 A;  1QYP A;  3S16 I;  2EXD A;  4DR2 L;  1LUZ A;  1G51 A;  2K14 A;  1B70 B;  2HT1 A;  1TWA I;  1VQE A;  3CCV A;  4BA1 I;  4J15 A;  2HIV A;  3HOV G;  3A5Z B;  1TWH I;  3S14 I;  3KJO A;  3S2H H;  1VS0 A;  1N32 L;  1MKH A;  1I50 H;  2R7Z G;  4LFC Q;  1VQH A;  1O7I A;  1IBL Q;  2E2I H;  1SN8 A;  3GO5 A;  1E1O A;  3M4P A;  2B63 G;  4GKJ L;  5IP7 H;  1YIJ A;  1EUJ A;  1XPU A;  2HHH Q;  1XJV A;  1S40 A;  1UEB A;  1HZ9 A;  4JCV E;  3D6W A;  1Y1V H;  4DV0 L;  4DV7 Q;  1KL9 A;  1L0W A;  4YY3 L;  1I50 I;  1AE3 A;  1I5F A;  3G71 A;  1GO3 E;  2PNH A;  2PK7 A;  4A4I A;  1LTL A;  1ASZ A;  2DGY A;  4A3B G;  5IP7 I;  3KOJ A;  3S2D H;  4GLX A;  3L0O A;  3TRZ A;  1V43 A;  1C7Y A;  4JYA Q;  3U4Z A;  1Y1V I;  2WAQ E;  1I94 L;  2KPI A;  2ZTE A;  1S72 A;  4QL5 A;  1AH9 A;  2XTI A;  5IP9 G;  3HOV H;  2QA4 A;  2NVT H;  5GRO A;  4DUY L;  3F8T A;  2K5N A;  5GAE C;  2UUA L;  2R7Z H;  1DL6 A;  3GTM S;  1VQN A;  4IO9 A;  3S2D I;  3TEH B;  1U5K A;  1KC8 C;  2B63 H;  3CCR A;  3RLN A;  3AEV A;  2R7F A;  1RL2 A;  1L2F A;  1K9M C;  4JI3 L;  5HGQ A;  3K0X A;  3PGZ A;  4LF9 Q;  1K0R A;  5JJK A;  3EER A;  3HOV I;  1GVP A;  4DR5 L;  2NVT I;  4NB3 A;  1I6H H;  4A75 A;  2Y0S G;  4LF8 L;  3GTJ I;  2R7Z I;  4GLV B;  3UE1 A;  4P75 A;  1NMG A;  1JJ2 A;  4JV5 Q;  1LM0 A;  5M5Y H;  2N3S A;  4DV3 L;  2I0Q A;  1JJG A;  2B63 I;  4A3B H;  4C3H H;  1SMX A;  4R4O A;  3UDF A;  4NBH A;  4KLK A;  3GTK H;  1XTD A;  1CSQ A;  1GM5 A;  4JI6 L;  3J81 i;  2JA6 H;  1EFW A;  1XMO L;  3NEL A;  3JAM c;  2RCN A;  4BBR G;  4NBB A;  4YHH Q;  4A3F G;  3GKQ A;  3I4M G;  2IY5 B;  1W2B A;  2ALY B;  4QY7 A;  1TXY A;  2OTL A;  2JQO A;  2NVQ H;  2JA9 A;  4LF6 Q;  1K8A C;  1FJG Q;  4A3B I;  1CKO A;  2I5H A;  4A3M G;  1X56 A;  1HNZ Q;  3B6Y A;  3GTK I;  2UUB L;  2VQF Q;  2NN6 G;  2JA6 I;  2JE6 I;  1SLJ A;  1E22 A;  5CM2 M;  2EIF A;  2NZH A;  4JOI A;  1XNQ L;  4A3G G;  3E9H A;  5IP9 I;  2VUM G;  3NBH B;  2UXC L;  2NVY H;  4GKK Q;  4X6A H;  2UUC L;  3BZC A;  1FL0 A;  2NVQ I;  1EWI A;  3AYH B;  4POF A;  2IHE A;  4DAM A;  3T1Y L;  3D31 A;  1EIF A;  3UE0 A;  4DV6 L;  2F4O A;  1KAW A;  4L5S A;  4DV2 Q;  1Y1W G;  4DR4 Q;  4LNQ A;  4LF5 L;  3T1H Q;  2VQE L;  4IPC A;  2F4M A;  2IX0 A;  1MJE A;  4R4Q A;  4B3M L;  1M1K C;  4XX2 A;  2CWP A;  2NVY I;  1Q1B A;  3UDX A;  4X66 L;  4DR1 Q;  4NBG A;  3A74 A;  3RLF A;  3GTO H;  1E1T A;  1A63 A;  2K4K A;  2ZM6 Q;  1RO4 A;  2JA7 G;  4OX9 L;  3I4M H;  1PHJ A;  2WB1 E;  1NY4 A;  1CUK A;  4KHP L;  1PH9 A;  2MNA A;  4DR7 L;  4IPH A;  1VQA A;  1HNW L;  4MNO A;  1R9T H;  2B3G A;  4A3M H;  3TS2 A;  2MO0 A;  3D0F A;  1IBK L;  4JI2 Q;  2N49 A;  1H95 A;  2UXB L;  4K0K L;  5C3E G;  3HOW H;  2JA5 H;  4BBR I;  3GTO I;  2DE7 A;  4A3G H;  2VNU D;  2Z6K A;  3I4M I;  1QVG A;  1XMQ L;  2YV5 A;  1Q7Y C;  1YI2 A;  1HR0 L;  1R9T I;  1PH8 A;  3FHW A;  1JE5 A;  4A3M I;  1J6Q A;  4BA2 I;  1HH2 P;  2F52 A;  4IPG A;  1U0L A;  1DGS A;  4DPG A;  5JEA G;  3VMG A;  1Y1W H;  2NN6 I;  2HF1 A;  2K50 A;  4C2M H;  2KHI A;  4OWT B;  1OXT A;  2VW9 A;  1VQK A;  4NXN L;  1ML8 A;  4PG3 A;  1YHB A;  5LMU Q;  4JI5 L;  4A3G I;  1LQL A;  1Q81 C;  2VUM I;  1UE7 A;  5AJ3 L;  1LYL A;  1YZ6 A;  2RF4 A;  4LW1 A;  3PO3 S;  3FP9 A;  4IOC A;  4DR6 Q;  4X64 L;  1FGU A;  1N36 Q;  3PF5 A;  4DUZ Q;  1P8L A;  1V9P A;  3GCF A;  1Y1W I;  5C4J H;  1WYD A;  5ELN A;  3K7U C;  5LMN W;  3F2D A;  2GVA A;  2E5L Q;  4BY1 G;  4LF7 L;  3CMA A;  4LUV A;  4JI1 L;  4QJF A;  3BJU A;  2R93 G;  1WJJ A;  5C3E H;  4AYB G;  4NOZ A;  2D62 A;  5M3M G;  1VQC A;  2AWN A;  2I5L X;  4TVA B;  4DV4 Q;  2JEB I;  4O2D A;  4PZ8 A;  4QTU A;  4X65 Q;  4Y52 I;  2MFI A;  5C4J I;  2E8G A;  4AQY L;  1Q1E A;  4LFA L;  2R92 G;  1NE3 A;  4A93 G;  4GN4 B;  2A1A A;  5BR8 Q;  3CP0 A;  4TQU S;  3I4O A;  4A3E G;  1KQS A;  1QVC A;  4IFD G;  1ZB9 A;  2LSS A;  5C3E I;  4DR2 Q;  3PUY A;  2WB1 G;  3STB C;  1X3W A;  1TWG H;  2F3I A;  4HJA A;  4BXX G;  3NEM A;  4UPA A;  5IYB H;  2R7D A;  4GN5 A;  3OYY A;  3RZD H;  1N32 Q;  4NXM L;  2JA8 G;  1TWA H;  1YVC A;  2GN5 A;  1FVI A;  1PFT A;  5JEA J;  3VB9 A;  3H15 A;  2IX1 A;  1OXS C;  1L1O B;  5C44 H;  4GKJ Q;  3TS0 A;  2I5M X;  4IOA A;  4A3D G;  4DAY B;  2AKL A;  3WWV A;  4DR3 L;  3M4Q A;  1VQG A;  2BH2 A;  4BY1 H;  4DV5 L;  1TWG I;  4QTT A;  4JI4 L;  1BVS A;  1KXL A;  4HJ9 A;  4DV0 Q;  1K73 C;  1IXR A;  2R93 H;  2RHS B;  1JB7 A;  1W3S A;  3RR5 A;  3RZD I;  1XPR A;  4OO1 G;  5IYD G;  3J7Z C;  1V1Q A;  1Q86 C;  5IYC G;  3FKI G;  2B29 A;  1HNX L;  3RN2 A;  3J81 c;  2HQL A;  5C44 I;  3VDY A;  1VQO A;  4YWM A;  2R92 H;  1NMF A;  3CAM A;  5FLM G;  1KIX A;  4A93 H;  3KJP A;  2YYZ A;  3ERS X;  4BY1 I;  4IJH A;  4P74 A;  4UY8 C;  4A3E H;  1I94 Q;  2KHJ A;  2R93 I;  2VL6 A;  4XIG S;  3RZO H;  1G6P A;  3KLW A;  1QZG A;  1K83 H;  4DUY Q;  1VQ8 A;  4JI0 Q;  2JA8 H;  4IFD J;  2R92 I;  1N2F A;  4HJ5 A;  4A93 I;  4YCV A;  4A3E I;  3CF5 A;  2ZTD A;  3KF6 A;  4IFD I;  2F4V L;  4JI3 Q;  2AWO A;  1B8A A;  5C4X G;  1WCM G;  3RZO I;  5JJL A;  1K83 I;  3OTO L;  3CC2 A;  2BA1 A;  4RG1 A;  3EBE A;  5IYD H;  1AE2 A;  4MZ9 A;  3LUS A;  5IYC H;  3FKI H;  2JA8 I;  1VQD A;  4PZ7 A;  2UXD L;  1TWF H; 
#chains in the Genus database with same CATH topology
