3U50C

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
162
Chain Sequence
b'QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEIAYKVLKIEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
total genus 35
structure length 162
sequence length 168
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3u50C02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u50C01
4JI1L 3D31A 1N34L 4AQYQ 2JA7G 4HIDA 4LUZA 4MH4A 4Y52H 3HOWI 1VQDA 1VQJA 3M9BA 1GD7A 2Q2UA 1FJGL 1ML8A 3A0JA 4X66L 4HJAA 4YCVA 3S1RH 1S72A 4LF6Q 3K0XA 4BXXG 1C0AA 1I3QH 4Y7NH 1Q82C 2PI2A 1XMOQ 5IP7H 2JA8G 1D8LA 1VQ5A 5IYDH 3PIPA 3HFZB 4WJ3M 3S15I 3BZCA 4IJHA 1I94Q 4DR7Q 1PYBA 3NEMA 4JV5L 2OTLA 2H5XA 1PYSB 3J7ZC 3CC4A 2EIFA 1MJCA 1X3GA 4JI3L 3S1QI 1U5KA 4BY1I 4BXXI 3I4NG 4DV2Q 1PH4A 3PUZA 2E2IH 3GKQA 3EIVA 2UXDL 2JA8I 4DV1Q 5IP7G 1WW9A 1N36L 3GD7A 1E1OA 1EUJA 1A0IA 3EN2A 4A3GH 3HKZE 3JC66 5M3FH 4GLAC 2WB1E 3CQZI 4BBRG 4WJ4A 3NELA 1PH9A 1KL9A 4LFBL 2NN6G 4DV7L 4YWKA 4A3IH 4NXMQ 5BR8L 4DR6Q 5ELNA 3I4NI 1QUQA 2VNUD 1E7ZA 5M5WH 3CCUA 2I5LX 4J15A 1ZB8A 3HKZG 3EBEA 4IJLA 1SLJA 4R1JA 3J81c 2R7DA 4LF7L 3NENA 3H3VJ 2JA9A 3STBC 4JI4L 3KDFB 1I6HI 1B70B 4YWMA 1N33L 5C44I 1HZ9A 5M3FG 4BBRI 4R4TA 3G71A 1VQHA 4DV4Q 2F4MA 3BZKA 1QVFA 5C0XJ 5EAYA 3GTJH 2R92I 1K0RA 2R93H 4JI8Q 4JI2L 3LUSA 2JA6G 1C9OA 2NN6I 1RIPA 1TFIA 1Y1VI 3H0GG 1R9TI 3ULPA 3PO3I 1PHJA 3S17H 2ZJPA 4GOPA 3PF4A 1KRSA 4JBWA 4OO1I 2UUCQ 5C3EH 4DNIA 3M4PA 3GTLI 3RLOA 1EQRA 4X62L 2QGQA 1M1KC 2IX0A 2JA6I 3Q8DA 2R93G 3JAMc 2OTJA 2MFIA 3ULLA 4DR1L 4XX2A 3H0GI 2F3IA 4JI5Q 4GN3B 4PZ7A 4C2MH 3I4MH 2KENA 1K83I 1Y1WI 5C4XH 1RO4A 1PFSA 4IPGA 1JMCA 4R4QA 1KHIA 1GO3E 4QQBX 4UY8C 3GTKH 3L7ZC 3KF8B 4P71A 2I0QA 4B3ML 4A3DH 4A3MG 2GN5A 3SGIA 4DR2Q 1HNWL 2VQEL 2RHSB 4AIMA 1A62A 4K0KL 4JYAQ 2QEXA 2ASBA 3FHWA 1YEZA 1XPOA 5FJ8H 1S40A 3PUWA 4A3BH 2RF4A 4DV5Q 1K73C 1YHBA 2L15A 1X54A 1XPUA 3PCOB 3I4MG 1V9PA 4KHZA 4X65Q 3CC7A 1OXXK 2D62A 4DR3Q 1A63A 2UXCL 4DUYL 1QZHA 1IYJB 2IHEA 2YTVA 2YU9H 4A3MI 1VQOA 1GM5A 3ESWA 2NZHA 2HHHL 4A3DG 1UE6A 2R7ZH 3RZDI 4NBDA 1IBML 1WCMH 4R4IA 3KJPA 3M3YI 4LFCQ 1A8VA 1N2FA 1BKBA 1TWFI 1TWGI 4PZ6A 3CXCA 2VS1A 5FJ8G 5GADC 4A3BG 3KF6B 4LFAL 2JJQA 3E9IA 2AHOB 4OX9Q 1KC8C 4A93I 4QIWE 2OQKA 1Y1VS 3J81j 4POGA 2ALYB 1XNQL 1XMQL 3A5UA 2PNHA 3J80c 1DL6A 4GNXC 4OONA 4L5TA 1VQFA 2R7ZG 2JR6A 3F2CA 4NBFA 3BU2A 3FKII 3K80C 4PZ8A 3HOUH 1WCMG 2PK7A 2ZTCA 2E8GA 2V1CC 1K9MC 1SE8A 4DUZQ 1HZCA 3CC2A 4LF8Q 4DKAC 2MO1A 4A3FH 4JI7L 4HJ9A 3DM3A 4ME3A 4LF9Q 4JI6Q 3T1YQ 1CSPA 4DR5L 4POFA 1TWHH 1Q8KA 3T1HQ 1PV4A 3HOZG 4GKKL 1VQCA 1G291 1KD1C 4DAMA 1E24A 3HOWH 1E22A 1W3SA 3KJOA 2YTXA 2KHIA 2ZM6L 3S14I 3GTGI 1KQSA 5K36G 3E9HA 2AKWB 4B3SQ 2K5HA 5IP9I 3CW2C 1B7YB 1Z9FA 4LF6L 3PF5A 3HOZI 4RG1A 5LMNL 3S15H 1SROA 2JEAI 2D0PA 3MEFA 4KI0A 1J5EQ 1FGUA 2N8NA 4H02A 1IBLL 5JEAJ 5LMUQ 3S2HI 2PMZE 4A3KG 3CAMA 3S1QH 1I94L 5IWAL 1VLAA 4BY1H 4BXXH 5E7NA 1LUZA 1EIFA 2JA8H 4GLXA 1KAWA 3HOYI 2E2JI 2JS4A 4DPGA 1T9HA 4X6AI 1QUQB 2N49A 2B29A 4IFDJ 5M3MG 1YUAA 1L0WA 1VQ7A 4JI0Q 3CQZH 3S2DI 4HJ5A 1VQ6A 1HNXQ 1Z47A 1SN8A 1YI2A 4YCWA 5H1SE 4A3KI 4DV0L 2NVTI 4NPSA 3I4NH 3CCJA 1HR0L 4NXNQ 2WFWA 4BY1G 2YTYA 2IX1A 2JEBI 1KIXA 1JE5A 4A3CI 4B3TL 4A4IA 3HKSA 5DLQE 1I6HH 4DR6L 4B3RQ 1SFOI 5C44H 3GO5A 3PIOA 4A3JG 3S1MI 1WOCA 2OQ0A 4BBRH 4KHPL 1USPB 2E5LQ 1HZBA 4GOPC 2HF1A 3TQYA 2P3YA 3F2BA 2VQFQ 4JBMA 2R92H 4DV6Q 2VY3A 1YITA 4O0AA 1YHAA 2HT1A 2VL6A 1Y1VH 4TQUS 1VQKA 2RHQB 4P73A 1AE3A 3CF5A 3CPWA 1R9TH 3OYYA 1NBWA 3PO3H 2JK8A 4HIOA 4AH6A 1K8GA 3H15A 2UXBL 4A76A 4A3JI 1QVCA 2PQAA 2UUBQ 1FL0A 2LXJA 4JI1Q 3J7A5 5C44G 1BBUA 3GTLH 3AFQA 1HNZQ 1N34Q 1X3FA 4YHHL 1Q12A 4LUOA 1CUKA 2JA6H 3WWVA 2R92G 4DR4L 3I55A 3D6WA 1LYLA 3S1NI 5FLXc 4UPAA 3S16I 4NBHA 3S24A 3H0GH 3GTPI 1Y1VG 1ZB9A 1FJGQ 1K83H 4BBSG 2BH8A 1Y1WH 2IT1A 1NTGA 3PO3G 3OTOL 2N3SA 4DV3Q 3TS0A 5FLMG 1TWAI 5LMNW 5JJKA 3PO2G 4TVAB 2CWAA 4OO1G 1SRUA 1YJ9A 1PH7A 5AJ3Q 4YY3L 1X9NA 4P75A 2KCTA 3U58A 4HJ8A 1S3OA 4JV5Q 3EERA 1VQBA 1LM0A 1MIUA 3MXNB 4C3JH 2YYZA 4DR2L 4LNQA 4JI3Q 4BBSI 1Y1WG 1IL2A 1TWCI 5FLMI 3A5ZB 1N36Q 3PO2I 1VQLA 4A3MH 2Y0SE 1RLYA 2IY5B 3STBD 3GTOI 4BY7I 1CKOA 2NZOA 3RZDH 4A3LG 1YHQA 2DE7A 3M3YH 4PG3A 1TWFH 1TWGH 1AE2A 2KBNA 1VQEA 3U4ZA 4LFBQ 2Q2HA 4A3EI 4DV7Q 1HR0W 5BR8Q 1PH1A 4A93H 2Y0SG 4GN5A 1AH9A 1IBKL 2JQOA 2Q2TA 1I5FA 1HH2P 4APVA 4QJFA 4LF7Q 2UUAL 1N33Q 2A8VA 2K14A 1D7QA 2JA5G 1VCIA 2E2HI 1B8AA 3FKIH 4A3LI 5IT9c 3KYHC 3PSIA 4JI2Q 1JB7A 2ID0A 3FP9A 2A1AA 2BH2A 3PGZA 2CWPA 1CSQA 3G6EA 4A93G 2VW9A 3UDGA 4FDBA 2DUDA 4ALPA 2MQHA 1JJGA 4LF8L 1U0LA 1XPRA 1EIYB 1VQNA 1XNRL 1KXLA 2FXQA 3GTQI 1GKHA 2JA5I 1ASZA 4LF9L 1PH6A 3K7AI 1J6QA 2J6AA 3CP0A 3FKIG 4GKJL 3CCMA 4MTNA 3RZOI 2XGTA 2F52A 2B63I 1O7IA 3VB9A 2VUMI 1PH5A 1VQPA 3S14H 3GTGH 1G6PA 4LF5L 3HOXG 1WI5A 2EQSA 2OCEA 5IP9H 1QZGA 1M90C 3J81i 2ZJRA 3Q87A 3PO3S 3K81C 4X64L 3I7FA 3HOZH 4B3MQ 4B3SL 3KOJA 1JJCB 1HNWQ 4GNXB 2VQEQ 1N32L 1X56A 1NMFA 4K0KQ 1X3ZA 4NBBA 2BA1A 3TRZA 2EXDA 3F8TA 3S2HH 2I5MX 4JC0A 4NBEA 1G51A 5IE8A 2F4VL 1L1OC 3HOXI 1LQLA 2WAQE 2NVXI 2JE6I 5IP9G 3HOYH 5GAEC 2E2JH 2UXCQ 4DUYQ 4JG2A 4QL5A 3HOVG 4X6AH 1OXSC 5JJLA 4EX5A 5GQOA 3W5OA 2AWOA 2ZTDA 1Q81C 2HHHQ 4NB9A 3S2DH 2UU9L 1RL2A 2KHJA 3PUVA 4JOIC 1K3RA 1IBMQ 2WAQG 4MNOA 4LF4L 3JAMi 3DLLA 3W1GA 1XTDA 4A3KH 3CCEA 2ES2A 4BA2I 4UP7A 2NVTH 3GCFA 4LFAQ 4AQYL 3VMGA 1HNXL 2BJOA 5JJIA 3HOVI 3HOYG 2HIXA 4A3CH 1XNQQ 2WP8J 5M3MH 1SFOH 3CCLA 4IO9A 3S1MH 1XMOL 3U4VA 1SMXA 4GN4B 2CKZB 5IYCH 4LW1A 4YCUA 2PQAB 4B3RL 3RR5A 3GTMI 4DR7L 2PI2E 1X3WA 2VQFL 3BJUA 3M7NA 4NOZA 2DGYA 1N8RC 4DK3C 2NVYI 2AWNA 3RLFA 1HZAA 4DR5Q 3AEVA 1VQIA 4A3CG 4A3JH 4DV2L 4GKKQ 3A74A 4OWWB 1VQ8A 4DV1L 3L0OA 1YIJA 2OWOA 1L1OA 4DAYB 2ZJQA 5IYCG 3S1NH 3S16H 2C35B 2ZM6Q 1HNZL 3GTPH 4RMFA 3H3VI 2K5RA 1X3EA 4C3HH 3M4QA 1YJNA 1I50I 3RNUA 3KLWA 3PV0A 5C0XI 2MO0A 1OXVA 4NXML 4QTUA 1TWAH 4JOIA 3J80i 3GDEA 4NB8A 1EQQA 5LMNQ 4HJ7A 1UEBA 4GOPB 4DV3L 1NE3A 2ZTEA 2K4KA 1IBLQ 3TREA 4XIGS 2NVQI 3UE1A 1PH2A 5AJ3L 4DV4L 2JA7I 4KLKA 5IYBH 4BBSH 5IWAQ 2ATWA 4JI8L 2JNYA 3CPFA 2K50A 1Q7YC 5C4JI 1TWCH 2HIVA 4R4OA 5FLMH 3PO2H 1WJJA 3PUXA 3GTOH 4BY7H 3AQQA 1Q1BA 3ERSX 1VQ9A 3M4OI 3CCSA 1YZ6A 1JJ2A 2IHFA 5IYDG 3UDFA 2UUCL 4DV0Q 4XTCS 1CKNA 4A3EH 5M5XH 3M85A 3I4OA 4X66Q 5IYBG 1YJWA 1H95A 1HR0Q 5J3BA 3GTMS 4Y52I 4L5QA 3CCRA 4C3IH 1OXUA 1OTCA 4JI5L 4B3TQ 1Q86C 2Q2IA 3S1RI 1WYDA 1I3QI 4Y7NI 4KHPQ 2E2HH 5IP7I 4BY7G 4O2DA 4A3LH 2WB1G 1V1QA 2BA0A 2GVBA 5ELOA 2K5VA 4A3GG 4IPCA 4QGUA 4A3EG 3ER0A 4JYAL 1IXRA 2I5HA 1GVPA 1EYGA 4OXPA 3CMAA 2UXDQ 1PFTA 2RBLA 4DV5L 5M5YH 3OW2A 2UXBQ 2D0OA 3GTQH 4A3IG 4X65L 2JA5H 3ICEA 2E2II 3U50C 1SR3A 4DR3L 4OWTB 1USPA 3K7AH 1YBYA 4YHHQ 1YNXA 2HQLA 3RZOH 2RCNA 1TXYA 2B63H 4DR4Q 3I56A 2VUMH 4UP8A 4A3GI 1E3PA 3RLNA 1V43A 3G4SA 3RN2A 2DE5A 5IY0A 2R6GA 1WFQA 1XJVA 4LFCL 4JBJA 3B6YA 1X6OA 3OTOQ 4AYBE 3E0EA 4JCVE 1JT8A 4JI4Q 4IOAA 4OX9L 4A3II 5CM2M 3VDYA 3D0FA 1MKHA 1NUIA 3K8AA 2AKLA 4LWCA 2CCZA 4IPDA 1BBWA 4YY3Q 4GS3A 3CMEA 1HJPA 4LUVA 3TS2A 1YVCA 1EFWA 2B63G 2CQOA 2KCMA 2VUMG 4AYBG 5C3EG 3HOXH 3GTJI 2LXKA 2NVXH 1KRTA 2R93I 2GVAA 3IRBA 1N9WA 4DUZL 1VQGA 4NB3A 3VMHA 1PH3A 3VMIA 3K7UC 5GAHC 1UWVA 1K8AC 3KDFA 4EQ5A 5JEAG 5C4XG 4JI6L 3T1YL 1PVOA 4IOCA 1L2FA 4X62Q 4UP9A 3UDXA 2DE6A 3S17I 1UE7A 3T1HL 1DGSA 1X55A 3I2ZA 2K5NA 1W2BA 4DR1Q 4NBCA 2CFMA 5C3EI 1Q46A 3ZJYC 4JBKA 1IZ6A 1LTLA 4IFDG 2LSSA 3UE0A 1IBKQ 3PUYA 2KPIA 3HOVH 4L5SA 1FVIA 3I4MI 3CD6A 5C4XI 2UUAQ 3UDIA 4L5RC 3GTKI 2R7FA 5GROA 4A75A 3NBHB 4MZ9A 4A3DI 3GTMH 2K52A 3W1BA 1NY4A 1J5EL 1L1OB 2A19A 2Z6KC 2B3GA 3TEHB 4IFDI 1VQAA 1OXTA 2NVYH 5LMUL 4A3BI 1NMGA 4NBAA 5HGQA 1XNRQ 1VS0A 2YV5A 1PH8A 1C7YA 1UE5A 3CCQA 4GLVB 1VQMA 5GAGC 4GKJQ 3F1ZA 2YU9I 3KFUA 4QY7A 2N78A 4HIKA 2Z0SA 4JI0L 2R7ZI 3H3VH 2XTIA 4LF5Q 4BA1I 1WCMI 1QVGA 3HOUG 1I50H 4QTTA 1MJEA 4P72A 2VZAA 3I07A 2K75A 3L2PA 1XMQQ 1BVSA 4NXNL 4A3FG 4X64Q 1EWIA 1P16A 4PMWA 4HIMA 3ULJA 3G48A 4OWXB 1N32Q 1NJIC 3F2DA 4NBGA 2NVQH 1Y14B 2E5LL 2JA7H 2F4VQ 3KF6A 4JI7Q 1VQ4A 3LGJA 3HOUI 4DV6L 2MNAA 4IPHA 3HOWG 1CKNB 5HY6A 1ASYA 5C4JH 1CKMA 1P8LA 1Q1EA 4DK6C 5C0XG 4A3FI 1E1TA 4R4CA 1PA6A 3AYHB 1UE1A 2AMCB 2F4OA 4YWLA 2UU9Q 3M4OH 1X65A 4GNXA 1EOVA 2QA4A 1TWHI 3AFPA 4P74A 3CCVA 3RN5A 2Z6KA 4LF4Q 2UUBL 1QYPA
chains in the Genus database with same CATH superfamily
4JI1L 4IUVA 2O5JC 2NBFA 3D31A 1JE4A 1N34L 1ICWA 2Q8IB 4AQYQ 5IT9b 2JA7G 4HIDA 5T1IA 4LUZA 1JICA 4MH4A 3OW7A 4Y52H 2EYLA 3HOWI 5IT9f 1QNKA 4FXKC 1QCBD 4RAUC 1VQDA 1SNDA 1VQJA 3MXGA 5COYA 5M9OA 1TU2B 3M9BA 3HKZB 1SJED 4OGQC 2E2IB 1GD7A 2Q2UA 1FJGL 1ML8A 3A0JA 2TSSA 4X66L 2WB1B 4HJAA 4YCVA 2F0SA 1XX8A 2PMZA 3S1RH 2IW3A 1S72A 4LF6Q 3K0XA 4BXXG 5KYLA 5FK9C 5KEEA 1C0AA 1I3QH 4Y7NH 1Q82C 2PI2A 1XMOQ 5IP7H 3I4LA 2PZUA 2HD3A 2IWHA 2JA8G 4A3GB 3OHXC 4KKUA 2VXWA 2XWBB 1D8LA 5M3FB 1EY8A 1Y8PB 1VQ5A 2K28A 5IYDH 1HA5A 2WKCA 3PIPA 1NP6A 1D6EC 4J6HA 3HFZB 4WJ3M 4XT1B 1KQSZ 1GUSA 2F0DA 2L1BA 2QW7A 4DXFA 3S15I 3OIPA 1WD0A 1SNPA 3BZCA 3V2TA 5I2YA 4IJHA 4WRDA 1I94Q 4DR7Q 1LTGD 1PYBA 1E2WA 3NEMA 2PNRC 4JV5L 3VR2A 2OTLA 3G6E1 3TN2A 2H5XA 4F88A 1PYSB 4RKBA 3I91A 3J7ZC 3DEOA 4MN3A 1B9NA 5E4WC 4XQJA 2EIFA 3CC4A 1MJCA 4A3IB 1DM0B 4TSSA 2D2CC 1Q861 1X3GA 4JI3L 5M5WB 4HMIA 3S1QI 4MRIA 4G4KA 1U5KA 5FLXE 1IHZA 3BDOA 1VQN1 4HSVA 4BY1I 2Z8LA 2IL8A 1WTQA 4BXXI 4DNTB 3K59A 1UAPA 4NFRA 4MXUA 3I4NG 4DV2Q 1PH4A 3PUZA 2E2IH 3GKQA 3EIVA 2F1MA 2C5CA 3ND8A 2RIQA 2UXDL 1LACA 2JA8I 1KAAA 4DV1Q 5IP7G 2M9VA 3IFDA 1WW9A 1N36L 3GD7A 4KTAA 1E1OA 1EUJA 2FHTA 4IQZA 3CCM1 1A0IA 3EN2A 4DN4M 4A3GH 3HKZE 3JC66 5LL6f 1EY7A 5M3FH 2PO4A 4GLAC 3TP5A 1P9NA 2HDLA 2WB1E 3NTKA 4FXGC 2R93B 3CQZI 1VQP1 4BBRG 4WJ4A 2V8JA 3NELA 3MTSA 1PH9A 2B2YA 1LV9A 1SJHD 3EQLC 1FYCA 4DFAA 2AQ3B 3A7LA 5DM63 1RO2A 1KNEA 1KL9A 4LFBL 2Q4ZA 1ILQA 4QCLA 1STYA 1VQ7Z 1WTRA 2NN6G 5ELBA 3MAQA 4DV7L 4YWKA 5KIXA 5CV6A 1VQ6Z 1E2ZA 1BCPC 4A3IH 4NXMQ 5BR8L 2VF1A 2B2WA 4DR6Q 5ELNA 3I4NI 2B8GA 1QUQA 1YI2Z 2VNUD 1E7ZA 2B2VC 2WIIB 5M5WH 3CCUA 2I5LX 3S17B 4J15A 1ZB8A 3HKZG 3EBEA 3KUPA 4IJLA 1SLJA 4R1JA 3MZKB 5FOBB 1RTOA 3J81c 2R7DA 5DEHA 4ZKBB 3V05A 2IX3A 4LF7L 1RQFA 3NENA 4O42A 5C3EB 1ILPA 3H3VJ 2JA9A 3STBC 4JI4L 2F0OA 1F77A 1Q16A 4FNFA 1V1PA 3CCJZ 3KDFB 1I6HI 1B70B 2O2LD 3H09A 4DAYA 4YWMA 1N33L 5C44I 4RA8A 1HZ9A 2WINB 3VR6A 1GHJA 3U9SA 3Q24A 1LTSD 5M3FG 4BBRI 4R4TA 3G71A 1VQHA 4DV4Q 3MEHA 2F4MA 1SSOA 3BZKA 3GQBA 1CT1D 1QVFA 5C0XJ 5E1FA 5EAYA 3GTJH 1R4QB 2R92I 1K0RA 4HSPA 5I6WA 4JI8Q 4JI2L 2R93H 3SR1A 1IYVA 4HEDA 3LUSA 5T67A 2JA6G 5A35A 5HURA 1C9OA 4C2MB 3I4MB 1FDIA 3BG1B 1Z6HA 1V1OA 1RIPA 2NN6I 1TFIA 1Y1VI 2KJXA 4G7OC 5C4XB 4WORA 5C3WA 3E6ZX 2P28A 3H0GG 3J81L 5CV4A 2EZVA 1R9TI 4DK1A 4DAVA 3ULPA 1TY2A 2JYOA 3PIP3 2K33A 3GTKB 3PO3I 1YITZ 5A2QL 1BR9A 4I7ZC 3WDNA 3DMUA 1PHJA 1VQKZ 3S17H 4A3DB 2ZJPA 4GOPA 3PF4A 1KRSA 3CPWZ 1SYBA 2EYJA 3KBGA 3QWNA 2F0MA 4JBWA 3KIFA 4OO1I 4DGZA 3K5MA 2EY6A 3QJYA 2UUCQ 5C3EH 2BDNA 4DNIA 3M4PA 3CCE1 3GTLI 1JWMD 3MC0B 3RLOA 3TBIB 1EQRA 4X62L 1AP0A 1BF4A 4A3BB 4RHRA 2BCOA 2QGQA 1M1KC 2IX0A 2CH4A 1G2TA 4E2YA 2JA6I 3Q8DA 1WVLA 3R3OA 2R93G 1UEAB 3JAMc 2OTJA 4JK1C 2L0CA 1SIWA 2MFIA 3ULLA 2E76C 4DR1L 4XX2A 1K8A1 1NR2A 5IT9E 4QB4A 1TR5A 3H0GI 2F3IA 3TP8A 4JI5Q 4GN3B 4PZ7A 2KA7A 4C2MH 3I4MH 1O78A 2KENA 1K83I 1CZGA 2K5DA 2DN8A 2V8IA 5JEAH 3ND9A 1Y1WI 5C4XH 1R4PB 2EE1A 3CCL1 3I55Z 1RO4A 3R93A 3MHBA 3K5LA 1PFSA 4IPGA 1NSNS 