3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
molecule keywords Telomerase-associated protein 82
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4OO1G 1N33L 3ZJYC 4JBJA 2QA4A 1MJEA 3BZCA 4JI7Q 3S16H 2ZM6Q 4BA2I 3EBEA 4DR4Q 4IPCA 3CXCA 4KHPQ 4LNQA 2F4OA 3H0GH 2YYZA 1RLYA 1E3PA 3M85A 1NTGA 2Z0SA 4OXPA 3H0GI 5H1SE 5IP9H 2N3SA 2Z6KA 1WI5A 2V1CC 2NVXH 4JI4Q 4DV7L 5JJIA 2K5RA 3GTMH 4A3MI 2RHQB 1P8LA 4Y7NI 3NBHB 2DE6A 3HOXG 1XPRA 3JC66 2YTXA 3KF8B 4JBKA 4GN5A 4NBFA 2IX1A 3S2DI 3M4QA 1J5EQ 5M5YH 3ER0A 3IRBA 3PGZA 1B7YB 3BJUA 4DV5Q 1XMQL 3S1QH 4LF8L 3J80i 1LM0A 2MNAA 1ML8A 2K50A 1NE3A 4P71A 3STBD 4DV0Q 1PVOA 5IP7G 1YNXA 4O2DA 1PYSB 1RIPA 2NVXI 2F52A 1XJVA 2PNHA 1GM5A 1OXTA 1PA6A 1U0LA 1E1TA 1SRUA 4GKKL 2F4VQ 1LYLA 4NBDA 3S16I 1IBKL 4JV5L 4ME3A 4YCUA 1VQ5A 3F2DA 4LFAQ 1A63A 3S1NI 3L7ZC 3FHWA 3UE0A 2E2JH 1FJGL 3RN5A 1D7QA 3KF6B 4HJ9A 2Q2TA 1Q46A 2R7ZI 4L5RC 1N36L 1B8AA 4NXMQ 4AQYL 5IYBH 4A3MH 3RR5A 3U50C 4BA1I 4DV6L 1K73C 2JA6H 3H3VI 1TWHI 1S40A 1CKNB 5IYDG 3K7UC 3CAMA 2VQEQ 3A74A 2CWAA 3BZKA 4RMFA 1PH1A 4DKAC 1ASYA 5HY6A 2UU9L 4GS3A 3VMGA 5C3EG 2JA9A 1EUJA 1E7ZA 4PZ7A 4IFDG 4DR7Q 1H95A 2HHHQ 4Y52H 4IPGA 3SGIA 3HOZH 1PV4A 3HOWG 1I3QI 4NOZA 2NVQH 1Q7YC 4HJ7A 2F3IA 2AKWB 2MFIA 3Q87A 4LF9Q 1PH7A 4BY1H 2HQLA 2KHIA 3PUZA 4JI7L 2BJOA 3UDIA 1N32L 1Y14B 1TWGH 4POGA 5DLQE 1HR0L 2VW9A 5FJ8G 3KJPA 1EQRA 2YV5A 1JB7A 2I5MX 3UDXA 5FLMH 3OTOQ 1K9MC 2UUAQ 1HZ9A 1VQJA 3KYHC 2JA6I 1LQLA 3NENA 3H3VH 5JJKA 1PH3A 3EERA 4LF6Q 3JAMc 1G6PA 3AQQA 1ASZA 2AWOA 3I56A 3GTGI 1YVCA 2KENA 2AWNA 4B3SQ 4BBSI 4HIOA 4GOPA 4LF5Q 4QIWE 3G6EA 1Y1VI 2D62A 4JI0Q 2CQOA 1XMQQ 1VCIA 3PO3H 1DL6A 3G71A 5IE8A 2K52A 2VUMH 1RL2A 1UE1A 3T1YQ 3F2CA 3G4SA 4JI6Q 1FVIA 1A0IA 4BXXH 2VZAA 3PF4A 3GKQA 5JEAJ 5FJ8H 3H15A 4A3DG 3CCSA 3TREA 3CQZH 1IBKQ 4A75A 1E24A 4NBAA 3NEMA 4AQYQ 3HKZG 4PZ6A 2VQFL 4LFAL 1IXRA 3S17I 3UE1A 3PO3I 3I55A 1A8VA 4HJAA 3PO2G 3I4NI 1X3GA 2JE6I 4APVA 1SMXA 3GTPH 2JA8I 4IFDJ 5LMNL 4C3HH 3EIVA 1M1KC 4OX9L 2L15A 4DNIA 1HNWL 3ULLA 4A3FG 2OCEA 1VQAA 2BA0A 3S1QI 1OXXK 1USPB 1XTDA 5AJ3Q 2E5LL 4LFBL 2E2IH 2UXDL 3VB9A 4A3MG 1IBML 5IYBG 3CMEA 1HNXL 4QY7A 4DAMA 2CWPA 4DPGA 3H3VJ 4X62Q 5C44H 4JI5Q 4HIDA 5GROA 4NB8A 1KRSA 2IHEA 3PUVA 2ALYB 3L0OA 4LF9L 1Y1VS 3K0XA 3DM3A 3J7A5 2UUBQ 1EIFA 4A3KI 1I94L 4BBSH 1OXSC 1I3QH 1WCMH 2I5HA 5J3BA 3HFZB 1UEBA 3S14H 3HKZE 2R92I 1XMOQ 1PH6A 2KBNA 1Z47A 2LXKA 5M3MH 2ZM6L 1Z9FA 2WB1E 1EFWA 3HOVG 2WB1G 1PH5A 3T1YL 2IT1A 2N49A 2ZTEA 4BXXG 4X66L 2JA7I 2RBLA 2EXDA 1PYBA 1Y1VH 2JNYA 4DV2Q 4GNXB 2HIVA 1IL2A 2B3GA 5IWAQ 2BH2A 3PO3G 1NY4A 4B3TL 2KCTA 2ASBA 3H0GG 3CCMA 3CCLA 1HNZL 1P16A 1XPOA 4NB9A 1BBWA 1V1QA 1VQMA 3RLOA 3CC7A 1YHQA 4GKKQ 1JE5A 4A3KH 4IOCA 2JS4A 4B3MQ 2OWOA 4A3FI 2MO1A 1S72A 4DV1Q 3AYHB 4LUZA 3CW2C 3T1HQ 1LUZA 1SE8A 2GVAA 4C2MH 1I50I 1N2FA 1KHIA 5IY0A 3W5OA 5GAEC 1TWHH 2LSSA 3KOJA 4NXML 2HT1A 4YHHQ 4OX9Q 5AJ3L 2E5LQ 1I6HH 3PIOA 4DUZL 5IP7I 4DV6Q 1YEZA 1I6HI 2ES2A 1HZBA 2YU9H 1TWAH 4YWMA 3PUWA 4YWLA 3MEFA 4XTCS 4JI2Q 4MH4A 3HOZI 3E0EA 2QEXA 1TFIA 1VQ4A 3I4MH 5GADC 1YBYA 2OTJA 2PQAA 3D31A 2GVBA 4JI5L 1N33Q 2E8GA 2HHHL 3HOWH 4NBEA 3GTPI 2K75A 1CKOA 5ELNA 5C4JH 3CCRA 3UDFA 2J6AA 3GTMS 1GO3E 1KRTA 4KI0A 1JJGA 4WJ3M 3FKIG 5C3EH 5EAYA 2H5XA 3JAMi 3CF5A 4DV3Q 3GTOH 4OWXB 1W2BA 1N32Q 1QUQA 1HR0Q 1KXLA 1YIJA 3M3YH 1I5FA 5IT9c 4B3RL 2YTVA 4R4CA 3D0FA 1QZGA 3CCJA 4DR7L 4GKJL 4YY3Q 2B63G 4L5TA 4UY8C 1YJWA 3I4NH 4JOIA 3S15H 4JOIC 2JJQA 1BBUA 2FXQA 4H02A 5C0XI 2K4KA 4GN4B 3RN2A 2E2HI 3I4MI 3CQZI 1X65A 1EQQA 1N34L 4LFCL 2IX0A 4EX5A 3GTQI 4A3CG 2JA8G 3PF5A 3VMIA 4LF4L 4DV2L 2D0PA 1M90C 4NBGA 4NBCA 3RZOI 2NVTI 2AMCB 4X64L 1UWVA 5M3FH 3T1HL 1AE3A 1HR0W 1N36Q 1UE5A 3PUXA 2ID0A 3M4OH 4JI1L 2HF1A 1DGSA 3K7AH 1Y1WH 4JI6L 2CCZA 4DR2L 2NVQI 4JC0A 2A8VA 4AYBE 3I2ZA 1O7IA 3U4VA 1L1OB 3S1RI 1IYJB 3U58A 4QL5A 3I07A 2R93G 1V9PA 1A62A 1OXUA 3S1MH 1Q81C 1KAWA 5FLMI 2CFMA 1B70B 1I50H 3KLWA 4DAYB 1VQ6A 1GD7A 3M3YI 4R4OA 5C44I 4A3GG 4LFBQ 1X3WA 3FKIH 4IJHA 2UUAL 2B63I 3VDYA 2R92H 2DUDA 2IY5B 2D0OA 4P75A 4PG3A 2K5VA 4BXXI 4YCWA 1K0RA 1GVPA 4QJFA 4BBRG 1BKBA 3VMHA 4Y7NH 5C0XJ 3RNUA 4DR4L 1C9OA 4HJ5A 2UXBQ 1NBWA 3GTLI 2WFWA 2E2HH 2VL6A 1IZ6A 3DLLA 3HOUH 3I4MG 3HOWI 1K83H 4X6AH 2Z6KC 3AFQA 3CP0A 4NPSA 4BY7I 4B3RQ 1GKHA 2P3YA 3GTKH 2RHSB 5CM2M 3RZDH 3I7FA 2DE7A 3E9IA 4A3JG 1U5KA 1WYDA 2BH8A 3A5ZB 5C4XI 1XNRQ 2MQHA 4JYAL 1VLAA 4IJLA 3KJOA 1VQ7A 4X64Q 2E2JI 2VS1A 3CCUA 1N34Q 4GOPC 1NJIC 1VQIA 3ERSX 1KL9A 4A3KG 3ICEA 2R93H 5HGQA 2UUCQ 3D6WA 1HH2P 3M4PA 4A3BG 4LUVA 4AIMA 1X3FA 1VQGA 4R4QA 4YCVA 3W1BA 1FJGQ 2F4VL 2XGTA 4B3TQ 4DR1L 5GQOA 4MTNA 1VQFA 2EQSA 4KLKA 3S24A 3E9HA 3F2BA 4JI1Q 4LF8Q 3U4ZA 4A93H 1Q82C 4DV0L 3HOYG 5IWAL 1TWFI 1Y1VG 3K8AA 1CKNA 2CKZB 4DR2Q 2VQEL 1Y1WG 1QVFA 2R7DA 1QVGA 3J80c 3PCOB 2NVYI 4NXNL 3GTKI 4A3GI 1PHJA 3HOVH 1VQKA 3MXNB 2JEAI 3PIPA 4DV1L 4NBBA 4HJ8A 4AYBG 3GTJH 4DUYL 2ZJRA 2UXCL 4JBMA 3HOUI 4NBHA 1TWGI 1WCMG 2PI2E 4JI8L 4K0KQ 3G48A 4WJ4A 1WFQA 4IO9A 3GTLH 2KPIA 1K3RA 4P73A 1PH9A 4NB3A 1PFTA 4LW1A 1Q12A 2Q2UA 4MZ9A 4UP7A 2I0QA 4ALPA 1YI2A 1OTCA 2QGQA 3RLNA 1YITA 3OTOL 3PO3S 4JBWA 4GOPB 4A3EH 2B63H 1EYGA 4QQBX 5GAGC 3S15I 1HZAA 2ZTCA 1VQ8A 1JJCB 1ZB9A 2RCNA 2ATWA 5IP9I 4OONA 1D8LA 1XNRL 3BU2A 4JYAQ 2OQ0A 2R7ZH 2Q2IA 1OXVA 4DV3L 1V43A 4C3JH 1Q86C 4BY1I 1QVCA 2N8NA 4JI0L 1MKHA 3KDFA 4QTUA 1FL0A 4P72A 1JJ2A 4KHPL 2B29A 3RZDI 3UDGA 4X65Q 1WOCA 4LF5L 2JR6A 1TWFH 3PO2H 2R7FA 4GKJQ 3OYYA 3CCQA 4GLXA 1HNZQ 4LF6L 3K7AI 1R9TI 2UUCL 2NZHA 4LF7Q 3WWVA 2R7ZG 2NZOA 2RF4A 4A3DH 3RZOH 4J15A 2R93I 5M5XH 2NVYH 3TEHB 2YU9I 2YTYA 1VQLA 4R4TA 2KCMA 2ZJPA 4GNXA 4L5SA 4LFCQ 1YJ9A 1KIXA 2VUMG 3S1NH 4A3IH 2JA7G 2OQKA 1Q1EA 1CSPA 4A3EG 1WCMI 1CKMA 3NELA 1PH4A 5LMUL 2AHOB 1L1OC 4C3IH 4JV5Q 2NN6G 2VQFQ 3L2PA 4JG2A 1C0AA 3CCEA 4OO1I 1SROA 4GN3B 3KDFB 3EN2A 1SLJA 1JT8A 3PV0A 4A4IA 4K0KL 1YHAA 4XX2A 5IYCH 1TWAI 3OW2A 4DUYQ 5C4XH 5BR8Q 1JMCA 4A3LG 4A3II 4BY7G 2JEBI 1HNXQ 2OTLA 3F8TA 5JJLA 4X62L 3GTQH 3GTMI 1HNWQ 1QYPA 1IBMQ 3AEVA 1IBLL 4BY7H 5M3MG 4BY1G 4L5QA 3HKSA 4A3LH 5C4XG 1T9HA 4DR3Q 1L2FA 2C35B 4PZ8A 5IYCG 2NVTH 2UUBL 4DV7Q 4DV4Q 2PMZE 1YJNA 3HOZG 1NMFA 4BBSG 4R1JA 4A3BI 2PI2A 3J7ZC 1I94Q 1QZHA 4X65L 4JI4L 4A3BH 3CCVA 4Y52I 1XNQQ 4HIMA 4A76A 4DR6Q 2UXBL 1VQBA 1VQCA 5M5WH 3HOYI 3FKII 2WAQE 3K81C 4POFA 5C44G 5IYDH 1J5EL 4GLAC 2JQOA 3KF6A 3M4OI 4LF4Q 3TS2A 2VY3A 4A3JH 1XMOL 1EIYB 3S1MI 1Q1BA 2Y0SE 1XNQL 2DGYA 1QUQB 4A3FH 4HIKA 1N8RC 3K80C 4A3CI 3AFPA 3CD6A 2MO0A 3GD7A 3S1RH 3Q8DA 4AH6A 4DR5Q 5C3EI 2XTIA 3HOUG 4A93I 5C0XG 4JCVE 5IP7H 2N78A 4DR1Q 4BBRH 1SN8A 1N9WA 2PQAB 3GCFA 4EQ5A 1KC8C 3GO5A 4A3JI 1UE7A 4A3IG 2JA7H 2I5LX 1L1OA 1SR3A 3M7NA 1X6OA 3TS0A 1PH8A 4A3GH 1EWIA 2BA1A 1Q8KA 5GAHC 2VNUD 1YUAA 2K14A 1TWCI 4NXNQ 2EIFA 1NUIA 4JI3L 1TWCH 3TRZA 1X54A 1VQDA 2WAQG 1KD1C 5IP9G 4QTTA 1YHBA 4P74A 1E1OA 1LTLA 4JI2L 3A5UA 3PSIA 1IBLQ 4DV4L 1VQ9A 1K8GA 3S17H 2UXCQ 1USPA 2JA5I 4QGUA 4JI8Q 2GN5A 4GNXC 3GTGH 4TQUS 3STBC 2UXDQ 3HOVI 1VQPA 1HZCA 3ESWA 3W1GA 4YY3L 1HJPA 1G291 2WP8J 5E7NA 5FLMG 4DR3L 4OWWB 1SFOH 2ZJQA 1VQEA 1BVSA 5M3FG 3S2DH 3F1ZA 1SFOI 1ZB8A 3S14I 2JK8A 3J81c 1E22A 3M9BA 4OWTB 3J81j 5C4JI 2Q2HA 4IFDI 2A19A 2JA8H 1AH9A 2ZTDA 4A3DI 1PH2A 1NMGA 3CMAA 3B6YA 2JA5H 4B3SL 4DR6L 3HOYH 4BBRI 3RLFA 4A3EI 4A93G 4IOAA 3CC4A 1W3SA 5LMNW 1AE2A 4DR5L 2A1AA 2NN6I 4YWKA 4DK6C 2HIXA 3I4NG 1VQHA 2PK7A 1J6QA 3PUYA 1WW9A 4IPHA 1X55A 2Y0SG 1K8AC 4RG1A 3ULJA 1S3OA 4UP9A 5JEAG 4A3CH 1FGUA 4KHZA 5FLXc 4DV5L 3J81i 3HOXI 4PMWA 4X66Q 3FP9A 4LF7L 3LUSA 2JA6G 1MIUA 4A3LI 1VS0A 3S2HI 3GDEA 1PFSA 2R6GA 4LWCA 3ULPA 1MJCA 1CSQA 3I4OA 1X3ZA 1YZ6A 1K83I 2E2II 4X6AI 4IPDA 4DK3C 1XPUA 1VQOA 2K5HA 4MNOA 3CPFA 5LMNQ 2F4MA 4O0AA 1C7YA 4B3ML 1G51A 2UU9Q 2JA5G 1RO4A 3LGJA 4UP8A 5K36G 3A0JA 2K5NA 2KHJA 4LUOA 5ELOA 5LMUQ 4JI3Q 3GTJI 1Y1WI 3S2HH 4GLVB 1CUKA 3CC2A 4FDBA 4YHHL 2R92G 4TVAB 2DE5A 2VUMI 4DUZQ 1X3EA 1VQNA 3KFUA 1EOVA 3CPWA 1UE6A 1WJJA 1X56A 2IHFA 1L0WA 1R9TH 2AKLA 3HOXH 1KQSA 5BR8L 1X9NA 3TQYA 1TXYA 4UPAA 2LXJA 3PO2I 3GTOI 4R4IA 4XIGS
chains in the Genus database with same CATH superfamily
2SOBA 5ELCA 4K5XA 1N33L 4JBJA 4JI7Q 4BA2I 3BZCA 4DR4Q 4IPCA 2B39A 1C8CA 3H0GH 2YYZA 3D6CA 1NTGA 5H1SE 3H0GI 2CQAA 2PMZB 4J8QA 5IP9H 4JI4Q 1WI5A 4DV7L 2K5RA 1P8LA 4KTAA 4Y7NI 3S1NB 4JBKA 2L0CA 3S2DI 5HURA 3H09A 5M5YH 3IRBA 1B7YB 1XMQL 5JVG3 2PYKA 2MNAA 5KNDA 3M4YA 1EYAA 1VQ7Z 2F0OA 1IHZA 1PVOA 3X3NA 2NVXI 2F52A 2PNHA 1OXTA 1U0LA 1E1TA 2F4VQ 3H94A 5D1OB 4KKUA 3A55A 4JV5L 4YCUA 2OTLZ 3L7ZC 1D7QA 1FJGL 4HJ9A 1Q46A 1N36L 3I4MB 4BY7B 1AN8A 2SNSA 5C5LA 3U50C 3H3VI 1S40A 5BN5A 3K7UC 3CAMA 2A73B 2CWAA 3OMCA 2UU9L 5HY6A 2F0JA 3IF8A 1HFGA 2JA9A 4KY7A 1EUJA 4E2ZA 4DR7Q 4IPGA 3HOWG 1I3QI 2NVQH 2DNEA 3CCV1 2MFIA 4K6LA 2R7ZB 4BY1H 2HQLA 3PUZA 3TSSA 1N32L 4NP5A 5CV8A 5DLQE 1GOZA 1I4XA 1QNUA 4CL1A 2YV5A 1EY5A 1YIT1 1LQLA 3H3VH 2B8GA 4FXDA 1K0SA 1C48A 1G6PA 5C44B 2VB2X 3I56A 3GTGI 2KENA 2AWNA 3TMEA 1ZH1A 4BBSI 2CQOA 1VCIA 3A54A 2K52A 2GTHA 3QG1A 4RVFA 1FVIA 1A0IA 1WTRA 3PO2B 5JEAJ 4A3DG 1IBKQ 1F2MA 4NBAA 3CC7Z 4LFAL 2JSOA 1D5XC 1Z02A 1A8VA 4E31A 4HJAA 4K6DA 3I4NI 1HUNA 5LMNL 3FKIB 1M1KC 4I7ZC 4RFBA 4DNIA 2EY5A 5JPMC 3S2DB 5D1OA 1HNWL 1RJTA 2E75C 1VQ81 4G7OC 2XWBB 2UXDL 5AJ3Q 5CBAE 2E2IH 2A6HC 1WD1A 5EQ0A 4DPGA 4JI5Q 4HIDA 5C3WA 3DM3A 3RUZA 2YU9B 1HQRD 1I94L 4BBSH 1PRTF 1I3QH 1MHWC 5J3BA 1UEBA 3S14H 1XMOQ 2KBNA 3C46A 1Z9FA 2WB1E 1EFWA 2WB1G 1HUMA 2IT1A 1VQM1 2AQ1B 1L0YB 1LABA 1HRJA 1XXGA 1PYBA 2F0VA 4TNUA 1IL2A 4G7ZC 4RH6A 4HMIA 2BH2A 4B3TL 2R3ZA 1H9RA 3CCMA 1HNZL 1IW7D 1XPOA 1V1QA 1YHQA 3RLOA 4XQQA 3G6E1 4A3KH 1RO2A 2JS4A 2ZXPA 3G711 3MZ5A 2VB3X 3CW2C 1LUZA 1O7YA 2GVAA 4C2MH 5C4ZA 3W5OA 1PDQA 3CCE1 1F2YA 2F0QA 4YHHQ 3D9XA 1I6HH 4N8FA 1K731 5IP7I 4MRIA 1HZBA 1K28A 3PUWA 4RVDA 3P5JB 3EQLC 5BN3A 4OIJA 1TFIA 2EJFC 2PZUA 3NH4A 1IYUA 1SYBA 1CKOA 1TS3A 1JJGA 5C3EH 5EAYA 1K8MA 2AQ3B 2L4NA 1STNA 3LWUA 1HR0Q 4HMJA 4B3RL 3S17B 3MTSA 2YTVA 4IUNA 2JIMA 2F0SA 1TKWB 1ENFA 3D8GA 4JOIA 1EEID 2PO4A 1YJWA 2NYZD 4JOIC 1BBUA 5IGCA 1TQOA 3CQZI 1X65A 1N34L 1X0TA 4LFCL 1CQFA 3EA6A 1EWCA 5F2DA 4DV2L 1M90C 3CCUZ 2L5TA 1RDPD 2F0TA 4NBGA 1HXYD 5A2QL 4X64L 3T13A 2JIPA 4HCSA 2F0MA 4ILWA 5KYIA 5D14A 2KQ3A 2M00A 4XQJA 4JI6L 4CDCC 2G9DA 2NVQI 1SAPA 4MXUA 1QVFZ 4JC0A 1L1OB 3J81E 4UHVA 2EOTA 3CQZB 4QL5A 1J8IA 1TT2A 1EZ6A 1D5MC 1QILA 1KAWA 5C3XA 4QF4A 1B70B 1I50H 1YNJD 2BE5D 2NWGA 3G7LA 2K33A 2XWJB 4LFBQ 4F7XA 3KIFA 3VDYA 5ELBA 2QA4Z 2D0OA 1SE2A 3S2HB 1BKBA 1EQTA 1TWCB 1QXFA 1JJ2Y 3GTLI 2E2HH 2VL6A 3DLLA 3I4MG 4X6AH 4J6HA 3AFQA 1XTCD 1RQFA 4RHSA 5D3IB 4EQNA 1VDZA 3I72A 2RHSB 3TDQA 5D3DA 2EYLA 3SDZA 4OIKA 3KLRA 1K8A1 1DOKA 1G2SA 1RTOA 2KCCA 1V8QA 2MQHA 1QVGZ 2C9OA 3EROA 1EY8A 2P5ZX 3R93A 3ERSX 2Q8IB 5HGQA 5ISRA 4A3BG 1STGA 4C3HB 4LUVA 1X3FA 1VQGA 4R4QA 4YCVA 2XGTA 2QREB 1VQFA 2EQSA 1U4MA 3E9HA 1Q90A 3U4ZA 1Q82C 4MONA 1SIWA 2O2LD 1VQ41 2K5DA 2V4DA 4QIWB 2K5WA 3CPWY 1TS5A 4FNFA 3PIPA 4DV1L 4HJ8A 1D1KA 5M5XB 2ZJRA 2F0UA 4JBMA 3K58A 1TWGI 1WCMG 2ICIA 4JI8L 2QRDB 3G48A 4WJ4A 3M7GA 1LO5D 3DWQA 3R2IA 1AW7A 1Q12A 1YI2A 3AB9A 4JBWA 3L9AX 3OIPA 4KD3A 1JJCB 1BOSA 5IT9f 4HSPA 2ATWA 3T53B 5DNFA 2NVQB 2RDFA 4JYAQ 3BU2A 1F9PA 1CZWA 2OQ0A 2Q2IA 3NBHA 2R7ZH 4BY1I 2N8NA 4JI0L 1MKHA 4N9PA 4KHPL 2CH4A 1JJ2A 3C1FA 2NTSA 1TWFH 4PMBA 3OYYA 3SVMA 1LTSD 1H9SA 2UUCL 2NZHA 4WRDA 4LF7Q 2RT9A 2RF4A 4CDEC 4LJZC 4J15A 2R93I 5M5XH 1G6ZA 4RVHA 1QVGY 4TSSA 4L5SA 2YU9I 1ZKOA 2YTYA 