 1B2T A;  4DV3 Q;  4K6D A;  3LWE A;  1EY0 A;  1LTG D;  4C1N K;  1WJ2 A;  3GTJ H;  1STG A;  1TU2 B;  1Y14 B;  4PMW A;  1YUA A;  1QVG Y;  3R2T A;  1D5Z C;  1XPO A;  4C3I H;  1PH4 A;  2KVM A;  2E2J H;  3KDF B;  1Q7Y 1;  4UAI A;  4JI6 Q;  4A3L G;  2MO1 A;  4B3S L;  4XQN A;  1XMO Q;  4DU9 A;  3L2P A;  4O0A A;  4BBR B;  1YNX A;  1LTI D;  1SE4 A;  1LTR D;  3VTN A;  1CT1 D;  2RDF A;  3H0G G;  4A3F B;  3KF6 B;  3GTO B;  1Q46 A;  1IBM L;  2Q8R E;  3QG1 A;  3E5S A;  1EQQ A;  3OIP A;  2AUJ D;  3CCU 1;  3FKI I;  1TY2 A;  2AQ1 B;  2RDG A;  3I4M B;  2CW0 D;  5LMN L;  1PVO A;  3U50 C;  1TWF I;  1LTT D;  4DK1 A;  3S1R B;  3VMI A;  1R9T B;  3Q6S A;  5EPK A;  1EQR A;  3T53 B;  2K7V A;  4FXK C;  4CKC A;  1QUQ B;  4ZLT F;  1UNS A;  1H9S B;  3LWU A;  4A3M B;  2D0O A;  3FQQ A;  1SEB D;  4FF2 A;  3GTL H;  1ASY A;  2F0L A;  3EN2 A;  2UUB Q;  3AFP A;  2E2J I;  3I55 Z;  5FLX f;  4IUT A;  1MJC A;  4DXF A;  2YAD A;  2LXJ A;  3GTG B;  4TNU A;  2EE1 A;  2R61 A;  3NEN A;  1YNN D;  3RUZ A;  1X32 A;  1SMY C;  1D5X C;  2KOL A;  4CBV A;  3CCQ 1;  5COY A;  1EY8 A;  3GTM H;  5DM6 3;  2VF1 A;  1XNQ Q;  4A3G B;  3PIO A;  3S1N I;  1HUM A;  1LT5 D;  4G7H C;  2VUM B;  1QOH A;  2UXC Q;  1SYB A;  3E0J A;  3HOY G;  3DEP A;  2UUC Q;  3KIH A;  3Q87 A;  5LL6 S;  2MQH A;  1Q82 1;  4RCO A;  2ZTC A;  3MWY W;  5ELB A;  3T1Y Q;  3NHH A;  3P75 A;  1ZYR D;  3KLS X;  3OW7 A;  2O5I C;  1BUV T;  4MHE A;  5IP9 H;  1PH2 A;  4DV6 Q;  1AN8 A;  4A3K G;  1OXX K;  3GTL I;  3HOX G;  3CCU A;  1ET9 A;  1EY9 A;  2EJM A;  2L12 A;  3NK9 A;  1Y1W B;  3G4S 1;  1KLU D;  5KIX A;  4LF5 Q;  1BQQ T;  2OTJ A;  3PUV A;  2VQE Q;  2V1C C;  1X55 A;  1CHQ D;  3A8K E;  2SEB D;  3ULP A;  1CKM A;  3GV3 A;  4B3M Q;  2OQK A;  1OXV A;  3GTM I;  5C4X I;  1VQ4 A;  3GTP B;  1ZB8 A;  2QKI C;  3DWP A;  1ZEQ X;  4CL1 A;  3E9I A;  4J1M A;  1JR0 D;  1KLG D;  5LHY 1;  5EBC A;  4RH6 A;  2CFM A;  5NUC A;  1EFI D;  1XNR L;  3VR6 A;  1TS5 A;  3CME A;  4X66 Q;  1ENF A;  5IT9 f;  4UDU C;  4K2L A;  3J80 E;  1VQ6 1;  4Q0F A;  4NBF A;  1B3A A;  1CA5 A;  1XXG A;  5HY6 A;  4ABN A;  3A0J A;  3CCQ A;  2JA7 B;  3BG0 B;  4OX9 Q;  4R8N A;  2PZU A;  1KQS Y;  3M7N A;  2P3Y A;  1A0I A;  4JV5 L;  2R3Z A;  2LFU A;  1HZB A;  5FOB B;  4KHP Q;  3V05 A;  1SIW A;  1KNA A;  3M3Y B;  1AEX A;  4DR7 Q;  4IZ8 A;  1HNW Q;  2BDN A;  3W1G A;  5A35 A;  5C4J B;  2IL8 A;  3MA2 B;  2XRS D;  4E30 A;  4DQY B;  3AB9 A;  5EPL A;  1M90 C;  1IBK Q;  2WAQ G;  2UXB Q;  4DGZ A;  4I7Z C;  3D8G A;  3M9B A;  4ZYS A;  5IGC A;  3C1E A;  2VS1 A;  4B9W A;  4K0K Q;  5C3E B;  5ELF A;  4OL7 A;  1N34 L;  3G4S A;  4O42 A;  5D65 A;  4YHH L;  1DXM A;  4K5X A;  5IWA L;  4H02 A;  1QVF A;  1FDI A;  4GZY C;  4JBM A;  1STN A;  1VQP Z;  4J8Q A;  3I4N G;  2Q2H A;  1RDP D;  4PZ6 A;  3G48 A;  1RNI A;  1XMQ Q;  2EYO A;  2Z9H A;  3HOY H;  2KCT A;  1U4P A;  4UP8 A;  3IRB A;  4BBR H;  1Z9F A;  2RIQ A;  3F3P C;  2X69 A;  2F0J A;  1HR0 Q;  4A3F H;  3STB D;  1SND A;  5HUR A;  4LFB Q;  3IAY A;  4B3T L;  3I55 1;  2G2K A;  1VQ6 A;  2VZA A;  5GAD C;  3A7L A;  4A3K H;  1TS3 A;  3HOX H;  1PA6 A;  1Q86 1;  3BG1 B;  3CC4 A;  4JI8 L;  2PNR C;  4ULL A;  4AYB A;  1PRT D;  3L3O C;  4RHR A;  2RVL A;  3S1R H;  2DJG C;  4KK7 A;  2RPR A;  4DXG A;  4E6I A;  3OMG A;  4FO2 A;  2K01 A;  4B3R Q;  1X9N A;  1TWG B;  2FHT A;  3PCO B;  4NXN Q;  2PCF B;  4R8I A;  2N78 A;  4JI5 Q;  4A76 A;  1TS2 A;  2F3V A;  2NN6 H;  3GTG H;  4K5W A;  4F8M A;  5JJZ A;  4GKK L;  1LAB A;  5AJ3 Q;  3VYT A;  3C1F A;  3MXG A;  3RZD B;  3BDO A;  3HOY I;  2ZJQ A;  5CV8 A;  1VQ9 A;  2N8N A;  2OOY B;  3SE0 A;  2F0E A;  2VPZ A;  4A3F I;  2MPM A;  2AKW B;  1NUI A;  3KLS A;  3X3N A;  2VUM H;  1IL8 A;  2DUD A;  5C44 B;  4A3K I;  4C56 C;  3HOX I;  4EQO A;  1KC8 2;  5FLX c;  4DR4 L;  3PUX A;  3MEF A;  3URY A;  1EYA A;  4A3I G;  2JK8 A;  1IL2 A;  2WB1 A;  3S1R I;  1HXY D;  2LMC B;  3IFT A;  3Q22 A;  5IY0 A;  3T1H L;  3CQZ H;  1LT6 D;  3PO3 G;  2RQX A;  4CDC C;  2I3C A;  5T6B A;  4FP5 D;  4X62 L;  3IL8 A;  3KIF A;  1OTC A;  1Z7T A;  3I55 A;  4BY1 B;  4LF7 Q;  1PFS A;  3PSI A;  3CCE Z;  4UHV A;  5E7N A;  4JI1 Q;  3NH8 A;  4Y7N H;  3EIV A;  3M4O H;  2R93 B;  3SK6 A;  4AYB B;  3GTG I;  4V19 0;  2ZT9 C;  5M3M B;  3HFZ B;  5CV6 A;  5FK9 C;  2NVX H;  1C0A A;  1ET6 A;  2EYP A;  3NWS A;  4XYQ A;  2X6G A;  1BOS A;  2SDF A;  3I4N H;  3T16 A;  1TII D;  1HA5 A;  1QZH A;  1N8R 1;  2M48 A;  2PI2 A;  1PRT B;  3PIP 3;  1VQJ A;  1SJE D;  2KA7 A;  3GTP H;  2DY8 A;  1DOM A;  4L5R C;  3JAM b;  1I4H A;  2L4N A;  3DM1 A;  1Q8I A;  3JAM i;  3MC0 B;  3H09 A;  1PH1 A;  5IGE A;  1PH5 A;  5C0X G;  4LUO A;  1D2B A;  2A8V A;  3IX0 A;  2JR6 A;  3A54 A;  4XXE A;  5M5W B;  4LFA Q;  3CQZ I;  3I07 A;  3W1B A;  1J5E L;  2JA7 H;  2R92 B;  4A93 B;  1AZQ A;  2E74 C;  2K5W A;  4Y52 H;  4ZRZ A;  2Q8I B;  1FNV A;  4LUZ A;  3GD7 A;  4A3E B;  3W3A A;  5E1F A;  4MH4 A;  4Y7N I;  3M3Y H;  3HKZ E;  5ELD A;  3M4O I;  3FPU B;  4ZUI A;  1VQB A;  1KAA A;  1VQI A;  3HZX A;  4DV1 L;  3K6O A;  4RHS A;  1EIY B;  1VQP 1;  1UE1 A;  2QIL A;  2WB1 B;  4LF4 L;  2NVX I;  2YTV A;  5IT9 c;  1X3E A;  2BJO A;  1TQO A;  2ASB A;  1FR3 A;  3J7A 4;  3I4N I;  1Q82 C;  4NBA A;  1K3R A;  4K5V A;  4DNI A;  3GTP I;  2Z0S A;  1K83 B;  1F9S A;  5CV7 A;  1G2T A;  4RMF A;  1QWY A;  1K8A 2;  2JA8 B;  3CC2 Z;  2KJX A;  3SDZ A;  1YBY A;  1V8Q A;  1H9M A;  1B44 D;  2K5H A;  4FDB A;  1IYJ B;  3JAM E;  5KEE A;  4PV1 C;  2JA7 I;  1L1O A;  4AIM A;  1K8O A;  3ESW A;  4CJ1 B;  1QE6 A;  2RHB A;  3PF4 A;  3ULJ A;  1CKN A;  4HCS A;  4A3D B;  4A3I H;  3IKJ A;  3M3Y I;  4HIO A;  2UU9 L;  5KYI A;  2Q2U A;  3PO3 H;  2YTY A;  4GS3 A;  1B7Y B;  1KTK A;  2KQ3 A;  3NDJ A;  5JVG 3;  1F77 A;  4DV5 Q;  4P71 A;  2D5D A;  3SGI A;  5HGT A;  1K3B C;  5M9O A;  2F1M A;  1N33 L;  1G91 A;  3EED A;  3G6E Z;  1C9O A;  2JIM A;  1JJ2 Y;  2RBM A;  3FKI B;  1VQP A;  5J39 A;  1HNX Q;  5CBE E;  3A55 A;  5DNF A;  2VXW A;  2B8F A;  1U4L A;  2BH8 A;  4DAV A;  1Y8P B;  2B2Y A;  4BY7 G;  1DYQ A;  1PRT C;  3PO2 G;  1WVL A;  5I9P A;  2OQ0 A;  2BDO A;  2J6A A;  5KNB A;  1G29 1;  3QOL A;  4A3I I;  4DKA C;  2QR1 B;  1I3Q B;  3CCE 1;  4C3I B;  4NB9 A;  2E2J B;  3PO3 I;  4RKL A;  3K81 C;  4GNX A;  2BA0 A;  3J80 L;  1A62 A;  5T67 A;  2XSC A;  4F87 A;  2C35 B;  1M1K 2;  1S4Z A;  3E0E A;  4DA2 A;  4RA8 A;  5EKK A;  1CKN B;  1X65 A;  4KJN A;  1PTO B;  5C3W A;  1TWC B;  1X3G A;  3K8A A;  2VB3 X;  4IUU A;  1PDQ A;  5EPJ A;  3S1N B;  5T64 A;  3TP5 A;  4RVH A;  2L11 A;  5K36 G;  2Z4H A;  1E0B A;  4DK3 C;  2KEE A;  2XWB B;  3GTQ B;  2F0W A;  4HSV A;  1X54 A;  1PH6 A;  5M3M H;  2JNY A;  4POG A;  2CWA A;  1SJH D;  1MGS A;  1VF7 