1JMCA 4R4QA 2YU9B 1KHIA 1GO3E 3IAYA 4QQBX 4UY8C 1EY6A 1EY9A 3GTKH 3CRKC 3L7ZC 4HTHA 3KF8B 2R7ZB 4P71A 2I46A 2IJ0A 2O4XA 2I0QA 4B3ML 4A3DH 4A3MG 2SNSA 2GN5A 1WCMB 2JSOA 5KNBA 3SGIA 4DR2Q 1HNWL 4QIWB 2VQEL 1QWYA 2K01A 3RUZA 2Y0SA 2RHSB 3TP6A 1A62A 4AIMA 4K0KL 1EY4A 2J4XA 4JYAQ 1M901 2QEXA 2ASBA 3FHWA 1YEZA 4IFDH 1XPOA 3GTGB 5FJ8H 1S40A 3PUWA 1GUNA 4A3BH 1PTOB 2RF4A 4DV5Q 2XN9C 1K73C 3QG1A 1F2LA 1YHBA 2L15A 1YJ9Z 5EKLA 3P75A 4CJ2C 1X54A 4U68A 4MD7A 5EPKA 1XPUA 3PCOB 3I4MG 1V9PA 4KHZA 4X65Q 3R2TA 5EPLA 1L0XB 1HHVA 3CC7A 1DOKA 1OXXK 2D62A 5KGUA 2C9OA 2F0UA 4DR3Q 4GZYC 3OIQA 1A63A 2UXCL 1VQ81 4DUYL 1F2YA 1IYJB 1QZHA 2IHEA 2WACA 2YTVA 5T6BA 5DNFA 1YIJ1 1K8OA 1JJ2Y 3I3CA 1PTOF 1BO0A 2HCIA 3D4WA 2YU9H 4A3MI 5J1ZA 1VQOA 1GM5A 3ESWA 4K14A 1CFMA 1VMPA 2NZHA 1B3AA 1DOLA 1F9PA 4YIJA 2HHHL 2CQAA 3MXNA 1UE6A 3HOUB 4A3DG 1KRLA 2R7ZH 1A6XA 3RZDI 5C4HA 4NBDA 1LTRD 3L9AX 1IBML 5EBDA 1KDBA 1WCMH 4R4IA 3KJPA 5BN4A 3M3YI 4LFCQ 2GTHA 1A8VA 1N2FA 1BKBA 1YNJC 1WD1A 1TWFI 1TWGI 1VQLZ 4PZ6A 4A3FB 3CXCA 1YJN1 1SAPA 2VS1A 5FJ8G 5GADC 3NDIA 4A3BG 3KF6B 5JPNC 4LFAL 2JJQA 2QREB 3E9IA 2AHOB 1PTOH 1WZNA 3TDHB 1TS4A 5I6YA 4OX9Q 1G6ZA 1KC8C 1YHQZ 4A93I 4QIWE 2OQKA 1Y1VS 1DOMA 3J81j 4POGA 1TWHB 1PFBA 2OOYB 2NYZD 4B9XA 2EYOA 2ALYB 3SDZA 2RT9A 3GV6A 1QOHA 4C56C 4QUFA 1XNQL 1XMQL 3A5UA 2PNHA 2V4DA 1SE3A 3J80c 4ZUJA 1DL6A 1EIGA 2F0NA 2RHBA 4OONA 4L5TA 1VQFA 4GNXC 1BNZA 1QXFA 3C1FA 2R7ZG 2JR6A 1M902 1CHQD 4R9WA 5C5LA 3F2CA 4NBFA 3BU2A 3FKII 3K80C 3MXUA 3N52A 4PZ8A 2KCNA 3HOUH 1WCMG 2PK7A 3P20A 5KRUA 1XXGA 2ZTCA 4ID6A 2E8GA 2V1CC 3GV3A 2IPKD 1K9MC 3VYRA 1SE8A 4DUZQ 1HZCA 5ELEA 3C46A 2WV6D 1FD7D 3CC2A 1EWCA 4LF8Q 4DKAC 3OW2Y 1PMRA 2MO1A 4A3FH 3MZLB 4JI7L 4K5XA 3X3MA 3J7AF 1VF5C 4HJ9A 4K8JA 2L11A 4IALA 3BZDB 1CA5A 1FDOA 3DM3A 4ME3A 4MIUA 4LF9Q 2NAPA 4JI6Q 3T1YQ 1NJI1 2E74C 1CSPA 1D1IA 3HRZC 1CZWA 1SE2A 3IFUA 2XIWA 4POFA 4DR5L 1VQ91 3S15B 1TWHH 1Z7TA 3CCS1 2LIYA 1LO5D 1Q8KA 3G6EZ 1YNND 3BYTB 4PMBA 5CBEE 3T1HQ 1PV4A 1TVXA 2BE5C 2JXMB 2Q8TA 3HOZG 4GKKL 1VQCA 1PZID 5L37A 4RGNA 1N8R1 1STNA 1G291 4KV6A 3TMEA 1KD1C 4DAMA 1WTPA 1TKWB 1E24A 3J81f 4PQXA 5ELFA 2Z4HA 1VQNZ 1BDOA 2DY8A 1YJW1 3HOWH 1E22A 2RSOA 3T53B 3S1QB 2ZXOA 2EYMA 1W3SA 3KJOA 5A2Qf 4BY1B 1K8MA 3CCR1 2YTXA 5C3XA 3C3LA 2KHIA 1Q812 2ZM6L 3S14I 2N88A 3GTGI 1S5ED 3K5NA 2EY1A 4E2XA 2F0VA 2JA8B 2QKDA 5AN9F 1B53A 3D4RA 1KQSA 5K36G 3CCMZ 3E9HA 2AKWB 4B3SQ 1IL8A 1Q8IA 1X32A 3HP3A 1W6KA 2K5HA 5CV5A 5IP9I 1SNCA 2WAQA 2A69D 2LS01 3FQMA 2LFUA 3CW2C 1VQPZ 2A5HA 2JIMA 1BUVT 4N8FA 1B7YB 2VPXA 3TZUA 1JOQA 5J22A 3CQZB 1Z9FA 4LF6L 4LJZC 5D1OA 1L0YB 1W6JA 3PF5A 3HOZI 4RG1A 5LMNL 3S15H 1SROA 3F3PC 3CKIB 2D0PA 2JEAI 3D9XA 2A6HC 3MEFA 4KI0A 1D5ZC 5IGCA 1J5EQ 1FGUA 2F03A 2N8NA 2M2LA 3DXJC 4H02A 2V3VA 1IBLL 1WTHA 5JEAJ 5LMUQ 4RGOS 1PRTD 3CMA1 3S2HI 3I4NB 1LT3D 2PMZE 4A3KG 3FMCA 3CAMA 2B2YC 3S1QH 1Q821 1I94L 1EYAA 1VLAA 5IWAL 4BY1H 4BXXH 1GUTA 3NH4A 5E7NA 1EIHA 1LUZA 1EIFA 4XDXA 2JA8H 1I6HB 3FDTA 1KAWA 4GLXA 2QRDB 2HQEA 3HOYI 2E2JI 2B2WC 3NP8A 2FJ2A 3AMUA 2JS4A 5C44B 2QILA 1Z01A 4PMCA 4DPGA 4FF2A 1T9HA 4RVGA 4ME5A 4X6AI 1QUQB 4BBRB 2N49A 2B29A 4IFDJ 4HN7A 3I561 3NBHA 5M3MG 1N8R2 2R92B 2OXPA 1YUAA 1L0WA 1VQ7A 4JI0Q 1W2BY 3G4S1 3CQZH 4ULLA 3S2DI 4HJ5A 1HNXQ 1VQ6A 1Z47A 1SN8A 5JVG3 5EBCA 2A73B 4N9TA 1Q7Y1 1ZH1A 3D6CA 1YI2A 1V1PB 1Y1VB 4YCWA 5H1SE 4UAIA 1HQRD 1R9TB 4A3KI 4DV0L 1CM9A 3NTHA 2CW0C 2NVTI 3D2LA 1HFNA 1CK1A 2E2DC 4NPSA 3PO3B 1RNIA 4RGTA 4LAAA 3F3FC 3K0YA 4X3TA 3CCJA 3I4NH 1HR0L 4NXNQ 2WFWA 2F0KA 4L6TB 4BY1G 2YTYA 4OL7A 3VYUA 2SEBD 2IX1A 2JEBI 1KIXA 3CCEZ 2K04A 1JE5A 5DM73 1AEXA 3K58A 4A3CI 4OEMB 4B3TL 4A4IA 3GTLB 3HKSA 5DLQE 4B9WA 3CME1 1I6HH 4DR6L 2XSCA 1Z02A 4B3RQ 2G2KA 5LL6S 1SFOI 5C44H 3GO5A 2HCCA 4KD3A 3PIOA 4A3JG 3S1MI 1WOCA 3IX0A 2OQ0A 4BBRH 4KHPL 1USPB 2E5LQ 1HZBA 4GOPC 2HF1A 2JA6B 3TQYA 3R2IA 2P3YA 3F2BA 3G7LA 2VQFQ 1KDCA 4CKBA 2K03A 4JBMA 1Q3LA 3EFXD 2R92H 4DV6Q 3P5JB 1RCVD 4ZCKA 3H0GB 3NWTA 5M5XB 2ZXRA 2VY3A 4DU9A 1YITA 4M8AA 4L8JA 3CCLZ 4O0AA 1YHAA 3T51B 2DNEA 2HT1A 2NN6H 2VL6A 1K83B 4ODGA 1Y1VH 1Y1WB 4TQUS 1VQKA 3K5OA 3LWUA 2RHQB 2PM9A 4P73A 1AE3A 3CF5A 1EYCA 3CPWA 1R9TH 3OYYA 2AYDA 1I4HA 2QLVB 3A8IE 4FP5D 2KUMA 1NBWA 3NPPA 3PO3H 1MD2D 3RD4A 3NUCA 2JK8A 4HIOA 1B9MA 1SYDA 1U4LA 2JIRA 4Q5VA 4NMZA 4AH6A 2CHBD 3A54A 1K8GA 3H15A 2UXBL 4CDCC 3M4YA 1IKMA 2B2UA 4OO1H 4A76A 4A3JI 3QWUA 1QVCA 2PQAA 2UUBQ 4KD4A 1FL0A 2LXJA 4JI1Q 3J7A5 5C44G 3FRPB 1BBUA 3GTLH 3AFQA 1HNZQ 1N34Q 4NH1C 1X3FA 1Q7Y2 2HUGA 5ISRA 5T1GA 3VA5A 4HCEA 2EPBA 1HXYD 4C3JB 4YHHL 5C4ZA 2ZXPA 1Q12A 2V45A 4LUOA 4K6LA 1CUKA 2JA6H 1JOOA 1OO9B 2LMCB 3WWVA 2R92G 4DR4L 3I55A 3SHLA 3D6WA 1LYLA 3S1NI 5FLXc 1QVGY 4UPAA 3S16I 3N6RA 2Y0SB 4NBHA 3S24A 3H0GH 3CHBD 3NQIA 2J0TD 3GTPI 1Y1VG 1VQ8Z 1ZB9A 1FJGQ 1K83H 1YIJZ 4BBSG 1MSGA 1BCPB 2BH8A 1Y1WH 2IT1A 4KMUC 3K6OA 3CD61 1NTGA 2Q51A 3PO3G 3OTOL 4XQNA 4H7BA 4A3MB 4ZAIA 2N3SA 3QO2A 4DV3Q 3MWYW 3TS0A 3QB3A 4DGLA 1AW7A 1D2BA 1RODA 1I4XA 1I4GA 1SYCA 5FLMG 1A15A 3G6JB 5IGFA 1TWAI 5LMNW 1T5EA 3RZDB 3PO2G 5JJKA 4TVAB 3KLSX 2NTTA 5E4XA 1JR0D 2CWAA 3D3RA 2F0HA 4OO1G 1YJNZ 1V8QA 5K5PA 3M3YB 1SRUA 1M1K1 4C1NK 1PZJD 3J7A4 1YJ9A 1GUOA 1TWFB 1TWGB 4TRDA 4YY3L 5FLXL 5AJ3Q 1X9NA 1PH7A 4P75A 1G8ZD 2KCTA 3U58A 1BCPF 4HJ8A 1S3OA 2OF1A 5EPJA 1HTLD 3L3OC 2KVMA 2H4OA 5IODA 4JV5Q 3EERA 1AA6A 1EQTA 1VQBA 2KEDA 1EY0A 1LM0A 1Q862 1MIUA 3MXNB 2EGTA 4NP5A 1T5XD 4C3JH 4Z9CB 1LTID 4CJ1B 4A93B 2YYZA 1GUGA 4DR2L 4LNQA 4JI3Q 2RQXA 1BQQT 4N9PA 4BBSI 2M6NA 3FEWX 3BG3A 3W3AA 2WB1A 4ZKCB 4DA2A 3J7YW 3LWEA 1Y1WG 3QOJA 2DNCA 3EA6A 1IL2A 3PIO3 3CCQ1 4HMJA 1GXDC 3E0JA 4C3IG 1TWCI 3H94A 1F9QA 1K3BC 5FLMI 1VQM1 3A5ZB 4OIJA 3IL8A 4RCOA 1N36Q 3PO2I 4CBVA 1ET6A 1VQLA 4A3MH 2Y0SE 5IOCA 3FKIB 1QG7A 2EJMA 2X69A 1RLYA 1SYFA 4IURA 2IY5B 1JORA 3STBD 3GTOI 4BY7I 1CKOA 2NZOA 3RZDH 3RMHA 2XNAC 1D5MC 1XYIA 2EJFC 3F2UA 2F0JA 4A3LG 1YHQA 2DE7A 3M3YH 3S9WA 4PG3A 4ZLTF 1K731 2D5DA 2EYPA 1TWFH 4MD9A 1TWGH 3P1HA 1AE2A 2KBNA 1F2MA 3R8BA 3X3NA 2F0FA 3W2DA 1VQEA 3U4ZA 4LFBQ 4J8QA 4C3JG 3EVQA 2Q2HA 4A3EI 1ONLA 4DV7Q 1HR0W 4B08A 1VQ9Z 3D4DA 3CCSZ 4KN4C 5BR8Q 1PH1A 4A93H 1JJ2Z 2RVLA 1PZKD 3T4AC 1SYGA 3WOFA 4G57A 3BS1A 2IZ3A 2Y0SG 3HS0C 4GN5A 1AH9A 4K2LA 4NDXA 1IBKL 5I2XA 1JB3A 1I4PA 5EGTA 2IZ4A 2JQOA 2Q2TA 1I5FA 4OIKA 1HH2P 4APVA 1NCVA 5KYIA 4QJFA 4LF7Q 2DY7A 4J1MA 1HPCA 1LTBD 3SK5A 1QJOA 1U4MA 4NW2A 5G3LF 1JCKB 1YJWZ 4EQPA 1M1K2 4X3SA 2UUAL 1N33Q 2A8VA 2KI7B 1SBBB 3CCRZ 2K14A 1D1KA 1D7QA 2JA5G 1XWEA 3JAML 1VCIA 2E2HI 4KY7A 4I65A 1B8AA 4A3LI 3FKIH 2L4NA 1S4ZA 2ENBA 2G5DA 5IT9c 1VQ41 3S14B 3Q23A 3KYHC 1S5FD 3PSIA 4E33A 4JI2Q 1JB7A 2B2TA 3MA2B 2ID0A 2GU2A 3FP9A 3FPPA 2PPBC 1I6VC 2A1AA 4IUQA 2BH2A 1SMYC 3E5SA 3PGZA 2CWPA 2XRQD 1CSQA 3OPOA 4E31A 3G6EA 2A68C 2Z4IA 2EY2A 4A93G 5CGKA 2VW9A 2EXZA 3UDGA 3DWAA 4F8MA 5BN3A 4FDBA 1STGA 2DUDA 4ALPA 2R6MA 2MQHA 1CI3M 3HOZB 1JJGA 4LF8L 1U0LA 1S5DD 1XPRA 1EIYB 1VQNA 1WTXA 1NR4A 1XNRL 1KXLA 3OMCA 2BOSA 1GJXA 4AYBA 2QA41 2FXQA 5LL6X 3GTQI 1A2UA 4WFN3 1LTTD 3CCV1 1Y8NB 1GUWA 1GKHA 2HDMA 2JA5I 1ASZA 3CMAZ 2FINB 4LF9L 2TMPA 1PH6A 3OW2Z 1H9MA 2JN4A 3FVQA 4KKTA 1DONA 3K7AI 1J6QA 2J6AA 3CP0A 1K28A 4ILWA 1PYWD 1K9M1 3FKIG 3S2HB 4GKJL 1ENAA 3CCMA 4MTNA 5D1OB 3RZOI 2XGTA 2F52A 2K32A 1G91A 4Q0FA 2JMOA 2B63I 1O7IA 3VB9A 1K8A2 1DYQA 3OWEB 3KLRA 2VUMI 2FMCA 2XWJB 4QMGA 1PH5A 1VQPA 4KKSA 3S14H 3GTGH 1PTOD 3D8GA 1IW7D 1G6PA 3M7GA 2PZTA 4KN7C 4XYOA 4ZQ3A 4LF5L 2JIOA 3HOXG 1WI5A 2EQSA 2OCEA 3HOYB 4RGMA 2E2JB 1LABA 1LT5D 1S721 3H6MA 4CDEC 5IP9H 3I56Z 4OHJA 1QZGA 1M90C 2I3CA 3J81i 3G4SZ 2ZJRA 3Q87A 3LNNA 3PO3S 3K81C 3SEBA 2F3WA 2M00A 4JPBW 1PXUA 2A6EC 1VQ51 3S2DB 1ENCA 3EROA 2AQ1B 4X64L 2BDOA 3I7FA 4CDFC 3HOZH 4B3MQ 2JIQA 4IN3A 4B3SL 2XRSD 3KOJA 3NSWA 3NK9A 4PV1C 2R3ZA 1JJCB 1HNWQ 4GNXB 1SNMA 2VQEQ 4IUPA 1N32L 1CQFA 1X56A 1YNNC 1NMFA 2QDLA 3LX0A 4K0KQ 4A3KB 1X3ZA 4NBBA 2FFKB 2OZKA 2BA1A 3TRZA 1QVFY 2NVTB 3H3VC 4JW0A 2E75C 2OTL1 2EXDA 3F8TA 3S2HH 2I5MX 3CC41 4JC0A 5EKIA 4NBEA 1G51A 1YNJD 1B3QA 5IE8A 2F4VL 1L1OC 1H9JA 4FF3A 3HOXI 2JIPA 4CGYB 1LQLA 2WAQE 5K36H 1C4QA 5D3IB 3CMEZ 4G7ZC 2NVXI 1RJTA 2CVRA 2JE6I 3BYYB 5E3FA 4PNYA 2RKSA 5I4DA 3J80L 2PYKA 3QR8A 5IP9G 3HOYH 5GAEC 5D1PA 5FLXf 3BG0B 1JWUD 2LKVA 5M3MB 1SFOB 2E2JH 2UXCQ 4DUYQ 4JG2A 3S1MB 4QL5A 3HOVG 2PMZB 3A56A 4X6AH 1AFPA 1OXSC 2QKIC 3BDCA 3VTNA 5JJLA 4EX5A 5GQOA 3W5OA 2AWOA 1MSHA 2ZTDA 1Q81C 2HHHQ 4NB9A 3J81b 3S2DH 2UU9L 2RPRA 1RL2A 1ICFB 2KHJA 3PUVA 5IGEA 4E2ZA 4JOIC 1K3RA 1IBMQ 3T13A 1LT4D 1O7ZA 5A2Qb 2WAQG 4MNOA 1IKLA 2F0WA 3OOCA 3BDLA 2H1EA 1EWHA 4LF4L 3JAMi 3DLLA 2X6GA 3W1GA 1XTDA 4KY5A 4A3KH 3CCEA 2ES2A 4TNUA 1H9SA 2F0IA 5ELCA 3E3XA 2QCPX 4UP7A 2NVTH 5CR3A 4BA2I 3RZOB 1JWHC 3GCFA 4M1UB 4LFAQ 2OT2A 4K2KA 4XYQA 4AQYL 3VMGA 1HNXL 3IFTA 2ZT9C 3MXPA 2BJOA 4HGYA 1PRTC 3DUZA 4KY6A 2KEEA 5JJIA 1DCZA 5CV8A 2F3VA 1SDFA 3CCU1 3MFGA 4H0LC 4MD8A 1W2BZ 4HCSA 4ZK9B 1C48A 4A3JB 3HOVI 3HOYG 2HIXA 4A3CH 4RHSA 1XNQQ 1WTOA 2IV2X 2WP8J 3TP7A 4RH6A 5M3MH 1SFOH 3CCLA 4IO9A 3DWQA 3S1MH 1XMOL 3CRLC 5EQ0A 3U4VA 4QUCA 4RFBA 2W03A 4HH4A 5KNCA 3G711 3S1NB 4XQQA 1PDQA 3S16B 1SMXA 4GN4B 2BE5D 2B2UC 1ET9A 2CKZB 2EDGA 4QF4A 1M4VA 5IYCH 2G9HD 1CHPD 4LW1A 3GTPB 4YCUA 2PQAB 1SEBD 4B3RL 3CD6Z 3RR5A 2PW5A 5JVH3 3I72A 4C3HB 5CBAE 1QILA 3GTMI 5CV7A 1G2SA 4DR7L 2PI2E 1X3WA 2VQFL 4XT3B 3BJUA 2QR1B 3M7NA 3IKJA 1QNUA 5IIFA 1EOTA 4NOZA 2DGYA 1PFMA 2MJ8A 3JAMb 3ONAB 1N8RC 1NJI2 4DK3C 1ZEQX 2NVYI 2KQ3A 5LHY1 5D14A 3NFZA 1TWAB 3JAMf 2PCFB 2AWNA 3RLFA 4C1NI 1HZAA 4XXEA 3J7AV 4DR5Q 3AEVA 1I3QB 1DD2A 1VQIA 2RSNA 2NZ1D 4A3CG 1MHWC 1PFNA 1ZYRD 2GTIA 4CKEA 4A3JH 1GOZA 2VPZA 2QF7A 4DV2L 3O13A 3MZ5A 2O4HA 4GKKQ 3A74A 4OWWB 2SDFA 1VQ8A 2ZAEB 4DV1L 1C8CA 3L0OA 1YIJA 2OWOA 3NDJA 1A3UA 1L1OA 3QOLA 4DAYB 4F87A 2ZJQA 3I70A 5IYCG 3C1EA 3S1NH 3OMGA 2QRCB 4BBSB 1F2ZA 3S16H 2B8FA 3MONA 2OTJ1 2NWGA 2C35B 1B4OA 3CXCY 2ZM6Q 1HNZL 3CCQZ 3GTPH 5JJZA 4RMFA 3H3VI 3VR3A 2K5RA 1X3EA 1VQMZ 4C3HH 2RBMA 3M4QA 1KABA 4FXDA 1TWCB 1YJNA 1I50I 4NKLA 3T56B 3OSOA 3PO2B 1JC7A 2MPMA 3RNUA 3KLWA 5TSSA 3PV0A 5C0XI 2MO0A 3VR5A 1OXVA 1ENFA 3GTOB 4BY7B 4NXML 4QTUA 1TWAH 4JOIA 3J80i 2I07B 3GDEA 2GA4B 3AU7A 1WTWA 3HEJA 1QVGZ 4NB8A 1EQQA 5LMNQ 3KIHA 3NXWA 4HJ7A 1UEBA 2DJGC 4IUNA 1MI2A 4E6IA 1RD9D 1EL0A 2PQEA 4GOPB 2E9HA 4O1NA 4DV3L 1NE3A 2ZTEA 3BVGA 2K4KA 1HTPA 3C2PA 4FF1A 1JWSD 1B1ZA 4A3EB 1STEA 2QEX1 3PMFA 1IBLQ 2B39A 3I8ZA 3TREA 1Y69U 4XIGS 2RDGA 1Q822 2NVQI 2O5IC 3UE1A 1PH2A 1KLUD 4ZUIA 5AJ3L 4DV4L 2JA7I 2K5QA 2LY7A 4KLKA 5IYBH 4BBSH 3DHQA 2K3RA 4EVOA 3EJIA 5IWAQ 2ATWA 1BOSA 4C3IB 3EEDA 2CW0D 4C3HG 5T64A 4JI8L 2JNYA 2F0LA 4ZYSA 3CPFA 1E2VA 2K50A 1HCZA 3VA7A 3CC71 2EOTA 1Q7YC 1TS3A 5C4JI 1TWCH 2HIVA 4L63B 2XVSA 3VYTA 1I4RA 4FO2A 4R4OA 5FLMH 1Y8CA 1ESRA 2K5WA 4IZ8A 4E30A 1STAA 3PO2H 3Q22A 3DWPA 2E2HB 1VQ4Z 1WJJA 2JUBA 2AQ2B 3PUXA 1CTMA 1VQO1 1JOKA 1SNOA 4RVDA 5CORA 2FMMA 4X3UA 3GTOH 4BY7H 3Q0AA 3AQQA 1Q1BA 1TS2A 1EEFD 3ERSX 1VQ9A 3M4OI 4WJWA 3CCSA 3P7JA 1YZ6A 1JJ2A 2PW7A 3J80b 1I4QA 2IHFA 5IYDG 3J81E 1X0TA 1DJRD 3UDFA 1ESFA 2NB0A 3J80f 5C5MA 4DV0Q 4UHVA 1LTAD 4XTCS 2UUCL 3GTJB 1CKNA 4A3EH 2LFNA 5M5XH 3M85A 3I4OA 2ICEC 5A2QE 4S1TA 4X66Q 3NH5A 5IYBG 4R8IA 1YJWA 1O80A 3A8JE 5M5YB 1H95A 1HR0Q 2B2TC 3TZDA 1Q90A 2QA4Z 5J3BA 3GTMS 4Y52I 1U4RA 3WOEA 4L5QA 3CCVZ 1LLRD 1F9RA 5IGBA 1KQSY 2PZWA 3CCRA 2F0TA 3IF8A 4DAPA 2EYFA 4C3IH 3GTQB 2O53A 3AB9A 2F0QA 5D3DA 