2ZJPA 1EU4A 5AFWA 3E6ZX 3S1NH 3Q24A 4A3IH 2JA7G 2FINB 3GTLB 1Q1EA 1ICFB 3NELA 1Q16A 3VYSA 1LTAD 1GUGA 1FNWA 2KVMA 4IUUA 5CV6A 3OW2Y 5FKAC 4A4IA 5IYCH 1TWAI 4TKOB 1YIJZ 1JMCA 4MIUA 5BR8Q 3OMGA 4BY7G 1HNXQ 4L6TB 2OOYB 5C4HA 1A3VA 4NW2A 3GTQH 3GTMI 1HNWQ 1CM9A 3W3AA 4BY7H 2JXMB 2F0IA 5C4XG 3A8KE 4Q5VA 3S1MB 4HSVA 2C35B 4DR3Q 1KDBA 2UUBL 3HP3A 2PMZE 3HOZG 4BBSG 1YIJ1 3J7ZC 2LKVA 4KKSA 4PV1C 3RZOB 3CCVA 4DGZA 4Y52I 2KI7B 3MEHA 4UAIA 3FKII 4POFA 3R2TA 1BBXC 2N88A 4ODGA 4C56C 4LF4Q 1NUCA 1NR2A 3TS2A 1XMOL 1EIYB 1QB5D 1HA6A 4A3FH 5DM63 3K80C 3AFPA 1SSOA 2ZXOA 1JOQA 5C3EI 1TIID 2XTIA 3MHBA 4A93I 5C0XG 4JCVE 1S72Z 2JA5B 1QVFY 4K2LA 1VQ51 2PQAB 1Y1VB 4KHVA 4A3JI 1L1OA 5K5PA 2R92B 3TS0A 4RA8A 5GAHC 2K14A 4C1NK 3NQIA 3FQMA 1HPCA 4LMQD 1YUKA 1X54A 4R8NA 2OTJZ 4JI2L 4KV6A 3GTKB 3J7YW 1BUVT 3VR3A 2UXCQ 4QGUA 2JA5I 4DAYA 2GN5A 3TDHB 1HZCA 4A3JB 3K0YA 1WTHA 3VR5A 1HJPA 4YY3L 2WP8J 3S2DH 2OTJ1 2NAPA 3N52A 3QR8A 2OT2A 4OWTB 4IFDI 1GJXA 2E2IB 4RS4A 5IGGA 4MN3A 3CMAA 5CV7A 2HUGA 2K1BA 5M3FB 4E33A 3OSOA 5LMNW 1AE2A 1LTID 2HIXA 2PK7A 4C3JB 4IPHA 3TBIB 1QWYA 5FO7B 3KLSA 4KHZA 1JOOA 5FLXc 3HOXI 3GTJB 1SNPA 4KKTA 4LWCA 2NUCA 4DK3C 3TZUA 2E2II 1STYA 2K5HA 2KEEA 1DOMA 1C7YA 1EOTA 5E3FA 3NH5A 2E76C 2K5NA 2KOLA 1WJ2A 2KHJA 4JI3Q 1CTMA 1KNAA 3VR6A 2Z4IA 4DUZQ 1VQNA 1EOVA 1B53A 3CPWA 1R9TH 1B1ZA 2RDHA 2K5QA 1L0WA 3UI2A 3HOXH 1EY4A 1NJI2 5FO9B 4DR7L 3T51B 4R4IA 3RZDB 5NUCA 5KNCA 2F03A 5CGKA 2F4OA 1I4QA 5EPJA 1RLYA 4OXPA 2Z0SA 2N3SA 4QUFA 3NTIA 3P1HA 2DE6A 2YTXA 2RPRA 1J5EQ 4BS9A 5JPNC 3PGZA 3BJUA 1SNOA 4LF8L 1A2TA 2B2WC 3J80i 1NE3A 3CCEZ 2IJ0A 5FLXE 1PYSB 3ERQA 1B50A 5CYUA 5IT9E 4GKKL 1NNXA 1TVXA 1VQ5A 2FMMA 1ENCA 1A63A 4RGNA 3FHWA 2E2JH 4FXKC 1AFPA 4LK1C 2R7ZI 2B2VC 2BDNA 2BOSA 1B8AA 5LL6f 1SYGA 5IYBH 2FJ2A 5J22A 3RR5A 2JA6H 4BA1I 1K73C 5IYDG 1ASYA 4DKAC 3HKZA 3VMGA 4HAEA 1E7ZA 3R8BA 1VQ5Z 3HOZH 1D5ZC 3FRPB 4R9WA 3CXCY 4RV9A 4HJ7A 2F3IA 4LF9Q 1YI21 2K3RA 4XYQA 2LIYA 1M902 1Y14B 4HGZA 3OPOA 4KD4A 5FJ8G 3KJPA 2UUAQ 3I70A 2I5MX 5FLMH 1GHJA 2MPMA 3NENA 4DAPA 1PH3A 4B9WA 4CJ1B 3AQQA 3I561 2PMZA 1AA6A 3O13A 1YVCA 2NB0A 4B3SQ 2F3WA 5KRUA 4HIOA 4LF5Q 2O5JC 4QIWE 2PPBC 4JI0Q 1XMQQ 2W04A 2JA8B 1PFBA 5EGTA 5T1GA 1PFNA 1CK1A 2GA4B 3T56B 1UE1A 3F2CA 3TE5B 2Y0SA 2EY6A 2VZAA 1RNIA 3PF4A 2NBFA 2K6AA 1YJ9Z 3NEMA 4AQYQ 2VQFL 5T1IA 3UE1A 1N8R1 3PO2G 1X3GA 4APVA 5I2YA 4C3HH 3EIVA 3ULLA 3S1QI 2HDLA 1XTDA 2A6ED 4QY7A 3H3VJ 3R3OA 2ALYB 1RD9D 1Y1VS 4ULLA 3Q23A 1RO0A 3P75A 2A68C 4A3KI 1M1K2 2Q8RE 2VUMB 4IZ8A 1OXSC 1WCMH 3HFZB 5KIXA 1ET6A 1Z47A 2EDGA 2PW5A 3Q0AA 3T1YL 2JA7I 2PM9A 3A7LA 2EXDA 1LT3D 4GNXB 2DJGC 3GTMB 3J81L 5IWAQ 3G4S1 1NY4A 4FF2A 2KCTA 1HCZA 4E32A 1P16A 3CD6Z 1K3BC 4HTHA 4IN3A 1VQMA 3CC7A 4IOCA 4B3MQ 5CV5A 4A3FI 1MD2D 2MO1A 4NFRA 2LMCB 5IY0A 1KHIA 3BZDB 3DWAA 1TWHH 2PQEA 3KOJA 4NXML 2QF7A 2F0HA 4OX9Q 4LAAA 1X3QA 4DV6Q 2ES2A 1STHA 1TWAH 2FMCA 3MXGA 4IURA 1VQLZ 4YWMA 4YWLA 3MEFA 4KJNA 1WCMB 3F2UA 1HHVA 1D1IA 3HOZI 2C5CA 5I9OA 2QEXA 3I4MH 3NK9A 4A3MB 2GVBA 3HOWH 2E8GA 2HHHL 4QMGA 3IFTA 2K75A 5ELNA 4IFDH 1AP0A 3CCRA 2J6AA 3JAMi 3CF5A 1W2BA 4IUPA 2WAQA 1VQPZ 5HGTA 1KXLA 2X6LA 1I5FA 3PMFA 4YY3Q 4L5TA 3D4DA 3S15H 1S4ZA 3CU7A 4H02A 3TP8A 5C0XI 1X32A 2K4KA 3RN2A 2E2HI 3OHXC 5FO8B 1SYEA 1MSGA 1PZKD 2A74C 2Q2TA 4NBCA 2AMCB 2NVTI 3T1HL 1HR0W 1RODA 4ZCKA 1AE3A 1EL0A 1UE5A 2EZVA 4JI1L 1DGSA 1BNZA 3M4OH 2CCZA 3QIAA 4DR2L 2EGTA 1DYQA 2B2VA 5D1PA 2RSOA 3HG9A 3U4VA 5IGFA 1IYJB 5CORA 2R93G 1V9PA 3NWTA 1OXUA 3NH8A 4DXGA 2PZTA 4BBRB 2RQXA 3KLWA 4DAYB 1U4PA 2B8FA 4R4OA 3I4NB 4IJHA 4G7HC 2R92H 2NVXB 4MD9A 4FVMA 2K5VA 3H6MA 4YCWA 2EVBA 3MWYW 1T5XD 4QJFA 5ELFA 3VMHA 3CC21 4Y7NH 5C0XJ 2L1BA 2UXBQ 3HOWI 1EYDA 4NPSA 4BY7I 4B3RQ 2P3YA 3GTKH 3ITPA 2DE7A 1U5KA 2A68D 4JYAL 1VLAA 4IJLA 1W6KA 3S14B 2ENBA 4EWCA 3CCUA 1N34Q 1VQIA 2F0NA 4A3KG 3GV3A 1HH2P 4FF4A 3SK8A 4AIMA 3HS0C 4LF8Q 3F2BA 1BF4A 3HOYG 2HU9A 1CKNA 3CC4Z 1QVFA 2R7DA 4IUVA 1IL8A 4M1UB 4K14A 1LTTD 4P2CB 1PHJA 1XYIA 3MXNB 2JEAI 1Z7TA 2RBMA 4DUYL 3GTGB 3HOUI 4NBHA 4K0KQ 1B4OA 4RKBA 2H1EA 1WFQA 3GTLH 1PH9A 1F77A 4C3IG 4MZ9A 3DXJC 4ALPA 1OTCA 1YITA 1VQP1 4A3EH 1WTWA 1EYGA 1HZAA 2ZTCA 4HH4A 1VQ8A 2F0PA 1ZB9A 4E2WA 4KK7A 5E4XA 5IT9L 4PMCA 1XNRL 2XN9C 3PO3B 2D5DA 3KF8A 1CHPD 1ZEQX 3KDFA 3HOXB 1FDIA 2B29A 3UDGA 2HD3A 2JR6A 1GHKA 2H85A 4WJWA 3I56Z 4GLXA 3D4WA 1R9TI 4K5WA 1MGSA 2K32A 2R7ZG 2NZOA 4A3DH 3RZOH 3DM1A 3TEHB 4LFCQ 2KCMA 4GNXA 5M5WB 2X69A 3IAYA 3SK5A 4DA2A 1KIXA 2VUMG 3FEWX 4OEMB 2OQKA 1CSPA 4KMUC 1UUPA 3A8IE 5KGUA 1ICWA 1PH4A 2DNCA 3K5NA 5LMUL 3CCRZ 4JV5Q 2AYDA 1KD12 3L2PA 2Z4HA 4OO1I 4GN3B 3EN2A 1BCPC 3CCS1 3PV0A 1PTOB 1RF2D 2PW7A 3OW2A 3J81b 3NXWA 4A3LG 3FPPA 1PZID 1SE3A 1I6VC 4X62L 1YJWZ 1NAPA 4XYOA 3AEVA 3NE5B 4EGVA 3VA5A 4BY1G 2E74C 4Z9CB 1SBBB 1L2FA 1I50B 1YJNA 1AEXA 1NMFA 4R1JA 2PI2A 4JI4L 2EYMA 3MVVA 1I94Q 1CHQD 4A3BH 3J80b 2NVYB 4ZRZA 4CHTB 1WTQA 4DR6Q 5M5WH 2R6MA 3MXPA 3CRLC 3HOUB 3NUCA 2OZKA 2VY3A 4A3JH 1JR0D 1XNQL 2PNRC 2G2KA 5T6BA 1N8RC 3NTHA 2EY2A 2MO0A 3GD7A 2DY8A 1PTOH 3CKIB 1VQ91 1B3QA 1VQK1 4DR1Q 2Q51A 1N9WA 2B2UC 3GCFA 2DJFC 2H4OA 3GO5A 2K7VA 3HEJA 3G6EZ 4DF7A 1NJI1 2BA1A 1Q8KA 3G71Z 4NXNQ 2EIFA 4I65A 3K5LA 1NUIA 3U9SA 3V2TA 1KNEA 3OIQA 1VQDA 1SYFA 1Y69U 1KD1C 4QTTA 5T67A 1YHBA 4CDFC 1E2WA 3A5UA 1IBLQ 3I55Z 3LWEA 4JI8Q 1TY0A 3G6JB 4TQUS 2UXDQ 3ESWA 5IODA 5E7NA 1G291 4DR3L 4OWWB 5JVH3 2CVRA 1SFOH 1ZXTA 2XVSA 1WIIA 2JK8A 1EIHA 1BCPD 3EJIA 1AH9A 1A3UA 2ZTDA 1PH2A 3CMEZ 4HN7A 4BBRI 2RHBA 3CCL1 1SJED 4IOAA 3CC4A 2EJGC 1W3SA 2TSSA 1YJ91 4H13C 1YNNC 4JPBW 4MTKA 4YWKA 1GUOA 4DK6C 3I4NG 1Y1WB 4FP5D 1I3QB 1S3OA 2LEXA 4JVZA 1FGUA 3LX0A 3Q6SA 3BVGA 4PMWA 3FP9A 2JA6G 3E3XA 3AMUA 3GTPB 3S2HI 1PFSA 2R6GA 4XT3B 1MJCA 1CSQA 3I4OA 4X6AI 4IPDA 3S1QB 1XPUA 1ONLA 1LTGD 5LMNQ 1P9NA 1RO4A 5FK9C 1GUTA 3CXCZ 1TS4A 3GTJI 1WTVA 1Y1WI 4YHHL 3BYYB 4A3KB 2VUMI 1X3EA 1WTPA 1UE6A 2AKLA 2QRCB 1JJ2Z 2J7ZA 5BR8L 1X9NA 4CGYB 1TXYA 3GTOI 4XIGS 4OO1G 3NPPA 3QWUA 1MJEA 2ZM6Q 3EBEA 3CXCA 1PRTB 2KJXA 4LNQA 1E3PA 3M85A 2EYOA 2Z6KA 2B2YC 4RGMA 2A5HA 2V1CC 4DN4M 5I4DA 1EY7A 1ILPA 4A3MI 1XPRA 3HOXG 3SR1A 5EKIA 4NBFA 1DOLA 3M4QA 1VQ71 2KCNA 2KUMA 4DV5Q 3S1QH 1TWGB 3MZKB 1LM0A 4C3IB 3J7AV 4O42A 2K50A 3KK7A 2VF1A 2IX3A 2O4XA 3STBD 3D4RA 5IP7G 2RCFA 1YNXA 4O2DA 3CCJZ 3QWNA 4HEDA 1KC81 4MHEA 4NBDA 3G4SZ 4ME3A 3S15B 4ZQ3A 3F2DA 2QW7A 1JORA 3UE0A 2QDBA 4L5RC 4J1MA 4E2YA 2Z1CA 5EPLA 2OXPA 2JYOA 1YHQ1 3BZKA 3BG1B 1M4VA 1VQKZ 4PZ7A 3X3MA 3I551 4IFDG 1ESRA 4Y52H 5EBCA 3SGIA 1I4GA 4ID6A 1Q7YC 1M1K1 3Q87A 1JQYD 2KA7A 1D6EC 1QF8A 2KHIA 4JI7L 2BJOA 3UDIA 1TWGH 1BR9A 1HR0L 2VW9A 1EQRA 1JB7A 3UDXA 1O7LA 1HZ9A 5JJKA 1CQVA 5LHY1 4LF6Q 3JAMc 4X3KA 1EEFD 3BG0B 4YIJA 1ASZA 3CCQZ 2AWOA 2WIIB 3GV6A 3G6EA 3QO2A 3PO3H 4EQPA 3G71A 3T4NB 5IE8A 2VUMH 3EEDA 1OO9B 2MJ8A 3T1YQ 4NH1C 2Q4ZA 3BVMA 3GKQA 4KJOA 3CCQ1 3CCLZ 3CQZH 4FF1A 4A75A 3WDNA 5JOBA 2M48A 1E24A 3HKZG 3MXNA 4PZ6A 1B2TA 1IXRA 3S17I 1CT1D 3PO3I 1SNDA 5LL6S 2JE6I 4WFN3 4IFDJ 3I73A 2JA8I 1BXTA 2F0EA 4A3FG 4N8X1 4G4KA 2OCEA 3FPUB 4LFBL 1IBML 3CMEA 1HNXL 2JIOA 2XRSD 2CWPA 3KBGA 3MZLB 4DAMA 3K6OA 2WV6D 5GROA 1KRSA 3BG3A 5A2Qb 3PUVA 5FOBB 3L0OA 3MFGA 4LF9L 1YNND 1MSHA 3J7A5 3RD4A 2UUBQ 1EIFA 1ILQA 3S9WA 1G2TA 2R92I 3JAME 1U4RA 2LXKA 5M3MH 3HOVG 1DJRD 1DONA 2KECA 2IV2X 2ZT9C 4CJ0B 2ZTEA 4BXXG 4X66L 2BCOA 2RBLA 2HIVA 2ZXRA 4B9XA 2ASBA 3H0GG 1V1PA 4N9TA 1BBWA 1I4PA 2GTIA 3DWPA 2MP1A 3NTKA 3TP7A 2QR1B 2IPKD 3AYHB 3TN2A 3T1HQ 4A3IG 2JA7H 3GQBA 1N2FA 3I8ZA 2JMOA 4OGQC 1J9OA 2E5LQ 1S5CD 3PIOA 5JAVA 1YEZA 1I6HI 3S16B 2I46A 4XTCS 1STBA 5DM73 3E0EA 1VQ4A 2Z8LA 3M4OB 2XSCA 2OTJA 2PQAA 3D31A 3VTNA 4OELB 4JI5L 1N33Q 4B08A 3GTPI 3CME1 3GTMS 1GO3E 3VYUA 1IKMA 1RTNA 3CHBD 3FVQA 1SJHD 1JE4A 4CKCA 4DV3Q 3GTOH 5E1FA 4OWXB 1L0XB 1N32Q 4KN4C 4R4CA 2HCIA 4M8AA 3CCJA 1C4QA 4GKJL 2B63G 4UY8C 3I4NH 1KLGD 1S5ED 2WB1B 4GZYC 1TY2A 2FXQA 5TSSA 1EYCA 3WOFA 2IX0A 4RHRA 3CCMZ 3PF5A 4RAUC 4LF4L 2D0PA 1EY0A 4A3BB 1GXDC 4E6IA 1DXMA 1VQ9A 1UWVA 1T5EA 4WORA 5M3FH 1N36Q 5A2QE 3K7AH 1Y1WH 1PTOC 2KHSA 5IT9b 5G3LD 1QJOA 1VQOZ 1O7IA 2LFNA 2RIQA 3U58A 2JIQA 3JAMb 3I07A 2QEXZ 2QEJC 1A62A 3S1MH 2NVTB 1FNVA 5FLMI 2CFMA 1QNKA 1Q811 5D65A 4A3GG 2IY5B 3FKIH 2WKCA 3RMHA 1F9RA 3CPWZ 3SE0A 4PG3A 1WZNA 2K05A 1SNMA 1GVPA 4DR4L 4BBRG 3RNUA 1C9OA 2GU2A 1H9SB 4K2KA 1IZ6A 3K5OA 1Q3LA 2Z6KC 2XNAC 3CP0A 3V96A 1JWSD 1GKHA 5FLXL 4K5VA 3RZDH 1JWUD 1O80A 4A3JG 1WYDA 1XNRQ 1VQ7A 3KJOA 3FDTA 2E2JI 2W03A 2VS1A 1WTOA 4GOPC 1KL9A 4XQNA 2UUCQ 2K03A 2F4VL 4RVGA 3W1BA 4B3TQ 3S24A 3D3RA 4KLKA 2AQ2B 3OW7A 1PYWD 1FYCA 3V05A 4RGTA 5IWAL 1Y1VG 2E9HA 3K8AA 1Y1WG 2VQEL 5EKKA 1M901 1LLRD 3HKZB 3PCOB 3J80c 3QJYA 3TZDA 1JWHC 1CI3M 2JN4A 3JAML 4NBBA 3GTJH 4BY1B 2AUKA 1GUWA 2E2JB 1Q8IA 2PI2E 1K83B 5CV4A 3J80E 5COYA 2KPIA 2QILA 1K3RA 2Q2UA 4LW1A 2EYPA 4ZUIA 2QGQA 3RLNA 3OTOL 2RDGA 1G91A 4QQBX 4GOPB 2B63H 3S15I 2D9UA 4DFAA 2F0DA 4V0BA 2E2DC 3HOZB 5FLXf 5IP9I 4OONA 1D8LA 2F0FA 1OXVA 4U68A 1V43A 4XT1B 1Q86C 1QVCA 1ML0D 2V3VA 4QTUA 3CCVZ 1FL0A 1NCVA 2KEDA 4P72A 5DAUA 3RZDI 3KIHA 2VUGA 1FD7D 1WOCA 3BDLA 4CDDC 5JJZA 3PO2H 1HNZQ 4LF6L 3VR4A 1JC7A 5IOCA 4C3JG 2CW0C 1AZPA 1ENAA 4S3SA 3SK6A 2NVYH 3DEOA 3MXUA 2BE5C 1VQLA 4ZLTF 3VR2A 3CC71 3PQIA 3OW2Z 4X3SA 4ABNA 5CBEE 3DEPA 2EPBA 2QKDA 4A3EG 1K732 2FHTA 4C3IH 2VQFQ 4JG2A 3BYTB 1SLJA 1YJNZ 1JT8A 2M6NA 2L55A 1YHAA 2HQEA 1BQQT 3IL8A 5C4XH 4DUYQ 1RHPA 1KQSY 5JJLA 3F8TA 2E7ZA 3H0GB 3FQQA 2B2WA 5M3MG 3HKSA 4FO2A 5IYCG 1LT6D 4DV7Q 3I4LA 2QA41 3PIO3 1QZHA 4X65L 3NSWA 1SNQA 1ZYRD 1DZ1A 2UXBL 1VQCA 5IYDH 3HOYI 3K81C 2X6GA 1Q861 2L9HA 4PQXA 1J5EL 1SYCA 3KF6A 3M4OI 1PTOD 3CMAZ 1Q1BA 1K8A2 4E2XA 3A56A 2DGYA 2D2CC 4A3CI 4ZYSA 5M3MB 4C2MB 3MAQA 3CD6A 4QCLA 2OF1A 4AH6A 2A6HD 3HOUG 3CRKC 3HZXA 1KTKA 1VQL1 4DNTB 2FFKB 5C4XB 1EQVA 1SN8A 4DU9A 1UE7A 1H9JA 1VQMZ 5EBDA 5KNBA 2I5LX 4FF3A 4E30A 4F8MA 1X6OA 1EWIA 1KLUD 1SDFA 2VNUD 1YUAA 4RCNA 1TWCH 3K57A 3TRZA 2WAQG 2HDMA 3F3PC 5E4WC 1E1OA 3K5MA 1LTLA 2XRQD 5DEHA 3WOEA 1M8AA 1VQN1 3PSIA 4O1NA 1K8OA 4DV4L 1K8GA 4L63B 3K59A 1USPA 2F0GA 1VMPA 4GNXC 3HOVI 1SE4A 1AZQA 3W1GA 3J81f 3E0JA 1VQEA 3ZYYX 3F1ZA 1SFOI 3J80L 4X3UA 3J81c 1E22A 4DK0A 2LS01 5C4JI 1A15A 2Q2HA 2JA8H 1W6JA 5A2Qf 4ZUJA 1KABA 2WAQB 4DR6L 4B3SL 3RLFA 1IKLA 3U9OA 4DR5L 2NN6I 4H7BA 4A3GB 5G3LF 1VQHA 1PMRA 1JICA 1J6QA 3PUYA 2EYHA 1X55A 1K8AC 2F1MA 1DM0B 4RG1A 3ULJA 2DN8A 4UP9A 4F87A 5JEAG 4LF7L 3HOVB 4DV5L 3J7AF 3CCM1 4XDXA 4JW0A 2F0WA 4A3LI 5J1ZA 1II3A 3ULPA 5C5MA 1X3ZA 1K83I 2EJMA 1KQSZ 1B44D 1KAAA 1EZ8A 2V8IA 1Y8CA 2F0LA 3NDJA 4O0AA 1NSNS 1G51A 2I3CA 2UU9Q 4B3ML 4MD8A 1VQ8Z 3LGJA 5LL6X 1IYVA 1Y8PB 3A0JA 5K36G 5LMUQ 4LUOA 2F3VA 3S2HH 4GLVB 1CUKA 1SYDA 4FDBA 3CC2A 2E2HB 1X56A 1SMYD 1KQSA 3TQYA 1FDOA 2LXJA 4MNOA 4UPAA 3ZJYC 2QA4A 3S16H 3MFYA 4KHPQ 4JK1C 4IUQA 1TR5A 3CC2Z 3TP6A 2NVXH 1GUNA 1CA5A 5JJIA 3GTMH 2R93B 2RHQB 3NBHB 1O78A 3JC66 3KF8B 2IX1A 4GN5A 3ER0A 4HR7B 3GTOB 3OOCA 3FMCA 2K04A 1ML8A 2SDFA 4P71A 4DV0Q 1TS2A 1S7MA 2QLVB 1FNUA 2I0QA 1RIPA 1BDOA 1XJVA 1GM5A 1PA6A 3NDIA 1SRUA 1LACA 1LYLA 1IBKL 3S16I 1I6HB 1BCPF 4LFAQ 3S1NI 3RN5A 3GTQB 5I6WA 3KF6B 1WTXA 4NXMQ 1LT4D 5L37A 3LNNA 4AQYL 4A3MH 3P7JA 4DV6L 3HOWB 1H9MA 3DUZA 1TWHI 1CKNB 2VQEQ 4A3CG 2V8KA 3A74A 2WINB 3D2LA 4H44C 4RMFA 1PH1A 4GS3A 3MONA 3C1EA 1VQNZ 5C3EG 2VPXA 2NTTA 4KY5A 1PZJD 1PLFA 2G5DA 3NP8A 1H95A 2HHHQ 1YI2Z 2Q8TA 1YITZ 1PV4A 1B3AA 2ZAEB 4NOZA 2O5IC 1QG7A 2AKWB 1U4LA 1PH7A 2A6EC 4RGOS 2RKSA 5M5YB 4POGA 1GUSA 