A;  1Y8C A;  4YY3 Q;  4QGU A;  4HJ7 A;  3PQI A;  2O4H A;  4MD7 A;  1SE8 A;  2IHF A;  5EBD A;  2Z6B A;  3GTL B;  1Y1V S;  1ML0 D;  1VDZ A;  4TSS A;  4YWL A;  2PQA B;  1F2Y A;  2F0N A;  3Q24 A;  1VLA A;  2K75 A;  4ODG A;  3I7F A;  1K8M A;  1JQY D;  4CHT B;  1SYD A;  1EY4 A;  2NYZ D;  2F4V Q;  2PM9 A;  2OTJ Z;  1MHW C;  5IIF A;  1QG7 A;  3D2L A;  1ESR A;  3F1Z A;  4R4T A;  2F4I A;  5M5W H;  1HJP A;  1IZ6 A;  1X6O A;  2EY6 A;  2QGQ A;  1BKB A;  3GTM B;  5C4X B;  1WCM B;  3CCE A;  4GNX B;  3CCM Z;  3F3F C;  1ZH1 A;  2A68 C;  2L55 A;  1DOK A;  1STY A;  4H13 C;  1VQ4 Z;  3VMH A;  3PIP A;  4JW0 A;  3A5U A;  1M90 1;  1F9Q A;  1M8A A;  3G6J B;  3J7Y W;  1WTV A;  1EYD A;  1WFQ A;  4V0B A;  3OTO Q;  3CME Z;  4HIK A;  1Q7Y 2;  3QR8 A;  3DXJ C;  4L5T A;  1USP A;  4NW2 A;  3ND8 A;  1Z47 A;  3CCQ Z;  3HKZ G;  1GD7 A;  5JAV A;  4BXX H;  3K5N A;  2PMZ E;  1HFG A;  3SK5 A;  2QDL A;  2UXD Q;  3ER0 A;  3OSO A;  5A2Q b;  4BY7 H;  3NP8 A;  1S5D D;  1QVF Y;  3PO2 H;  4E2X A;  1KDC A;  3NE5 B;  3AFQ A;  4FXG C;  2UUA Q;  3A8J E;  1IYU A;  1EYG A;  1UAP A;  4E32 A;  3VA7 A;  4EGV A;  3UDI A;  1PH3 A;  2RBL A;  3KDF A;  4JI7 L;  4JBK A;  3S1Q B;  1EIG A;  2ATW A;  2ZAE B;  3FPP A;  1NTG A;  4IQZ A;  2ES2 A;  4B3S Q;  2HDL A;  1WOC A;  3G6E 1;  1Q81 2;  4QQB X;  5D1P A;  1L1O C;  3S1M H;  1N8R C;  4A3D H;  1C48 A;  3S2H I;  1TT2 A;  3G4S Z;  3HOU G;  3EA6 A;  1EOT A;  5IE8 A;  4IN3 A;  2DNC A;  4HAE A;  1IBM Q;  1II3 A;  4APV A;  1VCI A;  4XT1 B;  4KMU C;  3NWT A;  1S5F D;  2IZ3 A;  3KYH C;  2H5X A;  4KN4 C;  4JBJ A;  3JC6 6;  4BBS G;  1JOQ A;  5K36 H;  5ISR A;  4BXX I;  1L0Y B;  2V8I A;  3KLR A;  2E2I I;  1QNU A;  4YIJ A;  5LMN Q;  4DR5 Q;  3NPP A;  1G8Z D;  4BY7 I;  4C3H G;  3PO2 I;  2FMM A;  1GUT A;  1QUQ A;  4MTN A;  3S24 A;  4LF8 Q;  4OO1 H;  2V4D A;  5CC4 A;  2KCM A;  1X0T A;  4EQN A;  1H9K A;  1VQ7 Z;  4KHZ A;  4LFC L;  2E76 C;  2OOX B;  1USP B;  4GN3 B;  4PMB A;  1VQ6 Z;  3J7A 5;  1IBL L;  3EFX D;  4IUN A;  4XQQ A;  2JA6 G;  1HR0 W;  1PYW D;  3CC4 Z;  1LV9 A;  4L5Q A;  2NVX B;  4JG2 A;  4EQP A;  2B2Y C;  2HHH L;  3S1M I;  4A3D I;  4C3J H;  3A56 A;  4LAA A;  5D1O B;  3TZU A;  1I3Q H;  4IPD A;  5IOC A;  1B9N A;  2YU9 H;  2B2T A;  3BYY B;  5FLM H;  3QO2 A;  1YJW A;  1EY6 A;  4DV7 L;  2QW7 A;  4P2C B;  4GNX C;  3HOY B;  2HU9 A;  2Z4I A;  1V1P A;  5IT9 E;  3G6E A;  4JI0 L;  3U4V A;  1W6K A;  2EYM A;  4NDX A;  3BZK A;  3RN5 A;  1VQ9 Z;  1PTO H;  1TWC H;  4A3C G;  1HPC A;  1SFO H;  4OO1 I;  3TSS A;  2WAQ A;  1UE6 A;  3SR1 A;  1DON A;  3S1N H;  2ICE C;  4BWG B;  4ZCK A;  4ME3 A;  4A3K B;  3HOX B;  4RFB A;  2CHB D;  3I73 A;  4R1J A;  4UP7 A;  3GTQ H;  3MVV A;  2H85 A;  4HID A;  2OTJ 1;  2K03 A;  2OEO A;  4GOP A;  1ILQ A;  3CCL A;  2K52 A;  3IR7 A;  2N88 A;  2RA4 A;  3CCM 1;  3WOF A;  3KUP A;  1I3Q I;  1VQ4 1;  2YU9 I;  2K5Q A;  4JYA L;  5FLM I;  3VR5 A;  3JAM L;  3E3X A;  3CME 1;  3QWU A;  3CKI B;  1XNR Q;  3K5L A;  2KEN A;  4LWC A;  4XDX A;  3HOU H;  5T1I A;  4FF4 A;  1GKH A;  3K7A H;  2XVS A;  2HDM A;  2EOT A;  4ILW A;  1YHQ A;  1TWC I;  1UWV A;  1CA6 A;  1SFO I;  3J80 b;  1Q8K A;  1TKW B;  5C4X H;  1WCM H;  5J3B A;  1E2Z A;  1NJI C;  4BBS H;  3J80 i;  5DAU A;  3A7A B;  3DWQ A;  1YIT Z;  2L15 A;  3GTQ I;  2X6L A;  1VQM Z;  1V1P B;  2NWG A;  2RKS A;  3HS0 C;  3D3R A;  5EAY A;  4L6T B;  3CQZ B;  1RIP A;  3CPW A;  1PZK D;  2WAQ B;  2ZJR A;  4OWW B;  4F88 A;  5D3I B;  2P28 A;  4HTH A;  2PZT A;  1YEZ A;  2YTX A;  4P73 A;  3CCS A;  2IT1 A;  5I4D A;  4Y7N B;  4XTC S;  3M4O B;  3NFZ A;  1K73 2;  5FO8 B;  3S17 H;  1N34 Q;  1XWE A;  2K1B A;  2JXM B;  2MJ8 A;  4X3K A;  5IWA Q;  1TFI A;  4HGY A;  4GOP B;  1I6H I;  1F9R A;  2RSO A;  3HOU I;  1FGB D;  4N8X 1;  3F2C A;  4LF9 L;  2EY5 A;  4L8J A;  1MD2 D;  2ID0 A;  3K7A I;  3I4N B;  3S1Q H;  3CCM A;  3HRZ C;  1MSG A;  3HOZ G;  1WCM I;  3J7A F;  4A3L H;  4BBS I;  3Q0A A;  2LKV A;  2EYH A;  4WJ4 A;  3PUZ A;  1I4Q A;  3H3V H;  3M7G A;  1VQ7 1;  3H6M A;  1L0X B;  4XYO A;  3H0G H;  3S15 H;  4A3C H;  1CQF A;  5EQ0 A;  4B3T Q;  4NBE A;  5J22 A;  1GJX A;  2HIX A;  3CC4 1;  1FYC A;  3IF8 A;  2JSO A;  3KBG A;  3NTI A;  3I8Z A;  4RCN A;  4CDE C;  2OT2 A;  4JI8 Q;  2NTT A;  2IJ0 A;  4KY7 A;  5M5X B;  3HOW G;  3F2B A;  1H9J A;  3S17 I;  2SOB A;  1I4R A;  2JA5 G;  2TMP A;  1JJC B;  4RVD A;  4ID6 A;  3J81 E;  5GAH C;  2KHS A;  1WD1 A;  4R4I A;  3H3V J;  2XGT A;  4WJ3 M;  3TZD A;  3FEW X;  5E4W C;  1E2V A;  2EJF C;  4A3J G;  3S1Q I;  2OWO A;  4DNR B;  1DJR D;  3C2P A;  2NAP A;  4A3L I;  2CQO A;  5JPM C;  1VQ9 1;  2JEA I;  4DK6 C;  2LY7 A;  1D8L A;  4U68 A;  1BBU A;  4FYD A;  2DE5 A;  3T51 B;  3H3V I;  4OEL B;  2WV6 D;  1VQ5 1;  2EYL A;  3D4D A;  3HKS A;  1VQL Z;  2B2W A;  2NZO A;  2R6G A;  2GTI A;  3H0G I;  3S15 I;  1PYB A;  4QCL A;  3BYT B;  4A3C I;  4K8I A;  2F0Q A;  4AYB E;  3T4N B;  4DAP A;  3RLO A;  1EZ8 A;  1YUK A;  3I70 A;  1LLR D;  1OO9 B;  3BDC A;  2CCZ A;  2B2T C;  1HQR D;  1OXU A;  4EQ5 A;  1A2T A;  4KI0 A;  4WJW A;  4LF6 L;  1UE5 A;  1A2U A;  3C3L A;  4JC0 A;  1FJG L;  4A3I B;  3TE5 B;  2FXQ A;  2Q2I A;  1JMC A;  3DLL A;  3CC7 A;  1T9H A;  1WI5 A;  1VQ7 A;  2KI7 B;  3PO3 B;  3I2Z A;  1HNZ L;  1KRS A;  1RLY A;  1C8C A;  1CK1 A;  1F2Z A;  1MIU A;  2JIO A;  2KCN A;  4X62 Q;  1YJ9 A;  2O53 A;  5GQO A;  2LXK A;  4WOR A;  5E3F A;  1PZJ D;  4WFN 3;  2E7Z A;  4B9X A;  4EX5 A;  2VQF L;  3O13 A;  1IKM A;  3W5O A;  1S3O A;  2VPX A;  1GUS A;  2MUY A;  5CV5 A;  4X6A I;  3EJI A;  1H9R A;  3CRL C;  1CSP A;  4R4C A;  2DN8 A;  3P1H A;  2HD3 A;  3CXC A;  5DLQ E;  1P16 A;  3X3M A;  4GOP C;  3KFU A;  3CD6 Z;  4KV6 A;  2XNA C;  1EWC A;  5IOD A;  1YIT 1;  5J1Z A;  3HOZ H;  3RNU A;  3K80 C;  1VQM 1;  1UEA B;  5DM7 3;  1JT8 A;  3GV6 A;  1RJT A;  1WW9 A;  2K33 A;  3I3C A;  3MXN A;  3PUW A;  1PRT F;  4P72 A;  1VQ5 A;  4OXP A;  2F0P A;  4X64 Q;  3MXU A;  3DMU A;  1J5E Q;  4HIM A;  1CFM A;  1MBY A;  2F0G A;  