4DQYB 1OXUA 2X6LA 1OTCA 1XTCD 2JA5B 4JI5L 4B3TQ 3TE5B 2D9UA 1Q86C 2Q2IA 3S1RI 1WYDA 3K7AB 1I3QI 4Y7NI 1LT6D 4LMQD 4MHEA 4KHPQ 5IGDA 2KECA 5AFWA 2E2HH 5IP7I 5I9PA 4O2DA 4BY7G 2B63B 2M48A 1S5CD 4A3LH 2WB1G 1V1QA 2BA0A 2VUMB 1J9OA 2GVBA 3SVMA 4AYBB 5ELOA 1RDPD 5HGTA 1TY0A 1S72Z 3NWSA 4MONA 2Q8RE 2K5VA 2KHSA 4A3GG 2Z9HA 3A7AB 4IPCA 4QGUA 5JPMC 4A3EG 3ER0A 3HKZA 3CC21 4RV9A 3IR7A 4JYAL 1IXRA 1ZKOA 1EEID 2I5HA 1VQ5Z 1GVPA 1EYGA 1A3TA 1HQMC 4OXPA 1RO0A 4CDDC 1BCPD 3CMAA 2UXDQ 1PFTA 2RBLA 4U673 3OWFA 5M5YH 4DV5L 3OW2A 1S5BD 2QDBA 1RF2D 1AZQA 2L5TA 4RVFA 1QF8A 5CMDA 3JAME 2UXBQ 2D0OA 3GTQH 4A3IG 2OTLZ 2H85A 2VPYA 4X65L 2JA5H 4CL1A 1WJ2A 3ICEA 2E2II 1VMCA 1FR3A 3U50C 3CC4Z 1SR3A 4DR3L 4OWTB 1USPA 3K7AH 1YBYA 1E0BA 3HZXA 4KK7A 4YHHQ 1YNXA 2HQLA 4FF4A 4JVZA 1M8AA 3RZOH 2RCNA 3SK6A 1B2TA 1TXYA 2B63H 4DR4Q 1GHKA 3FPUB 1SYEA 3I56A 3HOXB 4UP8A 2VUMH 4A3GI 1E3PA 3RLNA 2P5ZX 1V43A 4P2CB 5JOBA 3G4SA 4DXGA 2L12A 2NVXB 1VDZA 3RN2A 3A8KE 3UI2A 1EFID 2DE5A 4RVHA 4HR7B 5IY0A 4EWCA 2R6GA 1WFQA 1XJVA 4LFCL 4JBJA 2EYHA 2NTSA 3B6YA 1QE6A 3KLSA 1EZ8A 1X6OA 3OTOQ 1IYUA 4AYBE 5I9OA 2V8KA 1NUCA 3E0EA 5FO9B 1II3A 3SK8A 2Z6BA 4JCVE 3SK4A 1JT8A 4JI4Q 4IOAA 4OX9L 4A3II 3H91A 2AUKA 3I73A 5CM2M 3VDYA 1DXMA 3D0FA 2K7VA 4LK1C 1MKHA 1NUIA 3K8AA 2AKLA 3NQTA 4LWCA 2CCZA 4H13C 1BBWA 4IPDA 4YY3Q 4RKLA 2K1BA 1H9RA 4DK0A 2SNMA 4GS3A 3CMEA 1HJPA 4LUVA 3TS2A 1FNUA 1YVCA 3SXHA 1EFWA 2B63G 1STBA 2CQOA 4R8NA 3CCUZ 2KCMA 2VUMG 1SE4A 1KC81 5G3LD 4AYBG 5C3EG 5JAVA 1WTVA 3HOXH 2EJGC 3MFYA 3MVVA 3GTJI 3CPWY 2LXKA 2NVXH 1KRTA 1K0SA 3HOVB 2R93I 2GVAA 1PTOC 1H9SB 5DAUA 1PLFA 1IW7C 3IRBA 1N9WA 2B2VA 1H9KA 4DUZL 1VQGA 2MP1A 3G71Z 4NB3A 4S3SA 3VMHA 1QVFZ 1PH3A 1EU3A 4KJOA 3VMIA 1KTKA 3K7UC 5GAHC 1UWVA 1K8AC 1QB5D 1SXTA 5IT9L 4K6DA 3KDFA 4EQ5A 2WAQB 5JEAG 5KNDA 1FNWA 5C4XG 1X3PA 2VB3X 4JI6L 3T1YL 1PVOA 4IOCA 1VQ71 1L2FA 4X62Q 4UP9A 3UDXA 2DE6A 1K732 2YADA 4H44C 1VQ61 3S17I 1TS5A 1UE7A 4CKCA 3GTMB 1SNQA 1HFGA 4UDUC 1YI21 4EGVA 3T1HL 3V96A 1DGSA 1X55A 1F9SA 2K5NA 3I2ZA 3K57A 1W2BA 4DR1Q 4NBCA 2CFMA 5C3EI 3HGBA 1Q46A 4BWGB 3ZJYC 3J80E 2NVYB 4JBKA 3FQQA 1NAPA 1IZ6A 2A74C 1SMYD 3CCJ1 1HUMA 1LTLA 4IFDG 3BVZA 5EJWA 3TDQA 2VB2X 4E32A 2LSSA 2EVBA 3UE0A 4K5VA 1IBKQ 3PUYA 2A68D 2KPIA 3HOVH 4F7XA 5BN5A 4L5SA 5CC4A 1Q811 1FVIA 1NNXA 3I4MI 3GP7A 1KD11 3CD6A 2R61A 1CQVA 5C4XI 2UUAQ 3T16A 2OTJZ 4X3KA 3NTIA 3HG9A 3UDIA 4L5RC 2F0EA 1O7YA 1EZ6A 3GTKI 1RHPA 1EU4A 2R7FA 5GROA 3BVMA 1HRJA 1KLGD 4A75A 3VR4A 3U9OA 3NBHB 3NHHA 4MZ9A 3NE5B 1KC82 3SE0A 1YIT1 2KCCA 4A3DI 2UUBL 2KOLA 2OOXB 1O7LA 5C6AA 2K52A 3GTMH 1Z03A 4V0BA 3HOWB 3W1BA 1I50B 1NY4A 3KK7A 1VQK1 1J5EL 4I7AA 1S7MA 1L1OB 4K8IA 2A19A 5CV9A 2Z6KC 2F0GA 3NBIA 4EQNA 1U9RA 2B3GA 1B50A 2Z1CA 3TEHB 4IFDI 5FLXb 1VQAA 4V190 1OXTA 2NVYH 5LMUL 2JP1A 1TIID 1FGBD 4A3BI 1ZXTA 2N55A 3DM1A 5EKKA 1NMGA 5F2DA 2RA4A 1UNSA 1RTNA 4NBAA 5HGQA 4CJ0B 2HU9A 1XNRQ 2A69C 2RCFA 1KDAA 2QEXZ 3KF8A 5J39A 1VS0A 1A2TA 4HGZA 2YV5A 2MHVA 1PH8A 1C7YA 1UE5A 2K6AA 2F4IA 3PQIA 2A6ED 3CCQA 5CYUA 1KNAA 5D65A 4MTKA 2MGSA 1K9M2 4GLVB 1VQMA 5GAGC 4HAEA 4G7HC 1B44D 3QIAA 3TSSA 2NVQB 4GKJQ 1J8IA 1FNVA 2JA7B 1BBXC 3F1ZA 2YU9I 1VF7A 3T4NB 3I551 3KFUA 4QY7A 2N78A 4HIKA 2Z0SA 3CC7Z 4DF7A 4JI0L 4RS4A 2R7ZI 3H3VH 1A3VA 2XTIA 4LF5Q 4BA1I 4BS9A 4TKOB 4DNRB 2L55A 1WCMI 2CH4W 5C4JB 3A55A 1QVGA 3HOUG 1PRTB 2AUJD 1I50H 4QTTA 5IGGA 1MJEA 3CU7A 4P72A 1VQOZ 4ZRZA 2J7ZA 2NUCA 1EYDA 1AN8A 4RWSC 5C0XH 1UUPA 2VPWA 2VZAA 1D5XC 2F0PA 1JQYD 2QEJC 5ELDA 3I07A 2WKDA 2K75A 2L9HA 3L2PA 1XMQQ 2G9DA 2W04A 1KD12 1BVSA 4NXNL 4A3FG 4X64Q 3M4OB 4KHVA 1U4PA 1EWIA 1STHA 5FO8B 1P16A 4PMWA 1RKNA 1CA6A 5FKAC 5NUCA 3CXCZ 4HIMA 1ZYRC 1BXTA 3ULJA 3G48A 4OWXB 1N32Q 1YJ91 2SOBA 2DJFC 1X3QA 1PRTF 1MGSA 4K5WA 1Y8OB 1NJIC 1EY5A 4FYDA 1DZ1A 3KBXA 4OELB 3F2DA 4NBGA 2OEOA 4IUTA 2E7ZA 3VYSA 2NVQH 1Y14B 2E5LL 2RDHA 2JA7H 2F4VQ 1TQOA 1AZPA 3NH8A 3KF6A 3ERQA 5FO7B 4N8X1 4JI7Q 1VQ4A 4CHTB 3LGJA 1EQVA 3HOUI 2EY5A 4DV6L 3I90A 2MNAA 4IPHA 4E2WA 3HOWG 1CKNB 5HY6A 4IUUA 3DEPA 1ASYA 4ABNA 5C4JH 1CKMA 3S1RB 1P8LA 1Q1EA 4DK6C 5C0XG 4Y7NB 2LEXA 1MBYA 4RCNA 4FVMA 4A3FI 1E1TA 4R4CA 1VQL1 4EQOA 1PA6A 3ITPA 3AYHB 4KJNA 2VUGA 1UE1A 1TT2A 2AMCB 1WIIA 2F4OA 3Q6SA 4YWLA 2UU9Q 3M4OH 1X65A 4GNXA 1YUKA 3CC2Z 2ICIA 3URYA 2RDFA 2MUYA 1EOVA 2QA4A 1TWHI 3AFPA 2A6HD 4P74A 1YHQ1 2K05A 3CCVA 3RN5A 2Z6KA 4LF4Q 1HA6A 1HUNA 3ZYYX 1ML0D 1QYPA
chains in the Genus database with same CATH topology
4JI1L 3D31A 1N34L 4AQYQ 5IT9b 2JA7G 4HIDA 4LUZA 4MH4A 4Y52H 3HOWI 5IT9f 1VQDA 1VQJA 3M9BA 1GD7A 2Q2UA 1FJGL 1ML8A 3A0JA 4X66L 4HJAA 4YCVA 2PMZA 3S1RH 1S72A 4LF6Q 3K0XA 4BXXG 1C0AA 1I3QH 4Y7NH 1Q82C 2PI2A 1XMOQ 5IP7H 2JA8G 1D8LA 1VQ5A 5IYDH 3PIPA 1NP6A 3HFZB 4WJ3M 1KQSZ 3S15I 3BZCA 4IJHA 1I94Q 4DR7Q 1PYBA 3NEMA 4JV5L 2OTLA 3G6E1 2H5XA 1PYSB 3J7ZC 3CC4A 2EIFA 1MJCA 1Q861 1X3GA 4JI3L 3S1QI 4MRIA 1U5KA 1VQN1 4BY1I 4BXXI 4NFRA 4MXUA 3I4NG 4DV2Q 1PH4A 3PUZA 2E2IH 3GKQA 3EIVA 2UXDL 2RIQA 2JA8I 4DV1Q 5IP7G 1WW9A 1N36L 3GD7A 1E1OA 1EUJA 3CCM1 1A0IA 3EN2A 4A3GH 3HKZE 3JC66 5LL6f 5M3FH 4GLAC 1P9NA 2WB1E 3CQZI 1VQP1 4BBRG 4WJ4A 2V8JA 3NELA 1PH9A 1RO2A 1KL9A 4LFBL 2Q4ZA 1VQ7Z 2NN6G 4DV7L 4YWKA 1VQ6Z 4A3IH 4NXMQ 5BR8L 2VF1A 4DR6Q 5ELNA 3I4NI 1QUQA 1YI2Z 2VNUD 1E7ZA 5M5WH 3CCUA 2I5LX 4J15A 1ZB8A 3HKZG 3EBEA 4IJLA 1SLJA 4R1JA 3MZKB 3J81c 2R7DA 4LF7L 1RQFA 3NENA 3H3VJ 2JA9A 3STBC 4JI4L 3KDFB 3CCJZ 1I6HI 1B70B 4YWMA 1N33L 5C44I 1HZ9A 5M3FG 4BBRI 4R4TA 3G71A 1VQHA 4DV4Q 2F4MA 3BZKA 1QVFA 5C0XJ 5EAYA 3GTJH 2R92I 1K0RA 2R93H 4JI8Q 4JI2L 3LUSA 5T67A 2JA6G 1C9OA 3BG1B 2NN6I 1RIPA 1TFIA 1Y1VI 2P28A 3H0GG 1R9TI 4DK1A 3ULPA 3PO3I 1YITZ 1PHJA 1VQKZ 3S17H 2ZJPA 4GOPA 3PF4A 1KRSA 3CPWZ 4JBWA 3KIFA 4OO1I 2UUCQ 5C3EH 4DNIA 3M4PA 3CCE1 3GTLI 3RLOA 1EQRA 4X62L 2QGQA 1M1KC 2IX0A 4E2YA 2JA6I 3Q8DA 2R93G 3JAMc 2OTJA 2MFIA 3ULLA 4DR1L 4XX2A 1K8A1 3H0GI 2F3IA 4JI5Q 4GN3B 4PZ7A 4C2MH 3I4MH 2KENA 1K83I 2V8IA 1Y1WI 5C4XH 3CCL1 3I55Z 1RO4A 1PFSA 4IPGA 1JMCA 4R4QA 1KHIA 1GO3E 4QQBX 4UY8C 3GTKH 3L7ZC 3KF8B 4P71A 2I0QA 4B3ML 4A3DH 4A3MG 2GN5A 3SGIA 4DR2Q 1HNWL 2VQEL 2Y0SA 2RHSB 4AIMA 1A62A 4K0KL 4JYAQ 1M901 2QEXA 2ASBA 3FHWA 1YEZA 1XPOA 5FJ8H 1S40A 3PUWA 4A3BH 2RF4A 4DV5Q 1K73C 1YHBA 2L15A 1YJ9Z 1X54A 4MD7A 1XPUA 3PCOB 3I4MG 1V9PA 4KHZA 4X65Q 3CC7A 1OXXK 2D62A 4DR3Q 1A63A 2UXCL 1VQ81 4DUYL 1QZHA 1IYJB 2IHEA 2YTVA 5T6BA 1YIJ1 1JJ2Y 2YU9H 4A3MI 1VQOA 1GM5A 3ESWA 2NZHA 2HHHL 4A3DG 1UE6A 1KRLA 2R7ZH 3RZDI 4NBDA 1IBML 1WCMH 4R4IA 3KJPA 3M3YI 4LFCQ 2GTHA 1A8VA 1N2FA 1BKBA 1TWFI 1TWGI 1VQLZ 4PZ6A 3CXCA 1YJN1 2VS1A 5FJ8G 5GADC 3NDIA 4A3BG 3KF6B 4LFAL 2JJQA 2QREB 3E9IA 2AHOB 3TDHB 4OX9Q 1KC8C 1YHQZ 4A93I 4QIWE 2OQKA 1Y1VS 3J81j 4POGA 2OOYB 2ALYB 2RT9A 1XNQL 1XMQL 3A5UA 2PNHA 3J80c 1DL6A 2RHBA 4OONA 4L5TA 1VQFA 4GNXC 2R7ZG 2JR6A 1M902 3F2CA 4NBFA 3BU2A 3FKII 3K80C 4PZ8A 3HOUH 1WCMG 2PK7A 2ZTCA 2E8GA 2V1CC 1K9MC 1SE8A 4DUZQ 1HZCA 3CC2A 4LF8Q 4DKAC 3OW2Y 2MO1A 4A3FH 3MZLB 4JI7L 4HJ9A 3DM3A 4ME3A 4LF9Q 4JI6Q 3T1YQ 1NJI1 1CSPA 4DR5L 3IFUA 4POFA 1VQ91 1TWHH 3CCS1 2LIYA 1Q8KA 3G6EZ 3T1HQ 1PV4A 3HOZG 4GKKL 1VQCA 1N8R1 1G291 1KD1C 4DAMA 1E24A 3J81f 1VQNZ 1YJW1 3HOWH 1E22A 1W3SA 3KJOA 5A2Qf 2YTXA 3CCR1 2KHIA 1Q812 2ZM6L 3S14I 3GTGI 4E2XA 2QKDA 5AN9F 1KQSA 5K36G 3CCMZ 3E9HA 2AKWB 4B3SQ 2K5HA 5IP9I 2WAQA 3FQMA 2LFUA 3CW2C 1VQPZ 1B7YB 1Z9FA 4LF6L 5D1OA 3PF5A 3HOZI 4RG1A 5LMNL 3S15H 1SROA 3F3PC 2JEAI 2D0PA 3D9XA 3MEFA 4KI0A 1J5EQ 1FGUA 2N8NA 4H02A 1IBLL 5JEAJ 5LMUQ 3CMA1 3S2HI 2PMZE 4A3KG 3CAMA 3S1QH 1Q821 1I94L 5IWAL 1VLAA 4BY1H 4BXXH 3NH4A 5E7NA 1LUZA 1EIFA 2JA8H 4GLXA 1KAWA 2QRDB 3HOYI 2E2JI 2JS4A 1Z01A 4DPGA 1T9HA 4RVGA 4X6AI 1QUQB 2N49A 2B29A 4IFDJ 3I561 5M3MG 1N8R2 1YUAA 1L0WA 1VQ7A 4JI0Q 1W2BY 3G4S1 3CQZH 3S2DI 4HJ5A 1HNXQ 1VQ6A 1Z47A 1SN8A 1Q7Y1 1ZH1A 1YI2A 4YCWA 5H1SE 4A3KI 4DV0L 2NVTI 4NPSA 1RNIA 3F3FC 3I4NH 3CCJA 1HR0L 4NXNQ 2WFWA 4BY1G 2YTYA 2IX1A 2JEBI 1KIXA 3CCEZ 1JE5A 4A3CI 4B3TL 4A4IA 3HKSA 5DLQE 3CME1 1I6HH 4DR6L 1Z02A 4B3RQ 2G2KA 1SFOI 5C44H 3GO5A 3PIOA 4A3JG 3S1MI 1WOCA 3IX0A 2OQ0A 4BBRH 4KHPL 1USPB 2E5LQ 1HZBA 4GOPC 2HF1A 3TQYA 2P3YA 3F2BA 2VQFQ 4JBMA 2R92H 4DV6Q 3P5JB 2VY3A 1YITA 4O0AA 3CCLZ 1YHAA 2HT1A 2VL6A 1Y1VH 4TQUS 1VQKA 2RHQB 2PM9A 4P73A 1AE3A 3CF5A 3CPWA 1R9TH 3OYYA 2QLVB 1NBWA 3PO3H 2JK8A 4HIOA 4AH6A 1K8GA 3H15A 2UXBL 4A76A 4A3JI 3QWUA 1QVCA 2PQAA 2UUBQ 1FL0A 2LXJA 4JI1Q 3J7A5 5C44G 1BBUA 3GTLH 3AFQA 1HNZQ 1N34Q 4NH1C 1X3FA 1Q7Y2 4YHHL 1Q12A 4LUOA 1CUKA 2JA6H 3WWVA 2R92G 4DR4L 3I55A 3D6WA 1LYLA 3S1NI 5FLXc 1QVGY 4UPAA 3S16I 4NBHA 3S24A 3H0GH 3GTPI 1Y1VG 1VQ8Z 1ZB9A 1FJGQ 1K83H 1YIJZ 4BBSG 2BH8A 1Y1WH 2IT1A 3CD61 1NTGA 2Q51A 3PO3G 3OTOL 2N3SA 4DV3Q 3TS0A 4DGLA 5FLMG 1TWAI 5LMNW 5JJKA 3PO2G 4TVAB 2CWAA 4OO1G 1YJNZ 1SRUA 1M1K1 3J7A4 1YJ9A 1PH7A 5AJ3Q 4YY3L 1X9NA 4P75A 2KCTA 3U58A 4HJ8A 1S3OA 4JV5Q 3EERA 1VQBA 1LM0A 1Q862 1MIUA 3MXNB 2EGTA 4C3JH 2YYZA 4DR2L 4LNQA 4JI3Q 4BBSI 2M6NA 2WB1A 1Y1WG 1IL2A 3CCQ1 1TWCI 5FLMI 1VQM1 3A5ZB 1N36Q 3PO2I 1VQLA 4A3MH 2Y0SE 1RLYA 2IY5B 3STBD 3GTOI 4BY7I 1CKOA 2NZOA 3RZDH 4A3LG 1YHQA 2DE7A 3M3YH 4PG3A 1K731 1TWFH 4MD9A 1TWGH 1AE2A 2KBNA 1VQEA 3U4ZA 4LFBQ 2Q2HA 4A3EI 4DV7Q 1HR0W 1VQ9Z 3CCSZ 5BR8Q 1PH1A 4A93H 1JJ2Z 2IZ3A 2Y0SG 4GN5A 1AH9A 1IBKL 2IZ4A 2JQOA 2Q2TA 1I5FA 1HH2P 4APVA 4QJFA 4LF7Q 1YJWZ 1M1K2 2UUAL 1N33Q 2A8VA 2KI7B 3CCRZ 2K14A 1D7QA 2JA5G 1VCIA 2E2HI 1B8AA 3FKIH 4A3LI 5IT9c 1VQ41 3KYHC 3PSIA 4E33A 4JI2Q 1JB7A 2ID0A 2GU2A 3FP9A 2A1AA 2BH2A 3PGZA 2CWPA 1CSQA 4E31A 3G6EA 4A93G 2VW9A 3UDGA 4FDBA 2DUDA 4ALPA 2R6MA 2MQHA 1JJGA 4LF8L 1U0LA 1XPRA 1EIYB 1VQNA 1XNRL 1KXLA 4AYBA 2QA41 2FXQA 3GTQI 3CCV1 1GKHA 2JA5I 1ASZA 3CMAZ 4LF9L 1PH6A 3OW2Z 3K7AI 1J6QA 2J6AA 3CP0A 1K9M1 3FKIG 4GKJL 3CCMA 4MTNA 5D1OB 3RZOI 2XGTA 2F52A 2JMOA 2B63I 1O7IA 3VB9A 1K8A2 2VUMI 1PH5A 1VQPA 3S14H 3GTGH 1G6PA 4LF5L 3HOXG 1WI5A 2EQSA 2OCEA 1S721 5IP9H 3I56Z 1QZGA 1M90C 2I3CA 3J81i 3G4SZ 2ZJRA 3Q87A 3PO3S 3K81C 1VQ51 4X64L 3I7FA 3HOZH 4B3MQ 4B3SL 3KOJA 1JJCB 1HNWQ 4GNXB 2VQEQ 1N32L 1X56A 1NMFA 4K0KQ 1X3ZA 4NBBA 2OZKA 2BA1A 3TRZA 1QVFY 2OTL1 2EXDA 3F8TA 3S2HH 2I5MX 3CC41 4JC0A 4NBEA 1G51A 5IE8A 2F4VL 1L1OC 3HOXI 1LQLA 2WAQE 3CMEZ 2NVXI 2JE6I 5IP9G 3HOYH 5GAEC 5D1PA 5FLXf 3BG0B 2E2JH 2UXCQ 4DUYQ 4JG2A 4QL5A 3HOVG 4X6AH 1OXSC 3VTNA 5JJLA 4EX5A 5GQOA 3W5OA 2AWOA 2ZTDA 1Q81C 2HHHQ 4NB9A 3J81b 3S2DH 2UU9L 2RPRA 1RL2A 2KHJA 3PUVA 4E2ZA 4JOIC 1K3RA 1IBMQ 5A2Qb 2WAQG 4MNOA 4LF4L 3JAMi 3DLLA 3W1GA 1XTDA 4A3KH 3CCEA 2ES2A 4TNUA 4BA2I 4UP7A 2NVTH 1JWHC 3GCFA 4LFAQ 4AQYL 3VMGA 1HNXL 2BJOA 4HGYA 5JJIA 3CCU1 4MD8A 1W2BZ 3HOVI 3HOYG 2HIXA 4A3CH 1XNQQ 2WP8J 5M3MH 1SFOH 3CCLA 4IO9A 3S1MH 1XMOL 3U4VA 2W03A 4HH4A 3G711 1SMXA 4GN4B 2CKZB 5IYCH 4LW1A 4YCUA 2PQAB 4B3RL 3CD6Z 3RR5A 3GTMI 4DR7L 2PI2E 1X3WA 2VQFL 3BJUA 2QR1B 3M7NA 4NOZA 2DGYA 3JAMb 1N8RC 1NJI2 4DK3C 2NVYI 3NFZA 3JAMf 2AWNA 3RLFA 1HZAA 4DR5Q 3AEVA 1VQIA 4A3CG 2GTIA 4A3JH 4DV2L 2O4HA 4GKKQ 3A74A 4OWWB 1VQ8A 2ZAEB 4DV1L 3L0OA 1YIJA 2OWOA 3NDJA 1L1OA 4DAYB 2ZJQA 5IYCG 3S1NH 2QRCB 3S16H 3MONA 2OTJ1 2C35B 3CXCY 2ZM6Q 1HNZL 3CCQZ 3GTPH 4RMFA 3H3VI 2K5RA 1X3EA 1VQMZ 4C3HH 3M4QA 1YJNA 1I50I 3RNUA 3KLWA 3PV0A 5C0XI 2MO0A 1OXVA 4NXML 4QTUA 1TWAH 4JOIA 3J80i 3GDEA 1QVGZ 4NB8A 1EQQA 5LMNQ 3KIHA 4HJ7A 1UEBA 4GOPB 2E9HA 4DV3L 1NE3A 2ZTEA 2K4KA 2QEX1 1IBLQ 3TREA 4XIGS 1Q822 2NVQI 3UE1A 1PH2A 5AJ3L 4DV4L 2JA7I 4KLKA 5IYBH 4BBSH 2K3RA 5IWAQ 