1Q7Y2 2CHBD 3A8JE 4DAVA 3H91A 3OTOQ 1K9MC 2EXZA 2LFUA 4C1NI 3HGBA 1VQJA 3KYHC 1KRLA 2JA6I 1VQ6Z 3EERA 2B63B 1RKNA 3PIP3 2SNMA 3KLSX 1KD11 1PRTC 2K01A 1F9SA 4GOPA 4ZKCB 1Y1VI 2D62A 1Z03A 1PFMA 4A3IB 5ELDA 1DL6A 3BDOA 1RL2A 3G4SA 4JI6Q 5M9OA 4BXXH 5FJ8H 3H15A 3CCSA 3TREA 5IGEA 2WKDA 2BDOA 2B2TC 3VYTA 3I55A 1XWEA 2PZWA 1UNSA 1B9MA 1SMXA 2IL8A 3GTPH 3VYRA 2B2YA 4OX9L 2L15A 1ESFA 3QOLA 3BVZA 4HGYA 2EYFA 1VQAA 3CCSZ 2BA0A 3GP7A 1OXXK 5KEEA 1USPB 2E5LL 1E0BA 5KYLA 3VB9A 1W2BY 4A3MG 4DNRB 5IYBG 1A6XA 4X62Q 5C44H 4NB8A 2AUJD 2IHEA 1QCBD 2DY7A 3K0XA 3NFZA 1G8ZD 1F9QA 2A69C 1LTBD 5I9PA 1W2BZ 2I5HA 3HKZE 1PH6A 2N55A 2P28A 5IGDA 2ZM6L 3MC0B 3AU7A 3S1RB 1PH5A 4FXGC 2OOXB 2ICEC 2N49A 1CA6A 4ME5A 1Q822 1Y1VH 2JNYA 1UEAB 4DV2Q 2B3GA 3M3YB 3PO3G 3CCLA 1RCVD 1I4RA 2G9HD 4NB9A 4GKKQ 3A7AB 1JE5A 1F2ZA 1VQ4Z 5J39A 2OWOA 3EVQA 1S72A 4DV1Q 4LUZA 1R9TB 1SE8A 4KN7C 1I50I 2K28A 5GAEC 2LSSA 2HT1A 2WB1A 5AJ3L 4A3DB 4DUZL 2YU9H 1Q821 3MA2B 4A3EB 2XIWA 1STAA 5K36H 1E2VA 1YHQZ 4JI2Q 3URYA 4MH4A 3KBXA 2V45A 3IR7A 1YBYA 5GADC 1IW7C 3H3VC 4NBEA 3BS1A 1R4PB 5C4JH 2M9VA 3UDFA 4CBVA 1KRTA 2IZ4A 1EFID 1VMCA 4KI0A 2F0KA 3FKIG 4WJ3M 2H5XA 4CJ2C 4DXFA 5CC4A 3OWEB 4DGLA 1QUQA 1TWFB 3OWFA 1YIJA 1FR3A 3M3YH 5IT9c 5JEAH 4IQZA 2O4HA 3D0FA 1QZGA 2QKIC 4I7AA 4H0LC 2JJQA 5CR3A 4V190 4GN4B 3QOJA 3I4MI 2Z6BA 1K9M1 2L12A 1EQQA 4F88A 3JAMf 4EX5A 3GTQI 2JA8G 3VMIA 2J0TD 1Y8OB 2MUYA 3RZOI 1XNQQ 3PUXA 2ID0A 1Q862 2HF1A 2JP1A 4EVOA 4IUTA 1VQO1 1BCPB 5C4JB 4EQOA 3SEBA 2A8VA 4AYBE 3I2ZA 1EY6A 3S1RI 5IGBA 3ND8A 1Q81C 4A93B 4KY6A 1VQ6A 3P20A 1GD7A 3M3YI 4S1TA 5C44I 1JOKA 4RCOA 1EY9A 1X3WA 2EE1A 2UUAL 2B63I 2DUDA 2NZ1D 4P75A 2YADA 4BXXI 2TMPA 3CMA1 1K0RA 3I91A 5BN4A 2RVLA 1YNJC 3EFXD 4OHJA 3E5SA 5C0XH 4HJ5A 1NBWA 2WFWA 3HOUH 5AN9F 2B2UA 1V1OA 1K83H 2EY1A 1JWMD 2RSNA 5CM2M 1HFNA 3I7FA 4IALA 3E9IA 2BH8A 2A69D 3A5ZB 5C4XI 1TU2B 4AYBB 4X64Q 4U673 2HCCA 3NHHA 3ICEA 1NJIC 1VQ9Z 1U9RA 3NQTA 1KDAA 1PTOF 2I07B 1DCZA 2R93H 3D6WA 1CZGA 3M4PA 1FJGQ 4QUCA 4DR1L 5GQOA 4MTNA 2CW0D 4JI1Q 4A93H 1DD2A 4X3TA 4DV0L 1PRTD 1TWFI 4DR2Q 2CKZB 4CKEA 2MHVA 1QVGA 3T4AC 1F2LA 2B2TA 5I6YA 2NVYI 4NXNL 3GTKI 4A3GI 4XXEA 5EPKA 1VQKA 3HOVH 4AYBG 2UXCL 1HTPA 2OTL1 4IO9A 1SFOB 4P73A 4NB3A 1PFTA 1STEA 1VQ61 4UP7A 1X3PA 3PO3S 5GAGC 3I3CA 2Z9HA 1QE6A 5IIFA 2RCNA 4DK1A 4DV3L 4C3JH 3DMUA 2QDLA 4X65Q 1K9M2 4ZK9B 4UDUC 4LF5L 3SK4A 2R7FA 4GKJQ 1WVLA 3CCQA 5EJWA 4L8JA 3CCU1 3K7AI 2OEOA 3WWVA 4RWSC 1A3TA 1TWAB 1WD0A 1HTLD 4R4TA 5CV9A 5ELEA 1YJ9A 3NBIA 4NMZA 5T64A 1WCMI 4BWGB 4AYBA 1CKMA 1HA5A 2AHOB 1L1OC 2NN6G 1C0AA 4DQYB 1BO0A 2JUBA 2LY7A 3CCEA 1SROA 3KDFB 1MBYA 4OL7A 4K0KL 3K7AB 4XX2A 1LV9A 4ZAIA 4PNYA 4K8JA 4A3II 2JEBI 2OTLA 2M2LA 3N6RA 3DHQA 5EKLA 1O7ZA 4BBSB 3BDCA 2QCPX 3SHLA 1QYPA 1IBMQ 4FYDA 2R61A 1IBLL 2JIRA 4L5QA 4A3LH 1T9HA 1YJW1 2NVTH 4PZ8A 2O53A 3W2DA 4DV4Q 3Q22A 1N8R2 1D2BA 2IWHA 5CMDA 4A3BI 3J7A4 2NN6H 4HIMA 1R4QB 3SXHA 4A76A 4ZKBB 3C3LA 1VQBA 4RKLA 1NP6A 1XX8A 2IW3A 1NR4A 2WAQE 4QB4A 5C44G 4GLAC 1FGBD 2JQOA 3CC41 2CH4W 5FLXb 3S1MI 1V1PB 2Y0SE 2IZ3A 1CFMA 1QUQB 3QB3A 3CCJ1 4HIKA 1Q7Y1 1ET9A 3CD61 1KC82 4C3HG 1SMYC 2F4IA 3S1RH 3Q8DA 1EIGA 4DR5Q 1S5FD 1TWHB 2JA6B 5IP7H 2N78A 4K8IA 2VPYA 4BBRH 4CKBA 3HOYB 1HQMC 4EQ5A 1KC8C 1H9KA 1EU3A 1S721 1I4HA 1SR3A 1EWHA 1VF7A 3M7NA 4A3GH 1PH8A 2EYJA 1SNCA 1TWCI 1B9NA 3IKJA 4JI3L 3C2PA 5IP9G 5C3EB 2JA7B 4P74A 4TRDA 1MI2A 3S17H 4OO1H 4R8IA 3IX0A 2Y0SB 3KUPA 3ONAB 5C6AA 2PCFB 5I2XA 3GTGH 3STBC 1VQPA 4NKLA 5FLMG 4A3FB 2ZJQA 1BVSA 1S5DD 5M3FG 1Z01A 2VPZA 1ZB8A 3S14I 3M9BA 3J81j 4MD7A 3I90A 2A19A 4A3DI 2L11A 2VXWA 1NMGA 2JA5H 3B6YA 2VPWA 3L3OC 3HOYH 5A35A 4A3EI 4A93G 4NDXA 1JB3A 4Q0FA 1Z6HA 2A1AA 1WW9A 2Y0SG 3ND9A 2V8JA 2SEBD 4A3CH 3J81i 1Q812 4X66Q 3LUSA 1MIUA 1VS0A 1SEBD 3GDEA 3NWSA 1YZ6A 1SXTA 3IFDA 3VA7A 1A2UA 1KDCA 1VQOA 1LTRD 1QOHA 1ZYRC 1E2ZA 4HCEA 3CPFA 2F4MA 1VF5C 2JA5G 1JCKB 3CCR1 2J4XA 4UP8A 2MGSA 5ELOA 3TP5A 3IFUA 1LT5D 3HRZC 1S5BD 3T16A 1PXUA 4Y7NB 2WACA 1Y8NB 2R92G 1YJN1 4TVAB 2DE5A 2QEX1 3KFUA 1UAPA 1WJJA 2IHFA 3J80f 4G57A 2RA4A 3PO2I 3F3FC
chains in the Genus database with same CATH topology
1N33L 4JBJA 4JI7Q 4BA2I 3BZCA 4DR4Q 4IPCA 3H0GH 2YYZA 1NTGA 5H1SE 3H0GI 5IP9H 4JI4Q 1WI5A 4DV7L 2K5RA 1P8LA 4Y7NI 4JBKA 3S2DI 5M5YH 3IRBA 1B7YB 1XMQL 2MNAA 1VQ7Z 1PVOA 2NVXI 2F52A 2PNHA 1OXTA 1U0LA 1E1TA 2F4VQ 5D1OB 4JV5L 4YCUA 2OTLZ 3L7ZC 1D7QA 1FJGL 4HJ9A 1Q46A 1N36L 3U50C 3H3VI 1S40A 3K7UC 3CAMA 2CWAA 2UU9L 5HY6A 3IF8A 2JA9A 1EUJA 4E2ZA 4DR7Q 4IPGA 3HOWG 1I3QI 2NVQH 3CCV1 2MFIA 4BY1H 2HQLA 3PUZA 1N32L 5DLQE 2YV5A 4CL1A 1YIT1 1LQLA 3H3VH 1G6PA 3I56A 3GTGI 2KENA 2AWNA 1ZH1A 4BBSI 2CQOA 1VCIA 2K52A 2GTHA 4RVFA 1FVIA 1A0IA 5JEAJ 4A3DG 1IBKQ 4NBAA 3CC7Z 4LFAL 1Z02A 1A8VA 4E31A 4HJAA 3I4NI 5LMNL 1M1KC 4DNIA 5D1OA 1HNWL 1VQ81 2UXDL 5AJ3Q 2E2IH 4DPGA 4JI5Q 4HIDA 3DM3A 1I94L 4BBSH 1I3QH 5J3BA 1UEBA 3S14H 1XMOQ 2KBNA 1Z9FA 2WB1E 1EFWA 2WB1G 2IT1A 1VQM1 1PYBA 4TNUA 1IL2A 2BH2A 4B3TL 3CCMA 1HNZL 1XPOA 1V1QA 1YHQA 3RLOA 3G6E1 4A3KH 1RO2A 2JS4A 3G711 3CW2C 1LUZA 2GVAA 4C2MH 3W5OA 3CCE1 4YHHQ 3D9XA 1I6HH 1K731 5IP7I 4MRIA 1HZBA 3PUWA 4RVDA 3P5JB 1TFIA 3NH4A 1CKOA 1JJGA 5C3EH 5EAYA 1HR0Q 4B3RL 2YTVA 1YJWA 4JOIA 4JOIC 1BBUA 3CQZI 1X65A 1N34L 1X0TA 4LFCL 4DV2L 1M90C 3CCUZ 4NBGA 4X64L 4JI6L 2NVQI 4MXUA 1QVFZ 4JC0A 1L1OB 4QL5A 1KAWA 1B70B 1I50H 4LFBQ 3KIFA 3VDYA 2QA4Z 2D0OA 1BKBA 1JJ2Y 3GTLI 2E2HH 2VL6A 3DLLA 3I4MG 4X6AH 3AFQA 1RQFA 2RHSB 1K8A1 2MQHA 1QVGZ 3ERSX 5HGQA 4A3BG 4LUVA 1X3FA 1VQGA 4R4QA 4YCVA 2XGTA 2QREB 1VQFA 2EQSA 3E9HA 3U4ZA 1Q82C 4MONA 1VQ41 3CPWY 3PIPA 4DV1L 4HJ8A 2ZJRA 4JBMA 1TWGI 1WCMG 4JI8L 2QRDB 3G48A 4WJ4A 1Q12A 1YI2A 4JBWA 1JJCB 5IT9f 2ATWA 4JYAQ 3BU2A 2OQ0A 2R7ZH 2Q2IA 4BY1I 2N8NA 4JI0L 1MKHA 4KHPL 1JJ2A 1TWFH 3OYYA 2UUCL 2NZHA 4LF7Q 2RT9A 2RF4A 4J15A 2R93I 5M5XH 1QVGY 4RVHA 4L5SA 2YU9I 2YTYA 2ZJPA 3S1NH 4A3IH 2JA7G 1Q1EA 3NELA 3OW2Y 4A4IA 5IYCH 1TWAI 1YIJZ 1JMCA 5BR8Q 4BY7G 1HNXQ 2OOYB 3GTQH 3GTMI 1HNWQ 4BY7H 5C4XG 4DR3Q 2C35B 2UUBL 2PMZE 3HOZG 4BBSG 1YIJ1 3J7ZC 3CCVA 4Y52I 2KI7B 3FKII 4POFA 4LF4Q 3TS2A 1XMOL 1EIYB 4A3FH 3K80C 3AFPA 5C3EI 2XTIA 4A93I 5C0XG 4JCVE 1S72Z 1QVFY 1VQ51 2PQAB 4A3JI 1L1OA 3TS0A 5GAHC 2K14A 3FQMA 1YUKA 1X54A 2OTJZ 4JI2L 2UXCQ 4QGUA 2JA5I 2GN5A 3TDHB 1HZCA 4YY3L 1HJPA 2WP8J 3S2DH 2OTJ1 4OWTB 4IFDI 4RS4A 3CMAA 4E33A 5LMNW 1AE2A 2HIXA 2PK7A 4IPHA 4KHZA 5FLXc 3HOXI 4LWCA 4DK3C 2E2II 2K5HA 1C7YA 3NH5A 2K5NA 2KHJA 4JI3Q 4DUZQ 1VQNA 1EOVA 3CPWA 1R9TH 1L0WA 3HOXH 1NJI2 4DR7L 4R4IA 2F4OA 1RLYA 4OXPA 2Z0SA 2N3SA 2DE6A 2YTXA 2RPRA 1J5EQ 3PGZA 3BJUA 4LF8L 3J80i 1NE3A 3CCEZ 1PYSB 4GKKL 1VQ5A 1A63A 3FHWA 2E2JH 2R7ZI 1B8AA 5LL6f 5IYBH 3RR5A 2JA6H 4BA1I 1K73C 5IYDG 1ASYA 4DKAC 3HKZA 3VMGA 1E7ZA 1VQ5Z 3HOZH 3CXCY 4RV9A 4HJ7A 2F3IA 4LF9Q 1YI21 2K3RA 2LIYA 1M902 1Y14B 4HGZA 5FJ8G 3KJPA 2UUAQ 2I5MX 5FLMH 3NENA 1PH3A 3AQQA 3I561 2PMZA 1YVCA 4B3SQ 4HIOA 4LF5Q 4QIWE 4JI0Q 1XMQQ 2W04A 1UE1A 3F2CA 3TE5B 2Y0SA 2VZAA 1RNIA 3PF4A 1YJ9Z 3NEMA 4AQYQ 2VQFL 3UE1A 1N8R1 3PO2G 1X3GA 4APVA 4C3HH 3EIVA 3ULLA 3S1QI 1XTDA 4QY7A 3H3VJ 2ALYB 1Y1VS 1RO0A 4A3KI 1M1K2 1OXSC 1WCMH 3HFZB 1Z47A 3T1YL 2JA7I 2PM9A 2EXDA 4GNXB 5IWAQ 3G4S1 1NY4A 2KCTA 4E32A 1P16A 3CD6Z 1VQMA 3CC7A 4IOCA 4B3MQ 4A3FI 2MO1A 4NFRA 5IY0A 1KHIA 1TWHH 3KOJA 4NXML 4OX9Q 4DV6Q 2ES2A 1TWAH 4YWMA 4YWLA 1VQLZ 3MEFA 3HOZI 2QEXA 3I4MH 2GVBA 3HOWH 2E8GA 2HHHL 2K75A 5ELNA 3CCRA 2J6AA 3JAMi 3CF5A 1W2BA 2WAQA 1VQPZ 1KXLA 1I5FA 4YY3Q 4L5TA 3S15H 4H02A 5C0XI 2K4KA 3RN2A 2E2HI 2Q2TA 4NBCA 2AMCB 2NVTI 3T1HL 1HR0W 1AE3A 1UE5A 3M4OH 4JI1L 1DGSA 2CCZA 4DR2L 2EGTA 5D1PA 3U4VA 1IYJB 2R93G 1V9PA 1OXUA 3NH8A 3KLWA 4DAYB 4R4OA 4IJHA 2R92H 4MD9A 2K5VA 4YCWA 4Y7NH 4QJFA 5C0XJ 3VMHA 3CC21 2UXBQ 3HOWI 4NPSA 4BY7I 4B3RQ 2P3YA 3GTKH 2DE7A 1U5KA 4JYAL 1VLAA 4IJLA 4EWCA 3CCUA 1N34Q 1VQIA 4A3KG 1HH2P 4AIMA 4LF8Q 3F2BA 3HOYG 2HU9A 1CKNA 3CC4Z 1QVFA 2R7DA 1PHJA 2JEAI 3MXNB 4DUYL 3HOUI 4NBHA 4K0KQ 1WFQA 3GTLH 1PH9A 4MZ9A 4ALPA 1OTCA 1YITA 1VQP1 4A3EH 1EYGA 1HZAA 2ZTCA 4HH4A 1VQ8A 1ZB9A 4E2WA 1XNRL 3KDFA 2B29A 3UDGA 2JR6A 2H85A 3I56Z 4GLXA 1R9TI 2R7ZG 2NZOA 4A3DH 3RZOH 3TEHB 4LFCQ 2KCMA 4GNXA 1KIXA 2VUMG 2OQKA 1CSPA 1PH4A 5LMUL 3CCRZ 4JV5Q 1KD12 3L2PA 4OO1I 4GN3B 3EN2A 3CCS1 3PV0A 3OW2A 3J81b 4A3LG 4X62L 1YJWZ 3AEVA 4BY1G 1L2FA 1YJNA 1NMFA 4R1JA 2PI2A 4JI4L 1I94Q 4A3BH 3J80b 4DR6Q 5M5WH 2R6MA 2OZKA 2VY3A 4A3JH 1XNQL 2G2KA 5T6BA 1N8RC 2MO0A 3GD7A 1VQ91 1VQK1 4DR1Q 2Q51A 1N9WA 3GCFA 3GO5A 3G6EZ 1NJI1 2BA1A 1Q8KA 3G71Z 4NXNQ 2EIFA 1NUIA 1VQDA 1KD1C 4QTTA 5T67A 1YHBA 3A5UA 1IBLQ 3I55Z 4JI8Q 4TQUS 2UXDQ 3ESWA 5E7NA 1G291 4DR3L 4OWWB 1SFOH 1WIIA 2JK8A 1AH9A 2ZTDA 1PH2A 3CMEZ 4BBRI 2RHBA 3CCL1 4IOAA 3CC4A 1W3SA 1YJ91 4YWKA 4DK6C 3I4NG 1S3OA 1FGUA 4PMWA 3FP9A 2JA6G 3S2HI 1PFSA 2R6GA 1MJCA 1CSQA 3I4OA 4X6AI 4IPDA 1XPUA 5LMNQ 1P9NA 1RO4A 3CXCZ 3GTJI 1Y1WI 4YHHL 2VUMI 1X3EA 1UE6A 2AKLA 2QRCB 1JJ2Z 1X9NA 5BR8L 1TXYA 3GTOI 4XIGS 4OO1G 3QWUA 1MJEA 2ZM6Q 3EBEA 3CXCA 4LNQA 1E3PA 3M85A 2Z6KA 2V1CC 4A3MI 1XPRA 3HOXG 4NBFA 3M4QA 1VQ71 4DV5Q 3S1QH 3MZKB 1LM0A 2K50A 2VF1A 3STBD 5IP7G 1YNXA 4O2DA 3CCJZ 1KC81 4NBDA 3G4SZ 4ME3A 3F2DA 3UE0A 4L5RC 4E2YA 1YHQ1 3BZKA 3BG1B 1VQKZ 4PZ7A 3I551 4IFDG 4Y52H 3SGIA 1Q7YC 1M1K1 3Q87A 1QF8A 2KHIA 4JI7L 2BJOA 3UDIA 1TWGH 1HR0L 2VW9A 1EQRA 1JB7A 3UDXA 1HZ9A 5JJKA 4LF6Q 3JAMc 3BG0B 1ASZA 3CCQZ 2AWOA 3G6EA 3PO3H 3G71A 3T4NB 5IE8A 2VUMH 3EEDA 3T1YQ 4NH1C 2Q4ZA 3GKQA 3CCQ1 3CCLZ 3CQZH 4A75A 2M48A 1E24A 3HKZG 4PZ6A 1IXRA 3S17I 3PO3I 2JE6I 4IFDJ 2JA8I 4A3FG 2OCEA 4LFBL 1IBML 3CMEA 1HNXL 4DAMA 2CWPA 3MZLB 5GROA 1KRSA 5A2Qb 3PUVA 3L0OA 4LF9L 3J7A5 2UUBQ 1EIFA 2R92I 2LXKA 5M3MH 3HOVG 2ZTEA 4BXXG 4X66L 2RBLA 2HIVA 2ASBA 3H0GG 1BBWA 2GTIA 2QR1B 3AYHB 3T1HQ 4A3IG 2JA7H 1N2FA 2JMOA 2E5LQ 3PIOA 1YEZA 1I6HI 4XTCS 3E0EA 1VQ4A 2OTJA 2PQAA 3D31A 3VTNA 4JI5L 1N33Q 3GTPI 3CME1 3GTMS 1GO3E 4DV3Q 3GTOH 4OWXB 1N32Q 4R4CA 3CCJA 4GKJL 2B63G 4UY8C 3I4NH 2FXQA 2IX0A 3CCMZ 3PF5A 4LF4L 2D0PA 1VQ9A 1UWVA 5M3FH 1N36Q 3K7AH 1Y1WH 5IT9b 1VQOZ 1O7IA 2RIQA 3U58A 3JAMb 3I07A 2QEXZ 1A62A 3S1MH 5FLMI 2CFMA 1Q811 4A3GG 2IY5B 3FKIH 3CPWZ 4PG3A 1GVPA 4DR4L 4BBRG 3RNUA 1C9OA 2GU2A 1IZ6A 2Z6KC 3CP0A 1GKHA 3RZDH 4A3JG 1WYDA 1XNRQ 1VQ7A 3KJOA 2E2JI 2W03A 2VS1A 4GOPC 1KL9A 2UUCQ 2F4VL 4RVGA 3W1BA 4B3TQ 3S24A 4KLKA 5IWAL 1Y1VG 2E9HA 3K8AA 1Y1WG 2VQEL 1M901 3J80c 3PCOB 1JWHC 4NBBA 3GTJH 2PI2E 2KPIA 1K3RA 2Q2UA 4LW1A 2QGQA 3RLNA 3OTOL 4QQBX 4GOPB 2B63H 3S15I 5FLXf 5IP9I 4OONA 1D8LA 1OXVA 1V43A 1Q86C 1QVCA 4QTUA 3CCVZ 1FL0A 4P72A 3RZDI 3KIHA 2VUGA 1WOCA 3PO2H 1HNZQ 4LF6L 2NVYH 1VQLA 3CC71 3OW2Z 2QKDA 4A3EG 1K732 4C3IH 2VQFQ 4JG2A 1SLJA 1YJNZ 1JT8A 2M6NA 1YHAA 4DUYQ 5C4XH 1KQSY 5JJLA 3F8TA 3FQQA 5M3MG 3HKSA 5IYCG 4DV7Q 2QA41 1QZHA 4X65L 2UXBL 1VQCA 5IYDH 3HOYI 3K81C 1Q861 1J5EL 3KF6A 3M4OI 3CMAZ 1Q1BA 1K8A2 4E2XA 2DGYA 4A3CI 3CD6A 4AH6A 3HOUG 1VQL1 1SN8A 1UE7A 1VQMZ 2I5LX 4E30A 1X6OA 1EWIA 2VNUD 1YUAA 1TWCH 3TRZA 2WAQG 3F3PC 1E1OA 1LTLA 1VQN1 3PSIA 4DV4L 1K8GA 1USPA 4GNXC 3HOVI 3W1GA 3J81f 1VQEA 3F1ZA 1SFOI 3J81c 1E22A 5C4JI 2Q2HA 2JA8H 5A2Qf 4DR6L 4B3SL 3RLFA 4DR5L 2NN6I 1VQHA 1J6QA 3PUYA 1X55A 1K8AC 4RG1A 3ULJA 4UP9A 5JEAG 4LF7L 4DV5L 3CCM1 4A3LI 3ULPA 1X3ZA 1K83I 1KQSZ 2V8IA 3NDJA 4O0AA 4B3ML 1G51A 2I3CA 2UU9Q 4MD8A 1VQ8Z 3LGJA 5K36G 3A0JA 5LMUQ 4LUOA 3S2HH 4GLVB 1CUKA 3CC2A 4FDBA 1X56A 1KQSA 3TQYA 4UPAA 4MNOA 2LXJA 3ZJYC 2QA4A 3S16H 4KHPQ 3CC2Z 2NVXH 5JJIA 3GTMH 2RHQB 3NBHB 