1B50 A;  4DV2 L;  1YHA A;  4JBW A;  1RCV D;  3TP8 A;  1BDO A;  2RDH A;  5CMD A;  1PFN A;  3CCJ A;  1X3F A;  1U4R A;  2PI2 E;  2O2L D;  3ZJY C;  4DV1 Q;  2Z8L A;  4OWX B;  2VY3 A;  2B39 A;  2AUK A;  1K9M 2;  3OPO A;  5ELE A;  4E2Z A;  4LF4 Q;  3J80 f;  1JOK A;  1K8G A;  4NPS A;  3CCV Z;  1GUW A;  2F0S A;  4A3J H;  1QNK A;  3OMC A;  1PV4 A;  3E6Z X;  2KBN A;  3HOZ I;  5A2Q L;  3SHL A;  3TQY A;  3MXP A;  3CW2 C;  4ZKC B;  2IWH A;  4NBC A;  5FJ8 G;  4DR1 L;  2HCC A;  1A6X A;  1BBX C;  1BF4 A;  3MTS A;  1NR2 A;  4LFB L;  1SRU A;  3AQQ A;  3ZYY X;  1TS4 A;  3CPF A;  2ZM6 L;  5M3F G;  1YNJ C;  3ICE A;  5KND A;  2QDB A;  2EXZ A;  2WKD A;  2A68 D;  1YIT A;  3FQM A;  3D4R A;  1LT4 D;  3H94 A;  1VQM A;  4YWK A;  4G57 A;  1YIJ Z;  2GVB A;  3HOW I;  2UU9 Q;  2JA5 I;  5IT9 L;  3M85 A;  2PQE A;  3MXN B;  4B3R L;  2CKZ B;  4AQY Q;  1Q12 A;  4JI2 L;  2QEX 1;  1LAC A;  5FKA C;  5IYB G;  3FDT A;  1SYF A;  4NBD A;  1HTL D;  4K14 A;  4A3J I;  2Q4Z A;  2JJQ A;  3S2H B;  1VQL 1;  5M5X H;  1KHI A;  3ULL A;  1N33 Q;  1JWH C;  1A8V A;  2WIN B;  1RQF A;  3FMC A;  5ELO A;  3HG9 A;  2AYD A;  2AMC B;  4XQJ A;  1R4Q B;  3NTK A;  3I56 1;  1E24 A;  1J8I A;  1CQV A;  2EVB A;  4IUR A;  2JS4 A;  3KF8 A;  2E2I B;  1IYV A;  1TR5 A;  3DM3 A;  3UDG A;  2QRC B;  1K28 A;  2PYK A;  1A3T A;  1VF5 C;  5C44 G;  1KD1 C;  1BBW A;  4BY7 B;  1EY7 A;  3Q8D A;  4JOI C;  3PO2 B;  1YJN 1;  1W6J A;  4NXM Q;  3TP7 A;  3L7Z C;  3BVZ A;  1N9W A;  1SRO A;  4ZAI A;  4KY5 A;  1PTO D;  1WD0 A;  2B2W C;  4G7O C;  4HSP A;  3TP6 A;  4YCW A;  3D6C A;  1U4M A;  3OW2 A;  4J6H A;  3OWE B;  1X3Z A;  2E2H H;  5C4H A;  4YCU A;  3S1M B;  2K5V A;  3MEH A;  1S72 Z;  3PMF A;  3LNN A;  3QJY A;  4DR3 Q;  2B2U A;  1KC8 1;  4NH1 C;  3CD6 1;  2NZ1 D;  1JWM D;  1WTQ A;  2EYJ A;  1S5C D;  3HKZ A;  4C1N I;  1IKL A;  4DN4 M;  5I2X A;  4RGT A;  2QEX A;  4JI4 Q;  2Q2T A;  2QRE B;  1YJW Z;  3P5J B;  5LMU L;  3FVQ A;  2QA4 Z;  3BU2 A;  4AH6 A;  3G7L A;  2G9D A;  2O4X A;  1O7Y A;  1PTO F;  4E2W A;  2JYO A;  3LGJ A;  1CHP D;  5FJ8 H;  1VQL A;  2JMO A;  4MTK A;  3I72 A;  1VQF A;  4N9T A;  4DR6 L;  4ZUJ A;  5H1S E;  1EQT A;  5M3F H;  1NBW A;  3DUZ A;  1M90 2;  3BVG A;  1HZC A;  1N36 L;  1X3P A;  2PQA A;  3I56 A;  3M4Y A;  3KF8 B;  3BG3 A;  2G5D A;  3K5O A;  2E2D C;  3J81 j;  3PV0 A;  2SNM A;  2A19 A;  2A74 C;  1KRL A;  4DUZ L;  4IJL A;  5IP7 G;  2WII B;  3C46 A;  3K0Y A;  4QIW E;  3SXH A;  1NJI 1;  3T4A C;  1D7Q A;  2AHO B;  2MP1 A;  2E2H I;  3CCR Z;  1EU4 A;  1ICW A;  2A6E C;  4IUP A;  5C0X H;  4ALP A;  1YJN A;  4C3J B;  4PMC A;  3CCV 1;  3CCL Z;  3TRE A;  4KKS A;  3GDE A;  1S5B D;  5EKL A;  2YU9 B;  1EOV A;  4UP9 A;  4MRI A;  2RHQ B;  4KN7 C;  2E5L L;  5GAG C;  1Y1V G;  2K6A A;  3S16 H;  4NP5 A;  1HCZ A;  1PZI D;  2OF1 A;  1PYS B;  2L5T A;  1GOZ A;  1I4G A;  3LX0 A;  1SFO B;  3NSW A;  2EQS A;  5KGU A;  4DV4 L;  2WP8 J;  4OON A;  1TWH H;  5IGB A;  1YHQ Z;  2JP1 A;  3U58 A;  3CD6 A;  5JOB A;  1RTN A;  1E3P A;  3HKZ B;  3J81 L;  5C0X J;  3S14 H;  2JIQ A;  1AW7 A;  1KRT A;  4X65 L;  1YIJ 1;  1CZW A;  2Z6K C;  2K5R A;  1BCP B;  2GTH A;  1HZA A;  4LMQ D;  1SR3 A;  5JJI A;  1Q3L A;  4NB8 A;  3GP7 A;  5C0X I;  2WFW A;  2D0P A;  3CPW Z;  4GLA C;  4HJ8 A;  1K8A 1;  4IAL A;  2Q51 A;  4JI7 Q;  1U9R A;  1PH7 A;  2OCE A;  4HCE A;  2IW3 A;  2Y0S E;  4ZK9 B;  3J80 c;  5BR8 L;  2C5C A;  5FLX b;  3CCS Z;  1Z01 A;  1E7Z A;  1JWS D;  2DE6 A;  3OIQ A;  1QYP A;  1STA A;  1K0S A;  3S16 I;  4FF1 A;  2EXD A;  3NH5 A;  4OHJ A;  1EQV A;  1LUZ A;  3A8I E;  4PQX A;  4DR2 L;  3HOU B;  1I6H B;  1MI2 A;  3ITP A;  1DCZ A;  1G51 A;  2K14 A;  1B70 B;  3G71 1;  3K7A B;  4KD4 A;  4LJZ C;  2GU2 A;  5FO7 B;  2HT1 A;  1TWA I;  1VQE A;  1B9M A;  3PIO 3;  3CCV A;  4BA1 I;  2F0K A;  2HIV A;  2LS0 1;  4J15 A;  3A5Z B;  3HOV G;  4BBS B;  1TWH I;  3S9W A;  3K5M A;  1W2B Z;  5AN9 F;  3JAM f;  3S14 I;  2DNE A;  1Y69 U;  3KJO A;  2OTL Z;  1MSH A;  3S2H H;  3N6R A;  1VS0 A;  2M00 A;  1D5M C;  1GHK A;  3N52 A;  1N32 L;  4C3H B;  1MKH A;  1I50 H;  2R7Z G;  4LFC Q;  1VQH A;  4C3I G;  2IPK D;  1KAB A;  1O7I A;  1IBL Q;  2E2I H;  1SN8 A;  4OEM B;  2VPW A;  3VYR A;  1AA6 A;  3I4L A;  1A3V A;  3GO5 A;  2JA6 B;  3R8B A;  1E1O A;  2HQE A;  3M4P A;  2B63 G;  2FJ2 A;  4GKJ L;  1S72 1;  1BO0 A;  1D6E C;  3QOJ A;  5IP7 H;  3S17 B;  1YIJ A;  5G3L D;  1EUJ A;  1XPU A;  4ZKB B;  2HHH Q;  5D1O A;  1XJV A;  1S40 A;  1UEB A;  1IW7 C;  1HZ9 A;  3TN2 A;  3NQI A;  1BNZ A;  1YJW 1;  2QA4 1;  4JCV E;  3D6W A;  5FLX E;  4QF4 A;  1SXT A;  1JWU D;  4MN3 A;  1Y1V H;  4CKE A;  4DV0 L;  2LEX A;  4DV7 Q;  4B08 A;  2NVQ B;  4H7B A;  1KL9 A;  1L0W A;  3TDH B;  3H0G B;  3S15 B;  5IT9 b;  3UI2 A;  4YY3 L;  3VYS A;  1I50 I;  4KTA A;  1VMC A;  5G3L F;  1AE3 A;  3I91 A;  4FF3 A;  1I5F A;  3G71 A;  1PTO C;  2M6N A;  1GO3 E;  2PNH A;  2PK7 A;  2B2U C;  4A4I A;  1XTC D;  4I65 A;  1LTL A;  1ASZ A;  5BN3 A;  3BZD B;  1J9O A;  2DGY A;  3CCR 1;  4MON A;  3CXC Y;  1CM9 A;  4A3B G;  3CCL 1;  5IP7 I;  3KOJ A;  2V8K A;  3S2D H;  3CC7 Z;  1GUG A;  4GLX A;  1BCP C;  3L0O A;  2Z1C A;  3DWA A;  3TRZ A;  1V43 A;  1TVX A;  1YJ9 Z;  4N8F A;  1C7Y A;  4JYA Q;  3U4Z A;  5CV4 A;  1Q82 2;  4TRD A;  5LL6 f;  1Y1V I;  2WAQ E;  1ROD A;  1I94 L;  2KPI A;  2ZTE A;  1S72 A;  5E4X A;  2I07 B;  4QL5 A;  2KED A;  2MHV A;  1YHQ 1;  1FNU A;  2A6H D;  1AH9 A;  2XTI A;  3CXC Z;  2RT9 A;  1HQM C;  5IP9 G;  5KYL A;  5AFW A;  3VR2 A;  3DHQ A;  3HOV H;  2NTS A;  5EGT A;  1EWH A;  2QA4 A;  3TDQ A;  2NVT H;  3R2I A;  3F2U A;  4QUF A;  3SVM A;  5GRO A;  2MGS A;  4DUY L;  1E2W A;  1Z6H A;  3F8T A;  4CJ0 B;  2K5N A;  2WAC A;  5GAE C;  2BE5 C;  2UUA L;  2R7Z H;  1SNC A;  1DL6 A;  3GTM S;  1NUC A;  1UUP A;  2ZXP A;  2F0U A;  4IO9 A;  1VQ5 Z;  3S2D I;  1VQN A;  4BS9 A;  1SNO A;  3EVQ A;  3TEH B;  3VR4 A;  2P5Z X;  1QCB D;  5I6Y A;  3CCS 1;  2E75 C;  2E9H A;  4K6L A;  1U5K A;  1KC8 C;  2B63 H;  2J7Z A;  2CH4 