2ATWA 3EEDA 5T64A 4JI8L 2JNYA 3CPFA 2K50A 1Q7YC 3CC71 5C4JI 1TWCH 2HIVA 4R4OA 5FLMH 4E30A 3PO2H 1VQ4Z 1WJJA 2JUBA 3PUXA 1VQO1 4RVDA 3GTOH 4BY7H 3AQQA 1Q1BA 3ERSX 1VQ9A 3M4OI 3CCSA 1YZ6A 1JJ2A 3J80b 2IHFA 5IYDG 1X0TA 3UDFA 3J80f 2UUCL 4DV0Q 4XTCS 1CKNA 4A3EH 5M5XH 3M85A 3I4OA 4S1TA 4X66Q 3NH5A 5IYBG 1YJWA 1H95A 1HR0Q 2QA4Z 5J3BA 3GTMS 4Y52I 4L5QA 3CCVZ 1KQSY 3CCRA 3IF8A 4C3IH 2O53A 4DQYB 1OXUA 1OTCA 4JI5L 4B3TQ 3TE5B 1Q86C 2Q2IA 3S1RI 1WYDA 1I3QI 4Y7NI 4KHPQ 2E2HH 5IP7I 4BY7G 4O2DA 2M48A 4A3LH 2WB1G 1V1QA 2BA0A 2GVBA 5ELOA 1S72Z 4MONA 2K5VA 4A3GG 4IPCA 4QGUA 4A3EG 3ER0A 3HKZA 3CC21 4RV9A 4JYAL 1IXRA 2I5HA 1VQ5Z 1GVPA 1EYGA 4OXPA 1RO0A 3CMAA 2UXDQ 1PFTA 2RBLA 4DV5L 5M5YH 3OW2A 4RVFA 1QF8A 2UXBQ 2D0OA 3GTQH 4A3IG 2OTLZ 2H85A 4X65L 2JA5H 4CL1A 3ICEA 2E2II 3U50C 3CC4Z 1SR3A 4DR3L 4OWTB 1USPA 3K7AH 1YBYA 4YHHQ 1YNXA 2HQLA 3RZOH 2RCNA 1TXYA 2B63H 4DR4Q 3I56A 2VUMH 4UP8A 4A3GI 1E3PA 3RLNA 1V43A 3G4SA 3RN2A 2DE5A 4RVHA 5IY0A 4EWCA 2R6GA 1WFQA 1XJVA 4LFCL 4JBJA 3B6YA 1X6OA 3OTOQ 4AYBE 2V8KA 3E0EA 4JCVE 1JT8A 4JI4Q 4IOAA 4OX9L 4A3II 5CM2M 3VDYA 3D0FA 1MKHA 1NUIA 3K8AA 2AKLA 4LWCA 2CCZA 4IPDA 1BBWA 4YY3Q 4GS3A 3CMEA 1HJPA 4LUVA 3TS2A 1YVCA 1EFWA 2B63G 2CQOA 3CCUZ 2KCMA 2VUMG 1KC81 4AYBG 5C3EG 3HOXH 3GTJI 3CPWY 2LXKA 2NVXH 1KRTA 2R93I 2GVAA 3IRBA 1N9WA 4DUZL 1VQGA 3G71Z 4NB3A 3VMHA 1QVFZ 1PH3A 3VMIA 3K7UC 5GAHC 1UWVA 1K8AC 3KDFA 4EQ5A 5JEAG 5C4XG 4JI6L 3T1YL 1PVOA 4IOCA 1VQ71 1L2FA 4X62Q 4UP9A 3UDXA 2DE6A 1K732 2YADA 1VQ61 3S17I 1UE7A 1YI21 3T1HL 1DGSA 1X55A 3I2ZA 2K5NA 1W2BA 4DR1Q 4NBCA 2CFMA 5C3EI 1Q46A 3ZJYC 4JBKA 3FQQA 1IZ6A 3CCJ1 1LTLA 4IFDG 4E32A 2LSSA 3UE0A 1IBKQ 3PUYA 2KPIA 3HOVH 4L5SA 1Q811 1FVIA 3I4MI 1KD11 3CD6A 5C4XI 2UUAQ 2OTJZ 3UDIA 4L5RC 3GTKI 2R7FA 5GROA 4A75A 3NBHB 4MZ9A 1KC82 1YIT1 4A3DI 2OOXB 3GTMH 2K52A 1Z03A 3W1BA 1NY4A 1VQK1 1J5EL 1S7MA 1L1OB 2A19A 2Z6KC 2B3GA 3TEHB 4IFDI 5FLXb 1VQAA 1OXTA 2NVYH 5LMUL 4A3BI 1NMGA 4NBAA 5HGQA 2HU9A 1XNRQ 2QEXZ 1VS0A 4HGZA 2YV5A 1PH8A 1C7YA 1UE5A 3CCQA 1K9M2 4GLVB 1VQMA 5GAGC 4GKJQ 3F1ZA 2YU9I 3T4NB 3I551 3KFUA 4QY7A 2N78A 4HIKA 2Z0SA 3CC7Z 4JI0L 4RS4A 2R7ZI 3H3VH 2XTIA 4LF5Q 4BA1I 1WCMI 1QVGA 3HOUG 1I50H 4QTTA 1MJEA 4P72A 1VQOZ 2VZAA 3I07A 2K75A 3L2PA 1XMQQ 2W04A 1KD12 1BVSA 4NXNL 4A3FG 4X64Q 1EWIA 1P16A 4PMWA 3CXCZ 4HIMA 3ULJA 3G48A 4OWXB 1N32Q 1YJ91 1NJIC 3F2DA 4NBGA 2NVQH 1Y14B 2E5LL 2JA7H 2F4VQ 3NH8A 3KF6A 4JI7Q 1VQ4A 3LGJA 3HOUI 4DV6L 2MNAA 4IPHA 4E2WA 3HOWG 1CKNB 5HY6A 1ASYA 5C4JH 1CKMA 1P8LA 1Q1EA 4DK6C 5C0XG 4A3FI 1E1TA 4R4CA 1VQL1 1PA6A 3AYHB 2VUGA 1UE1A 2AMCB 1WIIA 2F4OA 4YWLA 2UU9Q 3M4OH 1X65A 4GNXA 1YUKA 3CC2Z 1EOVA 2QA4A 1TWHI 3AFPA 4P74A 1YHQ1 3CCVA 3RN5A 2Z6KA 4LF4Q 2UUBL 1QYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 L;  3D31 A;  1N34 L;  4AQY Q;  2JA7 G;  4HID A;  4LUZ A;  4MH4 A;  4Y52 H;  3HOW I;  1VQD A;  1VQJ A;  3M9B A;  1GD7 A;  2Q2U A;  1FJG L;  1ML8 A;  3A0J A;  4X66 L;  4HJA A;  4YCV A;  3S1R H;  1S72 A;  4LF6 Q;  3K0X A;  4BXX G;  1C0A A;  1I3Q H;  4Y7N H;  1Q82 C;  2PI2 A;  1XMO Q;  5IP7 H;  2JA8 G;  1D8L A;  1VQ5 A;  5IYD H;  3PIP A;  3HFZ B;  4WJ3 M;  3S15 I;  3BZC A;  4IJH A;  1I94 Q;  4DR7 Q;  1PYB A;  3NEM A;  4JV5 L;  2OTL A;  2H5X A;  1PYS B;  3J7Z C;  3CC4 A;  2EIF A;  1MJC A;  1X3G A;  4JI3 L;  3S1Q I;  1U5K A;  4BY1 I;  4BXX I;  3I4N G;  4DV2 Q;  1PH4 A;  3PUZ A;  2E2I H;  3GKQ A;  3EIV A;  2UXD L;  2JA8 I;  4DV1 Q;  5IP7 G;  1WW9 A;  1N36 L;  3GD7 A;  1E1O A;  1EUJ A;  1A0I A;  3EN2 A;  4A3G H;  3HKZ E;  3JC6 6;  5M3F H;  4GLA C;  2WB1 E;  3CQZ I;  4BBR G;  4WJ4 A;  3NEL A;  1PH9 A;  1KL9 A;  4LFB L;  2NN6 G;  4DV7 L;  4YWK A;  4A3I H;  4NXM Q;  5BR8 L;  4DR6 Q;  5ELN A;  3I4N I;  1QUQ A;  2VNU D;  1E7Z A;  5M5W H;  3CCU A;  2I5L X;  4J15 A;  1ZB8 A;  3HKZ G;  3EBE A;  4IJL A;  1SLJ A;  4R1J A;  3J81 c;  2R7D A;  4LF7 L;  3NEN A;  3H3V J;  2JA9 A;  3STB C;  4JI4 L;  3KDF B;  1I6H I;  1B70 B;  4YWM A;  1N33 L;  5C44 I;  1HZ9 A;  5M3F G;  4BBR I;  4R4T A;  3G71 A;  1VQH A;  4DV4 Q;  2F4M A;  3BZK A;  1QVF A;  5C0X J;  5EAY A;  3GTJ H;  2R92 I;  1K0R A;  2R93 H;  4JI8 Q;  4JI2 L;  3LUS A;  2JA6 G;  1C9O A;  2NN6 I;  1RIP A;  1TFI A;  1Y1V I;  3H0G G;  1R9T I;  3ULP A;  3PO3 I;  1PHJ A;  3S17 H;  2ZJP A;  4GOP A;  3PF4 A;  1KRS A;  4JBW A;  4OO1 I;  2UUC Q;  5C3E H;  4DNI A;  3M4P A;  3GTL I;  3RLO A;  1EQR A;  4X62 L;  2QGQ A;  1M1K C;  2IX0 A;  2JA6 I;  3Q8D A;  2R93 G;  3JAM c;  2OTJ A;  2MFI A;  3ULL A;  4DR1 L;  4XX2 A;  3H0G I;  2F3I A;  4JI5 Q;  4GN3 B;  4PZ7 A;  4C2M H;  3I4M H;  2KEN A;  1K83 I;  1Y1W I;  5C4X H;  1RO4 A;  1PFS A;  4IPG A;  1JMC A;  4R4Q A;  1KHI A;  1GO3 E;  4QQB X;  4UY8 C;  3GTK H;  3L7Z C;  3KF8 B;  4P71 A;  2I0Q A;  4B3M L;  4A3D H;  4A3M G;  2GN5 A;  3SGI A;  4DR2 Q;  1HNW L;  2VQE L;  2RHS B;  4AIM A;  1A62 A;  4K0K L;  4JYA Q;  2QEX A;  2ASB A;  3FHW A;  1YEZ A;  1XPO A;  5FJ8 H;  1S40 A;  3PUW A;  4A3B H;  2RF4 A;  4DV5 Q;  1K73 C;  1YHB A;  2L15 A;  1X54 A;  1XPU A;  3PCO B;  3I4M G;  1V9P A;  4KHZ A;  4X65 Q;  3CC7 A;  1OXX K;  2D62 A;  4DR3 Q;  1A63 A;  2UXC L;  4DUY L;  1QZH A;  1IYJ B;  2IHE A;  2YTV A;  2YU9 H;  4A3M I;  1VQO A;  1GM5 A;  3ESW A;  2NZH A;  2HHH L;  4A3D G;  1UE6 A;  2R7Z H;  3RZD I;  4NBD A;  1IBM L;  1WCM H;  4R4I A;  3KJP A;  3M3Y I;  4LFC Q;  1A8V A;  1N2F A;  1BKB A;  1TWF I;  1TWG I;  4PZ6 A;  3CXC A;  2VS1 A;  5FJ8 G;  5GAD C;  4A3B G;  3KF6 B;  4LFA L;  2JJQ A;  3E9I A;  2AHO B;  4OX9 Q;  1KC8 C;  4A93 I;  4QIW E;  2OQK A;  1Y1V S;  3J81 j;  4POG A;  2ALY B;  1XNQ L;  1XMQ L;  3A5U A;  2PNH A;  3J80 c;  1DL6 A;  4GNX C;  4OON A;  4L5T A;  1VQF A;  2R7Z G;  2JR6 A;  3F2C A;  4NBF A;  3BU2 A;  3FKI I;  3K80 C;  4PZ8 A;  3HOU H;  1WCM G;  2PK7 A;  2ZTC A;  2E8G A;  2V1C C;  1K9M C;  1SE8 A;  4DUZ Q;  1HZC A;  3CC2 A;  4LF8 Q;  4DKA C;  2MO1 A;  4A3F H;  4JI7 L;  4HJ9 A;  3DM3 A;  4ME3 A;  4LF9 Q;  4JI6 Q;  3T1Y Q;  1CSP A;  4DR5 L;  4POF A;  1TWH H;  1Q8K A;  3T1H Q;  1PV4 A;  3HOZ G;  4GKK L;  1VQC A;  1G29 1;  1KD1 C;  4DAM A;  1E24 A;  3HOW H;  1E22 A;  1W3S A;  3KJO A;  2YTX A;  2KHI A;  2ZM6 L;  3S14 I;  3GTG I;  1KQS A;  5K36 G;  3E9H A;  2AKW B;  4B3S Q;  2K5H A;  5IP9 I;  3CW2 C;  1B7Y B;  1Z9F A;  4LF6 L;  3PF5 A;  3HOZ I;  4RG1 A;  5LMN L;  3S15 H;  1SRO A;  2JEA I;  2D0P A;  3MEF A;  4KI0 A;  1J5E Q;  1FGU A;  2N8N A;  4H02 A;  1IBL L;  5JEA J;  5LMU Q;  3S2H I;  2PMZ E;  4A3K G;  3CAM A;  3S1Q H;  1I94 L;  5IWA L;  1VLA A;  4BY1 H;  4BXX H;  5E7N A;  1LUZ A;  1EIF A;  2JA8 H;  4GLX A;  1KAW A;  3HOY I;  2E2J I;  2JS4 A;  4DPG A;  1T9H A;  4X6A I;  1QUQ B;  2N49 A;  2B29 A;  4IFD J;  5M3M G;  1YUA A;  1L0W A;  1VQ7 A;  4JI0 Q;  3CQZ H;  3S2D I;  4HJ5 A;  1VQ6 A;  1HNX Q;  1Z47 A;  1SN8 A;  1YI2 A;  4YCW A;  5H1S E;  4A3K I;  4DV0 L;  2NVT I;  4NPS A;  3I4N H;  3CCJ A;  1HR0 L;  4NXN Q;  2WFW A;  4BY1 G;  2YTY A;  2IX1 A;  2JEB I;  1KIX A;  1JE5 A;  4A3C I;  4B3T L;  4A4I A;  3HKS A;  5DLQ E;  1I6H H;  4DR6 L;  4B3R Q;  1SFO I;  5C44 H;  3GO5 A;  3PIO A;  4A3J G;  3S1M I;  1WOC A;  2OQ0 A;  4BBR H;  4KHP L;  1USP B;  2E5L Q;  1HZB A;  4GOP C;  2HF1 A;  3TQY A;  2P3Y A;  3F2B A;  2VQF Q;  4JBM A;  2R92 H;  4DV6 Q;  2VY3 A;  1YIT A;  4O0A A;  1YHA A;  2HT1 A;  2VL6 A;  1Y1V H;  4TQU S;  1VQK A;  2RHQ B;  4P73 A;  1AE3 A;  3CF5 A;  3CPW A;  1R9T H;  3OYY A;  1NBW A;  3PO3 H;  2JK8 A;  4HIO A;  4AH6 A;  1K8G A;  3H15 A;  2UXB L;  4A76 A;  4A3J I;  1QVC A;  2PQA A;  2UUB Q;  1FL0 A;  2LXJ A;  4JI1 Q;  3J7A 5;  5C44 G;  1BBU A;  3GTL H;  3AFQ A;  1HNZ Q;  1N34 Q;  1X3F A;  4YHH L;  1Q12 A;  4LUO A;  1CUK A;  2JA6 H;  3WWV A;  2R92 G;  4DR4 L;  3I55 A;  3D6W A;  1LYL A;  3S1N I;  5FLX c;  4UPA A;  3S16 I;  4NBH A;  3S24 A;  3H0G H;  3GTP I;  1Y1V G;  1ZB9 A;  1FJG Q;  1K83 H;  4BBS G;  2BH8 A;  1Y1W H;  2IT1 A;  1NTG A;  3PO3 G;  3OTO L;  2N3S A;  4DV3 Q;  3TS0 A;  5FLM G;  1TWA I;  5LMN W;  5JJK A;  3PO2 G;  4TVA B;  2CWA A;  4OO1 G;  1SRU A;  1YJ9 A;  1PH7 A;  5AJ3 Q;  4YY3 L;  1X9N A;  4P75 A;  2KCT A;  3U58 A;  4HJ8 A;  1S3O A;  4JV5 Q;  3EER A;  1VQB A;  1LM0 A;  1MIU A;  3MXN B;  4C3J H;  2YYZ A;  4DR2 L;  4LNQ A;  4JI3 Q;  4BBS I;  1Y1W G;  1IL2 A;  1TWC I;  5FLM I;  3A5Z B;  1N36 Q;  3PO2 I;  1VQL A;  4A3M H;  2Y0S E;  1RLY A;  2IY5 B;  3STB D;  3GTO I;  4BY7 I;  1CKO A;  2NZO A;  3RZD H;  4A3L G;  1YHQ A;  2DE7 A;  3M3Y H;  4PG3 A;  1TWF H;  1TWG H;  1AE2 A;  2KBN A;  1VQE A;  3U4Z A;  4LFB Q;  2Q2H A;  4A3E I;  4DV7 Q;  1HR0 W;  5BR8 Q;  1PH1 A;  4A93 H;  2Y0S G;  4GN5 A;  1AH9 A;  1IBK L;  2JQO A;  2Q2T A;  1I5F A;  1HH2 P;  4APV A;  4QJF A;  4LF7 Q;  2UUA L;  1N33 Q;  2A8V A;  2K14 A;  1D7Q A;  2JA5 G;  1VCI A;  2E2H I;  1B8A A;  3FKI H;  4A3L I;  5IT9 c;  3KYH C;  3PSI A;  4JI2 Q;  1JB7 A;  2ID0 A;  3FP9 A;  2A1A A;  2BH2 A;  3PGZ A;  2CWP A;  1CSQ A;  3G6E A;  4A93 G;  2VW9 A;  3UDG A;  4FDB A;  2DUD A;  4ALP A;  2MQH A;  1JJG A;  4LF8 L;  1U0L A;  1XPR A;  1EIY B;  1VQN A;  1XNR L;  1KXL A;  2FXQ A;  3GTQ I;  1GKH A;  2JA5 I;  1ASZ A;  4LF9 L;  1PH6 A;  3K7A I;  1J6Q A;  2J6A A;  3CP0 A;  3FKI G;  4GKJ L;  3CCM A;  4MTN A;  3RZO I;  2XGT A;  2F52 A;  2B63 I;  1O7I A;  3VB9 A;  2VUM I;  1PH5 A;  1VQP A;  3S14 H;  3GTG H;  1G6P A;  4LF5 L;  3HOX G;  1WI5 A;  2EQS A;  2OCE A;  5IP9 H;  1QZG A;  1M90 C;  3J81 i;  2ZJR A;  3Q87 A;  3PO3 S;  3K81 C;  4X64 L;  3I7F A;  3HOZ H;  4B3M Q;  4B3S L;  3KOJ A;  1JJC B;  1HNW Q;  4GNX B;  2VQE Q;  1N32 L;  1X56 A;  1NMF A;  4K0K Q;  1X3Z A;  4NBB A;  2BA1 A;  3TRZ A;  2EXD A;  3F8T A;  3S2H H;  2I5M X;  4JC0 A;  4NBE A;  1G51 A;  5IE8 A;  2F4V L;  1L1O C;  3HOX I;  1LQL A;  2WAQ E;  2NVX I;  2JE6 I;  5IP9 G;  3HOY H;  5GAE C;  2E2J H;  2UXC Q;  4DUY Q;  4JG2 A;  4QL5 A;  3HOV G;  4X6A H;  1OXS C;  5JJL A;  4EX5 A;  5GQO A;  3W5O A;  2AWO A;  2ZTD A;  1Q81 C;  2HHH Q;  4NB9 A;  3S2D H;  2UU9 L;  1RL2 A;  2KHJ A;  3PUV A;  4JOI C;  1K3R A;  1IBM Q;  2WAQ G;  4MNO A;  4LF4 L;  3JAM i;  3DLL A;  3W1G A;  1XTD A;  4A3K H;  3CCE A;  2ES2 A;  4BA2 I;  4UP7 A;  2NVT H;  3GCF A;  4LFA Q;  4AQY L;  3VMG A;  1HNX L;  2BJO A;  5JJI A;  3HOV I;  3HOY G;  2HIX A;  4A3C H;  1XNQ Q;  2WP8 J;  5M3M H;  1SFO H;  3CCL A;  4IO9 A;  3S1M H;  1XMO L;  3U4V A;  1SMX A;  4GN4 B;  2CKZ B;  5IYC H;  4LW1 A;  4YCU A;  2PQA B;  4B3R L;  3RR5 A;  3GTM I;  4DR7 L;  2PI2 E;  1X3W A;  2VQF L;  3BJU A;  3M7N A;  4NOZ A;  2DGY A;  1N8R C;  4DK3 C;  2NVY I;  2AWN A;  3RLF A;  1HZA A;  4DR5 Q;  3AEV A;  1VQI A;  4A3C G;  4A3J H;  4DV2 L;  4GKK Q;  3A74 A;  4OWW B;  1VQ8 A;  4DV1 L;  3L0O A;  1YIJ A;  2OWO A;  1L1O A;  4DAY B;  2ZJQ A;  5IYC G;  3S1N H;  3S16 H;  2C35 B;  2ZM6 Q;  1HNZ L;  3GTP H;  4RMF A;  3H3V I;  2K5R A;  1X3E A;  4C3H H;  3M4Q A;  1YJN A;  1I50 I;  3RNU A;  3KLW A;  3PV0 A;  5C0X I;  2MO0 A;  1OXV A;  4NXM L;  4QTU A;  1TWA H;  4JOI A;  3J80 i;  3GDE A;  4NB8 A;  1EQQ A;  5LMN Q;  4HJ7 A;  1UEB A;  4GOP B;  4DV3 L;  1NE3 A;  2ZTE A;  2K4K A;  1IBL Q;  3TRE A;  4XIG S;  2NVQ I;  3UE1 A;  1PH2 A;  5AJ3 L;  4DV4 L;  2JA7 I;  4KLK A;  5IYB H;  4BBS H;  5IWA Q;  2ATW A;  4JI8 L;  2JNY A;  3CPF A;  2K50 A;  1Q7Y C;  5C4J I;  1TWC H;  2HIV A;  4R4O A;  5FLM H;  3PO2 H;  1WJJ A;  