3JC66 2IX1A 3KF8B 4GN5A 3ER0A 1ML8A 4P71A 4DV0Q 1S7MA 2QLVB 2I0QA 1RIPA 1XJVA 1GM5A 1PA6A 3NDIA 1SRUA 1LYLA 1IBKL 3S16I 4LFAQ 3S1NI 3RN5A 3KF6B 4NXMQ 4AQYL 4A3MH 4DV6L 1TWHI 1CKNB 2VQEQ 4A3CG 2V8KA 3A74A 4RMFA 1PH1A 4GS3A 3MONA 1VQNZ 5C3EG 1H95A 2HHHQ 1YI2Z 1YITZ 1PV4A 2ZAEB 4NOZA 2AKWB 1PH7A 4POGA 1Q7Y2 3OTOQ 1K9MC 2LFUA 1VQJA 3KYHC 1KRLA 2JA6I 1VQ6Z 3EERA 1KD11 4GOPA 1Y1VI 2D62A 1Z03A 1DL6A 1RL2A 3G4SA 4JI6Q 4BXXH 5FJ8H 3H15A 3CCSA 3TREA 3I55A 1SMXA 3GTPH 4OX9L 2L15A 4HGYA 1VQAA 3CCSZ 2BA0A 1OXXK 2E5LL 1USPB 3VB9A 1W2BY 4A3MG 5IYBG 4X62Q 5C44H 4NB8A 2IHEA 3K0XA 3NFZA 1W2BZ 2I5HA 3HKZE 1PH6A 2P28A 2ZM6L 1PH5A 2OOXB 2N49A 1Q822 1Y1VH 2JNYA 4DV2Q 2B3GA 3PO3G 3CCLA 4NB9A 4GKKQ 1JE5A 1VQ4Z 2OWOA 1S72A 4DV1Q 4LUZA 1SE8A 1I50I 5GAEC 2LSSA 2HT1A 2WB1A 5AJ3L 4DUZL 2YU9H 1Q821 1YHQZ 4JI2Q 4MH4A 5GADC 1YBYA 4NBEA 5C4JH 3UDFA 1KRTA 2IZ4A 4KI0A 4WJ3M 3FKIG 2H5XA 4DGLA 1QUQA 1YIJA 3M3YH 5IT9c 2O4HA 3D0FA 1QZGA 2JJQA 4GN4B 3I4MI 1K9M1 1EQQA 3JAMf 4EX5A 3GTQI 2JA8G 3VMIA 3RZOI 1XNQQ 3PUXA 2ID0A 1Q862 2HF1A 1VQO1 2A8VA 4AYBE 3I2ZA 3S1RI 1Q81C 1VQ6A 1GD7A 3M3YI 4S1TA 5C44I 1X3WA 2UUAL 2B63I 2DUDA 4P75A 2YADA 4BXXI 3CMA1 1K0RA 4HJ5A 1NBWA 2WFWA 3HOUH 5AN9F 1K83H 5CM2M 3I7FA 3E9IA 2BH8A 3A5ZB 5C4XI 4X64Q 3ICEA 1NJIC 1VQ9Z 2R93H 3D6WA 3M4PA 1FJGQ 4DR1L 5GQOA 4MTNA 4JI1Q 4A93H 4DV0L 1TWFI 4DR2Q 2CKZB 1QVGA 2NVYI 4NXNL 3GTKI 4A3GI 3HOVH 1VQKA 4AYBG 2UXCL 2OTL1 4IO9A 4P73A 4NB3A 1PFTA 1VQ61 4UP7A 3PO3S 5GAGC 2RCNA 4DK1A 4DV3L 4C3JH 4X65Q 1K9M2 4LF5L 2R7FA 4GKJQ 3CCQA 3CCU1 3K7AI 3WWVA 4R4TA 1YJ9A 5T64A 1WCMI 4AYBA 1CKMA 2AHOB 1L1OC 2NN6G 1C0AA 4DQYB 3CCEA 2JUBA 1SROA 3KDFB 4K0KL 4XX2A 4A3II 2JEBI 2OTLA 1QYPA 1IBMQ 1IBLL 4L5QA 4A3LH 1T9HA 1YJW1 2NVTH 4PZ8A 2O53A 4DV4Q 1N8R2 4A3BI 3J7A4 4HIMA 4A76A 1VQBA 1NP6A 2WAQE 5C44G 4GLAC 2JQOA 3CC41 5FLXb 3S1MI 2Y0SE 2IZ3A 1QUQB 3CCJ1 4HIKA 1Q7Y1 3CD61 1KC82 3S1RH 3Q8DA 4DR5Q 5IP7H 2N78A 4BBRH 4EQ5A 1KC8C 1S721 1SR3A 3M7NA 4A3GH 1PH8A 1TWCI 4JI3L 5IP9G 4P74A 3S17H 3IX0A 3GTGH 3STBC 1VQPA 5FLMG 2ZJQA 1BVSA 5M3FG 1Z01A 1ZB8A 3S14I 3M9BA 3J81j 4MD7A 2A19A 4A3DI 1NMGA 2JA5H 3B6YA 3HOYH 4A3EI 4A93G 2A1AA 1WW9A 2Y0SG 2V8JA 4A3CH 3J81i 1Q812 4X66Q 3LUSA 1MIUA 1VS0A 3GDEA 1YZ6A 1VQOA 3CPFA 2F4MA 2JA5G 3CCR1 4UP8A 5ELOA 3IFUA 2R92G 1YJN1 4TVAB 2DE5A 2QEX1 3KFUA 1WJJA 2IHFA 3J80f 3PO2I 3F3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 G;  1N33 L;  3ZJY C;  4JBJ A;  2QA4 A;  1MJE A;  3BZC A;  4JI7 Q;  3S16 H;  2ZM6 Q;  4BA2 I;  3EBE A;  4DR4 Q;  4IPC A;  3CXC A;  4KHP Q;  4LNQ A;  2F4O A;  3H0G H;  2YYZ A;  1RLY A;  1E3P A;  3M85 A;  1NTG A;  2Z0S A;  4OXP A;  3H0G I;  5H1S E;  5IP9 H;  2N3S A;  2Z6K A;  1WI5 A;  2V1C C;  2NVX H;  4JI4 Q;  4DV7 L;  5JJI A;  2K5R A;  3GTM H;  4A3M I;  2RHQ B;  1P8L A;  4Y7N I;  3NBH B;  2DE6 A;  3HOX G;  1XPR A;  3JC6 6;  2YTX A;  3KF8 B;  4JBK A;  4GN5 A;  4NBF A;  2IX1 A;  3S2D I;  3M4Q A;  1J5E Q;  5M5Y H;  3ER0 A;  3IRB A;  3PGZ A;  1B7Y B;  3BJU A;  4DV5 Q;  1XMQ L;  3S1Q H;  4LF8 L;  3J80 i;  1LM0 A;  2MNA A;  1ML8 A;  2K50 A;  1NE3 A;  4P71 A;  3STB D;  4DV0 Q;  1PVO A;  5IP7 G;  1YNX A;  4O2D A;  1PYS B;  1RIP A;  2NVX I;  2F52 A;  1XJV A;  2PNH A;  1GM5 A;  1OXT A;  1PA6 A;  1U0L A;  1E1T A;  1SRU A;  4GKK L;  2F4V Q;  1LYL A;  4NBD A;  3S16 I;  1IBK L;  4JV5 L;  4ME3 A;  4YCU A;  1VQ5 A;  3F2D A;  4LFA Q;  1A63 A;  3S1N I;  3L7Z C;  3FHW A;  3UE0 A;  2E2J H;  1FJG L;  3RN5 A;  1D7Q A;  3KF6 B;  4HJ9 A;  2Q2T A;  1Q46 A;  2R7Z I;  4L5R C;  1N36 L;  1B8A A;  4NXM Q;  4AQY L;  5IYB H;  4A3M H;  3RR5 A;  3U50 C;  4BA1 I;  4DV6 L;  1K73 C;  2JA6 H;  3H3V I;  1TWH I;  1S40 A;  1CKN B;  5IYD G;  3K7U C;  3CAM A;  2VQE Q;  3A74 A;  2CWA A;  3BZK A;  4RMF A;  1PH1 A;  4DKA C;  1ASY A;  5HY6 A;  2UU9 L;  4GS3 A;  3VMG A;  5C3E G;  2JA9 A;  1EUJ A;  1E7Z A;  4PZ7 A;  4IFD G;  4DR7 Q;  1H95 A;  2HHH Q;  4Y52 H;  4IPG A;  3SGI A;  3HOZ H;  1PV4 A;  3HOW G;  1I3Q I;  4NOZ A;  2NVQ H;  1Q7Y C;  4HJ7 A;  2F3I A;  2AKW B;  2MFI A;  3Q87 A;  4LF9 Q;  1PH7 A;  4BY1 H;  2HQL A;  2KHI A;  3PUZ A;  4JI7 L;  2BJO A;  3UDI A;  1N32 L;  1Y14 B;  1TWG H;  4POG A;  5DLQ E;  1HR0 L;  2VW9 A;  5FJ8 G;  3KJP A;  1EQR A;  2YV5 A;  1JB7 A;  2I5M X;  3UDX A;  5FLM H;  3OTO Q;  1K9M C;  2UUA Q;  1HZ9 A;  1VQJ A;  3KYH C;  2JA6 I;  1LQL A;  3NEN A;  3H3V H;  5JJK A;  1PH3 A;  3EER A;  4LF6 Q;  3JAM c;  1G6P A;  3AQQ A;  1ASZ A;  2AWO A;  3I56 A;  3GTG I;  1YVC A;  2KEN A;  2AWN A;  4B3S Q;  4BBS I;  4HIO A;  4GOP A;  4LF5 Q;  4QIW E;  3G6E A;  1Y1V I;  2D62 A;  4JI0 Q;  2CQO A;  1XMQ Q;  1VCI A;  3PO3 H;  1DL6 A;  3G71 A;  5IE8 A;  2K52 A;  2VUM H;  1RL2 A;  1UE1 A;  3T1Y Q;  3F2C A;  3G4S A;  4JI6 Q;  1FVI A;  1A0I A;  4BXX H;  2VZA A;  3PF4 A;  3GKQ A;  5JEA J;  5FJ8 H;  3H15 A;  4A3D G;  3CCS A;  3TRE A;  3CQZ H;  1IBK Q;  4A75 A;  1E24 A;  4NBA A;  3NEM A;  4AQY Q;  3HKZ G;  4PZ6 A;  2VQF L;  4LFA L;  1IXR A;  3S17 I;  3UE1 A;  3PO3 I;  3I55 A;  1A8V A;  4HJA A;  3PO2 G;  3I4N I;  1X3G A;  2JE6 I;  4APV A;  1SMX A;  3GTP H;  2JA8 I;  4IFD J;  5LMN L;  4C3H H;  3EIV A;  1M1K C;  4OX9 L;  2L15 A;  4DNI A;  1HNW L;  3ULL A;  4A3F G;  2OCE A;  1VQA A;  2BA0 A;  3S1Q I;  1OXX K;  1USP B;  1XTD A;  5AJ3 Q;  2E5L L;  4LFB L;  2E2I H;  2UXD L;  3VB9 A;  4A3M G;  1IBM L;  5IYB G;  3CME A;  1HNX L;  4QY7 A;  4DAM A;  2CWP A;  4DPG A;  3H3V J;  4X62 Q;  5C44 H;  4JI5 Q;  4HID A;  5GRO A;  4NB8 A;  1KRS A;  2IHE A;  3PUV A;  2ALY B;  3L0O A;  4LF9 L;  1Y1V S;  3K0X A;  3DM3 A;  3J7A 5;  2UUB Q;  1EIF A;  4A3K I;  1I94 L;  4BBS H;  1OXS C;  1I3Q H;  1WCM H;  2I5H A;  5J3B A;  3HFZ B;  1UEB A;  3S14 H;  3HKZ E;  2R92 I;  1XMO Q;  1PH6 A;  2KBN A;  1Z47 A;  2LXK A;  5M3M H;  2ZM6 L;  1Z9F A;  2WB1 E;  1EFW A;  3HOV G;  2WB1 G;  1PH5 A;  3T1Y L;  2IT1 A;  2N49 A;  2ZTE A;  4BXX G;  4X66 L;  2JA7 I;  2RBL A;  2EXD A;  1PYB A;  1Y1V H;  2JNY A;  4DV2 Q;  4GNX B;  2HIV A;  1IL2 A;  2B3G A;  5IWA Q;  2BH2 A;  3PO3 G;  1NY4 A;  4B3T L;  2KCT A;  2ASB A;  3H0G G;  3CCM A;  3CCL A;  1HNZ L;  1P16 A;  1XPO A;  4NB9 A;  1BBW A;  1V1Q A;  1VQM A;  3RLO A;  3CC7 A;  1YHQ A;  4GKK Q;  1JE5 A;  4A3K H;  4IOC A;  2JS4 A;  4B3M Q;  2OWO A;  4A3F I;  2MO1 A;  1S72 A;  4DV1 Q;  3AYH B;  4LUZ A;  3CW2 C;  3T1H Q;  1LUZ A;  1SE8 A;  2GVA A;  4C2M H;  1I50 I;  1N2F A;  1KHI A;  5IY0 A;  3W5O A;  5GAE C;  1TWH H;  2LSS A;  3KOJ A;  4NXM L;  2HT1 A;  4YHH Q;  4OX9 Q;  5AJ3 L;  2E5L Q;  1I6H H;  3PIO A;  4DUZ L;  5IP7 I;  4DV6 Q;  1YEZ A;  1I6H I;  2ES2 A;  1HZB A;  2YU9 H;  1TWA H;  4YWM A;  3PUW A;  4YWL A;  3MEF A;  4XTC S;  4JI2 Q;  4MH4 A;  3HOZ I;  3E0E A;  2QEX A;  1TFI A;  1VQ4 A;  3I4M H;  5GAD C;  1YBY A;  2OTJ A;  2PQA A;  3D31 A;  2GVB A;  4JI5 L;  1N33 Q;  2E8G A;  2HHH L;  3HOW H;  4NBE A;  3GTP I;  2K75 A;  1CKO A;  5ELN A;  5C4J H;  3CCR A;  3UDF A;  2J6A A;  3GTM S;  1GO3 E;  1KRT A;  4KI0 A;  1JJG A;  4WJ3 M;  3FKI G;  5C3E H;  5EAY A;  2H5X A;  3JAM i;  3CF5 A;  4DV3 Q;  3GTO H;  4OWX B;  1W2B A;  1N32 Q;  1QUQ A;  1HR0 Q;  1KXL A;  1YIJ A;  3M3Y H;  1I5F A;  5IT9 c;  4B3R L;  2YTV A;  4R4C A;  3D0F A;  1QZG A;  3CCJ A;  4DR7 L;  4GKJ L;  4YY3 Q;  2B63 G;  4L5T A;  4UY8 C;  1YJW A;  3I4N H;  4JOI A;  3S15 H;  4JOI C;  2JJQ A;  1BBU A;  2FXQ A;  4H02 A;  5C0X I;  2K4K A;  4GN4 B;  3RN2 A;  2E2H I;  3I4M I;  3CQZ I;  1X65 A;  1EQQ A;  1N34 L;  4LFC L;  2IX0 A;  4EX5 A;  3GTQ I;  4A3C G;  2JA8 G;  3PF5 A;  3VMI A;  4LF4 L;  4DV2 L;  2D0P A;  1M90 C;  4NBG A;  4NBC A;  3RZO I;  2NVT I;  2AMC B;  4X64 L;  1UWV A;  5M3F H;  3T1H L;  1AE3 A;  1HR0 W;  1N36 Q;  1UE5 A;  3PUX A;  2ID0 A;  3M4O H;  4JI1 L;  2HF1 A;  1DGS A;  3K7A H;  1Y1W H;  4JI6 L;  2CCZ A;  4DR2 L;  2NVQ I;  4JC0 A;  2A8V A;  4AYB E;  3I2Z A;  1O7I A;  3U4V A;  1L1O B;  3S1R I;  1IYJ B;  3U58 A;  4QL5 A;  3I07 A;  2R93 G;  1V9P A;  1A62 A;  1OXU A;  3S1M H;  1Q81 C;  1KAW A;  5FLM I;  2CFM A;  1B70 B;  1I50 H;  3KLW A;  4DAY B;  1VQ6 A;  1GD7 A;  3M3Y I;  4R4O A;  5C44 I;  4A3G G;  4LFB Q;  1X3W A;  3FKI H;  4IJH A;  2UUA L;  2B63 I;  3VDY A;  2R92 H;  2DUD A;  2IY5 B;  2D0O A;  4P75 A;  4PG3 A;  2K5V A;  4BXX I;  4YCW A;  1K0R A;  1GVP A;  4QJF A;  4BBR G;  1BKB A;  3VMH A;  4Y7N H;  5C0X J;  3RNU A;  4DR4 L;  1C9O A;  4HJ5 A;  2UXB Q;  1NBW A;  3GTL I;  2WFW A;  2E2H H;  2VL6 A;  1IZ6 A;  3DLL A;  3HOU H;  3I4M G;  3HOW I;  1K83 H;  4X6A H;  2Z6K C;  3AFQ A;  3CP0 A;  4NPS A;  4BY7 I;  4B3R Q;  1GKH A;  2P3Y A;  3GTK H;  2RHS B;  5CM2 M;  3RZD H;  3I7F A;  2DE7 A;  3E9I A;  4A3J G;  1U5K A;  1WYD A;  2BH8 A;  3A5Z B;  5C4X I;  1XNR Q;  2MQH A;  4JYA L;  1VLA A;  4IJL A;  3KJO A;  1VQ7 A;  4X64 Q;  2E2J I;  2VS1 A;  3CCU A;  1N34 Q;  4GOP C;  1NJI C;  1VQI A;  3ERS X;  1KL9 A;  4A3K G;  3ICE A;  2R93 H;  5HGQ A;  2UUC Q;  3D6W A;  1HH2 P;  3M4P A;  4A3B G;  4LUV A;  4AIM A;  1X3F A;  1VQG A;  4R4Q A;  4YCV A;  3W1B A;  1FJG Q;  2F4V L;  2XGT A;  4B3T Q;  4DR1 L;  5GQO A;  4MTN A;  1VQF A;  2EQS A;  4KLK A;  3S24 A;  3E9H A;  3F2B A;  4JI1 Q;  4LF8 Q;  3U4Z A;  4A93 H;  1Q82 C;  4DV0 L;  3HOY G;  5IWA L;  1TWF I;  1Y1V G;  3K8A A;  1CKN A;  2CKZ B;  4DR2 Q;  2VQE L;  1Y1W G;  1QVF A;  2R7D A;  1QVG A;  3J80 c;  3PCO B;  2NVY I;  4NXN L;  3GTK I;  4A3G I;  1PHJ A;  3HOV H;  1VQK A;  3MXN B;  2JEA I;  3PIP A;  4DV1 L;  4NBB A;  4HJ8 A;  4AYB G;  3GTJ H;  4DUY L;  2ZJR A;  2UXC L;  4JBM A;  3HOU I;  4NBH A;  1TWG I;  1WCM G;  2PI2 E;  4JI8 L;  4K0K Q;  3G48 A;  4WJ4 A;  1WFQ A;  4IO9 A;  3GTL H;  2KPI A;  1K3R A;  4P73 A;  1PH9 A;  4NB3 A;  1PFT A;  4LW1 A;  1Q12 A;  2Q2U A;  4MZ9 A;  4UP7 A;  2I0Q A;  4ALP A;  1YI2 A;  1OTC A;  2QGQ A;  3RLN A;  1YIT A;  3OTO L;  3PO3 S;  4JBW A;  4GOP B;  4A3E H;  2B63 H;  1EYG A;  4QQB X;  5GAG C;  3S15 I;  1HZA A;  2ZTC A;  1VQ8 A;  1JJC B;  1ZB9 A;  2RCN A;  2ATW A;  5IP9 I;  4OON A;  1D8L A;  1XNR L;  3BU2 A;  4JYA Q;  2OQ0 A;  2R7Z H;  2Q2I A;  1OXV A;  4DV3 L;  1V43 A;  4C3J H;  1Q86 C;  4BY1 I;  1QVC A;  2N8N A;  4JI0 L;  1MKH A;  3KDF A;  4QTU A;  1FL0 A;  4P72 A;  1JJ2 A;  4KHP L;  2B29 A;  3RZD I;  3UDG A;  4X65 Q;  1WOC A;  4LF5 L;  2JR6 A;  1TWF H;  3PO2 H;  2R7F A;  4GKJ Q;  3OYY A;  3CCQ A;  4GLX A;  1HNZ Q;  4LF6 L;  3K7A I;  1R9T I;  2UUC L;  2NZH A;  4LF7 Q;  3WWV A;  2R7Z G;  2NZO A;  2RF4 A;  4A3D H;  3RZO H;  4J15 A;  2R93 I;  5M5X H;  2NVY H;  3TEH B;  2YU9 I;  2YTY A;  1VQL A;  4R4T A;  2KCM A;  2ZJP A;  4GNX A;  4L5S A;  4LFC Q;  1YJ9 A;  1KIX A;  2VUM G;  3S1N H;  4A3I H;  2JA7 G;  2OQK A;  1Q1E A;  1CSP A;  4A3E G;  1WCM I;  1CKM A;  3NEL A;  1PH4 A;  5LMU L;  2AHO B;  1L1O C;  4C3I H;  4JV5 Q;  2NN6 G;  2VQF Q;  3L2P A;  4JG2 A;  1C0A A;  3CCE A;  4OO1 I;  1SRO A;  4GN3 B;  3KDF B;  3EN2 A;  1SLJ A;  1JT8 A;  3PV0 A;  4A4I A;  4K0K L;  1YHA A;  4XX2 A;  5IYC H;  1TWA I;  3OW2 A;  4DUY Q;  5C4X H;  5BR8 Q;  1JMC A;  4A3L G;  4A3I I;  4BY7 G;  2JEB I;  1HNX Q;  2OTL A;  3F8T A;  5JJL A;  4X62 L;  3GTQ H;  3GTM I;  1HNW Q;  1QYP A;  1IBM Q;  3AEV A;  1IBL L;  4BY7 H;  5M3M G;  4BY1 G;  4L5Q A;  3HKS A;  4A3L H;  5C4X G;  1T9H A;  4DR3 Q;  1L2F A;  2C35 B;  4PZ8 A;  5IYC G;  2NVT H;  2UUB L;  4DV7 Q;  4DV4 Q;  2PMZ E;  1YJN A;  3HOZ G;  1NMF A;  4BBS G;  4R1J A;  4A3B I;  2PI2 