A;  1ONL A;  1WTR A;  2XIW A;  1A15 A;  3CCR A;  3RLN A;  1WTP A;  2R7F A;  3AEV A;  3I90 A;  1RL2 A;  3CCJ Z;  1L2F A;  2A69 D;  2LIY A;  1K9M C;  4JI3 L;  5HGQ A;  2PMZ B;  1NCV A;  3P7J A;  4DGL A;  3K0X A;  3PGZ A;  3BS1 A;  4HGZ A;  5I9O A;  1K0R A;  4LF9 Q;  1JE4 A;  1QJO A;  5JJK A;  3D4W A;  2OTL 1;  3TME A;  3HOZ B;  1EL0 A;  3EER A;  3HOV I;  1GVP A;  4DR5 L;  1QVG Z;  2NVT I;  1V1O A;  1SAP A;  4NB3 A;  1HA6 A;  2DY7 A;  1RKN A;  3TBI B;  4A75 A;  1I6H H;  2F3W A;  2Y0S G;  3ERQ A;  4MIU A;  4LF8 L;  1YI2 Z;  3H3V C;  1S7M A;  1Q81 1;  3GTJ I;  2R7Z I;  4GLV B;  3UE1 A;  4Z9C B;  4P75 A;  1NMG A;  2PO4 A;  1JJ2 A;  4JV5 Q;  5EKI A;  2PW5 A;  1LM0 A;  1RTO A;  2I46 A;  5M5Y H;  2N3S A;  4DV3 L;  2I0Q A;  1JJG A;  2B63 I;  4QUC A;  4A3B H;  2J4X A;  3HOW B;  1B4O A;  4C3H H;  2M2L A;  2JA5 B;  2QRD B;  1SMX A;  1TY0 A;  4R4O A;  2JIP A;  3IFU A;  1KD1 1;  3UDF A;  5EJW A;  3K57 A;  1SBB B;  4KD3 A;  4NBH A;  4KLK A;  3GTK H;  3NDI A;  1YNJ D;  3CHB D;  3J81 b;  4S1T A;  1VQK Z;  1QXF A;  1CSQ A;  1XTD A;  3OOC A;  3NBH A;  5L37 A;  1GM5 A;  4A3J B;  4JI6 L;  3J81 i;  2JA6 H;  1EFW A;  1XMO L;  3NEL A;  4X3S A;  4TKO B;  3JAM c;  2RCN A;  4BBR G;  4NBB A;  2V8J A;  3NH4 A;  4YHH Q;  4KJO A;  1T5X D;  4A3F G;  1D1K A;  1WII A;  5IGF A;  1A3U A;  1Q86 2;  2JIR A;  1F9P A;  3OW2 Y;  3GKQ A;  3I4M G;  2PZW A;  2F0F A;  2IY5 B;  1W2B A;  3VA5 A;  2L9H A;  2CVR A;  1RO2 A;  2EZV A;  2ALY B;  5A2Q f;  1TXY A;  2SNS A;  4QY7 A;  2OTL A;  2JQO A;  1PFB A;  2NVQ H;  2JA9 A;  1M4V A;  4LF6 Q;  3CC7 1;  1K8A C;  1FJG Q;  4IUV A;  4C2M B;  4A3B I;  1CKO A;  2I5H A;  4A3M G;  1X56 A;  1FNW A;  2ZXR A;  5D14 A;  1SNM A;  1YJ9 1;  1HNZ Q;  2AQ3 B;  4IUQ A;  3B6Y A;  3ND9 A;  3GTK I;  2UUB L;  2ZXO A;  4RKB A;  4K2K A;  2VPY A;  1LTS D;  3CMA Z;  1Z03 A;  4S3S A;  1O78 A;  5CBA E;  3OW2 Z;  2NN6 G;  2VQF Q;  2JA6 I;  2JE6 I;  2QEJ C;  4QMG A;  1O7Z A;  2F0H A;  5FO9 B;  3AU7 A;  5T1G A;  3WOE A;  1SLJ A;  2BCO A;  1Y8O B;  3SK8 A;  3RD4 A;  1E22 A;  3MON A;  3BVM A;  5CM2 M;  4KKU A;  2ZJP A;  2EIF A;  2NZH A;  1PFM A;  4JOI A;  1XNQ L;  1Z02 A;  4A3G G;  4KKT A;  4QB4 A;  3E9H A;  5IP9 I;  2VUM G;  2QEX Z;  3NBH B;  4HH4 A;  2UXC L;  2NVY H;  4RWS C;  4GKK Q;  4X6A H;  2UUC L;  5I2Y A;  3BZC A;  1FL0 A;  2NVQ I;  3W2D A;  1EWI A;  2AQ2 B;  2C9O A;  2PW7 A;  3AYH B;  4POF A;  2IHE A;  4DAM A;  3ERO A;  3T1Y L;  3D31 A;  5BN5 A;  1EIF A;  3H91 A;  3BDL A;  3UE0 A;  4DV6 L;  1RHP A;  5KRU A;  1HTP A;  3I56 Z;  2F4O A;  1R4P B;  2G9H D;  2NB0 A;  1KAW A;  4L5S A;  4RV9 A;  2D9U A;  4DV2 Q;  1JOR A;  3CCJ 1;  1Y1W G;  4HED A;  2K05 A;  4E2Y A;  2E2H B;  4DR4 Q;  5C5M A;  1KQS Z;  4LNQ A;  1ICF B;  4LF5 L;  1N8R 2;  1YJN Z;  4X3U A;  2A6H C;  3T1H Q;  2VQE L;  4IPC A;  2F4M A;  1C4Q A;  2IX0 A;  2K32 A;  1MJE A;  1NSN S;  3SK4 A;  1DOL A;  4XT3 B;  2D2C C;  4R4Q A;  4B3M L;  2W03 A;  3HEJ A;  1O7L A;  1M1K C;  1AP0 A;  1GXD C;  3D9X A;  4XX2 A;  2CWP A;  2NVY I;  3IFD A;  1YI2 1;  1Q1B A;  2V3V A;  3UDX A;  4X66 L;  4DR1 Q;  2R6M A;  4NBG A;  2A6E D;  3A74 A;  4OIJ A;  3RLF A;  3RMH A;  3VYU A;  4MXU A;  1XX8 A;  1E1T A;  3NBI A;  3GTO H;  1K73 1;  2F0V A;  1A63 A;  2K4K A;  5K5P A;  2ZM6 Q;  5M3F B;  1RO4 A;  2JA7 G;  4OX9 L;  3I4M H;  3MZ5 A;  1PHJ A;  2WB1 E;  4DF7 A;  1NY4 A;  1CUK A;  1GHJ A;  3SEB A;  4KHP L;  1LO5 D;  5FLX L;  1EEI D;  2FFK B;  3QWN A;  3QB3 A;  3ONA B;  2OZK A;  5KNC A;  2B2V A;  1PH9 A;  5C3X A;  2MNA A;  4DR7 L;  1PXU A;  4IPH A;  1VQA A;  1HNW L;  1GUO A;  2A69 C;  4MNO A;  4DFA A;  5IGG A;  1PLF A;  1R9T H;  2B3G A;  4A3M H;  3TS2 A;  2MO0 A;  1VQK 1;  3D0F A;  2EY1 A;  2K28 A;  4R9W A;  3NUC A;  1IBK L;  2W04 A;  4FNF A;  3DEO A;  4N9P A;  2N49 A;  4JI2 Q;  1H95 A;  2UXB L;  1I6V C;  1I4X A;  2CW0 C;  3U9S A;  3V96 A;  5BN4 A;  3S16 B;  3OHX C;  4K0K L;  2EYF A;  5C3E G;  1SYG A;  3HOW H;  1LTA D;  4ZQ3 A;  2JA5 H;  4BBR I;  1TWA B;  2F0T A;  1STH A;  3MAQ A;  2A73 B;  1WTX A;  1TWH B;  3GTO I;  2NBF A;  2H1E A;  2DE7 A;  4FVM A;  4A3G H;  1CZG A;  1VMP A;  2Z6K A;  3S14 B;  2VNU D;  3K58 A;  3I4M I;  1QVG A;  3FRP B;  1XMQ L;  2YV5 A;  2EGT A;  1S5E D;  1YNN C;  1ZKO A;  1Q7Y C;  1EY5 A;  1PMR A;  2DJF C;  1YI2 A;  1HR0 L;  1BXT A;  1HUN A;  5COR A;  2ICI A;  1R9T I;  1PH8 A;  2KCC A;  3FHW A;  1JE5 A;  4A3M I;  1VQO Z;  2XRQ D;  1J6Q A;  3T56 B;  3CMA 1;  3J81 f;  4BA2 I;  1SE3 A;  4ME5 A;  2K3R A;  1HH2 P;  1XYI A;  2F52 A;  4IPG A;  1U0L A;  1DGS A;  2QF7 A;  4DPG A;  2EPB A;  5JEA G;  3VMG A;  2KUM A;  1Y1W H;  1KDB A;  1SNQ A;  2NN6 I;  5JVH 3;  2HF1 A;  1ZXT A;  2K50 A;  4C2M H;  1IHZ A;  2KHI A;  4OWT B;  5IGD A;  1OXT A;  1ZYR C;  2VW9 A;  1EZ6 A;  4KY6 A;  1VQK A;  4MD9 A;  4NXN L;  5C4Z A;  1ML8 A;  2F0D A;  4PG3 A;  1YHB A;  5LMU Q;  4JI5 L;  1NJI 2;  3CU7 A;  3P20 A;  1G6Z A;  4A3G I;  1JC7 A;  5CGK A;  1LQL A;  1Q81 C;  2VUM I;  1UE7 A;  1Q90 A;  5D3D A;  5AJ3 L;  2F03 A;  1LYL A;  1YZ6 A;  1EU3 A;  2RF4 A;  3EQL C;  1VQ8 Z;  4LW1 A;  3MZL B;  1HHV A;  3PO3 S;  1AZP A;  1I50 B;  3FP9 A;  3R3O A;  1ESF A;  4IOC A;  2BOS A;  4DR6 Q;  2WKC A;  1IW7 D;  2A5H A;  2HUG A;  2RSN A;  4X64 L;  2EJG C;  3QIA A;  1FGU A;  1ILP A;  3G71 Z;  1N36 Q;  5CR3 A;  1LT3 D;  3PF5 A;  4FXD A;  1KDA A;  4DUZ Q;  1P8L A;  2HCI A;  1V9P A;  5LL6 X;  3GCF A;  1T5E A;  1JOO A;  1Y1W I;  1EYC A;  3KBX A;  4LK1 C;  1P9N A;  4M8A A;  1WYD A;  5C4J H;  1AFP A;  2ENB A;  2M9V A;  3K7U C;  5ELN A;  4EWC A;  1G2S A;  5LMN W;  3F2D A;  4RVF A;  2GVA A;  3R93 A;  4BY1 G;  2E5L Q;  3RZO B;  4LF7 L;  2LFN A;  3CMA A;  2K04 A;  4O1N A;  4LUV A;  1Y1V B;  4JI1 L;  4CJ2 C;  4QJF A;  1JCK B;  5C6A A;  1B3Q A;  5ELC A;  4M1U B;  3BJU A;  2R93 G;  1WJJ A;  4OIK A;  3T13 A;  5C3E H;  4AYB G;  4NOZ A;  2D62 A;  3NQT A;  5M3M G;  1VQC A;  2AWN A;  1LTB D;  1QF8 A;  2I5L X;  3GQB A;  4TVA B;  2F0O A;  