3PUX A;  3GTO H;  4BY7 H;  3AQQ A;  1Q1B A;  3ERS X;  1VQ9 A;  3M4O I;  3CCS A;  1YZ6 A;  1JJ2 A;  2IHF A;  5IYD G;  3UDF A;  2UUC L;  4DV0 Q;  4XTC S;  1CKN A;  4A3E H;  5M5X H;  3M85 A;  3I4O A;  4X66 Q;  5IYB G;  1YJW A;  1H95 A;  1HR0 Q;  5J3B A;  3GTM S;  4Y52 I;  4L5Q A;  3CCR A;  4C3I H;  1OXU A;  1OTC A;  4JI5 L;  4B3T Q;  1Q86 C;  2Q2I A;  3S1R I;  1WYD A;  1I3Q I;  4Y7N I;  4KHP Q;  2E2H H;  5IP7 I;  4BY7 G;  4O2D A;  4A3L H;  2WB1 G;  1V1Q A;  2BA0 A;  2GVB A;  5ELO A;  2K5V A;  4A3G G;  4IPC A;  4QGU A;  4A3E G;  3ER0 A;  4JYA L;  1IXR A;  2I5H A;  1GVP A;  1EYG A;  4OXP A;  3CMA A;  2UXD Q;  1PFT A;  2RBL A;  4DV5 L;  5M5Y H;  3OW2 A;  2UXB Q;  2D0O A;  3GTQ H;  4A3I G;  4X65 L;  2JA5 H;  3ICE A;  2E2I I;  3U50 C;  1SR3 A;  4DR3 L;  4OWT B;  1USP A;  3K7A H;  1YBY A;  4YHH Q;  1YNX A;  2HQL A;  3RZO H;  2RCN A;  1TXY A;  2B63 H;  4DR4 Q;  3I56 A;  2VUM H;  4UP8 A;  4A3G I;  1E3P A;  3RLN A;  1V43 A;  3G4S A;  3RN2 A;  2DE5 A;  5IY0 A;  2R6G A;  1WFQ A;  1XJV A;  4LFC L;  4JBJ A;  3B6Y A;  1X6O A;  3OTO Q;  4AYB E;  3E0E A;  4JCV E;  1JT8 A;  4JI4 Q;  4IOA A;  4OX9 L;  4A3I I;  5CM2 M;  3VDY A;  3D0F A;  1MKH A;  1NUI A;  3K8A A;  2AKL A;  4LWC A;  2CCZ A;  4IPD A;  1BBW A;  4YY3 Q;  4GS3 A;  3CME A;  1HJP A;  4LUV A;  3TS2 A;  1YVC A;  1EFW A;  2B63 G;  2CQO A;  2KCM A;  2VUM G;  4AYB G;  5C3E G;  3HOX H;  3GTJ I;  2LXK A;  2NVX H;  1KRT A;  2R93 I;  2GVA A;  3IRB A;  1N9W A;  4DUZ L;  1VQG A;  4NB3 A;  3VMH A;  1PH3 A;  3VMI A;  3K7U C;  5GAH C;  1UWV A;  1K8A C;  3KDF A;  4EQ5 A;  5JEA G;  5C4X G;  4JI6 L;  3T1Y L;  1PVO A;  4IOC A;  1L2F A;  4X62 Q;  4UP9 A;  3UDX A;  2DE6 A;  3S17 I;  1UE7 A;  3T1H L;  1DGS A;  1X55 A;  3I2Z A;  2K5N A;  1W2B A;  4DR1 Q;  4NBC A;  2CFM A;  5C3E I;  1Q46 A;  3ZJY C;  4JBK A;  1IZ6 A;  1LTL A;  4IFD G;  2LSS A;  3UE0 A;  1IBK Q;  3PUY A;  2KPI A;  3HOV H;  4L5S A;  1FVI A;  3I4M I;  3CD6 A;  5C4X I;  2UUA Q;  3UDI A;  4L5R C;  3GTK I;  2R7F A;  5GRO A;  4A75 A;  3NBH B;  4MZ9 A;  4A3D I;  3GTM H;  2K52 A;  3W1B A;  1NY4 A;  1J5E L;  1L1O B;  2A19 A;  2Z6K C;  2B3G A;  3TEH B;  4IFD I;  1VQA A;  1OXT A;  2NVY H;  5LMU L;  4A3B I;  1NMG A;  4NBA A;  5HGQ A;  1XNR Q;  1VS0 A;  2YV5 A;  1PH8 A;  1C7Y A;  1UE5 A;  3CCQ A;  4GLV B;  1VQM A;  5GAG C;  4GKJ Q;  3F1Z A;  2YU9 I;  3KFU A;  4QY7 A;  2N78 A;  4HIK A;  2Z0S A;  4JI0 L;  2R7Z I;  3H3V H;  2XTI A;  4LF5 Q;  4BA1 I;  1WCM I;  1QVG A;  3HOU G;  1I50 H;  4QTT A;  1MJE A;  4P72 A;  2VZA A;  3I07 A;  2K75 A;  3L2P A;  1XMQ Q;  1BVS A;  4NXN L;  4A3F G;  4X64 Q;  1EWI A;  1P16 A;  4PMW A;  4HIM A;  3ULJ A;  3G48 A;  4OWX B;  1N32 Q;  1NJI C;  3F2D A;  4NBG A;  2NVQ H;  1Y14 B;  2E5L L;  2JA7 H;  2F4V Q;  3KF6 A;  4JI7 Q;  1VQ4 A;  3LGJ A;  3HOU I;  4DV6 L;  2MNA A;  4IPH A;  3HOW G;  1CKN B;  5HY6 A;  1ASY A;  5C4J H;  1CKM A;  1P8L A;  1Q1E A;  4DK6 C;  5C0X G;  4A3F I;  1E1T A;  4R4C A;  1PA6 A;  3AYH B;  1UE1 A;  2AMC B;  2F4O A;  4YWL A;  2UU9 Q;  3M4O H;  1X65 A;  4GNX A;  1EOV A;  2QA4 A;  1TWH I;  3AFP A;  4P74 A;  3CCV A;  3RN5 A;  2Z6K A;  4LF4 Q;  2UUB L;  1QYP A; 
#chains in the Genus database with same CATH topology
 4JI1 L;  4IUV A;  2O5J C;  2NBF A;  3D31 A;  1JE4 A;  1N34 L;  1ICW A;  2Q8I B;  4AQY Q;  5IT9 b;  2JA7 G;  4HID A;  5T1I A;  4LUZ A;  1JIC A;  4MH4 A;  3OW7 A;  4Y52 H;  2EYL A;  3HOW I;  5IT9 f;  1QNK A;  4FXK C;  1QCB D;  4RAU C;  1VQD A;  1SND A;  1VQJ A;  3MXG A;  5COY A;  5M9O A;  1TU2 B;  3M9B A;  3HKZ B;  1SJE D;  4OGQ C;  2E2I B;  1GD7 A;  2Q2U A;  1FJG L;  1ML8 A;  3A0J A;  2TSS A;  4X66 L;  2WB1 B;  4HJA A;  4YCV A;  2F0S A;  1XX8 A;  2PMZ A;  3S1R H;  2IW3 A;  1S72 A;  4LF6 Q;  3K0X A;  4BXX G;  5KYL A;  5FK9 C;  5KEE A;  1C0A A;  1I3Q H;  4Y7N H;  1Q82 C;  2PI2 A;  1XMO Q;  5IP7 H;  3I4L A;  2PZU A;  2HD3 A;  2IWH A;  2JA8 G;  4A3G B;  3OHX C;  4KKU A;  2VXW A;  2XWB B;  1D8L A;  5M3F B;  1EY8 A;  1Y8P B;  1VQ5 A;  2K28 A;  5IYD H;  1HA5 A;  2WKC A;  3PIP A;  1NP6 A;  1D6E C;  4J6H A;  3HFZ B;  4WJ3 M;  4XT1 B;  1KQS Z;  1GUS A;  2F0D A;  2L1B A;  2QW7 A;  4DXF A;  3S15 I;  3OIP A;  1WD0 A;  1SNP A;  3BZC A;  3V2T A;  5I2Y A;  4IJH A;  4WRD A;  1I94 Q;  4DR7 Q;  1LTG D;  1PYB A;  1E2W A;  3NEM A;  2PNR C;  4JV5 L;  3VR2 A;  2OTL A;  3G6E 1;  3TN2 A;  2H5X A;  4F88 A;  1PYS B;  4RKB A;  3I91 A;  3J7Z C;  3DEO A;  4MN3 A;  1B9N A;  5E4W C;  4XQJ A;  2EIF A;  3CC4 A;  1MJC A;  4A3I B;  1DM0 B;  4TSS A;  2D2C C;  1Q86 1;  1X3G A;  4JI3 L;  5M5W B;  4HMI A;  3S1Q I;  4MRI A;  4G4K A;  1U5K A;  5FLX E;  1IHZ A;  3BDO A;  1VQN 1;  4HSV A;  4BY1 I;  2Z8L A;  2IL8 A;  1WTQ A;  4BXX I;  4DNT B;  3K59 A;  1UAP A;  4NFR A;  4MXU A;  3I4N G;  4DV2 Q;  1PH4 A;  3PUZ A;  2E2I H;  3GKQ A;  3EIV A;  2F1M A;  2C5C A;  3ND8 A;  2RIQ A;  2UXD L;  1LAC A;  2JA8 I;  1KAA A;  4DV1 Q;  5IP7 G;  2M9V A;  3IFD A;  1WW9 A;  1N36 L;  3GD7 A;  4KTA A;  1E1O A;  1EUJ A;  2FHT A;  4IQZ A;  3CCM 1;  1A0I A;  3EN2 A;  4DN4 M;  4A3G H;  3HKZ E;  3JC6 6;  5LL6 f;  1EY7 A;  5M3F H;  2PO4 A;  4GLA C;  3TP5 A;  1P9N A;  2HDL A;  2WB1 E;  3NTK A;  4FXG C;  2R93 B;  3CQZ I;  1VQP 1;  4BBR G;  4WJ4 A;  2V8J A;  3NEL A;  3MTS A;  1PH9 A;  2B2Y A;  1LV9 A;  1SJH D;  3EQL C;  1FYC A;  4DFA A;  2AQ3 B;  3A7L A;  5DM6 3;  1RO2 A;  1KNE A;  1KL9 A;  4LFB L;  2Q4Z A;  1ILQ A;  4QCL A;  1STY A;  1VQ7 Z;  1WTR A;  2NN6 G;  5ELB A;  3MAQ A;  4DV7 L;  4YWK A;  5KIX A;  5CV6 A;  1VQ6 Z;  1E2Z A;  1BCP C;  4A3I H;  4NXM Q;  5BR8 L;  2VF1 A;  2B2W A;  4DR6 Q;  5ELN A;  3I4N I;  2B8G A;  1QUQ A;  1YI2 Z;  2VNU D;  1E7Z A;  2B2V C;  2WII B;  5M5W H;  3CCU A;  2I5L X;  3S17 B;  4J15 A;  1ZB8 A;  3HKZ G;  3EBE A;  3KUP A;  4IJL A;  1SLJ A;  4R1J A;  3MZK B;  5FOB B;  1RTO A;  3J81 c;  2R7D A;  5DEH A;  4ZKB B;  3V05 A;  2IX3 A;  4LF7 L;  1RQF A;  3NEN A;  4O42 A;  5C3E B;  1ILP A;  3H3V J;  2JA9 A;  3STB C;  4JI4 L;  2F0O A;  1F77 A;  1Q16 A;  4FNF A;  1V1P A;  3CCJ Z;  3KDF B;  1I6H I;  1B70 B;  2O2L D;  3H09 A;  4DAY A;  4YWM A;  1N33 L;  5C44 I;  4RA8 A;  1HZ9 A;  2WIN B;  3VR6 A;  1GHJ A;  3U9S A;  3Q24 A;  1LTS D;  5M3F G;  4BBR I;  4R4T A;  3G71 A;  1VQH A;  4DV4 Q;  3MEH A;  2F4M A;  1SSO A;  3BZK A;  3GQB A;  1CT1 D;  1QVF A;  5C0X J;  5E1F A;  5EAY A;  3GTJ H;  1R4Q B;  2R92 I;  1K0R A;  4HSP A;  5I6W A;  4JI8 Q;  4JI2 L;  2R93 H;  3SR1 A;  1IYV A;  4HED A;  3LUS A;  5T67 A;  2JA6 G;  5A35 A;  5HUR A;  1C9O A;  4C2M B;  3I4M B;  1FDI A;  3BG1 B;  1Z6H A;  1V1O A;  1RIP A;  2NN6 I;  1TFI A;  1Y1V I;  2KJX A;  4G7O C;  5C4X B;  4WOR A;  5C3W A;  3E6Z X;  2P28 A;  3H0G G;  3J81 L;  5CV4 A;  2EZV A;  1R9T I;  4DK1 A;  4DAV A;  3ULP A;  1TY2 A;  2JYO A;  3PIP 3;  2K33 A;  3GTK B;  3PO3 I;  1YIT Z;  5A2Q L;  1BR9 A;  4I7Z C;  3WDN A;  3DMU A;  1PHJ A;  1VQK Z;  3S17 H;  4A3D B;  2ZJP A;  4GOP A;  3PF4 A;  1KRS A;  3CPW Z;  1SYB A;  2EYJ A;  3KBG A;  3QWN A;  2F0M A;  4JBW A;  3KIF A;  4OO1 I;  4DGZ A;  3K5M A;  2EY6 A;  3QJY A;  2UUC Q;  5C3E H;  2BDN A;  4DNI A;  3M4P A;  3CCE 1;  3GTL I;  1JWM D;  3MC0 B;  3RLO A;  3TBI B;  1EQR A;  4X62 L;  1AP0 A;  1BF4 A;  4A3B B;  4RHR A;  2BCO A;  2QGQ A;  1M1K C;  2IX0 A;  2CH4 A;  1G2T A;  4E2Y A;  2JA6 I;  3Q8D A;  1WVL A;  3R3O A;  2R93 G;  1UEA B;  3JAM c;  2OTJ A;  4JK1 C;  2L0C A;  1SIW A;  2MFI A;  3ULL A;  2E76 C;  4DR1 L;  4XX2 A;  1K8A 1;  1NR2 A;  5IT9 E;  4QB4 A;  1TR5 A;  3H0G I;  2F3I A;  3TP8 A;  4JI5 Q;  4GN3 B;  4PZ7 A;  2KA7 A;  4C2M H;  3I4M H;  1O78 A;  2KEN A;  1K83 I;  1CZG A;  2K5D A;  2DN8 A;  2V8I A;  5JEA H;  3ND9 A;  1Y1W I;  5C4X H;  1R4P B;  2EE1 A;  3CCL 1;  3I55 Z;  1RO4 A;  3R93 A;  3MHB A;  3K5L A;  1PFS A;  4IPG A;  1NSN S;  1JMC A;  4R4Q A;  2YU9 B;  1KHI A;  1GO3 E;  3IAY A;  4QQB X;  4UY8 C;  1EY6 A;  1EY9 A;  3GTK H;  3CRK C;  3L7Z C;  4HTH A;  3KF8 B;  2R7Z B;  4P71 A;  2I46 A;  2IJ0 A;  2O4X A;  2I0Q A;  4B3M L;  4A3D H;  4A3M G;  2SNS A;  2GN5 A;  1WCM B;  2JSO A;  5KNB A;  3SGI A;  4DR2 Q;  1HNW L;  4QIW B;  2VQE L;  1QWY A;  2K01 A;  3RUZ A;  2Y0S A;  2RHS B;  3TP6 A;  1A62 A;  4AIM A;  4K0K L;  1EY4 A;  2J4X A;  4JYA Q;  1M90 1;  2QEX A;  2ASB A;  3FHW A;  1YEZ A;  4IFD H;  1XPO A;  3GTG B;  5FJ8 H;  1S40 A;  3PUW A;  1GUN A;  4A3B H;  1PTO B;  2RF4 A;  4DV5 Q;  2XN9 C;  1K73 C;  3QG1 A;  1F2L A;  1YHB A;  2L15 A;  1YJ9 Z;  5EKL A;  3P75 A;  4CJ2 C;  1X54 A;  4U68 A;  4MD7 A;  5EPK A;  1XPU A;  3PCO B;  3I4M G;  1V9P A;  4KHZ A;  4X65 Q;  3R2T A;  5EPL A;  1L0X B;  1HHV A;  3CC7 A;  1DOK A;  1OXX K;  2D62 A;  5KGU A;  2C9O A;  2F0U A;  4DR3 Q;  4GZY C;  3OIQ A;  1A63 A;  2UXC L;  1VQ8 1;  4DUY L;  1F2Y A;  1IYJ B;  1QZH A;  2IHE A;  2WAC A;  2YTV A;  5T6B A;  5DNF A;  1YIJ 1;  1K8O A;  1JJ2 Y;  3I3C A;  1PTO F;  1BO0 A;  2HCI A;  3D4W A;  2YU9 H;  4A3M I;  5J1Z A;  1VQO A;  1GM5 A;  3ESW A;  4K14 A;  1CFM A;  1VMP A;  2NZH A;  1B3A A;  1DOL A;  1F9P A;  4YIJ A;  2HHH L;  2CQA A;  3MXN A;  1UE6 A;  3HOU B;  4A3D G;  1KRL A;  2R7Z H;  1A6X A;  3RZD I;  5C4H A;  4NBD A;  1LTR D;  3L9A X;  1IBM L;  5EBD A;  1KDB A;  1WCM H;  4R4I A;  3KJP A;  5BN4 A;  3M3Y I;  4LFC Q;  2GTH A;  1A8V A;  1N2F A;  1BKB A;  1YNJ C;  1WD1 A;  1TWF I;  1TWG I;  1VQL Z;  4PZ6 A;  4A3F B;  3CXC A;  1YJN 1;  1SAP A;  2VS1 A;  5FJ8 G;  5GAD C;  3NDI A;  4A3B G;  3KF6 B;  5JPN C;  4LFA L;  2JJQ A;  2QRE B;  3E9I A;  2AHO B;  1PTO H;  1WZN A;  3TDH B;  1TS4 A;  5I6Y A;  4OX9 Q;  1G6Z A;  1KC8 C;  1YHQ Z;  4A93 I;  4QIW E;  2OQK A;  1Y1V S;  1DOM A;  3J81 j;  4POG A;  1TWH B;  1PFB A;  2OOY B;  2NYZ D;  4B9X A;  2EYO A;  2ALY B;  3SDZ A;  2RT9 A;  3GV6 A;  1QOH A;  4C56 C;  4QUF A;  1XNQ L;  1XMQ L;  3A5U A;  2PNH A;  2V4D A;  1SE3 A;  3J80 c;  4ZUJ A;  1DL6 A;  1EIG A;  2F0N A;  2RHB A;  4OON A;  4L5T A;  1VQF A;  4GNX C;  1BNZ A;  1QXF A;  3C1F A;  2R7Z G;  2JR6 A;  1M90 2;  1CHQ D;  4R9W A;  5C5L A;  3F2C A;  4NBF A;  3BU2 A;  3FKI I;  3K80 C;  3MXU A;  3N52 A;  4PZ8 A;  2KCN A;  3HOU H;  1WCM G;  2PK7 A;  3P20 A;  5KRU A;  1XXG A;  2ZTC A;  4ID6 A;  2E8G A;  2V1C C;  3GV3 A;  2IPK D;  1K9M C;  3VYR A;  1SE8 A;  4DUZ Q;  1HZC A;  5ELE A;  3C46 A;  2WV6 D;  1FD7 D;  3CC2 A;  1EWC A;  4LF8 Q;  4DKA C;  3OW2 Y;  1PMR A;  2MO1 A;  4A3F H;  3MZL B;  4JI7 L;  4K5X A;  3X3M A;  3J7A F;  1VF5 C;  4HJ9 A;  4K8J A;  2L11 A;  4IAL A;  3BZD B;  1CA5 A;  1FDO A;  3DM3 A;  4ME3 A;  4MIU A;  4LF9 Q;  2NAP A;  4JI6 Q;  3T1Y Q;  1NJI 1;  2E74 C;  1CSP A;  1D1I A;  3HRZ C;  1CZW A;  1SE2 A;  3IFU A;  2XIW A;  4POF A;  4DR5 L;  1VQ9 1;  3S15 B;  1TWH H;  1Z7T A;  3CCS 1;  2LIY A;  1LO5 D;  1Q8K A;  3G6E Z;  1YNN D;  3BYT B;  4PMB A;  5CBE E;  3T1H Q;  1PV4 A;  1TVX A;  2BE5 C;  2JXM B;  2Q8T A;  3HOZ G;  4GKK L;  1VQC A;  1PZI D;  5L37 A;  4RGN A;  1N8R 1;  1STN A;  1G29 1;  4KV6 A;  3TME A;  1KD1 C;  4DAM A;  1WTP A;  1TKW B;  1E24 A;  3J81 f;  4PQX A;  5ELF A;  2Z4H A;  1VQN Z;  1BDO A;  2DY8 A;  1YJW 1;  3HOW H;  1E22 A;  2RSO A;  3T53 B;  3S1Q B;  2ZXO A;  2EYM A;  1W3S A;  3KJO A;  5A2Q f;  4BY1 B;  1K8M A;  3CCR 1;  2YTX A;  5C3X A;  3C3L A;  2KHI A;  1Q81 2;  2ZM6 L;  3S14 I;  2N88 A;  3GTG I;  1S5E D;  3K5N A;  2EY1 A;  4E2X A;  2F0V A;  