A;  3J7Z C;  1I94 Q;  1QZH A;  4X65 L;  4JI4 L;  4A3B H;  3CCV A;  4Y52 I;  1XNQ Q;  4HIM A;  4A76 A;  4DR6 Q;  2UXB L;  1VQB A;  1VQC A;  5M5W H;  3HOY I;  3FKI I;  2WAQ E;  3K81 C;  4POF A;  5C44 G;  5IYD H;  1J5E L;  4GLA C;  2JQO A;  3KF6 A;  3M4O I;  4LF4 Q;  3TS2 A;  2VY3 A;  4A3J H;  1XMO L;  1EIY B;  3S1M I;  1Q1B A;  2Y0S E;  1XNQ L;  2DGY A;  1QUQ B;  4A3F H;  4HIK A;  1N8R C;  3K80 C;  4A3C I;  3AFP A;  3CD6 A;  2MO0 A;  3GD7 A;  3S1R H;  3Q8D A;  4AH6 A;  4DR5 Q;  5C3E I;  2XTI A;  3HOU G;  4A93 I;  5C0X G;  4JCV E;  5IP7 H;  2N78 A;  4DR1 Q;  4BBR H;  1SN8 A;  1N9W A;  2PQA B;  3GCF A;  4EQ5 A;  1KC8 C;  3GO5 A;  4A3J I;  1UE7 A;  4A3I G;  2JA7 H;  2I5L X;  1L1O A;  1SR3 A;  3M7N A;  1X6O A;  3TS0 A;  1PH8 A;  4A3G H;  1EWI A;  2BA1 A;  1Q8K A;  5GAH C;  2VNU D;  1YUA A;  2K14 A;  1TWC I;  4NXN Q;  2EIF A;  1NUI A;  4JI3 L;  1TWC H;  3TRZ A;  1X54 A;  1VQD A;  2WAQ G;  1KD1 C;  5IP9 G;  4QTT A;  1YHB A;  4P74 A;  1E1O A;  1LTL A;  4JI2 L;  3A5U A;  3PSI A;  1IBL Q;  4DV4 L;  1VQ9 A;  1K8G A;  3S17 H;  2UXC Q;  1USP A;  2JA5 I;  4QGU A;  4JI8 Q;  2GN5 A;  4GNX C;  3GTG H;  4TQU S;  3STB C;  2UXD Q;  3HOV I;  1VQP A;  1HZC A;  3ESW A;  3W1G A;  4YY3 L;  1HJP A;  1G29 1;  2WP8 J;  5E7N A;  5FLM G;  4DR3 L;  4OWW B;  1SFO H;  2ZJQ A;  1VQE A;  1BVS A;  5M3F G;  3S2D H;  3F1Z A;  1SFO I;  1ZB8 A;  3S14 I;  2JK8 A;  3J81 c;  1E22 A;  3M9B A;  4OWT B;  3J81 j;  5C4J I;  2Q2H A;  4IFD I;  2A19 A;  2JA8 H;  1AH9 A;  2ZTD A;  4A3D I;  1PH2 A;  1NMG A;  3CMA A;  3B6Y A;  2JA5 H;  4B3S L;  4DR6 L;  3HOY H;  4BBR I;  3RLF A;  4A3E I;  4A93 G;  4IOA A;  3CC4 A;  1W3S A;  5LMN W;  1AE2 A;  4DR5 L;  2A1A A;  2NN6 I;  4YWK A;  4DK6 C;  2HIX A;  3I4N G;  1VQH A;  2PK7 A;  1J6Q A;  3PUY A;  1WW9 A;  4IPH A;  1X55 A;  2Y0S G;  1K8A C;  4RG1 A;  3ULJ A;  1S3O A;  4UP9 A;  5JEA G;  4A3C H;  1FGU A;  4KHZ A;  5FLX c;  4DV5 L;  3J81 i;  3HOX I;  4PMW A;  4X66 Q;  3FP9 A;  4LF7 L;  3LUS A;  2JA6 G;  1MIU A;  4A3L I;  1VS0 A;  3S2H I;  3GDE A;  1PFS A;  2R6G A;  4LWC A;  3ULP A;  1MJC A;  1CSQ A;  3I4O A;  1X3Z A;  1YZ6 A;  1K83 I;  2E2I I;  4X6A I;  4IPD A;  4DK3 C;  1XPU A;  1VQO A;  2K5H A;  4MNO A;  3CPF A;  5LMN Q;  2F4M A;  4O0A A;  1C7Y A;  4B3M L;  1G51 A;  2UU9 Q;  2JA5 G;  1RO4 A;  3LGJ A;  4UP8 A;  5K36 G;  3A0J A;  2K5N A;  2KHJ A;  4LUO A;  5ELO A;  5LMU Q;  4JI3 Q;  3GTJ I;  1Y1W I;  3S2H H;  4GLV B;  1CUK A;  3CC2 A;  4FDB A;  4YHH L;  2R92 G;  4TVA B;  2DE5 A;  2VUM I;  4DUZ Q;  1X3E A;  1VQN A;  3KFU A;  1EOV A;  3CPW A;  1UE6 A;  1WJJ A;  1X56 A;  2IHF A;  1L0W A;  1R9T H;  2AKL A;  3HOX H;  1KQS A;  5BR8 L;  1X9N A;  3TQY A;  1TXY A;  4UPA A;  2LXJ A;  3PO2 I;  3GTO I;  4R4I A;  4XIG S; 
#chains in the Genus database with same CATH topology
 2SOB A;  5ELC A;  4K5X A;  1N33 L;  4JBJ A;  4JI7 Q;  4BA2 I;  3BZC A;  4DR4 Q;  4IPC A;  2B39 A;  1C8C A;  3H0G H;  2YYZ A;  3D6C A;  1NTG A;  5H1S E;  3H0G I;  2CQA A;  2PMZ B;  4J8Q A;  5IP9 H;  4JI4 Q;  1WI5 A;  4DV7 L;  2K5R A;  1P8L A;  4KTA A;  4Y7N I;  3S1N B;  4JBK A;  2L0C A;  3S2D I;  5HUR A;  3H09 A;  5M5Y H;  3IRB A;  1B7Y B;  1XMQ L;  5JVG 3;  2PYK A;  2MNA A;  5KND A;  3M4Y A;  1EYA A;  1VQ7 Z;  2F0O A;  1IHZ A;  1PVO A;  3X3N A;  2NVX I;  2F52 A;  2PNH A;  1OXT A;  1U0L A;  1E1T A;  2F4V Q;  3H94 A;  5D1O B;  4KKU A;  3A55 A;  4JV5 L;  4YCU A;  2OTL Z;  3L7Z C;  1D7Q A;  1FJG L;  4HJ9 A;  1Q46 A;  1N36 L;  3I4M B;  4BY7 B;  1AN8 A;  2SNS A;  5C5L A;  3U50 C;  3H3V I;  1S40 A;  5BN5 A;  3K7U C;  3CAM A;  2A73 B;  2CWA A;  3OMC A;  2UU9 L;  5HY6 A;  2F0J A;  3IF8 A;  1HFG A;  2JA9 A;  4KY7 A;  1EUJ A;  4E2Z A;  4DR7 Q;  4IPG A;  3HOW G;  1I3Q I;  2NVQ H;  2DNE A;  3CCV 1;  2MFI A;  4K6L A;  2R7Z B;  4BY1 H;  2HQL A;  3PUZ A;  3TSS A;  1N32 L;  4NP5 A;  5CV8 A;  5DLQ E;  1GOZ A;  1I4X A;  1QNU A;  4CL1 A;  2YV5 A;  1EY5 A;  1YIT 1;  1LQL A;  3H3V H;  2B8G A;  4FXD A;  1K0S A;  1C48 A;  1G6P A;  5C44 B;  2VB2 X;  3I56 A;  3GTG I;  2KEN A;  2AWN A;  3TME A;  1ZH1 A;  4BBS I;  2CQO A;  1VCI A;  3A54 A;  2K52 A;  2GTH A;  3QG1 A;  4RVF A;  1FVI A;  1A0I A;  1WTR A;  3PO2 B;  5JEA J;  4A3D G;  1IBK Q;  1F2M A;  4NBA A;  3CC7 Z;  4LFA L;  2JSO A;  1D5X C;  1Z02 A;  1A8V A;  4E31 A;  4HJA A;  4K6D A;  3I4N I;  1HUN A;  5LMN L;  3FKI B;  1M1K C;  4I7Z C;  4RFB A;  4DNI A;  2EY5 A;  5JPM C;  3S2D B;  5D1O A;  1HNW L;  1RJT A;  2E75 C;  1VQ8 1;  4G7O C;  2XWB B;  2UXD L;  5AJ3 Q;  5CBA E;  2E2I H;  2A6H C;  1WD1 A;  5EQ0 A;  4DPG A;  4JI5 Q;  4HID A;  5C3W A;  3DM3 A;  3RUZ A;  2YU9 B;  1HQR D;  1I94 L;  4BBS H;  1PRT F;  1I3Q H;  1MHW C;  5J3B A;  1UEB A;  3S14 H;  1XMO Q;  2KBN A;  3C46 A;  1Z9F A;  2WB1 E;  1EFW A;  2WB1 G;  1HUM A;  2IT1 A;  1VQM 1;  2AQ1 B;  1L0Y B;  1LAB A;  1HRJ A;  1XXG A;  1PYB A;  2F0V A;  4TNU A;  1IL2 A;  4G7Z C;  4RH6 A;  4HMI A;  2BH2 A;  4B3T L;  2R3Z A;  1H9R A;  3CCM A;  1HNZ L;  1IW7 D;  1XPO A;  1V1Q A;  1YHQ A;  3RLO A;  4XQQ A;  3G6E 1;  4A3K H;  1RO2 A;  2JS4 A;  2ZXP A;  3G71 1;  3MZ5 A;  2VB3 X;  3CW2 C;  1LUZ A;  1O7Y A;  2GVA A;  4C2M H;  5C4Z A;  3W5O A;  1PDQ A;  3CCE 1;  1F2Y A;  2F0Q A;  4YHH Q;  3D9X A;  1I6H H;  4N8F A;  1K73 1;  5IP7 I;  4MRI A;  1HZB A;  1K28 A;  3PUW A;  4RVD A;  3P5J B;  3EQL C;  5BN3 A;  4OIJ A;  1TFI A;  2EJF C;  2PZU A;  3NH4 A;  1IYU A;  1SYB A;  1CKO A;  1TS3 A;  1JJG A;  5C3E H;  5EAY A;  1K8M A;  2AQ3 B;  2L4N A;  1STN A;  3LWU A;  1HR0 Q;  4HMJ A;  4B3R L;  3S17 B;  3MTS A;  2YTV A;  4IUN A;  2JIM A;  2F0S A;  1TKW B;  1ENF A;  3D8G A;  4JOI A;  1EEI D;  2PO4 A;  1YJW A;  2NYZ D;  4JOI C;  1BBU A;  5IGC A;  1TQO A;  3CQZ I;  1X65 A;  1N34 L;  1X0T A;  4LFC L;  1CQF A;  3EA6 A;  1EWC A;  5F2D A;  4DV2 L;  1M90 C;  3CCU Z;  2L5T A;  1RDP D;  2F0T A;  4NBG A;  1HXY D;  5A2Q L;  4X64 L;  3T13 A;  2JIP A;  4HCS A;  2F0M A;  4ILW A;  5KYI A;  5D14 A;  2KQ3 A;  2M00 A;  4XQJ A;  4JI6 L;  4CDC C;  2G9D A;  2NVQ I;  1SAP A;  4MXU A;  1QVF Z;  4JC0 A;  1L1O B;  3J81 E;  4UHV A;  2EOT A;  3CQZ B;  4QL5 A;  1J8I A;  1TT2 A;  1EZ6 A;  1D5M C;  1QIL A;  1KAW A;  5C3X A;  4QF4 A;  1B70 B;  1I50 H;  1YNJ D;  2BE5 D;  2NWG A;  3G7L A;  2K33 A;  2XWJ B;  4LFB Q;  4F7X A;  3KIF A;  3VDY A;  5ELB A;  2QA4 Z;  2D0O A;  1SE2 A;  3S2H B;  1BKB A;  1EQT A;  1TWC B;  1QXF A;  1JJ2 Y;  3GTL I;  2E2H H;  2VL6 A;  3DLL A;  3I4M G;  4X6A H;  4J6H A;  3AFQ A;  1XTC D;  1RQF A;  4RHS A;  5D3I B;  4EQN A;  1VDZ A;  3I72 A;  2RHS B;  3TDQ A;  5D3D A;  2EYL A;  3SDZ A;  4OIK A;  3KLR A;  1K8A 1;  1DOK A;  1G2S A;  1RTO A;  2KCC A;  1V8Q A;  2MQH A;  1QVG Z;  2C9O A;  3ERO A;  1EY8 A;  2P5Z X;  3R93 A;  3ERS X;  2Q8I B;  5HGQ A;  5ISR A;  4A3B G;  1STG A;  4C3H B;  4LUV A;  1X3F A;  1VQG A;  4R4Q A;  4YCV A;  2XGT A;  2QRE B;  1VQF A;  2EQS A;  1U4M A;  3E9H A;  1Q90 A;  3U4Z A;  1Q82 C;  4MON A;  1SIW A;  2O2L D;  1VQ4 1;  2K5D A;  2V4D A;  4QIW B;  2K5W A;  3CPW Y;  1TS5 A;  4FNF A;  3PIP A;  4DV1 L;  4HJ8 A;  1D1K A;  5M5X B;  2ZJR A;  2F0U A;  4JBM A;  3K58 A;  1TWG I;  1WCM G;  2ICI A;  4JI8 L;  2QRD B;  3G48 A;  4WJ4 A;  3M7G A;  1LO5 D;  3DWQ A;  3R2I A;  1AW7 A;  1Q12 A;  1YI2 A;  3AB9 A;  4JBW A;  3L9A X;  3OIP A;  4KD3 A;  1JJC B;  1BOS A;  5IT9 f;  4HSP A;  2ATW A;  3T53 B;  5DNF A;  2NVQ B;  2RDF A;  4JYA Q;  3BU2 A;  1F9P A;  1CZW A;  2OQ0 A;  2Q2I A;  3NBH A;  2R7Z H;  4BY1 I;  2N8N A;  4JI0 L;  1MKH A;  4N9P A;  4KHP L;  2CH4 A;  1JJ2 A;  3C1F A;  2NTS A;  1TWF H;  4PMB A;  3OYY A;  3SVM A;  1LTS D;  1H9S A;  2UUC L;  2NZH A;  4WRD A;  4LF7 Q;  2RT9 A;  2RF4 A;  4CDE C;  4LJZ C;  4J15 A;  2R93 I;  5M5X H;  1G6Z A;  4RVH A;  1QVG Y;  4TSS A;  4L5S A;  2YU9 I;  1ZKO A;  2YTY A;  2ZJP A;  1EU4 A;  5AFW A;  3E6Z X;  3S1N H;  3Q24 A;  4A3I H;  2JA7 G;  2FIN B;  3GTL B;  1Q1E A;  1ICF B;  3NEL A;  1Q16 A;  3VYS A;  1LTA D;  1GUG A;  1FNW A;  2KVM A;  4IUU A;  5CV6 A;  3OW2 Y;  5FKA C;  4A4I A;  5IYC H;  1TWA I;  4TKO B;  1YIJ Z;  1JMC A;  4MIU A;  5BR8 Q;  3OMG A;  4BY7 G;  1HNX Q;  4L6T B;  2OOY B;  5C4H A;  1A3V A;  4NW2 A;  3GTQ H;  3GTM I;  1HNW Q;  1CM9 A;  3W3A A;  4BY7 H;  2JXM B;  2F0I A;  5C4X G;  3A8K E;  4Q5V A;  3S1M B;  4HSV A;  2C35 B;  4DR3 Q;  1KDB A;  2UUB L;  3HP3 A;  2PMZ E;  3HOZ G;  4BBS G;  1YIJ 1;  3J7Z C;  2LKV A;  4KKS A;  4PV1 C;  3RZO B;  3CCV A;  4DGZ A;  4Y52 I;  2KI7 B;  3MEH A;  4UAI A;  3FKI I;  4POF A;  3R2T A;  1BBX C;  2N88 A;  4ODG A;  4C56 C;  4LF4 Q;  1NUC A;  1NR2 A;  3TS2 A;  1XMO L;  1EIY B;  1QB5 D;  1HA6 A;  4A3F H;  5DM6 3;  3K80 C;  3AFP A;  1SSO A;  2ZXO A;  1JOQ A;  5C3E I;  1TII D;  2XTI A;  3MHB A;  4A93 I;  5C0X G;  4JCV E;  1S72 Z;  2JA5 B;  1QVF Y;  4K2L A;  1VQ5 1;  2PQA B;  1Y1V B;  4KHV A;  4A3J I;  1L1O A;  5K5P A;  2R92 B;  3TS0 A;  4RA8 A;  5GAH C;  2K14 A;  4C1N K;  3NQI A;  3FQM A;  1HPC A;  4LMQ D;  1YUK A;  1X54 A;  4R8N A;  2OTJ Z;  4JI2 L;  4KV6 A;  3GTK B;  3J7Y W;  1BUV T;  3VR3 A;  2UXC Q;  4QGU A;  2JA5 I;  4DAY A;  2GN5 A;  3TDH B;  1HZC A;  4A3J B;  3K0Y A;  1WTH A;  3VR5 A;  1HJP A;  4YY3 L;  2WP8 J;  3S2D H;  2OTJ 1;  2NAP A;  3N52 A;  3QR8 A;  2OT2 A;  4OWT B;  4IFD I;  1GJX A;  2E2I B;  4RS4 A;  5IGG A;  4MN3 A;  3CMA A;  5CV7 A;  2HUG A;  2K1B A;  5M3F B;  4E33 A;  3OSO A;  5LMN W;  1AE2 A;  1LTI D;  2HIX A;  2PK7 A;  4C3J B;  4IPH A;  3TBI B;  1QWY A;  5FO7 B;  3KLS A;  4KHZ A;  1JOO A;  5FLX c;  3HOX I;  3GTJ B;  1SNP A;  4KKT A;  4LWC A;  2NUC A;  4DK3 C;  3TZU A;  2E2I I;  1STY A;  2K5H A;  2KEE A;  1DOM A;  1C7Y A;  1EOT A;  5E3F A;  3NH5 A;  2E76 C;  2K5N A;  2KOL A;  1WJ2 A;  2KHJ A;  4JI3 Q;  1CTM A;  1KNA A;  3VR6 A;  2Z4I A;  4DUZ Q;  1VQN A;  1EOV A;  1B53 A;  3CPW A;  1R9T H;  1B1Z A;  2RDH A;  2K5Q A;  1L0W A;  3UI2 A;  3HOX H;  1EY4 A;  1NJI 2;  5FO9 B;  4DR7 L;  3T51 B;  4R4I A;  3RZD B;  5NUC A;  5KNC A;  2F03 A;  5CGK A;  2F4O A;  1I4Q A;  5EPJ A;  1RLY A;  4OXP A;  2Z0S A;  2N3S A;  4QUF A;  3NTI A;  3P1H A;  2DE6 A;  2YTX A;  2RPR A;  1J5E Q;  4BS9 A;  5JPN C;  3PGZ A;  3BJU A;  1SNO A;  4LF8 L;  1A2T A;  2B2W C;  3J80 i;  1NE3 A;  3CCE Z;  2IJ0 A;  5FLX E;  1PYS B;  3ERQ A;  1B50 A;  5CYU A;  5IT9 E;  4GKK L;  1NNX A;  1TVX A;  1VQ5 A;  2FMM A;  1ENC A;  1A63 A;  4RGN A;  3FHW A;  2E2J H;  4FXK C;  1AFP A;  4LK1 C;  2R7Z I;  2B2V C;  2BDN A;  2BOS A;  1B8A A;  5LL6 f;  1SYG A;  5IYB H;  2FJ2 A;  5J22 A;  3RR5 A;  2JA6 H;  4BA1 I;  1K73 C;  5IYD G;  1ASY A;  4DKA C;  3HKZ A;  3VMG A;  4HAE A;  1E7Z A;  3R8B A;  1VQ5 Z;  3HOZ H;  1D5Z C;  3FRP B;  4R9W A;  3CXC Y;  4RV9 A;  4HJ7 A;  2F3I A;  4LF9 Q;  1YI2 1;  2K3R A;  4XYQ A;  2LIY A;  1M90 2;  1Y14 B;  4HGZ A;  3OPO A;  4KD4 A;  5FJ8 G;  3KJP A;  2UUA Q;  3I70 A;  2I5M X;  5FLM H;  1GHJ A;  2MPM A;  3NEN A;  4DAP A;  1PH3 A;  4B9W A;  4CJ1 B;  3AQQ A;  3I56 1;  2PMZ A;  1AA6 A;  3O13 A;  1YVC A;  2NB0 A;  4B3S Q;  2F3W A;  5KRU A;  4HIO A;  4LF5 Q;  2O5J C;  4QIW E;  2PPB C;  4JI0 Q;  1XMQ Q;  2W04 A;  2JA8 B;  1PFB A;  5EGT A;  5T1G A;  1PFN A;  1CK1 A;  2GA4 B;  3T56 B;  1UE1 A;  3F2C A;  3TE5 B;  2Y0S A;  2EY6 A;  2VZA A;  1RNI A;  3PF4 A;  2NBF A;  2K6A A;  1YJ9 Z;  3NEM A;  4AQY Q;  2VQF L;  5T1I A;  3UE1 A;  1N8R 1;  3PO2 G;  1X3G A;  4APV A;  5I2Y A;  4C3H