4DV4 Q;  4H44 C;  1BCP D;  2JEB I;  4O2D A;  4PZ8 A;  1SDF A;  1K9M 1;  2F0M A;  4QTU A;  4X65 Q;  4Y52 I;  1KNE A;  3WDN A;  2MFI A;  4DAY A;  2VUG A;  3U9O A;  1NP6 A;  4F7X A;  4JK1 C;  3S2D B;  5C4J I;  1RD9 D;  2E8G A;  4JVZ A;  1VQN Z;  4JPB W;  1Q1E A;  4RGO S;  4I7A A;  4AQY L;  4LFA L;  2R92 G;  3MZK B;  2QCP X;  1CTM A;  1NE3 A;  4A93 G;  4CDF C;  4GN4 B;  2RCF A;  2A1A A;  2O5J C;  1DM0 B;  2JN4 A;  5BR8 Q;  3CP0 A;  4TQU S;  1BCP F;  3I4O A;  1NAP A;  1ENA A;  4A3E G;  5JEA H;  4HN7 A;  1KQS A;  1QVC A;  4IFD G;  1ZB9 A;  2LSS A;  5C3E I;  4DR2 Q;  4EVO A;  3PUY A;  1HRJ A;  2BE5 D;  2WB1 G;  3STB C;  1RF2 D;  2B2V C;  1F2L A;  4PNY A;  1X3Q A;  1X3W A;  1TWG H;  2F3I A;  3HOV B;  2QLV B;  4CKB A;  4HJA A;  4BXX G;  3NEM A;  4UPA A;  5IYB H;  2NVT B;  1TWF B;  1WTH A;  2R7D A;  4GN5 A;  3OYY A;  1SNP A;  2QKD A;  3CPW Y;  3RZD H;  1Y8N B;  4K8J A;  1N32 Q;  1QIL A;  1VQO 1;  4NXM L;  5DEH A;  3GTJ B;  2JA8 G;  1WZN A;  1TWA H;  2R7Z B;  1YVC A;  2FMC A;  2GN5 A;  1FVI A;  2L0C A;  3MFG A;  1EIH A;  4NMZ A;  1PFT A;  5JEA J;  2TSS A;  3VB9 A;  4RAU C;  3H15 A;  2IX1 A;  4HR7 B;  1O80 A;  1OXS C;  3MFY A;  4MD8 A;  1JJ2 Z;  3L9A X;  1L1O B;  5C44 H;  2B63 B;  1B53 A;  4GKJ Q;  3TS0 A;  4CDD C;  1NNX A;  2I5M X;  3MHB A;  4IOA A;  4RGN A;  3V2T A;  4A3D G;  2XWJ B;  4DAY B;  2AKL A;  3WWV A;  4DR3 L;  1W2B Y;  1SSO A;  2PPB C;  3M4Q A;  3AMU A;  1VQG A;  1STE A;  2FIN B;  3HGB A;  2L1B A;  2K5D A;  2BH2 A;  4BY1 H;  4DV5 L;  1TWG I;  4QTT A;  4JI4 L;  2F0I A;  2J0T D;  1BVS A;  4DK0 A;  2EY2 A;  1VQ8 1;  1KXL A;  4HJ9 A;  4DV0 Q;  1K73 C;  1IXR A;  4HMJ A;  1NR4 A;  2RHS B;  1JB7 A;  2R93 H;  1W3S A;  1F2M A;  3HP3 A;  3RR5 A;  1B1Z A;  1WTW A;  1D1I A;  3RZD I;  1XPR A;  1SMY D;  5IYD G;  3J7Z C;  4CGY B;  4OO1 G;  1JB3 A;  1V1Q A;  1Q86 C;  5IYC G;  3FKI G;  2B29 A;  1HNX L;  3RN2 A;  1SYE A;  2GA4 B;  3J81 c;  2HQL A;  3CCU Z;  5M5Y B;  3Q23 A;  5I6W A;  5C44 I;  1STB A;  3J7A V;  4A3B B;  4NFR A;  3VDY A;  4L63 B;  2XN9 C;  2NUC A;  4C3J G;  1VQO A;  2IX3 A;  2CQA A;  3GTK B;  4YWM A;  1RO0 A;  1NMF A;  2R92 H;  3CAM A;  5FLM G;  1KIX A;  4A93 H;  3KJP A;  2KEC A;  2YYZ A;  3ERS X;  4BY1 I;  3NTH A;  3VR3 A;  4RGM A;  4IJH A;  4P74 A;  4UY8 C;  4A3E H;  2IV2 X;  1I94 Q;  4G7Z C;  3CC2 1;  4IFD H;  2KHJ A;  2R93 I;  2Y0S A;  2VL6 A;  1DZ1 A;  1SE2 A;  4XIG S;  1WTO A;  4RS4 A;  2JUB A;  3RZO H;  4QIW B;  3OWF A;  1G6P A;  3KLW A;  4HMI A;  1QZG A;  2VB2 X;  1K83 H;  4DUY Q;  1VQ8 A;  1QB5 D;  4RVG A;  4H0L C;  4JI0 Q;  3CRK C;  5CV9 A;  1VQN 1;  2V45 A;  1M1K 1;  1BR9 A;  2JA8 H;  4U67 3;  1HFN A;  2H4O A;  1FD7 D;  2N55 A;  4IFD J;  1ENC A;  2R92 I;  1DD2 A;  4G4K A;  1N2F A;  1I4P A;  4HJ5 A;  4A93 I;  4YCV A;  4NKL A;  2EDG A;  4WRD A;  1EEF D;  4E31 A;  4A3E I;  4KHV A;  2ZTD A;  3CF5 A;  3KF6 A;  2PMZ A;  3NXW A;  4IFD I;  2F4V L;  4JI3 Q;  1GUN A;  4DNT B;  1QVF Z;  2AWO A;  5JPN C;  1B8A A;  5C5L A;  1JIC A;  5C4X G;  3KK7 A;  1WCM G;  1CI3 M;  4OGQ C;  2NVY B;  3RZO I;  1SYC A;  2IZ4 A;  1KD1 2;  2OXP A;  5TSS A;  4E33 A;  1FDO A;  5JJL A;  5F2D A;  1K83 I;  4X3T A;  3OTO L;  3CC2 A;  2BA1 A;  2Y0S B;  1H9S A;  3EBE A;  4RG1 A;  2CH4 W;  5CYU A;  2Q8T A;  1AE2 A;  4MZ9 A;  5IYD H;  3LUS A;  5IYC H;  3FKI H;  2JA8 I;  1VQD A;  3K59 A;  2B8G A;  1Q16 A;  5A2Q E;  4PZ7 A;  2UXD L;  1TWF H;  4Q5V A; 
#chains in the Genus database with same CATH homology
 4DV3 Q;  3GTJ H;  1Y14 B;  4PMW A;  1YUA A;  1QVG Y;  1XPO A;  4C3I H;  1PH4 A;  2E2J H;  3KDF B;  1Q7Y 1;  4JI6 Q;  4A3L G;  2MO1 A;  4B3S L;  1XMO Q;  3L2P A;  4O0A A;  1YNX A;  3VTN A;  3H0G G;  3KF6 B;  1Q46 A;  1IBM L;  1EQQ A;  3CCU 1;  3FKI I;  5LMN L;  1PVO A;  3U50 C;  1TWF I;  4DK1 A;  3VMI A;  1EQR A;  1QUQ B;  2D0O A;  3FQQ A;  3GTL H;  1ASY A;  3EN2 A;  2UUB Q;  3AFP A;  2E2J I;  3I55 Z;  5FLX f;  1MJC A;  2YAD A;  2LXJ A;  4TNU A;  3NEN A;  3CCQ 1;  3GTM H;  1XNQ Q;  2VF1 A;  3PIO A;  3S1N I;  2UXC Q;  3HOY G;  2UUC Q;  3KIH A;  3Q87 A;  2MQH A;  1Q82 1;  2ZTC A;  3T1Y Q;  5IP9 H;  1PH2 A;  4DV6 Q;  4A3K G;  1OXX K;  3GTL I;  3HOX G;  3CCU A;  3G4S 1;  4LF5 Q;  2OTJ A;  3PUV A;  2VQE Q;  2V1C C;  1X55 A;  3ULP A;  1CKM A;  4B3M Q;  2OQK A;  1OXV A;  3GTM I;  5C4X I;  1VQ4 A;  1ZB8 A;  4CL1 A;  3E9I A;  2CFM A;  1XNR L;  3CME A;  4X66 Q;  5IT9 f;  1VQ6 1;  4NBF A;  5HY6 A;  3A0J A;  3CCQ A;  3BG0 B;  4OX9 Q;  1KQS Y;  3M7N A;  2P3Y A;  1A0I A;  4JV5 L;  2LFU A;  1HZB A;  4KHP Q;  4DR7 Q;  1HNW Q;  3W1G A;  4E30 A;  4DQY B;  1M90 C;  1IBK Q;  2WAQ G;  2UXB Q;  3M9B A;  2VS1 A;  4K0K Q;  1N34 L;  3G4S A;  4YHH L;  5IWA L;  4H02 A;  1QVF A;  4JBM A;  3I4N G;  1VQP Z;  2Q2H A;  4PZ6 A;  3G48 A;  1RNI A;  1XMQ Q;  3HOY H;  2KCT A;  4UP8 A;  3IRB A;  4BBR H;  1Z9F A;  2RIQ A;  3F3P C;  1HR0 Q;  4A3F H;  3STB D;  4LFB Q;  4B3T L;  3I55 1;  2G2K A;  1VQ6 A;  2VZA A;  5GAD C;  4A3K H;  3HOX H;  1PA6 A;  1Q86 1;  3BG1 B;  3CC4 A;  4JI8 L;  4AYB A;  3S1R H;  2RPR A;  4B3R Q;  1X9N A;  3PCO B;  4NXN Q;  2N78 A;  4JI5 Q;  4A76 A;  3GTG H;  4GKK L;  5AJ3 Q;  3HOY I;  2ZJQ A;  1VQ9 A;  2N8N A;  2OOY B;  4A3F I;  2AKW B;  1NUI A;  2VUM H;  2DUD A;  4A3K I;  3HOX I;  1KC8 2;  5FLX c;  4DR4 L;  3PUX A;  3MEF A;  4A3I G;  2JK8 A;  1IL2 A;  2WB1 A;  3S1R I;  5IY0 A;  3T1H L;  3CQZ H;  3PO3 G;  2I3C A;  5T6B A;  4X62 L;  1OTC A;  3KIF A;  3I55 A;  4LF7 Q;  1PFS A;  3PSI A;  3CCE Z;  5E7N A;  4JI1 Q;  3NH8 A;  4Y7N H;  3EIV A;  3M4O H;  3GTG I;  3HFZ B;  2NVX H;  1C0A A;  3I4N H;  1QZH A;  1N8R 1;  2M48 A;  2PI2 A;  1VQJ A;  3GTP H;  4L5R C;  3JAM b;  3JAM i;  1PH5 A;  1PH1 A;  5C0X G;  4LUO A;  2A8V A;  3IX0 A;  2JR6 A;  4LFA Q;  3CQZ I;  3I07 A;  3W1B A;  1J5E L;  2JA7 H;  4Y52 H;  4LUZ A;  3GD7 A;  4MH4 A;  4Y7N I;  3M3Y H;  3HKZ E;  3M4O I;  1VQB A;  1VQI A;  4DV1 L;  1EIY B;  1VQP 1;  1UE1 A;  4LF4 L;  2NVX I;  2YTV A;  5IT9 