2JA8 B;  2QKD A;  5AN9 F;  1B53 A;  3D4R A;  1KQS A;  5K36 G;  3CCM Z;  3E9H A;  2AKW B;  4B3S Q;  1IL8 A;  1Q8I A;  1X32 A;  3HP3 A;  1W6K A;  2K5H A;  5CV5 A;  5IP9 I;  1SNC A;  2WAQ A;  2A69 D;  2LS0 1;  3FQM A;  2LFU A;  3CW2 C;  1VQP Z;  2A5H A;  2JIM A;  1BUV T;  4N8F A;  1B7Y B;  2VPX A;  3TZU A;  1JOQ A;  5J22 A;  3CQZ B;  1Z9F A;  4LF6 L;  4LJZ C;  5D1O A;  1L0Y B;  1W6J A;  3PF5 A;  3HOZ I;  4RG1 A;  5LMN L;  3S15 H;  1SRO A;  3F3P C;  3CKI B;  2D0P A;  2JEA I;  3D9X A;  2A6H C;  3MEF A;  4KI0 A;  1D5Z C;  5IGC A;  1J5E Q;  1FGU A;  2F03 A;  2N8N A;  2M2L A;  3DXJ C;  4H02 A;  2V3V A;  1IBL L;  1WTH A;  5JEA J;  5LMU Q;  4RGO S;  1PRT D;  3CMA 1;  3S2H I;  3I4N B;  1LT3 D;  2PMZ E;  4A3K G;  3FMC A;  3CAM A;  2B2Y C;  3S1Q H;  1Q82 1;  1I94 L;  1EYA A;  1VLA A;  5IWA L;  4BY1 H;  4BXX H;  1GUT A;  3NH4 A;  5E7N A;  1EIH A;  1LUZ A;  1EIF A;  4XDX A;  2JA8 H;  1I6H B;  3FDT A;  1KAW A;  4GLX A;  2QRD B;  2HQE A;  3HOY I;  2E2J I;  2B2W C;  3NP8 A;  2FJ2 A;  3AMU A;  2JS4 A;  5C44 B;  2QIL A;  1Z01 A;  4PMC A;  4DPG A;  4FF2 A;  1T9H A;  4RVG A;  4ME5 A;  4X6A I;  1QUQ B;  4BBR B;  2N49 A;  2B29 A;  4IFD J;  4HN7 A;  3I56 1;  3NBH A;  5M3M G;  1N8R 2;  2R92 B;  2OXP A;  1YUA A;  1L0W A;  1VQ7 A;  4JI0 Q;  1W2B Y;  3G4S 1;  3CQZ H;  4ULL A;  3S2D I;  4HJ5 A;  1HNX Q;  1VQ6 A;  1Z47 A;  1SN8 A;  5JVG 3;  5EBC A;  2A73 B;  4N9T A;  1Q7Y 1;  1ZH1 A;  3D6C A;  1YI2 A;  1V1P B;  1Y1V B;  4YCW A;  5H1S E;  4UAI A;  1HQR D;  1R9T B;  4A3K I;  4DV0 L;  1CM9 A;  3NTH A;  2CW0 C;  2NVT I;  3D2L A;  1HFN A;  1CK1 A;  2E2D C;  4NPS A;  3PO3 B;  1RNI A;  4RGT A;  4LAA A;  3F3F C;  3K0Y A;  4X3T A;  3CCJ A;  3I4N H;  1HR0 L;  4NXN Q;  2WFW A;  2F0K A;  4L6T B;  4BY1 G;  2YTY A;  4OL7 A;  3VYU A;  2SEB D;  2IX1 A;  2JEB I;  1KIX A;  3CCE Z;  2K04 A;  1JE5 A;  5DM7 3;  1AEX A;  3K58 A;  4A3C I;  4OEM B;  4B3T L;  4A4I A;  3GTL B;  3HKS A;  5DLQ E;  4B9W A;  3CME 1;  1I6H H;  4DR6 L;  2XSC A;  1Z02 A;  4B3R Q;  2G2K A;  5LL6 S;  1SFO I;  5C44 H;  3GO5 A;  2HCC A;  4KD3 A;  3PIO A;  4A3J G;  3S1M I;  1WOC A;  3IX0 A;  2OQ0 A;  4BBR H;  4KHP L;  1USP B;  2E5L Q;  1HZB A;  4GOP C;  2HF1 A;  2JA6 B;  3TQY A;  3R2I A;  2P3Y A;  3F2B A;  3G7L A;  2VQF Q;  1KDC A;  4CKB A;  2K03 A;  4JBM A;  1Q3L A;  3EFX D;  2R92 H;  4DV6 Q;  3P5J B;  1RCV D;  4ZCK A;  3H0G B;  3NWT A;  5M5X B;  2ZXR A;  2VY3 A;  4DU9 A;  1YIT A;  4M8A A;  4L8J A;  3CCL Z;  4O0A A;  1YHA A;  3T51 B;  2DNE A;  2HT1 A;  2NN6 H;  2VL6 A;  1K83 B;  4ODG A;  1Y1V H;  1Y1W B;  4TQU S;  1VQK A;  3K5O A;  3LWU A;  2RHQ B;  2PM9 A;  4P73 A;  1AE3 A;  3CF5 A;  1EYC A;  3CPW A;  1R9T H;  3OYY A;  2AYD A;  1I4H A;  2QLV B;  3A8I E;  4FP5 D;  2KUM A;  1NBW A;  3NPP A;  3PO3 H;  1MD2 D;  3RD4 A;  3NUC A;  2JK8 A;  4HIO A;  1B9M A;  1SYD A;  1U4L A;  2JIR A;  4Q5V A;  4NMZ A;  4AH6 A;  2CHB D;  3A54 A;  1K8G A;  3H15 A;  2UXB L;  4CDC C;  3M4Y A;  1IKM A;  2B2U A;  4OO1 H;  4A76 A;  4A3J I;  3QWU A;  1QVC A;  2PQA A;  2UUB Q;  4KD4 A;  1FL0 A;  2LXJ A;  4JI1 Q;  3J7A 5;  5C44 G;  3FRP B;  1BBU A;  3GTL H;  3AFQ A;  1HNZ Q;  1N34 Q;  4NH1 C;  1X3F A;  1Q7Y 2;  2HUG A;  5ISR A;  5T1G A;  3VA5 A;  4HCE A;  2EPB A;  1HXY D;  4C3J B;  4YHH L;  5C4Z A;  2ZXP A;  1Q12 A;  2V45 A;  4LUO A;  4K6L A;  1CUK A;  2JA6 H;  1JOO A;  1OO9 B;  2LMC B;  3WWV A;  2R92 G;  4DR4 L;  3I55 A;  3SHL A;  3D6W A;  1LYL A;  3S1N I;  5FLX c;  1QVG Y;  4UPA A;  3S16 I;  3N6R A;  2Y0S B;  4NBH A;  3S24 A;  3H0G H;  3CHB D;  3NQI A;  2J0T D;  3GTP I;  1Y1V G;  1VQ8 Z;  1ZB9 A;  1FJG Q;  1K83 H;  1YIJ Z;  4BBS G;  1MSG A;  1BCP B;  2BH8 A;  1Y1W H;  2IT1 A;  4KMU C;  3K6O A;  3CD6 1;  1NTG A;  2Q51 A;  3PO3 G;  3OTO L;  4XQN A;  4H7B A;  4A3M B;  4ZAI A;  2N3S A;  3QO2 A;  4DV3 Q;  3MWY W;  3TS0 A;  3QB3 A;  4DGL A;  1AW7 A;  1D2B A;  1ROD A;  1I4X A;  1I4G A;  1SYC A;  5FLM G;  1A15 A;  3G6J B;  5IGF A;  1TWA I;  5LMN W;  1T5E A;  3RZD B;  3PO2 G;  5JJK A;  4TVA B;  3KLS X;  2NTT A;  5E4X A;  1JR0 D;  2CWA A;  3D3R A;  2F0H A;  4OO1 G;  1YJN Z;  1V8Q A;  5K5P A;  3M3Y B;  1SRU A;  1M1K 1;  4C1N K;  1PZJ D;  3J7A 4;  1YJ9 A;  1GUO A;  1TWF B;  1TWG B;  4TRD A;  4YY3 L;  5FLX L;  5AJ3 Q;  1X9N A;  1PH7 A;  4P75 A;  1G8Z D;  2KCT A;  3U58 A;  1BCP F;  4HJ8 A;  1S3O A;  2OF1 A;  5EPJ A;  1HTL D;  3L3O C;  2KVM A;  2H4O A;  5IOD A;  4JV5 Q;  3EER A;  1AA6 A;  1EQT A;  1VQB A;  2KED A;  1EY0 A;  1LM0 A;  1Q86 2;  1MIU A;  3MXN B;  2EGT A;  4NP5 A;  1T5X D;  4C3J H;  4Z9C B;  1LTI D;  4CJ1 B;  4A93 B;  2YYZ A;  1GUG A;  4DR2 L;  4LNQ A;  4JI3 Q;  2RQX A;  1BQQ T;  4N9P A;  4BBS I;  2M6N A;  3FEW X;  3BG3 A;  3W3A A;  2WB1 A;  4ZKC B;  4DA2 A;  3J7Y W;  3LWE A;  1Y1W G;  3QOJ A;  2DNC A;  3EA6 A;  1IL2 A;  3PIO 3;  3CCQ 1;  4HMJ A;  1GXD C;  3E0J A;  4C3I G;  1TWC I;  3H94 A;  1F9Q A;  1K3B C;  5FLM I;  1VQM 1;  3A5Z B;  4OIJ A;  3IL8 A;  4RCO A;  1N36 Q;  3PO2 I;  4CBV A;  1ET6 A;  1VQL A;  4A3M H;  2Y0S E;  5IOC A;  3FKI B;  1QG7 A;  2EJM A;  2X69 A;  1RLY A;  1SYF A;  4IUR A;  2IY5 B;  1JOR A;  3STB D;  3GTO I;  4BY7 I;  1CKO A;  2NZO A;  3RZD H;  3RMH A;  2XNA C;  1D5M C;  1XYI A;  2EJF C;  3F2U A;  2F0J A;  4A3L G;  1YHQ A;  2DE7 A;  3M3Y H;  3S9W A;  4PG3 A;  4ZLT F;  1K73 1;  2D5D A;  2EYP A;  1TWF H;  4MD9 A;  1TWG H;  3P1H A;  1AE2 A;  2KBN A;  1F2M A;  3R8B A;  3X3N A;  2F0F A;  3W2D A;  1VQE A;  3U4Z A;  4LFB Q;  4J8Q A;  4C3J G;  3EVQ A;  2Q2H A;  4A3E I;  1ONL A;  4DV7 Q;  1HR0 W;  4B08 A;  1VQ9 Z;  3D4D A;  3CCS Z;  4KN4 C;  5BR8 Q;  1PH1 A;  4A93 H;  1JJ2 Z;  2RVL A;  1PZK D;  3T4A C;  1SYG A;  3WOF A;  4G57 A;  3BS1 A;  2IZ3 A;  2Y0S G;  3HS0 C;  4GN5 A;  1AH9 A;  4K2L A;  4NDX A;  1IBK L;  5I2X A;  1JB3 A;  1I4P A;  5EGT A;  2IZ4 A;  2JQO A;  2Q2T A;  1I5F A;  4OIK A;  1HH2 P;  4APV A;  1NCV A;  5KYI A;  4QJF A;  4LF7 Q;  2DY7 A;  4J1M A;  1HPC A;  1LTB D;  3SK5 A;  1QJO A;  1U4M A;  4NW2 A;  5G3L F;  1JCK B;  1YJW Z;  4EQP A;  1M1K 2;  4X3S A;  2UUA L;  1N33 Q;  2A8V A;  2KI7 B;  1SBB B;  3CCR Z;  2K14 A;  1D1K A;  1D7Q A;  2JA5 G;  1XWE A;  3JAM L;  1VCI A;  2E2H I;  4KY7 A;  4I65 A;  1B8A A;  4A3L I;  3FKI H;  2L4N A;  1S4Z A;  2ENB A;  2G5D A;  5IT9 c;  1VQ4 1;  3S14 B;  3Q23 A;  3KYH C;  1S5F D;  3PSI A;  4E33 A;  4JI2 Q;  1JB7 A;  2B2T A;  3MA2 B;  2ID0 A;  2GU2 A;  3FP9 A;  3FPP A;  2PPB C;  1I6V C;  2A1A A;  4IUQ A;  2BH2 A;  1SMY C;  3E5S A;  3PGZ A;  2CWP A;  2XRQ D;  1CSQ A;  3OPO A;  4E31 A;  3G6E A;  2A68 C;  2Z4I A;  2EY2 A;  4A93 G;  5CGK A;  2VW9 A;  2EXZ A;  3UDG A;  3DWA A;  4F8M A;  5BN3 A;  4FDB A;  1STG A;  2DUD A;  4ALP A;  2R6M A;  2MQH A;  1CI3 M;  3HOZ B;  1JJG A;  4LF8 L;  1U0L A;  1S5D D;  1XPR A;  1EIY B;  1VQN A;  1WTX A;  1NR4 A;  1XNR L;  1KXL A;  3OMC A;  2BOS A;  1GJX A;  4AYB A;  2QA4 1;  2FXQ A;  5LL6 X;  3GTQ I;  1A2U A;  4WFN 3;  1LTT D;  3CCV 1;  1Y8N B;  1GUW A;  1GKH A;  2HDM A;  2JA5 I;  1ASZ A;  3CMA Z;  2FIN B;  4LF9 L;  2TMP A;  1PH6 A;  3OW2 Z;  1H9M A;  2JN4 A;  3FVQ A;  4KKT A;  1DON A;  3K7A I;  1J6Q A;  2J6A A;  3CP0 A;  1K28 A;  4ILW A;  1PYW D;  1K9M 1;  3FKI G;  3S2H B;  4GKJ L;  1ENA A;  3CCM A;  4MTN A;  5D1O B;  3RZO I;  2XGT A;  2F52 A;  2K32 A;  1G91 A;  4Q0F A;  2JMO A;  2B63 I;  1O7I A;  3VB9 A;  1K8A 2;  1DYQ A;  3OWE B;  3KLR A;  2VUM I;  2FMC A;  2XWJ B;  4QMG A;  1PH5 A;  1VQP A;  4KKS A;  3S14 H;  3GTG H;  1PTO D;  3D8G A;  1IW7 D;  1G6P A;  3M7G A;  2PZT A;  4KN7 C;  4XYO A;  4ZQ3 A;  4LF5 L;  2JIO A;  3HOX G;  1WI5 A;  2EQS A;  2OCE A;  3HOY B;  4RGM A;  2E2J B;  1LAB A;  1LT5 D;  1S72 1;  3H6M A;  4CDE C;  5IP9 H;  3I56 Z;  4OHJ A;  1QZG A;  1M90 C;  2I3C A;  3J81 i;  3G4S Z;  2ZJR A;  3Q87 A;  3LNN A;  3PO3 S;  3K81 C;  3SEB A;  2F3W A;  2M00 A;  4JPB W;  1PXU A;  2A6E C;  1VQ5 1;  3S2D B;  1ENC A;  3ERO A;  2AQ1 B;  4X64 L;  2BDO A;  3I7F A;  4CDF C;  3HOZ H;  4B3M Q;  2JIQ A;  4IN3 A;  4B3S L;  2XRS D;  3KOJ A;  3NSW A;  3NK9 A;  4PV1 C;  2R3Z A;  1JJC B;  1HNW Q;  4GNX B;  1SNM A;  2VQE Q;  4IUP A;  1N32 L;  1CQF A;  1X56 A;  1YNN C;  1NMF A;  2QDL A;  3LX0 A;  4K0K Q;  4A3K B;  1X3Z A;  4NBB A;  2FFK B;  2OZK A;  2BA1 A;  3TRZ A;  1QVF Y;  2NVT B;  3H3V C;  4JW0 A;  2E75 C;  2OTL 1;  2EXD A;  3F8T A;  3S2H H;  2I5M X;  3CC4 1;  4JC0 A;  5EKI A;  4NBE A;  1G51 A;  1YNJ D;  1B3Q A;  5IE8 A;  2F4V L;  1L1O C;  1H9J A;  4FF3 A;  3HOX I;  2JIP A;  4CGY B;  1LQL A;  2WAQ E;  5K36 H;  1C4Q A;  5D3I B;  3CME Z;  4G7Z C;  2NVX I;  1RJT A;  2CVR A;  2JE6 I;  3BYY B;  5E3F A;  4PNY A;  2RKS A;  5I4D A;  3J80 L;  2PYK A;  3QR8 A;  5IP9 G;  3HOY H;  5GAE C;  5D1P A;  5FLX f;  3BG0 B;  1JWU D;  2LKV A;  5M3M B;  1SFO B;  2E2J H;  2UXC Q;  4DUY Q;  4JG2 A;  3S1M B;  4QL5 A;  3HOV G;  2PMZ B;  3A56 A;  4X6A H;  1AFP A;  1OXS C;  2QKI C;  3BDC A;  3VTN A;  5JJL A;  4EX5 A;  5GQO A;  3W5O A;  2AWO A;  1MSH A;  2ZTD A;  1Q81 C;  2HHH Q;  4NB9 A;  3J81 b;  3S2D H;  2UU9 L;  2RPR A;  1RL2 A;  1ICF B;  2KHJ A;  3PUV A;  5IGE A;  4E2Z A;  4JOI C;  1K3R A;  1IBM Q;  3T13 A;  1LT4 D;  1O7Z A;  5A2Q b;  2WAQ G;  4MNO A;  1IKL A;  2F0W A;  3OOC A;  3BDL A;  2H1E A;  1EWH A;  4LF4 L;  3JAM i;  3DLL A;  2X6G A;  3W1G A;  1XTD A;  4KY5 A;  4A3K H;  3CCE A;  2ES2 A;  4TNU A;  1H9S A;  2F0I A;  5ELC A;  3E3X A;  2QCP X;  4UP7 A;  2NVT H;  5CR3 A;  4BA2 I;  3RZO B;  1JWH C;  3GCF A;  4M1U B;  4LFA Q;  2OT2 A;  4K2K A;  4XYQ A;  4AQY L;  3VMG A;  1HNX L;  3IFT A;  2ZT9 C;  3MXP A;  2BJO A;  4HGY A;  1PRT C;  3DUZ A;  4KY6 A;  2KEE A;  5JJI A;  1DCZ A;  5CV8 A;  2F3V A;  1SDF A;  3CCU 1;  3MFG A;  4H0L C;  4MD8 A;  1W2B Z;  4HCS A;  4ZK9 B;  1C48 A;  4A3J B;  3HOV I;  3HOY G;  2HIX A;  4A3C H;  4RHS A;  1XNQ Q;  1WTO A;  2IV2 X;  2WP8 J;  3TP7 A;  4RH6 A;  5M3M H;  1SFO H;  3CCL A;  4IO9 A;  3DWQ A;  3S1M H;  1XMO L;  3CRL C;  5EQ0 A;  3U4V A;  4QUC A;  4RFB A;  2W03 A;  4HH4 A;  5KNC A;  3G71 1;  3S1N B;  4XQQ A;  1PDQ A;  3S16 B;  1SMX A;  4GN4 B;  2BE5 D;  2B2U C;  1ET9 A;  2CKZ B;  2EDG A;  4QF4 A;  1M4V A;  5IYC H;  2G9H D;  1CHP D;  4LW1 A;  3GTP B;  4YCU A;  2PQA B;  1SEB D;  4B3R L;  3CD6 Z;  3RR5 A;  2PW5 A;  5JVH 3;  3I72 A;  4C3H B;  5CBA E;  1QIL A;  3GTM I;  5CV7 A;  1G2S A;  4DR7 L;  2PI2 E;  1X3W A;  2VQF L;  4XT3 B;  3BJU A;  2QR1 B;  3M7N A;  3IKJ A;  1QNU A;  5IIF A;  1EOT A;  4NOZ A;  2DGY A;  1PFM A;  2MJ8 A;  3JAM b;  3ONA B;  1N8R C;  1NJI 2;  4DK3 C;  1ZEQ X;  2NVY I;  2KQ3 A;  5LHY 1;  5D14 A;  3NFZ A;  1TWA B;  3JAM f;  2PCF B;  2AWN A;  3RLF A;  4C1N I;  1HZA A;  4XXE A;  3J7A V;  4DR5 Q;  3AEV A;  1I3Q B;  1DD2 A;  1VQI A;  2RSN A;  2NZ1 D;  4A3C G;  1MHW C;  1PFN A;  1ZYR D;  2GTI A;  4CKE A;  4A3J H;  1GOZ A;  2VPZ A;  2QF7 A;  4DV2 L;  3O13 A;  3MZ5 A;  2O4H A;  4GKK Q;  3A74 A;  4OWW B;  2SDF A;  1VQ8 A;  2ZAE B;  4DV1 L;  1C8C A;  3L0O A;  1YIJ A;  2OWO A;  3NDJ A;  1A3U A;  1L1O A;  3QOL A;  4DAY B;  4F87 A;  2ZJQ A;  3I70 A;  5IYC G;  3C1E A;  3S1N H;  3OMG A;  2QRC B;  4BBS B;  1F2Z A;  3S16 H;  2B8F A;  3MON A;  2OTJ 1;  2NWG A;  2C35 B;  1B4O A;  3CXC Y;  2ZM6 Q;  1HNZ L;  3CCQ Z;  3GTP H;  5JJZ A;  4RMF A;  3H3V I;  3VR3 A;  2K5R A;  1X3E A;  1VQM Z;  4C3H H;  2RBM A;  