H;  3EIV A;  3ULL A;  3S1Q I;  2HDL A;  1XTD A;  2A6E D;  4QY7 A;  3H3V J;  3R3O A;  2ALY B;  1RD9 D;  1Y1V S;  4ULL A;  3Q23 A;  1RO0 A;  3P75 A;  2A68 C;  4A3K I;  1M1K 2;  2Q8R E;  2VUM B;  4IZ8 A;  1OXS C;  1WCM H;  3HFZ B;  5KIX A;  1ET6 A;  1Z47 A;  2EDG A;  2PW5 A;  3Q0A A;  3T1Y L;  2JA7 I;  2PM9 A;  3A7L A;  2EXD A;  1LT3 D;  4GNX B;  2DJG C;  3GTM B;  3J81 L;  5IWA Q;  3G4S 1;  1NY4 A;  4FF2 A;  2KCT A;  1HCZ A;  4E32 A;  1P16 A;  3CD6 Z;  1K3B C;  4HTH A;  4IN3 A;  1VQM A;  3CC7 A;  4IOC A;  4B3M Q;  5CV5 A;  4A3F I;  1MD2 D;  2MO1 A;  4NFR A;  2LMC B;  5IY0 A;  1KHI A;  3BZD B;  3DWA A;  1TWH H;  2PQE A;  3KOJ A;  4NXM L;  2QF7 A;  2F0H A;  4OX9 Q;  4LAA A;  1X3Q A;  4DV6 Q;  2ES2 A;  1STH A;  1TWA H;  2FMC A;  3MXG A;  4IUR A;  1VQL Z;  4YWM A;  4YWL A;  3MEF A;  4KJN A;  1WCM B;  3F2U A;  1HHV A;  1D1I A;  3HOZ I;  2C5C A;  5I9O A;  2QEX A;  3I4M H;  3NK9 A;  4A3M B;  2GVB A;  3HOW H;  2E8G A;  2HHH L;  4QMG A;  3IFT A;  2K75 A;  5ELN A;  4IFD H;  1AP0 A;  3CCR A;  2J6A A;  3JAM i;  3CF5 A;  1W2B A;  4IUP A;  2WAQ A;  1VQP Z;  5HGT A;  1KXL A;  2X6L A;  1I5F A;  3PMF A;  4YY3 Q;  4L5T A;  3D4D A;  3S15 H;  1S4Z A;  3CU7 A;  4H02 A;  3TP8 A;  5C0X I;  1X32 A;  2K4K A;  3RN2 A;  2E2H I;  3OHX C;  5FO8 B;  1SYE A;  1MSG A;  1PZK D;  2A74 C;  2Q2T A;  4NBC A;  2AMC B;  2NVT I;  3T1H L;  1HR0 W;  1ROD A;  4ZCK A;  1AE3 A;  1EL0 A;  1UE5 A;  2EZV A;  4JI1 L;  1DGS A;  1BNZ A;  3M4O H;  2CCZ A;  3QIA A;  4DR2 L;  2EGT A;  1DYQ A;  2B2V A;  5D1P A;  2RSO A;  3HG9 A;  3U4V A;  5IGF A;  1IYJ B;  5COR A;  2R93 G;  1V9P A;  3NWT A;  1OXU A;  3NH8 A;  4DXG A;  2PZT A;  4BBR B;  2RQX A;  3KLW A;  4DAY B;  1U4P A;  2B8F A;  4R4O A;  3I4N B;  4IJH A;  4G7H C;  2R92 H;  2NVX B;  4MD9 A;  4FVM A;  2K5V A;  3H6M A;  4YCW A;  2EVB A;  3MWY W;  1T5X D;  4QJF A;  5ELF A;  3VMH A;  3CC2 1;  4Y7N H;  5C0X J;  2L1B A;  2UXB Q;  3HOW I;  1EYD A;  4NPS A;  4BY7 I;  4B3R Q;  2P3Y A;  3GTK H;  3ITP A;  2DE7 A;  1U5K A;  2A68 D;  4JYA L;  1VLA A;  4IJL A;  1W6K A;  3S14 B;  2ENB A;  4EWC A;  3CCU A;  1N34 Q;  1VQI A;  2F0N A;  4A3K G;  3GV3 A;  1HH2 P;  4FF4 A;  3SK8 A;  4AIM A;  3HS0 C;  4LF8 Q;  3F2B A;  1BF4 A;  3HOY G;  2HU9 A;  1CKN A;  3CC4 Z;  1QVF A;  2R7D A;  4IUV A;  1IL8 A;  4M1U B;  4K14 A;  1LTT D;  4P2C B;  1PHJ A;  1XYI A;  3MXN B;  2JEA I;  1Z7T A;  2RBM A;  4DUY L;  3GTG B;  3HOU I;  4NBH A;  4K0K Q;  1B4O A;  4RKB A;  2H1E A;  1WFQ A;  3GTL H;  1PH9 A;  1F77 A;  4C3I G;  4MZ9 A;  3DXJ C;  4ALP A;  1OTC A;  1YIT A;  1VQP 1;  4A3E H;  1WTW A;  1EYG A;  1HZA A;  2ZTC A;  4HH4 A;  1VQ8 A;  2F0P A;  1ZB9 A;  4E2W A;  4KK7 A;  5E4X A;  5IT9 L;  4PMC A;  1XNR L;  2XN9 C;  3PO3 B;  2D5D A;  3KF8 A;  1CHP D;  1ZEQ X;  3KDF A;  3HOX B;  1FDI A;  2B29 A;  3UDG A;  2HD3 A;  2JR6 A;  1GHK A;  2H85 A;  4WJW A;  3I56 Z;  4GLX A;  3D4W A;  1R9T I;  4K5W A;  1MGS A;  2K32 A;  2R7Z G;  2NZO A;  4A3D H;  3RZO H;  3DM1 A;  3TEH B;  4LFC Q;  2KCM A;  4GNX A;  5M5W B;  2X69 A;  3IAY A;  3SK5 A;  4DA2 A;  1KIX A;  2VUM G;  3FEW X;  4OEM B;  2OQK A;  1CSP A;  4KMU C;  1UUP A;  3A8I E;  5KGU A;  1ICW A;  1PH4 A;  2DNC A;  3K5N A;  5LMU L;  3CCR Z;  4JV5 Q;  2AYD A;  1KD1 2;  3L2P A;  2Z4H A;  4OO1 I;  4GN3 B;  3EN2 A;  1BCP C;  3CCS 1;  3PV0 A;  1PTO B;  1RF2 D;  2PW7 A;  3OW2 A;  3J81 b;  3NXW A;  4A3L G;  3FPP A;  1PZI D;  1SE3 A;  1I6V C;  4X62 L;  1YJW Z;  1NAP A;  4XYO A;  3AEV A;  3NE5 B;  4EGV A;  3VA5 A;  4BY1 G;  2E74 C;  4Z9C B;  1SBB B;  1L2F A;  1I50 B;  1YJN A;  1AEX A;  1NMF A;  4R1J A;  2PI2 A;  4JI4 L;  2EYM A;  3MVV A;  1I94 Q;  1CHQ D;  4A3B H;  3J80 b;  2NVY B;  4ZRZ A;  4CHT B;  1WTQ A;  4DR6 Q;  5M5W H;  2R6M A;  3MXP A;  3CRL C;  3HOU B;  3NUC A;  2OZK A;  2VY3 A;  4A3J H;  1JR0 D;  1XNQ L;  2PNR C;  2G2K A;  5T6B A;  1N8R C;  3NTH A;  2EY2 A;  2MO0 A;  3GD7 A;  2DY8 A;  1PTO H;  3CKI B;  1VQ9 1;  1B3Q A;  1VQK 1;  4DR1 Q;  2Q51 A;  1N9W A;  2B2U C;  3GCF A;  2DJF C;  2H4O A;  3GO5 A;  2K7V A;  3HEJ A;  3G6E Z;  4DF7 A;  1NJI 1;  2BA1 A;  1Q8K A;  3G71 Z;  4NXN Q;  2EIF A;  4I65 A;  3K5L A;  1NUI A;  3U9S A;  3V2T A;  1KNE A;  3OIQ A;  1VQD A;  1SYF A;  1Y69 U;  1KD1 C;  4QTT A;  5T67 A;  1YHB A;  4CDF C;  1E2W A;  3A5U A;  1IBL Q;  3I55 Z;  3LWE A;  4JI8 Q;  1TY0 A;  3G6J B;  4TQU S;  2UXD Q;  3ESW A;  5IOD A;  5E7N A;  1G29 1;  4DR3 L;  4OWW B;  5JVH 3;  2CVR A;  1SFO H;  1ZXT A;  2XVS A;  1WII A;  2JK8 A;  1EIH A;  1BCP D;  3EJI A;  1AH9 A;  1A3U A;  2ZTD A;  1PH2 A;  3CME Z;  4HN7 A;  4BBR I;  2RHB A;  3CCL 1;  1SJE D;  4IOA A;  3CC4 A;  2EJG C;  1W3S A;  2TSS A;  1YJ9 1;  4H13 C;  1YNN C;  4JPB W;  4MTK A;  4YWK A;  1GUO A;  4DK6 C;  3I4N G;  1Y1W B;  4FP5 D;  1I3Q B;  1S3O A;  2LEX A;  4JVZ A;  1FGU A;  3LX0 A;  3Q6S A;  3BVG A;  4PMW A;  3FP9 A;  2JA6 G;  3E3X A;  3AMU A;  3GTP B;  3S2H I;  1PFS A;  2R6G A;  4XT3 B;  1MJC A;  1CSQ A;  3I4O A;  4X6A I;  4IPD A;  3S1Q B;  1XPU A;  1ONL A;  1LTG D;  5LMN Q;  1P9N A;  1RO4 A;  5FK9 C;  1GUT A;  3CXC Z;  1TS4 A;  3GTJ I;  1WTV A;  1Y1W I;  4YHH L;  3BYY B;  4A3K B;  2VUM I;  1X3E A;  1WTP A;  1UE6 A;  2AKL A;  2QRC B;  1JJ2 Z;  2J7Z A;  5BR8 L;  1X9N A;  4CGY B;  1TXY A;  3GTO I;  4XIG S;  4OO1 G;  3NPP A;  3QWU A;  1MJE A;  2ZM6 Q;  3EBE A;  3CXC A;  1PRT B;  2KJX A;  4LNQ A;  1E3P A;  3M85 A;  2EYO A;  2Z6K A;  2B2Y C;  4RGM A;  2A5H A;  2V1C C;  4DN4 M;  5I4D A;  1EY7 A;  1ILP A;  4A3M I;  1XPR A;  3HOX G;  3SR1 A;  5EKI A;  4NBF A;  1DOL A;  3M4Q A;  1VQ7 1;  2KCN A;  2KUM A;  4DV5 Q;  3S1Q H;  1TWG B;  3MZK B;  1LM0 A;  4C3I B;  3J7A V;  4O42 A;  2K50 A;  3KK7 A;  2VF1 A;  2IX3 A;  2O4X A;  3STB D;  3D4R A;  5IP7 G;  2RCF A;  1YNX A;  4O2D A;  3CCJ Z;  3QWN A;  4HED A;  1KC8 1;  4MHE A;  4NBD A;  3G4S Z;  4ME3 A;  3S15 B;  4ZQ3 A;  3F2D A;  2QW7 A;  1JOR A;  3UE0 A;  2QDB A;  4L5R C;  4J1M A;  4E2Y A;  2Z1C A;  5EPL A;  2OXP A;  2JYO A;  1YHQ 1;  3BZK A;  3BG1 B;  1M4V A;  1VQK Z;  4PZ7 A;  3X3M A;  3I55 1;  4IFD G;  1ESR A;  4Y52 H;  5EBC A;  3SGI A;  1I4G A;  4ID6 A;  1Q7Y C;  1M1K 1;  3Q87 A;  1JQY D;  2KA7 A;  1D6E C;  1QF8 A;  2KHI A;  4JI7 L;  2BJO A;  3UDI A;  1TWG H;  1BR9 A;  1HR0 L;  2VW9 A;  1EQR A;  1JB7 A;  3UDX A;  1O7L A;  1HZ9 A;  5JJK A;  1CQV A;  5LHY 1;  4LF6 Q;  3JAM c;  4X3K A;  1EEF D;  3BG0 B;  4YIJ A;  1ASZ A;  3CCQ Z;  2AWO A;  2WII B;  3GV6 A;  3G6E A;  3QO2 A;  3PO3 H;  4EQP A;  3G71 A;  3T4N B;  5IE8 A;  2VUM H;  3EED A;  1OO9 B;  2MJ8 A;  3T1Y Q;  4NH1 C;  2Q4Z A;  3BVM A;  3GKQ A;  4KJO A;  3CCQ 1;  3CCL Z;  3CQZ H;  4FF1 A;  4A75 A;  3WDN A;  5JOB A;  2M48 A;  1E24 A;  3HKZ G;  3MXN A;  4PZ6 A;  1B2T A;  1IXR A;  3S17 I;  1CT1 D;  3PO3 I;  1SND A;  5LL6 S;  2JE6 I;  4WFN 3;  4IFD J;  3I73 A;  2JA8 I;  1BXT A;  2F0E A;  4A3F G;  4N8X 1;  4G4K A;  2OCE A;  3FPU B;  4LFB L;  1IBM L;  3CME A;  1HNX L;  2JIO A;  2XRS D;  2CWP A;  3KBG A;  3MZL B;  4DAM A;  3K6O A;  2WV6 D;  5GRO A;  1KRS A;  3BG3 A;  5A2Q b;  3PUV A;  5FOB B;  3L0O A;  3MFG A;  4LF9 L;  1YNN D;  1MSH A;  3J7A 5;  3RD4 A;  2UUB Q;  1EIF A;  1ILQ A;  3S9W A;  1G2T A;  2R92 I;  3JAM E;  1U4R A;  2LXK A;  5M3M H;  3HOV G;  1DJR D;  1DON A;  2KEC A;  2IV2 X;  2ZT9 C;  4CJ0 B;  2ZTE A;  4BXX G;  4X66 L;  2BCO A;  2RBL A;  2HIV A;  2ZXR A;  4B9X A;  2ASB A;  3H0G G;  1V1P A;  4N9T A;  1BBW A;  1I4P A;  2GTI A;  3DWP A;  2MP1 A;  3NTK A;  3TP7 A;  2QR1 B;  2IPK D;  3AYH B;  3TN2 A;  3T1H Q;  4A3I G;  2JA7 H;  3GQB A;  1N2F A;  3I8Z A;  2JMO A;  4OGQ C;  1J9O A;  2E5L Q;  1S5C D;  3PIO A;  5JAV A;  1YEZ A;  1I6H I;  3S16 B;  2I46 A;  4XTC S;  1STB A;  5DM7 3;  3E0E A;  1VQ4 A;  2Z8L A;  3M4O B;  2XSC A;  2OTJ A;  2PQA A;  3D31 A;  3VTN A;  4OEL B;  4JI5 L;  1N33 Q;  4B08 A;  3GTP I;  3CME 1;  3GTM S;  1GO3 E;  3VYU A;  1IKM A;  1RTN A;  3CHB D;  3FVQ A;  1SJH D;  1JE4 A;  4CKC A;  4DV3 Q;  3GTO H;  5E1F A;  4OWX B;  1L0X B;  1N32 Q;  4KN4 C;  4R4C A;  2HCI A;  4M8A A;  3CCJ A;  1C4Q A;  4GKJ L;  2B63 G;  4UY8 C;  3I4N H;  1KLG D;  1S5E D;  2WB1 B;  4GZY C;  1TY2 A;  2FXQ A;  5TSS A;  1EYC A;  3WOF A;  2IX0 A;  4RHR A;  3CCM Z;  3PF5 A;  4RAU C;  4LF4 L;  2D0P A;  1EY0 A;  4A3B B;  1GXD C;  4E6I A;  1DXM A;  1VQ9 A;  1UWV A;  1T5E A;  4WOR A;  5M3F H;  1N36 Q;  5A2Q E;  3K7A H;  1Y1W H;  1PTO C;  2KHS A;  5IT9 b;  5G3L D;  1QJO A;  1VQO Z;  1O7I A;  2LFN A;  2RIQ A;  3U58 A;  2JIQ A;  3JAM b;  3I07 A;  2QEX Z;  2QEJ C;  1A62 A;  3S1M H;  2NVT B;  1FNV A;  5FLM I;  2CFM A;  1QNK A;  1Q81 1;  5D65 A;  4A3G G;  2IY5 B;  3FKI H;  2WKC A;  3RMH A;  1F9R A;  3CPW Z;  3SE0 A;  4PG3 A;  1WZN A;  2K05 A;  1SNM A;  1GVP A;  4DR4 L;  4BBR G;  3RNU A;  1C9O A;  2GU2 A;  1H9S B;  4K2K A;  1IZ6 A;  3K5O A;  1Q3L A;  2Z6K C;  2XNA C;  3CP0 A;  3V96 A;  1JWS D;  1GKH A;  5FLX L;  4K5V A;  3RZD H;  1JWU D;  1O80 A;  4A3J G;  1WYD A;  1XNR Q;  1VQ7 A;  3KJO A;  3FDT A;  2E2J I;  2W03 A;  2VS1 A;  1WTO A;  4GOP C;  1KL9 A;  4XQN A;  2UUC Q;  2K03 A;  2F4V L;  4RVG A;  3W1B A;  4B3T Q;  3S24 A;  3D3R A;  4KLK A;  2AQ2 B;  3OW7 A;  1PYW D;  1FYC A;  3V05 A;  4RGT A;  5IWA L;  1Y1V G;  2E9H A;  3K8A A;  1Y1W G;  2VQE L;  5EKK A;  1M90 1;  1LLR D;  3HKZ B;  3PCO B;  3J80 c;  3QJY A;  3TZD A;  1JWH C;  1CI3 M;  2JN4 A;  3JAM L;  4NBB A;  3GTJ H;  4BY1 B;  2AUK A;  1GUW A;  2E2J B;  1Q8I A;  2PI2 E;  1K83 B;  5CV4 A;  3J80 E;  5COY A;  2KPI A;  2QIL A;  1K3R A;  2Q2U A;  4LW1 A;  2EYP A;  4ZUI A;  2QGQ A;  3RLN A;  3OTO L;  2RDG A;  1G91 A;  4QQB X;  4GOP B;  2B63 H;  3S15 I;  2D9U A;  4DFA A;  2F0D A;  4V0B A;  2E2D C;  3HOZ B;  5FLX f;  5IP9 I;  4OON A;  1D8L A;  2F0F A;  1OXV A;  4U68 A;  1V43 A;  4XT1 B;  1Q86 C;  1QVC A;  1ML0 D;  2V3V A;  4QTU A;  3CCV Z;  1FL0 A;  1NCV A;  2KED A;  4P72 A;  5DAU A;  3RZD I;  3KIH A;  2VUG A;  1FD7 D;  1WOC A;  3BDL A;  4CDD C;  5JJZ A;  3PO2 H;  1HNZ Q;  4LF6 L;  3VR4 A;  1JC7 A;  5IOC A;  4C3J G;  2CW0 C;  1AZP A;  1ENA A;  4S3S A;  3SK6 A;  2NVY H;  3DEO A;  3MXU A;  2BE5 C;  1VQL A;  4ZLT F;  3VR2 A;  3CC7 1;  3PQI A;  3OW2 Z;  4X3S A;  4ABN A;  5CBE E;  3DEP A;  2EPB A;  2QKD A;  4A3E G;  1K73 2;  2FHT A;  4C3I H;  2VQF Q;  4JG2 A;  3BYT B;  1SLJ A;  1YJN Z;  1JT8 A;  2M6N A;  2L55 A;  1YHA A;  2HQE A;  1BQQ T;  3IL8 A;  5C4X H;  4DUY Q;  1RHP A;  1KQS Y;  5JJL A;  3F8T A;  2E7Z A;  3H0G B;  3FQQ A;  2B2W A;  5M3M G;  3HKS A;  4FO2 A;  5IYC G;  1LT6 D;  4DV7 Q;  3I4L A;  2QA4 1;  3PIO 3;  1QZH A;  4X65 L;  3NSW A;  1SNQ A;  1ZYR D;  1DZ1 A;  2UXB L;  1VQC A;  5IYD H;  3HOY I;  3K81 C;  2X6G A;  1Q86 1;  2L9H A;  4PQX A;  1J5E L;  1SYC A;  3KF6 A;  3M4O I;  1PTO D;  3CMA Z;  1Q1B A;  1K8A 2;  4E2X A;  3A56 A;  2DGY A;  2D2C C;  4A3C I;  4ZYS A;  5M3M B;  4C2M B;  3MAQ A;  3CD6 A;  4QCL A;  2OF1 A;  4AH6 A;  2A6H D;  3HOU G;  3CRK C;  3HZX A;  1KTK A;  1VQL 1;  4DNT B;  2FFK B;  5C4X B;  1EQV A;  1SN8 A;  4DU9 A;  1UE7 A;  1H9J A;  1VQM Z;  5EBD A;  5KNB A;  2I5L X;  4FF3 A;  4E30 A;  4F8M A;  1X6O A;  1EWI A;  1KLU D;  1SDF A;  2VNU D;  1YUA A;  4RCN A;  1TWC H;  3K57 A;  3TRZ A;  2WAQ G;  2HDM A;  3F3P C;  5E4W C;  1E1O A;  3K5M A;  1LTL A;  2XRQ D;  5DEH A;  3WOE A;  1M8A A;  1VQN 1;  3PSI A;  4O1N A;  1K8O A;  4DV4 L;  1K8G A;  4L63 B;  