c;  1X3E A;  2BJO A;  2ASB A;  3J7A 4;  3I4N I;  1Q82 C;  4NBA A;  1K3R A;  4DNI A;  3GTP I;  2Z0S A;  4RMF A;  1K8A 2;  3CC2 Z;  1YBY A;  2K5H A;  4FDB A;  1IYJ B;  2JA7 I;  1L1O A;  4AIM A;  3ESW A;  2RHB A;  3PF4 A;  3ULJ A;  1CKN A;  4A3I H;  3M3Y I;  4HIO A;  2UU9 L;  2Q2U A;  3PO3 H;  2YTY A;  4GS3 A;  1B7Y B;  3NDJ A;  4DV5 Q;  4P71 A;  3SGI A;  1N33 L;  3EED A;  3G6E Z;  1C9O A;  1JJ2 Y;  1VQP A;  1HNX Q;  2BH8 A;  4BY7 G;  3PO2 G;  2OQ0 A;  2J6A A;  1G29 1;  4A3I I;  4DKA C;  2QR1 B;  3CCE 1;  4NB9 A;  3PO3 I;  3K81 C;  4GNX A;  2BA0 A;  1A62 A;  5T67 A;  3E0E A;  2C35 B;  1M1K 2;  1CKN B;  1X65 A;  1X3G A;  3K8A A;  5T64 A;  4RVH A;  5K36 G;  4DK3 C;  1X54 A;  1PH6 A;  5M3M H;  2JNY A;  4POG A;  2CWA A;  4QGU A;  4YY3 Q;  4HJ7 A;  2O4H A;  4MD7 A;  1SE8 A;  2IHF A;  1Y1V S;  4YWL A;  2PQA B;  1VLA A;  2K75 A;  3I7F A;  2F4V Q;  2PM9 A;  2OTJ Z;  3F1Z A;  4R4T A;  5M5W H;  1HJP A;  1IZ6 A;  1X6O A;  2QGQ A;  1BKB A;  3CCE A;  4GNX B;  3CCM Z;  3F3F C;  1ZH1 A;  2ZJP A;  1VQ4 Z;  3VMH A;  3PIP A;  3A5U A;  1M90 1;  1WFQ A;  3OTO Q;  3CME Z;  4HIK A;  1Q7Y 2;  4L5T A;  1USP A;  1Z47 A;  3CCQ Z;  3HKZ G;  1GD7 A;  4BXX H;  2PMZ E;  2UXD Q;  3ER0 A;  5A2Q b;  4BY7 H;  1QVF Y;  3PO2 H;  4E2X A;  3AFQ A;  2UUA Q;  1EYG A;  4E32 A;  1PH3 A;  3UDI A;  2RBL A;  3KDF A;  4JI7 L;  4JBK A;  2ATW A;  2ZAE B;  1NTG A;  2ES2 A;  4B3S Q;  1WOC A;  3G6E 1;  1Q81 2;  4QQB X;  5D1P A;  1L1O C;  3S1M H;  1N8R C;  4A3D H;  3S2H I;  3G4S Z;  3HOU G;  5IE8 A;  1IBM Q;  4APV A;  1VCI A;  2IZ3 A;  3KYH C;  2H5X A;  4JBJ A;  3JC6 6;  4BBS G;  4BXX I;  2V8I A;  5LMN Q;  2E2I I;  4DR5 Q;  4BY7 I;  3PO2 I;  4MTN A;  1QUQ A;  3S24 A;  4LF8 Q;  2KCM A;  1X0T A;  1VQ7 Z;  4KHZ A;  4LFC L;  2OOX B;  1USP B;  4GN3 B;  1VQ6 Z;  3J7A 5;  1IBL L;  2JA6 G;  1HR0 W;  3CC4 Z;  4L5Q A;  4JG2 A;  2HHH L;  3S1M I;  4A3D I;  4C3J H;  5D1O B;  1I3Q H;  4IPD A;  2YU9 H;  5FLM H;  1YJW A;  4DV7 L;  4GNX C;  2HU9 A;  3G6E A;  4JI0 L;  3U4V A;  3BZK A;  3RN5 A;  1VQ9 Z;  1TWC H;  4A3C G;  1SFO H;  4OO1 I;  2WAQ A;  1UE6 A;  3S1N H;  4ME3 A;  4R1J A;  4UP7 A;  3GTQ H;  2H85 A;  4HID A;  2OTJ 1;  4GOP A;  3CCL A;  2K52 A;  3CCM 1;  1I3Q I;  1VQ4 1;  2YU9 I;  4JYA L;  5FLM I;  3CME 1;  3QWU A;  1XNR Q;  2KEN A;  4LWC A;  3HOU H;  1GKH A;  3K7A H;  1YHQ A;  1TWC I;  1UWV A;  1SFO I;  3J80 b;  1Q8K A;  5C4X H;  1WCM H;  5J3B A;  1NJI C;  4BBS H;  3J80 i;  1YIT Z;  2L15 A;  3GTQ I;  1VQM Z;  5EAY A;  1RIP A;  3CPW A;  2ZJR A;  4OWW B;  2P28 A;  1YEZ A;  2YTX A;  3CCS A;  4P73 A;  2IT1 A;  4XTC S;  3NFZ A;  1K73 2;  3S17 H;  1N34 Q;  5IWA Q;  4GOP B;  1TFI A;  4HGY A;  1I6H I;  3F2C A;  3HOU I;  4LF9 L;  2ID0 A;  3K7A I;  3S1Q H;  3CCM A;  3HOZ G;  1WCM I;  4A3L H;  4BBS I;  4WJ4 A;  3PUZ A;  3H3V H;  1VQ7 1;  3H0G H;  3S15 H;  4A3C H;  4B3T Q;  4NBE A;  2HIX A;  3CC4 1;  3IF8 A;  4JI8 Q;  3HOW G;  3F2B A;  3S17 I;  2JA5 G;  1JJC B;  4RVD A;  5GAH C;  4R4I A;  3H3V J;  2XGT A;  4WJ3 M;  4A3J G;  3S1Q I;  2OWO A;  4A3L I;  2CQO A;  1VQ9 1;  2JEA I;  4DK6 C;  1D8L A;  1BBU A;  2DE5 A;  3H3V I;  1VQ5 1;  3HKS A;  1VQL Z;  2NZO A;  2R6G A;  2GTI A;  3H0G I;  3S15 I;  1PYB A;  4A3C I;  4AYB E;  3T4N B;  3RLO A;  1YUK A;  2CCZ A;  1OXU A;  4EQ5 A;  4KI0 A;  4LF6 L;  1UE5 A;  1FJG L;  4JC0 A;  3TE5 B;  2FXQ A;  2Q2I A;  1JMC A;  3DLL A;  3CC7 A;  1T9H A;  1WI5 A;  1VQ7 A;  2KI7 B;  3I2Z A;  1HNZ L;  1KRS A;  1RLY A;  1MIU A;  4X62 Q;  1YJ9 A;  2O53 A;  5GQO A;  2LXK A;  4EX5 A;  2VQF L;  3W5O A;  1S3O A;  4X6A I;  1CSP A;  4R4C A;  3CXC A;  5DLQ E;  1P16 A;  4GOP C;  3KFU A;  3CD6 Z;  1YIT 1;  3HOZ H;  3RNU A;  3K80 C;  1VQM 1;  1JT8 A;  1WW9 A;  3PUW A;  4P72 A;  1VQ5 A;  4OXP A;  4X64 Q;  1J5E Q;  4HIM A;  4DV2 L;  1YHA A;  4JBW A;  3CCJ A;  1X3F A;  2PI2 E;  3ZJY C;  4DV1 Q;  4OWX B;  2VY3 A;  1K9M 2;  4E2Z A;  4LF4 Q;  3J80 f;  1K8G A;  4NPS A;  3CCV Z;  4A3J H;  1PV4 A;  2KBN A;  3HOZ I;  3TQY A;  3CW2 C;  4NBC A;  5FJ8 G;  4DR1 L;  4LFB L;  1SRU A;  3AQQ A;  3CPF A;  2ZM6 L;  5M3F G;  3ICE A;  1YIT A;  3FQM A;  1VQM A;  4YWK A;  1YIJ Z;  2GVB A;  3HOW I;  2UU9 Q;  2JA5 I;  3M85 A;  3MXN B;  4B3R L;  2CKZ B;  4AQY Q;  1Q12 A;  4JI2 L;  2QEX 1;  5IYB G;  4NBD A;  4A3J I;  2Q4Z A;  2JJQ A;  1VQL 1;  5M5X H;  1KHI A;  3ULL A;  1N33 Q;  1JWH C;  1A8V A;  1RQF A;  5ELO A;  2AMC B;  3I56 1;  1E24 A;  2JS4 A;  3DM3 A;  3UDG A;  2QRC B;  5C44 G;  1KD1 C;  1BBW A;  3Q8D A;  4JOI C;  1YJN 1;  4NXM Q;  3L7Z C;  1N9W A;  1SRO A;  4YCW A;  3OW2 A;  1X3Z A;  2E2H H;  4YCU A;  2K5V A;  1S72 Z;  4DR3 Q;  1KC8 1;  4NH1 C;  3CD6 1;  3HKZ A;  2QEX A;  4JI4 Q;  2Q2T A;  2QRE B;  1YJW Z;  3P5J B;  5LMU L;  2QA4 Z;  3BU2 A;  4AH6 A;  4E2W A;  3LGJ A;  5FJ8 H;  1VQL A;  2JMO A;  1VQF A;  4DR6 L;  5H1S E;  5M3F H;  1NBW A;  1M90 2;  1N36 L;  1HZC A;  2PQA A;  3I56 A;  3KF8 B;  3J81 j;  3PV0 A;  2A19 A;  1KRL A;  4DUZ L;  4IJL A;  5IP7 G;  4QIW E;  1NJI 1;  1D7Q A;  2AHO B;  2E2H I;  3CCR Z;  1YJN A;  4ALP A;  3CCV 1;  3CCL Z;  3TRE A;  3GDE A;  1EOV A;  4UP9 A;  4MRI A;  2RHQ B;  2E5L L;  5GAG C;  1Y1V G;  3S16 H;  1PYS B;  2EQS A;  4DV4 L;  2WP8 J;  4OON A;  1TWH H;  1YHQ Z;  3U58 A;  3CD6 A;  1E3P A;  5C0X J;  3S14 H;  1KRT A;  4X65 L;  1YIJ 1;  2Z6K C;  2K5R A;  1HZA A;  2GTH A;  1SR3 A;  5JJI A;  4NB8 A;  5C0X I;  2WFW A;  2D0P A;  3CPW Z;  4GLA C;  4HJ8 A;  1K8A 1;  2Q51 A;  4JI7 Q;  1PH7 A;  2OCE A;  2Y0S E;  3J80 c;  5BR8 L;  5FLX b;  3CCS Z;  1Z01 A;  1E7Z A;  2DE6 A;  1QYP A;  3S16 I;  2EXD A;  3NH5 A;  4DR2 L;  1LUZ A;  1G51 A;  2K14 A;  1B70 B;  3G71 1;  2HT1 A;  2GU2 A;  1TWA I;  1VQE A;  3CCV A;  4BA1 I;  4J15 A;  2HIV A;  3HOV G;  3A5Z B;  1TWH I;  1W2B Z;  5AN9 F;  3JAM f;  3S14 I;  3KJO A;  2OTL Z;  3S2H H;  1VS0 A;  1N32 L;  1MKH A;  1I50 H;  2R7Z G;  4LFC Q;  1VQH A;  1O7I A;  1IBL Q;  2E2I H;  1SN8 A;  3GO5 A;  1E1O A;  3M4P A;  2B63 G;  