3M4Q A;  1KAB A;  4FXD A;  1TWC B;  1YJN A;  1I50 I;  4NKL A;  3T56 B;  3OSO A;  3PO2 B;  1JC7 A;  2MPM A;  3RNU A;  3KLW A;  5TSS A;  3PV0 A;  5C0X I;  2MO0 A;  3VR5 A;  1OXV A;  1ENF A;  3GTO B;  4BY7 B;  4NXM L;  4QTU A;  1TWA H;  4JOI A;  3J80 i;  2I07 B;  3GDE A;  2GA4 B;  3AU7 A;  1WTW A;  3HEJ A;  1QVG Z;  4NB8 A;  1EQQ A;  5LMN Q;  3KIH A;  3NXW A;  4HJ7 A;  1UEB A;  2DJG C;  4IUN A;  1MI2 A;  4E6I A;  1RD9 D;  1EL0 A;  2PQE A;  4GOP B;  2E9H A;  4O1N A;  4DV3 L;  1NE3 A;  2ZTE A;  3BVG A;  2K4K A;  1HTP A;  3C2P A;  4FF1 A;  1JWS D;  1B1Z A;  4A3E B;  1STE A;  2QEX 1;  3PMF A;  1IBL Q;  2B39 A;  3I8Z A;  3TRE A;  1Y69 U;  4XIG S;  2RDG A;  1Q82 2;  2NVQ I;  2O5I C;  3UE1 A;  1PH2 A;  1KLU D;  4ZUI A;  5AJ3 L;  4DV4 L;  2JA7 I;  2K5Q A;  2LY7 A;  4KLK A;  5IYB H;  4BBS H;  3DHQ A;  2K3R A;  4EVO A;  3EJI A;  5IWA Q;  2ATW A;  1BOS A;  4C3I B;  3EED A;  2CW0 D;  4C3H G;  5T64 A;  4JI8 L;  2JNY A;  2F0L A;  4ZYS A;  3CPF A;  1E2V A;  2K50 A;  1HCZ A;  3VA7 A;  3CC7 1;  2EOT A;  1Q7Y C;  1TS3 A;  5C4J I;  1TWC H;  2HIV A;  4L63 B;  2XVS A;  3VYT A;  1I4R A;  4FO2 A;  4R4O A;  5FLM H;  1Y8C A;  1ESR A;  2K5W A;  4IZ8 A;  4E30 A;  1STA A;  3PO2 H;  3Q22 A;  3DWP A;  2E2H B;  1VQ4 Z;  1WJJ A;  2JUB A;  2AQ2 B;  3PUX A;  1CTM A;  1VQO 1;  1JOK A;  1SNO A;  4RVD A;  5COR A;  2FMM A;  4X3U A;  3GTO H;  4BY7 H;  3Q0A A;  3AQQ A;  1Q1B A;  1TS2 A;  1EEF D;  3ERS X;  1VQ9 A;  3M4O I;  4WJW A;  3CCS A;  3P7J A;  1YZ6 A;  1JJ2 A;  2PW7 A;  3J80 b;  1I4Q A;  2IHF A;  5IYD G;  3J81 E;  1X0T A;  1DJR D;  3UDF A;  1ESF A;  2NB0 A;  3J80 f;  5C5M A;  4DV0 Q;  4UHV A;  1LTA D;  4XTC S;  2UUC L;  3GTJ B;  1CKN A;  4A3E H;  2LFN A;  5M5X H;  3M85 A;  3I4O A;  2ICE C;  5A2Q E;  4S1T A;  4X66 Q;  3NH5 A;  5IYB G;  4R8I A;  1YJW A;  1O80 A;  3A8J E;  5M5Y B;  1H95 A;  1HR0 Q;  2B2T C;  3TZD A;  1Q90 A;  2QA4 Z;  5J3B A;  3GTM S;  4Y52 I;  1U4R A;  3WOE A;  4L5Q A;  3CCV Z;  1LLR D;  1F9R A;  5IGB A;  1KQS Y;  2PZW A;  3CCR A;  2F0T A;  3IF8 A;  4DAP A;  2EYF A;  4C3I H;  3GTQ B;  2O53 A;  3AB9 A;  2F0Q A;  5D3D A;  4DQY B;  1OXU A;  2X6L A;  1OTC A;  1XTC D;  2JA5 B;  4JI5 L;  4B3T Q;  3TE5 B;  2D9U A;  1Q86 C;  2Q2I A;  3S1R I;  1WYD A;  3K7A B;  1I3Q I;  4Y7N I;  1LT6 D;  4LMQ D;  4MHE A;  4KHP Q;  5IGD A;  2KEC A;  5AFW A;  2E2H H;  5IP7 I;  5I9P A;  4O2D A;  4BY7 G;  2B63 B;  2M48 A;  1S5C D;  4A3L H;  2WB1 G;  1V1Q A;  2BA0 A;  2VUM B;  1J9O A;  2GVB A;  3SVM A;  4AYB B;  5ELO A;  1RDP D;  5HGT A;  1TY0 A;  1S72 Z;  3NWS A;  4MON A;  2Q8R E;  2K5V A;  2KHS A;  4A3G G;  2Z9H A;  3A7A B;  4IPC A;  4QGU A;  5JPM C;  4A3E G;  3ER0 A;  3HKZ A;  3CC2 1;  4RV9 A;  3IR7 A;  4JYA L;  1IXR A;  1ZKO A;  1EEI D;  2I5H A;  1VQ5 Z;  1GVP A;  1EYG A;  1A3T A;  1HQM C;  4OXP A;  1RO0 A;  4CDD C;  1BCP D;  3CMA A;  2UXD Q;  1PFT A;  2RBL A;  4U67 3;  3OWF A;  5M5Y H;  4DV5 L;  3OW2 A;  1S5B D;  2QDB A;  1RF2 D;  1AZQ A;  2L5T A;  4RVF A;  1QF8 A;  5CMD A;  3JAM E;  2UXB Q;  2D0O A;  3GTQ H;  4A3I G;  2OTL Z;  2H85 A;  2VPY A;  4X65 L;  2JA5 H;  4CL1 A;  1WJ2 A;  3ICE A;  2E2I I;  1VMC A;  1FR3 A;  3U50 C;  3CC4 Z;  1SR3 A;  4DR3 L;  4OWT B;  1USP A;  3K7A H;  1YBY A;  1E0B A;  3HZX A;  4KK7 A;  4YHH Q;  1YNX A;  2HQL A;  4FF4 A;  4JVZ A;  1M8A A;  3RZO H;  2RCN A;  3SK6 A;  1B2T A;  1TXY A;  2B63 H;  4DR4 Q;  1GHK A;  3FPU B;  1SYE A;  3I56 A;  3HOX B;  4UP8 A;  2VUM H;  4A3G I;  1E3P A;  3RLN A;  2P5Z X;  1V43 A;  4P2C B;  5JOB A;  3G4S A;  4DXG A;  2L12 A;  2NVX B;  1VDZ A;  3RN2 A;  3A8K E;  3UI2 A;  1EFI D;  2DE5 A;  4RVH A;  4HR7 B;  5IY0 A;  4EWC A;  2R6G A;  1WFQ A;  1XJV A;  4LFC L;  4JBJ A;  2EYH A;  2NTS A;  3B6Y A;  1QE6 A;  3KLS A;  1EZ8 A;  1X6O A;  3OTO Q;  1IYU A;  4AYB E;  5I9O A;  2V8K A;  1NUC A;  3E0E A;  5FO9 B;  1II3 A;  3SK8 A;  2Z6B A;  4JCV E;  3SK4 A;  1JT8 A;  4JI4 Q;  4IOA A;  4OX9 L;  4A3I I;  3H91 A;  2AUK A;  3I73 A;  5CM2 M;  3VDY A;  1DXM A;  3D0F A;  2K7V A;  4LK1 C;  1MKH A;  1NUI A;  3K8A A;  2AKL A;  3NQT A;  4LWC A;  2CCZ A;  4H13 C;  1BBW A;  4IPD A;  4YY3 Q;  4RKL A;  2K1B A;  1H9R A;  4DK0 A;  2SNM A;  4GS3 A;  3CME A;  1HJP A;  4LUV A;  3TS2 A;  1FNU A;  1YVC A;  3SXH A;  1EFW A;  2B63 G;  1STB A;  2CQO A;  4R8N A;  3CCU Z;  2KCM A;  2VUM G;  1SE4 A;  1KC8 1;  5G3L D;  4AYB G;  5C3E G;  5JAV A;  1WTV A;  3HOX H;  2EJG C;  3MFY A;  3MVV A;  3GTJ I;  3CPW Y;  2LXK A;  2NVX H;  1KRT A;  1K0S A;  3HOV B;  2R93 I;  2GVA A;  1PTO C;  1H9S B;  5DAU A;  1PLF A;  1IW7 C;  3IRB A;  1N9W A;  2B2V A;  1H9K A;  4DUZ L;  1VQG A;  2MP1 A;  3G71 Z;  4NB3 A;  4S3S A;  3VMH A;  1QVF Z;  1PH3 A;  1EU3 A;  4KJO A;  3VMI A;  1KTK A;  3K7U C;  5GAH C;  1UWV A;  1K8A C;  1QB5 D;  1SXT A;  5IT9 L;  4K6D A;  3KDF A;  4EQ5 A;  2WAQ B;  5JEA G;  5KND A;  1FNW A;  5C4X G;  1X3P A;  2VB3 X;  4JI6 L;  3T1Y L;  1PVO A;  4IOC A;  1VQ7 1;  1L2F A;  4X62 Q;  4UP9 A;  3UDX A;  2DE6 A;  1K73 2;  2YAD A;  4H44 C;  1VQ6 1;  3S17 I;  1TS5 A;  1UE7 A;  4CKC A;  3GTM B;  1SNQ A;  1HFG A;  4UDU C;  1YI2 1;  4EGV A;  3T1H L;  3V96 A;  1DGS A;  1X55 A;  1F9S A;  2K5N A;  3I2Z A;  3K57 A;  1W2B A;  4DR1 Q;  4NBC A;  2CFM A;  5C3E I;  3HGB A;  1Q46 A;  4BWG B;  3ZJY C;  3J80 E;  2NVY B;  4JBK A;  3FQQ A;  1NAP A;  1IZ6 A;  2A74 C;  1SMY D;  3CCJ 1;  1HUM A;  1LTL A;  4IFD G;  3BVZ A;  5EJW A;  3TDQ A;  2VB2 X;  4E32 A;  2LSS A;  2EVB A;  3UE0 A;  4K5V A;  1IBK Q;  3PUY A;  2A68 D;  2KPI A;  3HOV H;  4F7X A;  5BN5 A;  4L5S A;  5CC4 A;  1Q81 1;  1FVI A;  1NNX A;  3I4M I;  3GP7 A;  1KD1 1;  3CD6 A;  2R61 A;  1CQV A;  5C4X I;  2UUA Q;  3T16 A;  2OTJ Z;  4X3K A;  3NTI A;  3HG9 A;  3UDI A;  4L5R C;  2F0E A;  1O7Y A;  1EZ6 A;  3GTK I;  1RHP A;  1EU4 A;  2R7F A;  5GRO A;  3BVM A;  1HRJ A;  1KLG D;  4A75 A;  3VR4 A;  3U9O A;  3NBH B;  3NHH A;  4MZ9 A;  3NE5 B;  1KC8 2;  3SE0 A;  1YIT 1;  2KCC A;  4A3D I;  2UUB L;  2KOL A;  2OOX B;  1O7L A;  5C6A A;  2K52 A;  3GTM H;  1Z03 A;  4V0B A;  3HOW B;  3W1B A;  1I50 B;  1NY4 A;  3KK7 A;  1VQK 1;  1J5E L;  4I7A A;  1S7M A;  1L1O B;  4K8I A;  2A19 A;  5CV9 A;  2Z6K C;  2F0G A;  3NBI A;  4EQN A;  1U9R A;  2B3G A;  1B50 A;  2Z1C A;  3TEH B;  4IFD I;  5FLX b;  1VQA A;  4V19 0;  1OXT A;  2NVY H;  5LMU L;  2JP1 A;  1TII D;  1FGB D;  4A3B I;  1ZXT A;  2N55 A;  3DM1 A;  5EKK A;  1NMG A;  5F2D A;  2RA4 A;  1UNS A;  1RTN A;  4NBA A;  5HGQ A;  4CJ0 B;  2HU9 A;  1XNR Q;  2A69 C;  2RCF A;  1KDA A;  2QEX Z;  3KF8 A;  5J39 A;  1VS0 A;  1A2T A;  4HGZ A;  2YV5 A;  2MHV A;  1PH8 A;  1C7Y A;  1UE5 A;  2K6A A;  2F4I A;  3PQI A;  2A6E D;  3CCQ A;  5CYU A;  1KNA A;  5D65 A;  4MTK A;  2MGS A;  1K9M 2;  4GLV B;  1VQM A;  5GAG C;  4HAE A;  4G7H C;  1B44 D;  3QIA A;  3TSS A;  2NVQ B;  4GKJ Q;  1J8I A;  1FNV A;  2JA7 B;  1BBX C;  3F1Z A;  2YU9 I;  1VF7 A;  3T4N B;  3I55 1;  3KFU A;  4QY7 A;  2N78 A;  4HIK A;  2Z0S A;  3CC7 Z;  4DF7 A;  4JI0 L;  4RS4 A;  2R7Z I;  3H3V H;  1A3V A;  2XTI A;  4LF5 Q;  4BA1 I;  4BS9 A;  4TKO B;  4DNR B;  2L55 A;  1WCM I;  2CH4 W;  5C4J B;  3A55 A;  1QVG A;  3HOU G;  1PRT B;  2AUJ D;  1I50 H;  4QTT A;  5IGG A;  1MJE A;  3CU7 A;  4P72 A;  1VQO Z;  4ZRZ A;  2J7Z A;  2NUC A;  1EYD A;  1AN8 A;  4RWS C;  5C0X H;  1UUP A;  2VPW A;  2VZA A;  1D5X C;  2F0P A;  1JQY D;  2QEJ C;  5ELD A;  3I07 A;  2WKD A;  2K75 A;  2L9H A;  3L2P A;  1XMQ Q;  2G9D A;  2W04 A;  1KD1 2;  1BVS A;  4NXN L;  4A3F G;  4X64 Q;  3M4O B;  4KHV A;  1U4P A;  1EWI A;  1STH A;  5FO8 B;  1P16 A;  4PMW A;  1RKN A;  1CA6 A;  5FKA C;  5NUC A;  3CXC Z;  4HIM A;  1ZYR C;  1BXT A;  3ULJ A;  3G48 A;  4OWX B;  1N32 Q;  1YJ9 1;  2SOB A;  2DJF C;  1X3Q A;  1PRT F;  1MGS A;  4K5W A;  1Y8O B;  1NJI C;  1EY5 A;  4FYD A;  1DZ1 A;  3KBX A;  4OEL B;  3F2D A;  4NBG A;  2OEO A;  4IUT A;  2E7Z A;  3VYS A;  2NVQ H;  1Y14 B;  2E5L L;  2RDH A;  2JA7 H;  2F4V Q;  1TQO A;  1AZP A;  3NH8 A;  3KF6 A;  3ERQ A;  5FO7 B;  4N8X 1;  4JI7 Q;  1VQ4 A;  4CHT B;  3LGJ A;  1EQV A;  3HOU I;  2EY5 A;  4DV6 L;  3I90 A;  2MNA A;  4IPH A;  4E2W A;  3HOW G;  1CKN B;  5HY6 A;  4IUU A;  3DEP A;  1ASY A;  4ABN A;  5C4J H;  1CKM A;  3S1R B;  1P8L A;  1Q1E A;  4DK6 C;  5C0X G;  4Y7N B;  2LEX A;  1MBY A;  4RCN A;  4FVM A;  4A3F I;  1E1T A;  4R4C A;  1VQL 1;  4EQO A;  1PA6 A;  3ITP A;  3AYH B;  4KJN A;  2VUG A;  1UE1 A;  1TT2 A;  2AMC B;  1WII A;  2F4O A;  3Q6S A;  4YWL A;  2UU9 Q;  3M4O H;  1X65 A;  4GNX A;  1YUK A;  3CC2 Z;  2ICI A;  3URY A;  2RDF A;  2MUY A;  1EOV A;  2QA4 A;  1TWH I;  3AFP A;  2A6H D;  4P74 A;  1YHQ 1;  2K05 A;  3CCV A;  3RN5 A;  2Z6K A;  4LF4 Q;  1HA6 A;  1HUN A;  3ZYY X;  1ML0 D;  1QYP A; 
#chains in the Genus database with same CATH homology
 4JI1 L;  3D31 A;  1N34 L;  4AQY Q;  5IT9 b;  2JA7 G;  4HID A;  4LUZ A;  4MH4 A;  4Y52 H;  3HOW I;  5IT9 f;  1VQD A;  1VQJ A;  3M9B A;  1GD7 A;  2Q2U A;  1FJG L;  1ML8 A;  3A0J A;  4X66 L;  4HJA A;  4YCV A;  2PMZ A;  3S1R H;  1S72 A;  4LF6 Q;  3K0X A;  4BXX G;  1C0A A;  1I3Q H;  4Y7N H;  1Q82 C;  2PI2 A;  1XMO Q;  5IP7 H;  2JA8 G;  1D8L A;  1VQ5 A;  5IYD H;  3PIP A;  1NP6 A;  3HFZ B;  4WJ3 M;  1KQS Z;  3S15 I;  3BZC A;  4IJH A;  1I94 Q;  4DR7 Q;  1PYB A;  3NEM A;  4JV5 L;  2OTL A;  3G6E 1;  2H5X A;  1PYS B;  3J7Z C;  3CC4 A;  2EIF A;  1MJC A;  1Q86 1;  1X3G A;  4JI3 L;  3S1Q I;  4MRI A;  1U5K A;  1VQN 1;  4BY1 I;  4BXX I;  4NFR A;  4MXU A;  3I4N G;  4DV2 Q;  1PH4 A;  3PUZ A;  2E2I H;  3GKQ A;  3EIV A;  2UXD L;  2RIQ A;  2JA8 I;  4DV1 Q;  5IP7 G;  1WW9 A;  1N36 L;  3GD7 A;  1E1O A;  1EUJ A;  3CCM 1;  1A0I A;  3EN2 A;  4A3G H;  3HKZ E;  3JC6 6;  5LL6 f;  5M3F H;  4GLA C;  1P9N A;  2WB1 E;  3CQZ I;  1VQP 1;  4BBR G;  4WJ4 A;  2V8J A;  3NEL A;  1PH9 A;  1RO2 A;  1KL9 A;  4LFB L;  2Q4Z A;  1VQ7 Z;  2NN6 G;  4DV7 L;  4YWK A;  1VQ6 Z;  4A3I H;  4NXM Q;  5BR8 L;  2VF1 A;  4DR6 Q;  5ELN A;  3I4N I;  1QUQ A;  1YI2 Z;  2VNU D;  1E7Z A;  5M5W H;  3CCU A;  2I5L X;  4J15 A;  1ZB8 A;  3HKZ G;  3EBE A;  4IJL A;  1SLJ A;  4R1J A;  3MZK B;  3J81 c;  2R7D A;  4LF7 L;  1RQF A;  3NEN A;  3H3V J;  2JA9 A;  3STB C;  4JI4 L;  3KDF B;  3CCJ Z;  1I6H I;  1B70 B;  4YWM A;  1N33 L;  5C44 I;  1HZ9 A;  5M3F G;  4BBR I;  4R4T A;  3G71 A;  1VQH A;  4DV4 Q;  2F4M A;  3BZK A;  1QVF A;  5C0X J;  5EAY A;  3GTJ H;  2R92 I;  1K0R A;  2R93 H;  4JI8 Q;  4JI2 L;  3LUS A;  5T67 A;  2JA6 G;  1C9O A;  3BG1 B;  2NN6 I;  1RIP A;  1TFI A;  1Y1V I;  2P28 A;  3H0G G;  1R9T I;  4DK1 A;  3ULP A;  3PO3 I;  1YIT Z;  1PHJ A;  1VQK Z;  3S17 H;  2ZJP A;  4GOP A;  3PF4 A;  1KRS A;  3CPW Z;  4JBW A;  3KIF A;  4OO1 I;  2UUC Q;  5C3E H;  4DNI A;  3M4P A;  3CCE 1;  3GTL I;  3RLO A;  1EQR A;  4X62 L;  2QGQ A;  1M1K C;  2IX0 A;  4E2Y A;  2JA6 I;  3Q8D A;  2R93 G;  3JAM c;  2OTJ A;  2MFI A;  3ULL A;  4DR1 L;  4XX2 A;  1K8A 1;  3H0G I;  2F3I A;  4JI5 Q;  4GN3 B;  4PZ7 A;  4C2M H;  3I4M H;  2KEN A;  1K83 I;  2V8I A;  1Y1W I;  5C4X H;  3CCL 1;  3I55 Z;  1RO4 A;  1PFS A;  4IPG A;  1JMC A;  4R4Q A;  1KHI A;  1GO3 E;  4QQB X;  4UY8 C;  3GTK H;  3L7Z C;  3KF8 B;  4P71 A;  2I0Q A;  4B3M L;  4A3D H;  4A3M G;  2GN5 A;  3SGI A;  4DR2 Q;  1HNW L;  2VQE L;  2Y0S A;  2RHS B;  4AIM A;  1A62 A;  4K0K L;  4JYA Q;  1M90 1;  2QEX A;  2ASB A;  3FHW A;  1YEZ A;  1XPO A;  