3K59 A;  1USP A;  2F0G A;  1VMP A;  4GNX C;  3HOV I;  1SE4 A;  1AZQ A;  3W1G A;  3J81 f;  3E0J A;  1VQE A;  3ZYY X;  3F1Z A;  1SFO I;  3J80 L;  4X3U A;  3J81 c;  1E22 A;  4DK0 A;  2LS0 1;  5C4J I;  1A15 A;  2Q2H A;  2JA8 H;  1W6J A;  5A2Q f;  4ZUJ A;  1KAB A;  2WAQ B;  4DR6 L;  4B3S L;  3RLF A;  1IKL A;  3U9O A;  4DR5 L;  2NN6 I;  4H7B A;  4A3G B;  5G3L F;  1VQH A;  1PMR A;  1JIC A;  1J6Q A;  3PUY A;  2EYH A;  1X55 A;  1K8A C;  2F1M A;  1DM0 B;  4RG1 A;  3ULJ A;  2DN8 A;  4UP9 A;  4F87 A;  5JEA G;  4LF7 L;  3HOV B;  4DV5 L;  3J7A F;  3CCM 1;  4XDX A;  4JW0 A;  2F0W A;  4A3L I;  5J1Z A;  1II3 A;  3ULP A;  5C5M A;  1X3Z A;  1K83 I;  2EJM A;  1KQS Z;  1B44 D;  1KAA A;  1EZ8 A;  2V8I A;  1Y8C A;  2F0L A;  3NDJ A;  4O0A A;  1NSN S;  1G51 A;  2I3C A;  2UU9 Q;  4B3M L;  4MD8 A;  1VQ8 Z;  3LGJ A;  5LL6 X;  1IYV A;  1Y8P B;  3A0J A;  5K36 G;  5LMU Q;  4LUO A;  2F3V A;  3S2H H;  4GLV B;  1CUK A;  1SYD A;  4FDB A;  3CC2 A;  2E2H B;  1X56 A;  1SMY D;  1KQS A;  3TQY A;  1FDO A;  2LXJ A;  4MNO A;  4UPA A;  3ZJY C;  2QA4 A;  3S16 H;  3MFY A;  4KHP Q;  4JK1 C;  4IUQ A;  1TR5 A;  3CC2 Z;  3TP6 A;  2NVX H;  1GUN A;  1CA5 A;  5JJI A;  3GTM H;  2R93 B;  2RHQ B;  3NBH B;  1O78 A;  3JC6 6;  3KF8 B;  2IX1 A;  4GN5 A;  3ER0 A;  4HR7 B;  3GTO B;  3OOC A;  3FMC A;  2K04 A;  1ML8 A;  2SDF A;  4P71 A;  4DV0 Q;  1TS2 A;  1S7M A;  2QLV B;  1FNU A;  2I0Q A;  1RIP A;  1BDO A;  1XJV A;  1GM5 A;  1PA6 A;  3NDI A;  1SRU A;  1LAC A;  1LYL A;  1IBK L;  3S16 I;  1I6H B;  1BCP F;  4LFA Q;  3S1N I;  3RN5 A;  3GTQ B;  5I6W A;  3KF6 B;  1WTX A;  4NXM Q;  1LT4 D;  5L37 A;  3LNN A;  4AQY L;  4A3M H;  3P7J A;  4DV6 L;  3HOW B;  1H9M A;  3DUZ A;  1TWH I;  1CKN B;  2VQE Q;  4A3C G;  2V8K A;  3A74 A;  2WIN B;  3D2L A;  4H44 C;  4RMF A;  1PH1 A;  4GS3 A;  3MON A;  3C1E A;  1VQN Z;  5C3E G;  2VPX A;  2NTT A;  4KY5 A;  1PZJ D;  1PLF A;  2G5D A;  3NP8 A;  1H95 A;  2HHH Q;  1YI2 Z;  2Q8T A;  1YIT Z;  1PV4 A;  1B3A A;  2ZAE B;  4NOZ A;  2O5I C;  1QG7 A;  2AKW B;  1U4L A;  1PH7 A;  2A6E C;  4RGO S;  2RKS A;  5M5Y B;  4POG A;  1GUS A;  1Q7Y 2;  2CHB D;  3A8J E;  4DAV A;  3H91 A;  3OTO Q;  1K9M C;  2EXZ A;  2LFU A;  4C1N I;  3HGB A;  1VQJ A;  3KYH C;  1KRL A;  2JA6 I;  1VQ6 Z;  3EER A;  2B63 B;  1RKN A;  3PIP 3;  2SNM A;  3KLS X;  1KD1 1;  1PRT C;  2K01 A;  1F9S A;  4GOP A;  4ZKC B;  1Y1V I;  2D62 A;  1Z03 A;  1PFM A;  4A3I B;  5ELD A;  1DL6 A;  3BDO A;  1RL2 A;  3G4S A;  4JI6 Q;  5M9O A;  4BXX H;  5FJ8 H;  3H15 A;  3CCS A;  3TRE A;  5IGE A;  2WKD A;  2BDO A;  2B2T C;  3VYT A;  3I55 A;  1XWE A;  2PZW A;  1UNS A;  1B9M A;  1SMX A;  2IL8 A;  3GTP H;  3VYR A;  2B2Y A;  4OX9 L;  2L15 A;  1ESF A;  3QOL A;  3BVZ A;  4HGY A;  2EYF A;  1VQA A;  3CCS Z;  2BA0 A;  3GP7 A;  1OXX K;  5KEE A;  1USP B;  2E5L L;  1E0B A;  5KYL A;  3VB9 A;  1W2B Y;  4A3M G;  4DNR B;  5IYB G;  1A6X A;  4X62 Q;  5C44 H;  4NB8 A;  2AUJ D;  2IHE A;  1QCB D;  2DY7 A;  3K0X A;  3NFZ A;  1G8Z D;  1F9Q A;  2A69 C;  1LTB D;  5I9P A;  1W2B Z;  2I5H A;  3HKZ E;  1PH6 A;  2N55 A;  2P28 A;  5IGD A;  2ZM6 L;  3MC0 B;  3AU7 A;  3S1R B;  1PH5 A;  4FXG C;  2OOX B;  2ICE C;  2N49 A;  1CA6 A;  4ME5 A;  1Q82 2;  1Y1V H;  2JNY A;  1UEA B;  4DV2 Q;  2B3G A;  3M3Y B;  3PO3 G;  3CCL A;  1RCV D;  1I4R A;  2G9H D;  4NB9 A;  4GKK Q;  3A7A B;  1JE5 A;  1F2Z A;  1VQ4 Z;  5J39 A;  2OWO A;  3EVQ A;  1S72 A;  4DV1 Q;  4LUZ A;  1R9T B;  1SE8 A;  4KN7 C;  1I50 I;  2K28 A;  5GAE C;  2LSS A;  2HT1 A;  2WB1 A;  5AJ3 L;  4A3D B;  4DUZ L;  2YU9 H;  1Q82 1;  3MA2 B;  4A3E B;  2XIW A;  1STA A;  5K36 H;  1E2V A;  1YHQ Z;  4JI2 Q;  3URY A;  4MH4 A;  3KBX A;  2V45 A;  3IR7 A;  1YBY A;  5GAD C;  1IW7 C;  3H3V C;  4NBE A;  3BS1 A;  1R4P B;  5C4J H;  2M9V A;  3UDF A;  4CBV A;  1KRT A;  2IZ4 A;  1EFI D;  1VMC A;  4KI0 A;  2F0K A;  3FKI G;  4WJ3 M;  2H5X A;  4CJ2 C;  4DXF A;  5CC4 A;  3OWE B;  4DGL A;  1QUQ A;  1TWF B;  3OWF A;  1YIJ A;  1FR3 A;  3M3Y H;  5IT9 c;  5JEA H;  4IQZ A;  2O4H A;  3D0F A;  1QZG A;  2QKI C;  4I7A A;  4H0L C;  2JJQ A;  5CR3 A;  4V19 0;  4GN4 B;  3QOJ A;  3I4M I;  2Z6B A;  1K9M 1;  2L12 A;  1EQQ A;  4F88 A;  3JAM f;  4EX5 A;  3GTQ I;  2JA8 G;  3VMI A;  2J0T D;  1Y8O B;  2MUY A;  3RZO I;  1XNQ Q;  3PUX A;  2ID0 A;  1Q86 2;  2HF1 A;  2JP1 A;  4EVO A;  4IUT A;  1VQO 1;  1BCP B;  5C4J B;  4EQO A;  3SEB A;  2A8V A;  4AYB E;  3I2Z A;  1EY6 A;  3S1R I;  5IGB A;  3ND8 A;  1Q81 C;  4A93 B;  4KY6 A;  1VQ6 A;  3P20 A;  1GD7 A;  3M3Y I;  4S1T A;  5C44 I;  1JOK A;  4RCO A;  1EY9 A;  1X3W A;  2EE1 A;  2UUA L;  2B63 I;  2DUD A;  2NZ1 D;  4P75 A;  2YAD A;  4BXX I;  2TMP A;  3CMA 1;  1K0R A;  3I91 A;  5BN4 A;  2RVL A;  1YNJ C;  3EFX D;  4OHJ A;  3E5S A;  5C0X H;  4HJ5 A;  1NBW A;  2WFW A;  3HOU H;  5AN9 F;  2B2U A;  1V1O A;  1K83 H;  2EY1 A;  1JWM D;  2RSN A;  5CM2 M;  1HFN A;  3I7F A;  4IAL A;  3E9I A;  2BH8 A;  2A69 D;  3A5Z B;  5C4X I;  1TU2 B;  4AYB B;  4X64 Q;  4U67 3;  2HCC A;  3NHH A;  3ICE A;  1NJI C;  1VQ9 Z;  1U9R A;  3NQT A;  1KDA A;  1PTO F;  2I07 B;  1DCZ A;  2R93 H;  3D6W A;  1CZG A;  3M4P A;  1FJG Q;  4QUC A;  4DR1 L;  5GQO A;  4MTN A;  2CW0 D;  4JI1 Q;  4A93 H;  1DD2 A;  4X3T A;  4DV0 L;  1PRT D;  1TWF I;  4DR2 Q;  2CKZ B;  4CKE A;  2MHV A;  1QVG A;  3T4A C;  1F2L A;  2B2T A;  5I6Y A;  2NVY I;  4NXN L;  3GTK I;  4A3G I;  4XXE A;  5EPK A;  1VQK A;  3HOV H;  4AYB G;  2UXC L;  1HTP A;  2OTL 1;  4IO9 A;  1SFO B;  4P73 A;  4NB3 A;  1PFT A;  1STE A;  1VQ6 1;  4UP7 A;  1X3P A;  3PO3 S;  5GAG C;  3I3C A;  2Z9H A;  1QE6 A;  5IIF A;  2RCN A;  4DK1 A;  4DV3 L;  4C3J H;  3DMU A;  2QDL A;  4X65 Q;  1K9M 2;  4ZK9 B;  4UDU C;  4LF5 L;  3SK4 A;  2R7F A;  4GKJ Q;  1WVL A;  3CCQ A;  5EJW A;  4L8J A;  3CCU 1;  3K7A I;  2OEO A;  3WWV A;  4RWS C;  1A3T A;  1TWA B;  1WD0 A;  1HTL D;  4R4T A;  5CV9 A;  5ELE A;  1YJ9 A;  3NBI A;  4NMZ A;  5T64 A;  1WCM I;  4BWG B;  4AYB A;  1CKM A;  1HA5 A;  2AHO B;  1L1O C;  2NN6 G;  1C0A A;  4DQY B;  1BO0 A;  2JUB A;  2LY7 A;  3CCE A;  1SRO A;  3KDF B;  1MBY A;  4OL7 A;  4K0K L;  3K7A B;  4XX2 A;  1LV9 A;  4ZAI A;  4PNY A;  4K8J A;  4A3I I;  2JEB I;  2OTL A;  2M2L A;  3N6R A;  3DHQ A;  5EKL A;  1O7Z A;  4BBS B;  3BDC A;  2QCP X;  3SHL A;  1QYP A;  1IBM Q;  4FYD A;  2R61 A;  1IBL L;  2JIR A;  4L5Q A;  4A3L H;  1T9H A;  1YJW 1;  2NVT H;  4PZ8 A;  2O53 A;  3W2D A;  4DV4 Q;  3Q22 A;  1N8R 2;  1D2B A;  2IWH A;  5CMD A;  4A3B I;  3J7A 4;  2NN6 H;  4HIM A;  1R4Q B;  3SXH A;  4A76 A;  4ZKB B;  3C3L A;  1VQB A;  4RKL A;  1NP6 A;  1XX8 A;  2IW3 A;  1NR4 A;  2WAQ E;  4QB4 A;  5C44 G;  4GLA C;  1FGB D;  2JQO A;  3CC4 1;  2CH4 W;  5FLX b;  3S1M I;  1V1P B;  2Y0S E;  2IZ3 A;  1CFM A;  1QUQ B;  3QB3 A;  3CCJ 1;  4HIK A;  1Q7Y 1;  1ET9 A;  3CD6 1;  1KC8 2;  4C3H G;  1SMY C;  2F4I A;  3S1R H;  3Q8D A;  1EIG A;  4DR5 Q;  1S5F D;  1TWH B;  2JA6 B;  5IP7 H;  2N78 A;  4K8I A;  2VPY A;  4BBR H;  4CKB A;  3HOY B;  1HQM C;  4EQ5 A;  1KC8 C;  1H9K A;  1EU3 A;  1S72 1;  1I4H A;  1SR3 A;  1EWH A;  1VF7 A;  3M7N A;  4A3G H;  1PH8 A;  2EYJ A;  1SNC A;  1TWC I;  1B9N A;  3IKJ A;  4JI3 L;  3C2P A;  5IP9 G;  5C3E B;  2JA7 B;  4P74 A;  4TRD A;  1MI2 A;  3S17 H;  4OO1 H;  4R8I A;  3IX0 A;  2Y0S B;  3KUP A;  3ONA B;  5C6A A;  2PCF B;  5I2X A;  3GTG H;  3STB C;  1VQP A;  4NKL A;  5FLM G;  4A3F B;  2ZJQ A;  1BVS A;  1S5D D;  5M3F G;  1Z01 A;  2VPZ A;  1ZB8 A;  3S14 I;  3M9B A;  3J81 j;  4MD7 A;  3I90 A;  2A19 A;  4A3D I;  2L11 A;  2VXW A;  1NMG A;  2JA5 H;  3B6Y A;  2VPW A;  3L3O C;  3HOY H;  5A35 A;  4A3E I;  4A93 G;  4NDX A;  1JB3 A;  4Q0F A;  1Z6H A;  2A1A A;  1WW9 A;  2Y0S G;  3ND9 A;  2V8J A;  2SEB D;  4A3C H;  3J81 i;  1Q81 2;  4X66 Q;  3LUS A;  1MIU A;  1VS0 A;  1SEB D;  3GDE A;  3NWS A;  1YZ6 A;  1SXT A;  3IFD A;  3VA7 A;  1A2U A;  1KDC A;  1VQO A;  1LTR D;  1QOH A;  1ZYR C;  1E2Z A;  4HCE A;  3CPF A;  2F4M A;  1VF5 C;  2JA5 G;  1JCK B;  3CCR 1;  2J4X A;  4UP8 A;  2MGS A;  5ELO A;  3TP5 A;  3IFU A;  1LT5 D;  3HRZ C;  1S5B D;  3T16 A;  1PXU A;  4Y7N B;  2WAC A;  1Y8N B;  2R92 G;  1YJN 1;  4TVA B;  2DE5 A;  2QEX 1;  3KFU A;  1UAP A;  1WJJ A;  2IHF A;  3J80 f;  4G57 A;  2RA4 A;  3PO2 I;  3F3F C; 
#chains in the Genus database with same CATH homology
 1N33 L;  4JBJ A;  4JI7 Q;  4BA2 I;  3BZC A;  4DR4 Q;  4IPC A;  3H0G H;  2YYZ A;  1NTG A;  5H1S E;  3H0G I;  5IP9 H;  4JI4 Q;  1WI5 A;  4DV7 L;  2K5R A;  1P8L A;  4Y7N I;  4JBK A;  3S2D I;  5M5Y H;  3IRB A;  1B7Y B;  1XMQ L;  2MNA A;  1VQ7 Z;  1PVO A;  2NVX I;  2F52 A;  2PNH A;  1OXT A;  1U0L A;  1E1T A;  2F4V Q;  5D1O B;  4JV5 L;  4YCU A;  2OTL Z;  3L7Z C;  1D7Q A;  1FJG L;  4HJ9 A;  1Q46 A;  1N36 L;  3U50 C;  3H3V I;  1S40 A;  3K7U C;  3CAM A;  2CWA A;  2UU9 L;  5HY6 A;  3IF8 A;  2JA9 A;  1EUJ A;  4E2Z A;  4DR7 Q;  4IPG A;  3HOW G;  1I3Q I;  2NVQ H;  3CCV 1;  2MFI A;  4BY1 H;  2HQL A;  3PUZ A;  1N32 L;  5DLQ E;  2YV5 A;  4CL1 A;  1YIT 1;  1LQL A;  3H3V H;  1G6P A;  3I56 A;  3GTG I;  2KEN A;  2AWN A;  1ZH1 A;  4BBS I;  2CQO A;  1VCI A;  2K52 A;  2GTH A;  4RVF A;  1FVI A;  1A0I A;  5JEA J;  4A3D G;  1IBK Q;  4NBA A;  3CC7 Z;  4LFA L;  1Z02 A;  1A8V A;  4E31 A;  4HJA A;  3I4N I;  5LMN L;  1M1K C;  4DNI A;  5D1O A;  1HNW L;  1VQ8 1;  2UXD L;  5AJ3 Q;  2E2I H;  4DPG A;  4JI5 Q;  4HID A;  3DM3 A;  1I94 L;  4BBS H;  1I3Q H;  5J3B A;  1UEB A;  3S14 H;  1XMO Q;  2KBN A;  1Z9F A;  2WB1 E;  1EFW A;  2WB1 G;  2IT1 A;  1VQM 1;  1PYB A;  4TNU A;  1IL2 A;  2BH2 A;  4B3T L;  3CCM A;  1HNZ L;  1XPO A;  1V1Q A;  1YHQ A;  3RLO A;  3G6E 1;  4A3K H;  1RO2 A;  2JS4 A;  3G71 1;  3CW2 C;  1LUZ A;  2GVA A;  4C2M H;  3W5O A;  3CCE 1;  4YHH Q;  3D9X A;  1I6H H;  1K73 1;  5IP7 I;  4MRI A;  1HZB A;  3PUW A;  4RVD A;  3P5J B;  1TFI A;  3NH4 A;  1CKO A;  1JJG A;  5C3E H;  5EAY A;  1HR0 Q;  4B3R L;  2YTV A;  1YJW A;  4JOI A;  4JOI C;  1BBU A;  3CQZ I;  1X65 A;  1N34 L;  1X0T A;  4LFC L;  4DV2 L;  1M90 C;  3CCU Z;  4NBG A;  4X64 L;  4JI6 L;  2NVQ I;  4MXU A;  1QVF Z;  4JC0 A;  1L1O B;  4QL5 A;  1KAW A;  1B70 B;  1I50 H;  4LFB Q;  3KIF A;  3VDY A;  2QA4 Z;  2D0O A;  1BKB A;  1JJ2 Y;  3GTL I;  2E2H H;  2VL6 A;  3DLL A;  3I4M G;  4X6A H;  3AFQ A;  1RQF A;  2RHS B;  1K8A 1;  2MQH A;  1QVG Z;  3ERS X;  5HGQ A;  4A3B G;  4LUV A;  1X3F A;  1VQG A;  4R4Q A;  4YCV A;  2XGT A;  2QRE B;  1VQF A;  2EQS A;  3E9H A;  3U4Z A;  1Q82 C;  4MON A;  1VQ4 1;  3CPW Y;  3PIP A;  4DV1 L;  4HJ8 A;  2ZJR A;  4JBM A;  1TWG I;  1WCM G;  4JI8 L;  2QRD B;  3G48 A;  4WJ4 A;  1Q12 A;  1YI2 A;  4JBW A;  1JJC B;  5IT9 f;  2ATW A;  4JYA Q;  3BU2 A;  2OQ0 A;  2R7Z H;  2Q2I A;  4BY1 I;  2N8N A;  4JI0 L;  1MKH A;  4KHP L;  1JJ2 A;  1TWF H;  3OYY A;  2UUC L;  2NZH A;  4LF7 Q;  2RT9 A;  2RF4 A;  4J15 A;  2R93 I;  5M5X H;  1QVG Y;  4RVH A;  4L5S A;  2YU9 I;  2YTY A;  2ZJP A;  3S1N H;  4A3I H;  2JA7 G;  1Q1E A;  3NEL A;  3OW2 Y;  4A4I A;  5IYC H;  1TWA I;  1YIJ Z;  1JMC A;  5BR8 Q;  4BY7 G;  1HNX Q;  2OOY B;  3GTQ H;  3GTM I;  1HNW Q;  4BY7 H;  5C4X G;  4DR3 Q;  2C35 B;  2UUB L;  2PMZ E;  3HOZ G;  4BBS G;  1YIJ 1;  3J7Z C;  3CCV A;  4Y52 I;  2KI7 B;  3FKI I;  4POF A;  4LF4 Q;  3TS2 A;  1XMO L;  1EIY B;  4A3F H;  3K80 C;  3AFP A;  5C3E I;  2XTI A;  4A93 I;  5C0X G;  4JCV E;  1S72 Z;  1QVF Y;  1VQ5 1;  2PQA B;  4A3J I;  1L1O A;  3TS0 A;  5GAH C;  2K14 A;  3FQM A;  