4GKJ L;  1S72 1;  5IP7 H;  1YIJ A;  1EUJ A;  1XPU A;  2HHH Q;  5D1O A;  1XJV A;  1S40 A;  1UEB A;  1HZ9 A;  1YJW 1;  2QA4 1;  4JCV E;  3D6W A;  1Y1V H;  4DV0 L;  4DV7 Q;  1KL9 A;  1L0W A;  3TDH B;  5IT9 b;  4YY3 L;  1I50 I;  1AE3 A;  1I5F A;  3G71 A;  2M6N A;  1GO3 E;  2PNH A;  2PK7 A;  4A4I A;  1LTL A;  1ASZ A;  2DGY A;  3CCR 1;  4MON A;  3CXC Y;  4A3B G;  3CCL 1;  5IP7 I;  3KOJ A;  2V8K A;  3S2D H;  3CC7 Z;  4GLX A;  3L0O A;  3TRZ A;  1V43 A;  1YJ9 Z;  1C7Y A;  4JYA Q;  3U4Z A;  1Q82 2;  5LL6 f;  1Y1V I;  2WAQ E;  1I94 L;  2KPI A;  2ZTE A;  1S72 A;  4QL5 A;  1YHQ 1;  1AH9 A;  2XTI A;  3CXC Z;  2RT9 A;  5IP9 G;  3HOV H;  2QA4 A;  2NVT H;  5GRO A;  4DUY L;  3F8T A;  2K5N A;  5GAE C;  2UUA L;  2R7Z H;  1DL6 A;  3GTM S;  1VQN A;  4IO9 A;  1VQ5 Z;  3S2D I;  3TEH B;  3CCS 1;  2E9H A;  1U5K A;  1KC8 C;  2B63 H;  3CCR A;  3RLN A;  3AEV A;  2R7F A;  1RL2 A;  3CCJ Z;  1L2F A;  2LIY A;  1K9M C;  4JI3 L;  5HGQ A;  4DGL A;  3K0X A;  3PGZ A;  4HGZ A;  4LF9 Q;  1K0R A;  5JJK A;  2OTL 1;  3EER A;  3HOV I;  1GVP A;  4DR5 L;  1QVG Z;  2NVT I;  4NB3 A;  1I6H H;  4A75 A;  2Y0S G;  4LF8 L;  1YI2 Z;  1S7M A;  1Q81 1;  3GTJ I;  2R7Z I;  4GLV B;  3UE1 A;  4P75 A;  1NMG A;  1JJ2 A;  4JV5 Q;  1LM0 A;  5M5Y H;  2N3S A;  4DV3 L;  2I0Q A;  1JJG A;  2B63 I;  4A3B H;  4C3H H;  2QRD B;  1SMX A;  4R4O A;  3IFU A;  1KD1 1;  3UDF A;  4NBH A;  4KLK A;  3GTK H;  3NDI A;  3J81 b;  4S1T A;  1VQK Z;  1XTD A;  1CSQ A;  1GM5 A;  4JI6 L;  3J81 i;  2JA6 H;  1EFW A;  1XMO L;  3NEL A;  3JAM c;  2RCN A;  4BBR G;  4NBB A;  2V8J A;  3NH4 A;  4YHH Q;  4A3F G;  1WII A;  1Q86 2;  3OW2 Y;  3GKQ A;  3I4M G;  2IY5 B;  1W2B A;  1RO2 A;  2ALY B;  5A2Q f;  1TXY A;  4QY7 A;  2OTL A;  2JQO A;  2NVQ H;  2JA9 A;  4LF6 Q;  3CC7 1;  1K8A C;  1FJG Q;  4A3B I;  1CKO A;  2I5H A;  4A3M G;  1X56 A;  1YJ9 1;  1HNZ Q;  3B6Y A;  3GTK I;  2UUB L;  3CMA Z;  1Z03 A;  2VQF Q;  3OW2 Z;  2NN6 G;  2JA6 I;  2JE6 I;  1SLJ A;  1E22 A;  3MON A;  5CM2 M;  2EIF A;  2NZH A;  4JOI A;  1XNQ L;  1Z02 A;  4A3G G;  3E9H A;  5IP9 I;  2VUM G;  2QEX Z;  3NBH B;  4HH4 A;  2UXC L;  2NVY H;  4GKK Q;  4X6A H;  2UUC L;  3BZC A;  1FL0 A;  2NVQ I;  1EWI A;  3AYH B;  4POF A;  2IHE A;  4DAM A;  3T1Y L;  3D31 A;  1EIF A;  3UE0 A;  4DV6 L;  3I56 Z;  2F4O A;  1KAW A;  4L5S A;  4RV9 A;  4DV2 Q;  3CCJ 1;  1Y1W G;  4E2Y A;  4DR4 Q;  1KQS Z;  4LNQ A;  4LF5 L;  1N8R 2;  1YJN Z;  3T1H Q;  2VQE L;  4IPC A;  2F4M A;  2IX0 A;  1MJE A;  4R4Q A;  4B3M L;  2W03 A;  1M1K C;  3D9X A;  4XX2 A;  2CWP A;  2NVY I;  1YI2 1;  1Q1B A;  3UDX A;  4X66 L;  4DR1 Q;  2R6M A;  4NBG A;  3A74 A;  3RLF A;  4MXU A;  3GTO H;  1E1T A;  1K73 1;  1A63 A;  2K4K A;  2ZM6 Q;  1RO4 A;  2JA7 G;  4OX9 L;  3I4M H;  1PHJ A;  2WB1 E;  1NY4 A;  1CUK A;  4KHP L;  1PH9 A;  2OZK A;  2MNA A;  4DR7 L;  4IPH A;  1VQA A;  1HNW L;  4MNO A;  1R9T H;  2B3G A;  4A3M H;  3TS2 A;  2MO0 A;  1VQK 1;  3D0F A;  1IBK L;  2W04 A;  4JI2 Q;  2N49 A;  1H95 A;  2UXB L;  4K0K L;  5C3E G;  3HOW H;  2JA5 H;  4BBR I;  3GTO I;  2DE7 A;  4A3G H;  2VNU D;  2Z6K A;  3I4M I;  1QVG A;  1XMQ L;  2YV5 A;  2EGT A;  1Q7Y C;  1YI2 A;  1HR0 L;  1R9T I;  1PH8 A;  3FHW A;  1JE5 A;  4A3M I;  1VQO Z;  1J6Q A;  3CMA 1;  3J81 f;  4BA2 I;  2K3R A;  1HH2 P;  2F52 A;  4IPG A;  1U0L A;  1DGS A;  4DPG A;  5JEA G;  3VMG A;  1Y1W H;  2NN6 I;  2HF1 A;  2K50 A;  4C2M H;  2KHI A;  4OWT B;  1OXT A;  2VW9 A;  1VQK A;  4MD9 A;  4NXN L;  1ML8 A;  4PG3 A;  1YHB A;  5LMU Q;  4JI5 L;  1NJI 2;  4A3G I;  1LQL A;  1Q81 C;  2VUM I;  1UE7 A;  5AJ3 L;  1LYL A;  1YZ6 A;  2RF4 A;  1VQ8 Z;  4LW1 A;  3MZL B;  3PO3 S;  3FP9 A;  4IOC A;  4DR6 Q;  4X64 L;  1FGU A;  3G71 Z;  1N36 Q;  3PF5 A;  4DUZ Q;  1P8L A;  1V9P A;  3GCF A;  1Y1W I;  1P9N A;  5C4J H;  1WYD A;  5ELN A;  3K7U C;  4EWC A;  5LMN W;  3F2D A;  4RVF A;  2GVA A;  2E5L Q;  4BY1 G;  4LF7 L;  3CMA A;  4LUV A;  4JI1 L;  4QJF A;  3BJU A;  2R93 G;  1WJJ A;  5C3E H;  4AYB G;  4NOZ A;  2D62 A;  5M3M G;  1VQC A;  2AWN A;  1QF8 A;  2I5L X;  4TVA B;  4DV4 Q;  2JEB I;  4O2D A;  4PZ8 A;  1K9M 1;  4QTU A;  4X65 Q;  4Y52 I;  2MFI A;  2VUG A;  1NP6 A;  5C4J I;  2E8G A;  1VQN Z;  4AQY L;  1Q1E A;  4LFA L;  2R92 G;  3MZK B;  1NE3 A;  4A93 G;  4GN4 B;  2A1A A;  5BR8 Q;  3CP0 A;  4TQU S;  3I4O A;  4A3E G;  1KQS A;  1QVC A;  4IFD G;  1ZB9 A;  2LSS A;  5C3E I;  4DR2 Q;  3PUY A;  2WB1 G;  3STB C;  1X3W A;  1TWG H;  2F3I A;  2QLV B;  4HJA A;  4BXX G;  3NEM A;  4UPA A;  5IYB H;  2R7D A;  4GN5 A;  3OYY A;  2QKD A;  3CPW Y;  3RZD H;  1N32 Q;  4NXM L;  1VQO 1;  2JA8 G;  1TWA H;  1YVC A;  2GN5 A;  1FVI A;  1PFT A;  5JEA J;  3VB9 A;  3H15 A;  2IX1 A;  1OXS C;  4MD8 A;  1JJ2 Z;  1L1O B;  5C44 H;  4GKJ Q;  3TS0 A;  2I5M X;  4IOA A;  4A3D G;  4DAY B;  2AKL A;  3WWV A;  4DR3 L;  1W2B Y;  3M4Q A;  1VQG A;  2BH2 A;  4BY1 H;  4DV5 L;  1TWG I;  4QTT A;  4JI4 L;  1BVS A;  1VQ8 1;  1KXL A;  4HJ9 A;  4DV0 Q;  1K73 C;  1IXR A;  2RHS B;  2R93 H;  1JB7 A;  1W3S A;  3RR5 A;  3RZD I;  1XPR A;  4OO1 G;  5IYD G;  3J7Z C;  1V1Q A;  1Q86 C;  5IYC G;  3FKI G;  2B29 A;  1HNX L;  3RN2 A;  3J81 c;  2HQL A;  3CCU Z;  5C44 I;  4NFR A;  3VDY A;  1VQO A;  4YWM A;  1RO0 A;  1NMF A;  2R92 H;  3CAM A;  5FLM G;  1KIX A;  4A93 H;  3KJP A;  2YYZ A;  3ERS X;  4BY1 I;  4IJH A;  4P74 A;  4UY8 C;  4A3E H;  1I94 Q;  3CC2 1;  2KHJ A;  2R93 I;  2Y0S A;  2VL6 A;  4XIG S;  4RS4 A;  2JUB A;  3RZO H;  1G6P A;  3KLW A;  1QZG A;  1K83 H;  4DUY Q;  1VQ8 A;  4RVG A;  4JI0 Q;  1VQN 1;  1M1K 1;  2JA8 H;  4IFD J;  2R92 I;  1N2F A;  4HJ5 A;  4A93 I;  4YCV A;  4E31 A;  4A3E I;  3CF5 A;  2ZTD A;  3KF6 A;  2PMZ A;  4IFD I;  2F4V L;  4JI3 Q;  1QVF Z;  2AWO A;  1B8A A;  5C4X G;  1WCM G;  3RZO I;  2IZ4 A;  1KD1 2;  4E33 A;  5JJL A;  1K83 I;  3OTO L;  3CC2 A;  2BA1 A;  4RG1 A;  3EBE A;  5IYD H;  1AE2 A;  4MZ9 A;  3LUS A;  5IYC H;  3FKI H;  2JA8 I;  1VQD A;  4PZ7 A;  2UXD L;  1TWF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...