1YUK A;  1X54 A;  2OTJ Z;  4JI2 L;  2UXC Q;  4QGU A;  2JA5 I;  2GN5 A;  3TDH B;  1HZC A;  4YY3 L;  1HJP A;  2WP8 J;  3S2D H;  2OTJ 1;  4OWT B;  4IFD I;  4RS4 A;  3CMA A;  4E33 A;  5LMN W;  1AE2 A;  2HIX A;  2PK7 A;  4IPH A;  4KHZ A;  5FLX c;  3HOX I;  4LWC A;  4DK3 C;  2E2I I;  2K5H A;  1C7Y A;  3NH5 A;  2K5N A;  2KHJ A;  4JI3 Q;  4DUZ Q;  1VQN A;  1EOV A;  3CPW A;  1R9T H;  1L0W A;  3HOX H;  1NJI 2;  4DR7 L;  4R4I A;  2F4O A;  1RLY A;  4OXP A;  2Z0S A;  2N3S A;  2DE6 A;  2YTX A;  2RPR A;  1J5E Q;  3PGZ A;  3BJU A;  4LF8 L;  3J80 i;  1NE3 A;  3CCE Z;  1PYS B;  4GKK L;  1VQ5 A;  1A63 A;  3FHW A;  2E2J H;  2R7Z I;  1B8A A;  5LL6 f;  5IYB H;  3RR5 A;  2JA6 H;  4BA1 I;  1K73 C;  5IYD G;  1ASY A;  4DKA C;  3HKZ A;  3VMG A;  1E7Z A;  1VQ5 Z;  3HOZ H;  3CXC Y;  4RV9 A;  4HJ7 A;  2F3I A;  4LF9 Q;  1YI2 1;  2K3R A;  2LIY A;  1M90 2;  1Y14 B;  4HGZ A;  5FJ8 G;  3KJP A;  2UUA Q;  2I5M X;  5FLM H;  3NEN A;  1PH3 A;  3AQQ A;  3I56 1;  2PMZ A;  1YVC A;  4B3S Q;  4HIO A;  4LF5 Q;  4QIW E;  4JI0 Q;  1XMQ Q;  2W04 A;  1UE1 A;  3F2C A;  3TE5 B;  2Y0S A;  2VZA A;  1RNI A;  3PF4 A;  1YJ9 Z;  3NEM A;  4AQY Q;  2VQF L;  3UE1 A;  1N8R 1;  3PO2 G;  1X3G A;  4APV A;  4C3H H;  3EIV A;  3ULL A;  3S1Q I;  1XTD A;  4QY7 A;  3H3V J;  2ALY B;  1Y1V S;  1RO0 A;  4A3K I;  1M1K 2;  1OXS C;  1WCM H;  3HFZ B;  1Z47 A;  3T1Y L;  2JA7 I;  2PM9 A;  2EXD A;  4GNX B;  5IWA Q;  3G4S 1;  1NY4 A;  2KCT A;  4E32 A;  1P16 A;  3CD6 Z;  1VQM A;  3CC7 A;  4IOC A;  4B3M Q;  4A3F I;  2MO1 A;  4NFR A;  5IY0 A;  1KHI A;  1TWH H;  3KOJ A;  4NXM L;  4OX9 Q;  4DV6 Q;  2ES2 A;  1TWA H;  4YWM A;  4YWL A;  1VQL Z;  3MEF A;  3HOZ I;  2QEX A;  3I4M H;  2GVB A;  3HOW H;  2E8G A;  2HHH L;  2K75 A;  5ELN A;  3CCR A;  2J6A A;  3JAM i;  3CF5 A;  1W2B A;  2WAQ A;  1VQP Z;  1KXL A;  1I5F A;  4YY3 Q;  4L5T A;  3S15 H;  4H02 A;  5C0X I;  2K4K A;  3RN2 A;  2E2H I;  2Q2T A;  4NBC A;  2AMC B;  2NVT I;  3T1H L;  1HR0 W;  1AE3 A;  1UE5 A;  3M4O H;  4JI1 L;  1DGS A;  2CCZ A;  4DR2 L;  2EGT A;  5D1P A;  3U4V A;  1IYJ B;  2R93 G;  1V9P A;  1OXU A;  3NH8 A;  3KLW A;  4DAY B;  4R4O A;  4IJH A;  2R92 H;  4MD9 A;  2K5V A;  4YCW A;  4Y7N H;  4QJF A;  5C0X J;  3VMH A;  3CC2 1;  2UXB Q;  3HOW I;  4NPS A;  4BY7 I;  4B3R Q;  2P3Y A;  3GTK H;  2DE7 A;  1U5K A;  4JYA L;  1VLA A;  4IJL A;  4EWC A;  3CCU A;  1N34 Q;  1VQI A;  4A3K G;  1HH2 P;  4AIM A;  4LF8 Q;  3F2B A;  3HOY G;  2HU9 A;  1CKN A;  3CC4 Z;  1QVF A;  2R7D A;  1PHJ A;  2JEA I;  3MXN B;  4DUY L;  3HOU I;  4NBH A;  4K0K Q;  1WFQ A;  3GTL H;  1PH9 A;  4MZ9 A;  4ALP A;  1OTC A;  1YIT A;  1VQP 1;  4A3E H;  1EYG A;  1HZA A;  2ZTC A;  4HH4 A;  1VQ8 A;  1ZB9 A;  4E2W A;  1XNR L;  3KDF A;  2B29 A;  3UDG A;  2JR6 A;  2H85 A;  3I56 Z;  4GLX A;  1R9T I;  2R7Z G;  2NZO A;  4A3D H;  3RZO H;  3TEH B;  4LFC Q;  2KCM A;  4GNX A;  1KIX A;  2VUM G;  2OQK A;  1CSP A;  1PH4 A;  5LMU L;  3CCR Z;  4JV5 Q;  1KD1 2;  3L2P A;  4OO1 I;  4GN3 B;  3EN2 A;  3CCS 1;  3PV0 A;  3OW2 A;  3J81 b;  4A3L G;  4X62 L;  1YJW Z;  3AEV A;  4BY1 G;  1L2F A;  1YJN A;  1NMF A;  4R1J A;  2PI2 A;  4JI4 L;  1I94 Q;  4A3B H;  3J80 b;  4DR6 Q;  5M5W H;  2R6M A;  2OZK A;  2VY3 A;  4A3J H;  1XNQ L;  2G2K A;  5T6B A;  1N8R C;  2MO0 A;  3GD7 A;  1VQ9 1;  1VQK 1;  4DR1 Q;  2Q51 A;  1N9W A;  3GCF A;  3GO5 A;  3G6E Z;  1NJI 1;  2BA1 A;  1Q8K A;  3G71 Z;  4NXN Q;  2EIF A;  1NUI A;  1VQD A;  1KD1 C;  4QTT A;  5T67 A;  1YHB A;  3A5U A;  1IBL Q;  3I55 Z;  4JI8 Q;  4TQU S;  2UXD Q;  3ESW A;  5E7N A;  1G29 1;  4DR3 L;  4OWW B;  1SFO H;  1WII A;  2JK8 A;  1AH9 A;  2ZTD A;  1PH2 A;  3CME Z;  4BBR I;  2RHB A;  3CCL 1;  4IOA A;  3CC4 A;  1W3S A;  1YJ9 1;  4YWK A;  4DK6 C;  3I4N G;  1S3O A;  1FGU A;  4PMW A;  3FP9 A;  2JA6 G;  3S2H I;  1PFS A;  2R6G A;  1MJC A;  1CSQ A;  3I4O A;  4X6A I;  4IPD A;  1XPU A;  5LMN Q;  1P9N A;  1RO4 A;  3CXC Z;  3GTJ I;  1Y1W I;  4YHH L;  2VUM I;  1X3E A;  1UE6 A;  2AKL A;  2QRC B;  1JJ2 Z;  1X9N A;  5BR8 L;  1TXY A;  3GTO I;  4XIG S;  4OO1 G;  3QWU A;  1MJE A;  2ZM6 Q;  3EBE A;  3CXC A;  4LNQ A;  1E3P A;  3M85 A;  2Z6K A;  2V1C C;  4A3M I;  1XPR A;  3HOX G;  4NBF A;  3M4Q A;  1VQ7 1;  4DV5 Q;  3S1Q H;  3MZK B;  1LM0 A;  2K50 A;  2VF1 A;  3STB D;  5IP7 G;  1YNX A;  4O2D A;  3CCJ Z;  1KC8 1;  4NBD A;  3G4S Z;  4ME3 A;  3F2D A;  3UE0 A;  4L5R C;  4E2Y A;  1YHQ 1;  3BZK A;  3BG1 B;  1VQK Z;  4PZ7 A;  3I55 1;  4IFD G;  4Y52 H;  3SGI A;  1Q7Y C;  1M1K 1;  3Q87 A;  1QF8 A;  2KHI A;  4JI7 L;  2BJO A;  3UDI A;  1TWG H;  1HR0 L;  2VW9 A;  1EQR A;  1JB7 A;  3UDX A;  1HZ9 A;  5JJK A;  4LF6 Q;  3JAM c;  3BG0 B;  1ASZ A;  3CCQ Z;  2AWO A;  3G6E A;  3PO3 H;  3G71 A;  3T4N B;  5IE8 A;  2VUM H;  3EED A;  3T1Y Q;  4NH1 C;  2Q4Z A;  3GKQ A;  3CCQ 1;  3CCL Z;  3CQZ H;  4A75 A;  2M48 A;  1E24 A;  3HKZ G;  4PZ6 A;  1IXR A;  3S17 I;  3PO3 I;  2JE6 I;  4IFD J;  2JA8 I;  4A3F G;  2OCE A;  4LFB L;  1IBM L;  3CME A;  1HNX L;  4DAM A;  2CWP A;  3MZL B;  5GRO A;  1KRS A;  5A2Q b;  3PUV A;  3L0O A;  4LF9 L;  3J7A 5;  2UUB Q;  1EIF A;  2R92 I;  2LXK A;  5M3M H;  3HOV G;  2ZTE A;  4BXX G;  4X66 L;  2RBL A;  2HIV A;  2ASB A;  3H0G G;  1BBW A;  2GTI A;  2QR1 B;  3AYH B;  3T1H Q;  4A3I G;  2JA7 H;  1N2F A;  2JMO A;  2E5L Q;  3PIO A;  1YEZ A;  1I6H I;  4XTC S;  3E0E A;  1VQ4 A;  2OTJ A;  2PQA A;  3D31 A;  3VTN A;  4JI5 L;  1N33 Q;  3GTP I;  3CME 1;  3GTM S;  1GO3 E;  4DV3 Q;  3GTO H;  4OWX B;  1N32 Q;  4R4C A;  3CCJ A;  4GKJ L;  2B63 G;  4UY8 C;  3I4N H;  2FXQ A;  2IX0 A;  3CCM Z;  3PF5 A;  4LF4 L;  2D0P A;  1VQ9 A;  1UWV A;  5M3F H;  1N36 Q;  3K7A H;  1Y1W H;  5IT9 b;  1VQO Z;  1O7I A;  2RIQ A;  3U58 A;  3JAM b;  3I07 A;  2QEX Z;  1A62 A;  3S1M H;  5FLM I;  2CFM A;  1Q81 1;  4A3G G;  2IY5 B;  3FKI H;  3CPW Z;  4PG3 A;  1GVP A;  4DR4 L;  4BBR G;  3RNU A;  1C9O A;  2GU2 A;  1IZ6 A;  2Z6K C;  3CP0 A;  1GKH A;  3RZD H;  4A3J G;  1WYD A;  1XNR Q;  1VQ7 A;  3KJO A;  2E2J I;  2W03 A;  2VS1 A;  4GOP C;  1KL9 A;  2UUC Q;  2F4V L;  4RVG A;  3W1B A;  4B3T Q;  3S24 A;  4KLK A;  5IWA L;  1Y1V G;  2E9H A;  3K8A A;  1Y1W G;  2VQE L;  1M90 1;  3J80 c;  3PCO B;  1JWH C;  4NBB A;  3GTJ H;  2PI2 E;  2KPI A;  1K3R A;  2Q2U A;  4LW1 A;  2QGQ A;  3RLN A;  3OTO L;  4QQB X;  4GOP B;  2B63 H;  3S15 I;  5FLX f;  5IP9 I;  4OON A;  1D8L A;  1OXV A;  1V43 A;  1Q86 C;  1QVC A;  4QTU A;  3CCV Z;  1FL0 A;  4P72 A;  3RZD I;  3KIH A;  2VUG A;  1WOC A;  3PO2 H;  1HNZ Q;  4LF6 L;  2NVY H;  1VQL A;  3CC7 1;  3OW2 Z;  2QKD A;  4A3E G;  1K73 2;  4C3I H;  2VQF Q;  4JG2 A;  1SLJ A;  1YJN Z;  1JT8 A;  2M6N A;  1YHA A;  4DUY Q;  5C4X H;  1KQS Y;  5JJL A;  3F8T A;  3FQQ A;  5M3M G;  3HKS A;  5IYC G;  4DV7 Q;  2QA4 1;  1QZH A;  4X65 L;  2UXB L;  1VQC A;  5IYD H;  3HOY I;  3K81 C;  1Q86 1;  1J5E L;  3KF6 A;  3M4O I;  3CMA Z;  1Q1B A;  1K8A 2;  4E2X A;  2DGY A;  4A3C I;  3CD6 A;  4AH6 A;  3HOU G;  1VQL 1;  1SN8 A;  1UE7 A;  1VQM Z;  2I5L X;  4E30 A;  1X6O A;  1EWI A;  2VNU D;  1YUA A;  1TWC H;  3TRZ A;  2WAQ G;  3F3P C;  1E1O A;  1LTL A;  1VQN 1;  3PSI A;  4DV4 L;  1K8G A;  1USP A;  4GNX C;  3HOV I;  3W1G A;  3J81 f;  1VQE A;  3F1Z A;  1SFO I;  3J81 c;  1E22 A;  5C4J I;  2Q2H A;  2JA8 H;  5A2Q f;  4DR6 L;  4B3S L;  3RLF A;  4DR5 L;  2NN6 I;  1VQH A;  1J6Q A;  3PUY A;  1X55 A;  1K8A C;  4RG1 A;  3ULJ A;  4UP9 A;  5JEA G;  4LF7 L;  4DV5 L;  3CCM 1;  4A3L I;  3ULP A;  1X3Z A;  1K83 I;  1KQS Z;  2V8I A;  3NDJ A;  4O0A A;  4B3M L;  1G51 A;  2I3C A;  2UU9 Q;  4MD8 A;  1VQ8 Z;  3LGJ A;  5K36 G;  3A0J A;  5LMU Q;  4LUO A;  3S2H H;  4GLV B;  1CUK A;  3CC2 A;  4FDB A;  1X56 A;  1KQS A;  3TQY A;  4UPA A;  4MNO A;  2LXJ A;  3ZJY C;  2QA4 A;  3S16 H;  4KHP Q;  3CC2 Z;  2NVX H;  5JJI A;  3GTM H;  2RHQ B;  3NBH B;  3JC6 6;  2IX1 A;  3KF8 B;  4GN5 A;  3ER0 A;  1ML8 A;  4P71 A;  4DV0 Q;  1S7M A;  2QLV B;  2I0Q A;  1RIP A;  1XJV A;  1GM5 A;  1PA6 A;  3NDI A;  1SRU A;  1LYL A;  1IBK L;  3S16 I;  4LFA Q;  3S1N I;  3RN5 A;  3KF6 B;  4NXM Q;  4AQY L;  4A3M H;  4DV6 L;  1TWH I;  1CKN B;  2VQE Q;  4A3C G;  2V8K A;  3A74 A;  4RMF A;  1PH1 A;  4GS3 A;  3MON A;  1VQN Z;  5C3E G;  1H95 A;  2HHH Q;  1YI2 Z;  1YIT Z;  1PV4 A;  2ZAE B;  4NOZ A;  2AKW B;  1PH7 A;  4POG A;  1Q7Y 2;  3OTO Q;  1K9M C;  2LFU A;  1VQJ A;  3KYH C;  1KRL A;  2JA6 I;  1VQ6 Z;  3EER A;  1KD1 1;  4GOP A;  1Y1V I;  2D62 A;  1Z03 A;  1DL6 A;  1RL2 A;  3G4S A;  4JI6 Q;  4BXX H;  5FJ8 H;  3H15 A;  3CCS A;  3TRE A;  3I55 A;  1SMX A;  3GTP H;  4OX9 L;  2L15 A;  4HGY A;  1VQA A;  3CCS Z;  2BA0 A;  1OXX K;  2E5L L;  1USP B;  3VB9 A;  1W2B Y;  4A3M G;  5IYB G;  4X62 Q;  5C44 H;  4NB8 A;  2IHE A;  3K0X A;  3NFZ A;  1W2B Z;  2I5H A;  3HKZ E;  1PH6 A;  2P28 A;  2ZM6 L;  1PH5 A;  2OOX B;  2N49 A;  1Q82 2;  1Y1V H;  2JNY A;  4DV2 Q;  2B3G A;  3PO3 G;  3CCL A;  4NB9 A;  4GKK Q;  1JE5 A;  1VQ4 Z;  2OWO A;  1S72 A;  4DV1 Q;  4LUZ A;  1SE8 A;  1I50 I;  5GAE C;  2LSS A;  2HT1 A;  2WB1 A;  5AJ3 L;  4DUZ L;  2YU9 H;  1Q82 1;  1YHQ Z;  4JI2 Q;  4MH4 A;  5GAD C;  1YBY A;  4NBE A;  5C4J H;  3UDF A;  1KRT A;  2IZ4 A;  4KI0 A;  4WJ3 M;  3FKI G;  2H5X A;  4DGL A;  1QUQ A;  1YIJ A;  3M3Y H;  5IT9 c;  2O4H A;  3D0F A;  1QZG A;  2JJQ A;  4GN4 B;  3I4M I;  1K9M 1;  1EQQ A;  3JAM f;  4EX5 A;  3GTQ I;  2JA8 G;  3VMI A;  3RZO I;  1XNQ Q;  3PUX A;  2ID0 A;  1Q86 2;  2HF1 A;  1VQO 1;  2A8V A;  4AYB E;  3I2Z A;  3S1R I;  1Q81 C;  1VQ6 A;  1GD7 A;  3M3Y I;  4S1T A;  5C44 I;  1X3W A;  2UUA L;  2B63 I;  2DUD A;  4P75 A;  2YAD A;  4BXX I;  3CMA 1;  1K0R A;  4HJ5 A;  1NBW A;  2WFW A;  3HOU H;  5AN9 F;  1K83 H;  5CM2 M;  3I7F A;  3E9I A;  2BH8 A;  3A5Z B;  5C4X I;  4X64 Q;  3ICE A;  1NJI C;  1VQ9 Z;  2R93 H;  3D6W A;  3M4P A;  1FJG Q;  4DR1 L;  5GQO A;  4MTN A;  4JI1 Q;  4A93 H;  4DV0 L;  1TWF I;  4DR2 Q;  2CKZ B;  1QVG A;  2NVY I;  4NXN L;  3GTK I;  4A3G I;  3HOV H;  1VQK A;  4AYB G;  2UXC L;  2OTL 1;  4IO9 A;  4P73 A;  4NB3 A;  1PFT A;  1VQ6 1;  4UP7 A;  3PO3 S;  5GAG C;  2RCN A;  4DK1 A;  4DV3 L;  4C3J H;  4X65 Q;  1K9M 2;  4LF5 L;  2R7F A;  4GKJ Q;  3CCQ A;  3CCU 1;  3K7A I;  3WWV A;  4R4T A;  1YJ9 A;  5T64 A;  1WCM I;  4AYB A;  1CKM A;  2AHO B;  1L1O C;  2NN6 G;  1C0A A;  4DQY B;  3CCE A;  2JUB A;  1SRO A;  3KDF B;  4K0K L;  4XX2 A;  4A3I I;  2JEB I;  2OTL A;  1QYP A;  1IBM Q;  1IBL L;  4L5Q A;  4A3L H;  1T9H A;  1YJW 1;  2NVT H;  4PZ8 A;  2O53 A;  4DV4 Q;  1N8R 2;  4A3B I;  3J7A 4;  4HIM A;  4A76 A;  1VQB A;  1NP6 A;  2WAQ E;  5C44 G;  4GLA C;  2JQO A;  3CC4 1;  5FLX b;  3S1M I;  2Y0S E;  2IZ3 A;  1QUQ B;  3CCJ 1;  4HIK A;  1Q7Y 1;  3CD6 1;  1KC8 2;  3S1R H;  3Q8D A;  4DR5 Q;  5IP7 H;  2N78 A;  4BBR H;  4EQ5 A;  1KC8 C;  1S72 1;  1SR3 A;  3M7N A;  4A3G H;  1PH8 A;  1TWC I;  4JI3 L;  5IP9 G;  4P74 A;  3S17 H;  3IX0 A;  3GTG H;  3STB C;  1VQP A;  5FLM G;  2ZJQ A;  1BVS A;  5M3F G;  1Z01 A;  1ZB8 A;  3S14 I;  3M9B A;  3J81 j;  4MD7 A;  2A19 A;  4A3D I;  1NMG A;  2JA5 H;  3B6Y A;  3HOY H;  4A3E I;  4A93 G;  2A1A A;  1WW9 A;  2Y0S G;  2V8J A;  4A3C H;  3J81 i;  1Q81 2;  4X66 Q;  3LUS A;  1MIU A;  1VS0 A;  3GDE A;  1YZ6 A;  1VQO A;  3CPF A;  2F4M A;  2JA5 G;  3CCR 1;  4UP8 A;  5ELO A;  3IFU A;  2R92 G;  1YJN 1;  4TVA B;  2DE5 A;  2QEX 1;  3KFU A;  1WJJ A;  2IHF A;  3J80 f;  3PO2 I;  3F3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...