5FJ8 H;  1S40 A;  3PUW A;  4A3B H;  2RF4 A;  4DV5 Q;  1K73 C;  1YHB A;  2L15 A;  1YJ9 Z;  1X54 A;  4MD7 A;  1XPU A;  3PCO B;  3I4M G;  1V9P A;  4KHZ A;  4X65 Q;  3CC7 A;  1OXX K;  2D62 A;  4DR3 Q;  1A63 A;  2UXC L;  1VQ8 1;  4DUY L;  1QZH A;  1IYJ B;  2IHE A;  2YTV A;  5T6B A;  1YIJ 1;  1JJ2 Y;  2YU9 H;  4A3M I;  1VQO A;  1GM5 A;  3ESW A;  2NZH A;  2HHH L;  4A3D G;  1UE6 A;  1KRL A;  2R7Z H;  3RZD I;  4NBD A;  1IBM L;  1WCM H;  4R4I A;  3KJP A;  3M3Y I;  4LFC Q;  2GTH A;  1A8V A;  1N2F A;  1BKB A;  1TWF I;  1TWG I;  1VQL Z;  4PZ6 A;  3CXC A;  1YJN 1;  2VS1 A;  5FJ8 G;  5GAD C;  3NDI A;  4A3B G;  3KF6 B;  4LFA L;  2JJQ A;  2QRE B;  3E9I A;  2AHO B;  3TDH B;  4OX9 Q;  1KC8 C;  1YHQ Z;  4A93 I;  4QIW E;  2OQK A;  1Y1V S;  3J81 j;  4POG A;  2OOY B;  2ALY B;  2RT9 A;  1XNQ L;  1XMQ L;  3A5U A;  2PNH A;  3J80 c;  1DL6 A;  2RHB A;  4OON A;  4L5T A;  1VQF A;  4GNX C;  2R7Z G;  2JR6 A;  1M90 2;  3F2C A;  4NBF A;  3BU2 A;  3FKI I;  3K80 C;  4PZ8 A;  3HOU H;  1WCM G;  2PK7 A;  2ZTC A;  2E8G A;  2V1C C;  1K9M C;  1SE8 A;  4DUZ Q;  1HZC A;  3CC2 A;  4LF8 Q;  4DKA C;  3OW2 Y;  2MO1 A;  4A3F H;  3MZL B;  4JI7 L;  4HJ9 A;  3DM3 A;  4ME3 A;  4LF9 Q;  4JI6 Q;  3T1Y Q;  1NJI 1;  1CSP A;  4DR5 L;  3IFU A;  4POF A;  1VQ9 1;  1TWH H;  3CCS 1;  2LIY A;  1Q8K A;  3G6E Z;  3T1H Q;  1PV4 A;  3HOZ G;  4GKK L;  1VQC A;  1N8R 1;  1G29 1;  1KD1 C;  4DAM A;  1E24 A;  3J81 f;  1VQN Z;  1YJW 1;  3HOW H;  1E22 A;  1W3S A;  3KJO A;  5A2Q f;  2YTX A;  3CCR 1;  2KHI A;  1Q81 2;  2ZM6 L;  3S14 I;  3GTG I;  4E2X A;  2QKD A;  5AN9 F;  1KQS A;  5K36 G;  3CCM Z;  3E9H A;  2AKW B;  4B3S Q;  2K5H A;  5IP9 I;  2WAQ A;  3FQM A;  2LFU A;  3CW2 C;  1VQP Z;  1B7Y B;  1Z9F A;  4LF6 L;  5D1O A;  3PF5 A;  3HOZ I;  4RG1 A;  5LMN L;  3S15 H;  1SRO A;  3F3P C;  2JEA I;  2D0P A;  3D9X A;  3MEF A;  4KI0 A;  1J5E Q;  1FGU A;  2N8N A;  4H02 A;  1IBL L;  5JEA J;  5LMU Q;  3CMA 1;  3S2H I;  2PMZ E;  4A3K G;  3CAM A;  3S1Q H;  1Q82 1;  1I94 L;  5IWA L;  1VLA A;  4BY1 H;  4BXX H;  3NH4 A;  5E7N A;  1LUZ A;  1EIF A;  2JA8 H;  4GLX A;  1KAW A;  2QRD B;  3HOY I;  2E2J I;  2JS4 A;  1Z01 A;  4DPG A;  1T9H A;  4RVG A;  4X6A I;  1QUQ B;  2N49 A;  2B29 A;  4IFD J;  3I56 1;  5M3M G;  1N8R 2;  1YUA A;  1L0W A;  1VQ7 A;  4JI0 Q;  1W2B Y;  3G4S 1;  3CQZ H;  3S2D I;  4HJ5 A;  1HNX Q;  1VQ6 A;  1Z47 A;  1SN8 A;  1Q7Y 1;  1ZH1 A;  1YI2 A;  4YCW A;  5H1S E;  4A3K I;  4DV0 L;  2NVT I;  4NPS A;  1RNI A;  3F3F C;  3I4N H;  3CCJ A;  1HR0 L;  4NXN Q;  2WFW A;  4BY1 G;  2YTY A;  2IX1 A;  2JEB I;  1KIX A;  3CCE Z;  1JE5 A;  4A3C I;  4B3T L;  4A4I A;  3HKS A;  5DLQ E;  3CME 1;  1I6H H;  4DR6 L;  1Z02 A;  4B3R Q;  2G2K A;  1SFO I;  5C44 H;  3GO5 A;  3PIO A;  4A3J G;  3S1M I;  1WOC A;  3IX0 A;  2OQ0 A;  4BBR H;  4KHP L;  1USP B;  2E5L Q;  1HZB A;  4GOP C;  2HF1 A;  3TQY A;  2P3Y A;  3F2B A;  2VQF Q;  4JBM A;  2R92 H;  4DV6 Q;  3P5J B;  2VY3 A;  1YIT A;  4O0A A;  3CCL Z;  1YHA A;  2HT1 A;  2VL6 A;  1Y1V H;  4TQU S;  1VQK A;  2RHQ B;  2PM9 A;  4P73 A;  1AE3 A;  3CF5 A;  3CPW A;  1R9T H;  3OYY A;  2QLV B;  1NBW A;  3PO3 H;  2JK8 A;  4HIO A;  4AH6 A;  1K8G A;  3H15 A;  2UXB L;  4A76 A;  4A3J I;  3QWU A;  1QVC A;  2PQA A;  2UUB Q;  1FL0 A;  2LXJ A;  4JI1 Q;  3J7A 5;  5C44 G;  1BBU A;  3GTL H;  3AFQ A;  1HNZ Q;  1N34 Q;  4NH1 C;  1X3F A;  1Q7Y 2;  4YHH L;  1Q12 A;  4LUO A;  1CUK A;  2JA6 H;  3WWV A;  2R92 G;  4DR4 L;  3I55 A;  3D6W A;  1LYL A;  3S1N I;  5FLX c;  1QVG Y;  4UPA A;  3S16 I;  4NBH A;  3S24 A;  3H0G H;  3GTP I;  1Y1V G;  1VQ8 Z;  1ZB9 A;  1FJG Q;  1K83 H;  1YIJ Z;  4BBS G;  2BH8 A;  1Y1W H;  2IT1 A;  3CD6 1;  1NTG A;  2Q51 A;  3PO3 G;  3OTO L;  2N3S A;  4DV3 Q;  3TS0 A;  4DGL A;  5FLM G;  1TWA I;  5LMN W;  5JJK A;  3PO2 G;  4TVA B;  2CWA A;  4OO1 G;  1YJN Z;  1SRU A;  1M1K 1;  3J7A 4;  1YJ9 A;  1PH7 A;  5AJ3 Q;  4YY3 L;  1X9N A;  4P75 A;  2KCT A;  3U58 A;  4HJ8 A;  1S3O A;  4JV5 Q;  3EER A;  1VQB A;  1LM0 A;  1Q86 2;  1MIU A;  3MXN B;  2EGT A;  4C3J H;  2YYZ A;  4DR2 L;  4LNQ A;  4JI3 Q;  4BBS I;  2M6N A;  2WB1 A;  1Y1W G;  1IL2 A;  3CCQ 1;  1TWC I;  5FLM I;  1VQM 1;  3A5Z B;  1N36 Q;  3PO2 I;  1VQL A;  4A3M H;  2Y0S E;  1RLY A;  2IY5 B;  3STB D;  3GTO I;  4BY7 I;  1CKO A;  2NZO A;  3RZD H;  4A3L G;  1YHQ A;  2DE7 A;  3M3Y H;  4PG3 A;  1K73 1;  1TWF H;  4MD9 A;  1TWG H;  1AE2 A;  2KBN A;  1VQE A;  3U4Z A;  4LFB Q;  2Q2H A;  4A3E I;  4DV7 Q;  1HR0 W;  1VQ9 Z;  3CCS Z;  5BR8 Q;  1PH1 A;  4A93 H;  1JJ2 Z;  2IZ3 A;  2Y0S G;  4GN5 A;  1AH9 A;  1IBK L;  2IZ4 A;  2JQO A;  2Q2T A;  1I5F A;  1HH2 P;  4APV A;  4QJF A;  4LF7 Q;  1YJW Z;  1M1K 2;  2UUA L;  1N33 Q;  2A8V A;  2KI7 B;  3CCR Z;  2K14 A;  1D7Q A;  2JA5 G;  1VCI A;  2E2H I;  1B8A A;  3FKI H;  4A3L I;  5IT9 c;  1VQ4 1;  3KYH C;  3PSI A;  4E33 A;  4JI2 Q;  1JB7 A;  2ID0 A;  2GU2 A;  3FP9 A;  2A1A A;  2BH2 A;  3PGZ A;  2CWP A;  1CSQ A;  4E31 A;  3G6E A;  4A93 G;  2VW9 A;  3UDG A;  4FDB A;  2DUD A;  4ALP A;  2R6M A;  2MQH A;  1JJG A;  4LF8 L;  1U0L A;  1XPR A;  1EIY B;  1VQN A;  1XNR L;  1KXL A;  4AYB A;  2QA4 1;  2FXQ A;  3GTQ I;  3CCV 1;  1GKH A;  2JA5 I;  1ASZ A;  3CMA Z;  4LF9 L;  1PH6 A;  3OW2 Z;  3K7A I;  1J6Q A;  2J6A A;  3CP0 A;  1K9M 1;  3FKI G;  4GKJ L;  3CCM A;  4MTN A;  5D1O B;  3RZO I;  2XGT A;  2F52 A;  2JMO A;  2B63 I;  1O7I A;  3VB9 A;  1K8A 2;  2VUM I;  1PH5 A;  1VQP A;  3S14 H;  3GTG H;  1G6P A;  4LF5 L;  3HOX G;  1WI5 A;  2EQS A;  2OCE A;  1S72 1;  5IP9 H;  3I56 Z;  1QZG A;  1M90 C;  2I3C A;  3J81 i;  3G4S Z;  2ZJR A;  3Q87 A;  3PO3 S;  3K81 C;  1VQ5 1;  4X64 L;  3I7F A;  3HOZ H;  4B3M Q;  4B3S L;  3KOJ A;  1JJC B;  1HNW Q;  4GNX B;  2VQE Q;  1N32 L;  1X56 A;  1NMF A;  4K0K Q;  1X3Z A;  4NBB A;  2OZK A;  2BA1 A;  3TRZ A;  1QVF Y;  2OTL 1;  2EXD A;  3F8T A;  3S2H H;  2I5M X;  3CC4 1;  4JC0 A;  4NBE A;  1G51 A;  5IE8 A;  2F4V L;  1L1O C;  3HOX I;  1LQL A;  2WAQ E;  3CME Z;  2NVX I;  2JE6 I;  5IP9 G;  3HOY H;  5GAE C;  5D1P A;  5FLX f;  3BG0 B;  2E2J H;  2UXC Q;  4DUY Q;  4JG2 A;  4QL5 A;  3HOV G;  4X6A H;  1OXS C;  3VTN A;  5JJL A;  4EX5 A;  5GQO A;  3W5O A;  2AWO A;  2ZTD A;  1Q81 C;  2HHH Q;  4NB9 A;  3J81 b;  3S2D H;  2UU9 L;  2RPR A;  1RL2 A;  2KHJ A;  3PUV A;  4E2Z A;  4JOI C;  1K3R A;  1IBM Q;  5A2Q b;  2WAQ G;  4MNO A;  4LF4 L;  3JAM i;  3DLL A;  3W1G A;  1XTD A;  4A3K H;  3CCE A;  2ES2 A;  4TNU A;  4BA2 I;  4UP7 A;  2NVT H;  1JWH C;  3GCF A;  4LFA Q;  4AQY L;  3VMG A;  1HNX L;  2BJO A;  4HGY A;  5JJI A;  3CCU 1;  4MD8 A;  1W2B Z;  3HOV I;  3HOY G;  2HIX A;  4A3C H;  1XNQ Q;  2WP8 J;  5M3M H;  1SFO H;  3CCL A;  4IO9 A;  3S1M H;  1XMO L;  3U4V A;  2W03 A;  4HH4 A;  3G71 1;  1SMX A;  4GN4 B;  2CKZ B;  5IYC H;  4LW1 A;  4YCU A;  2PQA B;  4B3R L;  3CD6 Z;  3RR5 A;  3GTM I;  4DR7 L;  2PI2 E;  1X3W A;  2VQF L;  3BJU A;  2QR1 B;  3M7N A;  4NOZ A;  2DGY A;  3JAM b;  1N8R C;  1NJI 2;  4DK3 C;  2NVY I;  3NFZ A;  3JAM f;  2AWN A;  3RLF A;  1HZA A;  4DR5 Q;  3AEV A;  1VQI A;  4A3C G;  2GTI A;  4A3J H;  4DV2 L;  2O4H A;  4GKK Q;  3A74 A;  4OWW B;  1VQ8 A;  2ZAE B;  4DV1 L;  3L0O A;  1YIJ A;  2OWO A;  3NDJ A;  1L1O A;  4DAY B;  2ZJQ A;  5IYC G;  3S1N H;  2QRC B;  3S16 H;  3MON A;  2OTJ 1;  2C35 B;  3CXC Y;  2ZM6 Q;  1HNZ L;  3CCQ Z;  3GTP H;  4RMF A;  3H3V I;  2K5R A;  1X3E A;  1VQM Z;  4C3H H;  3M4Q A;  1YJN A;  1I50 I;  3RNU A;  3KLW A;  3PV0 A;  5C0X I;  2MO0 A;  1OXV A;  4NXM L;  4QTU A;  1TWA H;  4JOI A;  3J80 i;  3GDE A;  1QVG Z;  4NB8 A;  1EQQ A;  5LMN Q;  3KIH A;  4HJ7 A;  1UEB A;  4GOP B;  2E9H A;  4DV3 L;  1NE3 A;  2ZTE A;  2K4K A;  2QEX 1;  1IBL Q;  3TRE A;  4XIG S;  1Q82 2;  2NVQ I;  3UE1 A;  1PH2 A;  5AJ3 L;  4DV4 L;  2JA7 I;  4KLK A;  5IYB H;  4BBS H;  2K3R A;  5IWA Q;  2ATW A;  3EED A;  5T64 A;  4JI8 L;  2JNY A;  3CPF A;  2K50 A;  1Q7Y C;  3CC7 1;  5C4J I;  1TWC H;  2HIV A;  4R4O A;  5FLM H;  4E30 A;  3PO2 H;  1VQ4 Z;  1WJJ A;  2JUB A;  3PUX A;  1VQO 1;  4RVD A;  3GTO H;  4BY7 H;  3AQQ A;  1Q1B A;  3ERS X;  1VQ9 A;  3M4O I;  3CCS A;  1YZ6 A;  1JJ2 A;  3J80 b;  2IHF A;  5IYD G;  1X0T A;  3UDF A;  3J80 f;  2UUC L;  4DV0 Q;  4XTC S;  1CKN A;  4A3E H;  5M5X H;  3M85 A;  3I4O A;  4S1T A;  4X66 Q;  3NH5 A;  5IYB G;  1YJW A;  1H95 A;  1HR0 Q;  2QA4 Z;  5J3B A;  3GTM S;  4Y52 I;  4L5Q A;  3CCV Z;  1KQS Y;  3CCR A;  3IF8 A;  4C3I H;  2O53 A;  4DQY B;  1OXU A;  1OTC A;  4JI5 L;  4B3T Q;  3TE5 B;  1Q86 C;  2Q2I A;  3S1R I;  1WYD A;  1I3Q I;  4Y7N I;  4KHP Q;  2E2H H;  5IP7 I;  4BY7 G;  4O2D A;  2M48 A;  4A3L H;  2WB1 G;  1V1Q A;  2BA0 A;  2GVB A;  5ELO A;  1S72 Z;  4MON A;  2K5V A;  4A3G G;  4IPC A;  4QGU A;  4A3E G;  3ER0 A;  3HKZ A;  3CC2 1;  4RV9 A;  4JYA L;  1IXR A;  2I5H A;  1VQ5 Z;  1GVP A;  1EYG A;  4OXP A;  1RO0 A;  3CMA A;  2UXD Q;  1PFT A;  2RBL A;  4DV5 L;  5M5Y H;  3OW2 A;  4RVF A;  1QF8 A;  2UXB Q;  2D0O A;  3GTQ H;  4A3I G;  2OTL Z;  2H85 A;  4X65 L;  2JA5 H;  4CL1 A;  3ICE A;  2E2I I;  3U50 C;  3CC4 Z;  1SR3 A;  4DR3 L;  4OWT B;  1USP A;  3K7A H;  1YBY A;  4YHH Q;  1YNX A;  2HQL A;  3RZO H;  2RCN A;  1TXY A;  2B63 H;  4DR4 Q;  3I56 A;  2VUM H;  4UP8 A;  4A3G I;  1E3P A;  3RLN A;  1V43 A;  3G4S A;  3RN2 A;  2DE5 A;  4RVH A;  5IY0 A;  4EWC A;  2R6G A;  1WFQ A;  1XJV A;  4LFC L;  4JBJ A;  3B6Y A;  1X6O A;  3OTO Q;  4AYB E;  2V8K A;  3E0E A;  4JCV E;  1JT8 A;  4JI4 Q;  4IOA A;  4OX9 L;  4A3I I;  5CM2 M;  3VDY A;  3D0F A;  1MKH A;  1NUI A;  3K8A A;  2AKL A;  4LWC A;  2CCZ A;  4IPD A;  1BBW A;  4YY3 Q;  4GS3 A;  3CME A;  1HJP A;  4LUV A;  3TS2 A;  1YVC A;  1EFW A;  2B63 G;  2CQO A;  3CCU Z;  2KCM A;  2VUM G;  1KC8 1;  4AYB G;  5C3E G;  3HOX H;  3GTJ I;  3CPW Y;  2LXK A;  2NVX H;  1KRT A;  2R93 I;  2GVA A;  3IRB A;  1N9W A;  4DUZ L;  1VQG A;  3G71 Z;  4NB3 A;  3VMH A;  1QVF Z;  1PH3 A;  3VMI A;  3K7U C;  5GAH C;  1UWV A;  1K8A C;  3KDF A;  4EQ5 A;  5JEA G;  5C4X G;  4JI6 L;  3T1Y L;  1PVO A;  4IOC A;  1VQ7 1;  1L2F A;  4X62 Q;  4UP9 A;  3UDX A;  2DE6 A;  1K73 2;  2YAD A;  1VQ6 1;  3S17 I;  1UE7 A;  1YI2 1;  3T1H L;  1DGS A;  1X55 A;  3I2Z A;  2K5N A;  1W2B A;  4DR1 Q;  4NBC A;  2CFM A;  5C3E I;  1Q46 A;  3ZJY C;  4JBK A;  3FQQ A;  1IZ6 A;  3CCJ 1;  1LTL A;  4IFD G;  4E32 A;  2LSS A;  3UE0 A;  1IBK Q;  3PUY A;  2KPI A;  3HOV H;  4L5S A;  1Q81 1;  1FVI A;  3I4M I;  1KD1 1;  3CD6 A;  5C4X I;  2UUA Q;  2OTJ Z;  3UDI A;  4L5R C;  3GTK I;  2R7F A;  5GRO A;  4A75 A;  3NBH B;  4MZ9 A;  1KC8 2;  1YIT 1;  4A3D I;  2OOX B;  3GTM H;  2K52 A;  1Z03 A;  3W1B A;  1NY4 A;  1VQK 1;  1J5E L;  1S7M A;  1L1O B;  2A19 A;  2Z6K C;  2B3G A;  3TEH B;  4IFD I;  5FLX b;  1VQA A;  1OXT A;  2NVY H;  5LMU L;  4A3B I;  1NMG A;  4NBA A;  5HGQ A;  2HU9 A;  1XNR Q;  2QEX Z;  1VS0 A;  4HGZ A;  2YV5 A;  1PH8 A;  1C7Y A;  1UE5 A;  3CCQ A;  1K9M 2;  4GLV B;  1VQM A;  5GAG C;  4GKJ Q;  3F1Z A;  2YU9 I;  3T4N B;  3I55 1;  3KFU A;  4QY7 A;  2N78 A;  4HIK A;  2Z0S A;  3CC7 Z;  4JI0 L;  4RS4 A;  2R7Z I;  3H3V H;  2XTI A;  4LF5 Q;  4BA1 I;  1WCM I;  1QVG A;  3HOU G;  1I50 H;  4QTT A;  1MJE A;  4P72 A;  1VQO Z;  2VZA A;  3I07 A;  2K75 A;  3L2P A;  1XMQ Q;  2W04 A;  1KD1 2;  1BVS A;  4NXN L;  4A3F G;  4X64 Q;  1EWI A;  1P16 A;  4PMW A;  3CXC Z;  4HIM A;  3ULJ A;  3G48 A;  4OWX B;  1N32 Q;  1YJ9 1;  1NJI C;  3F2D A;  4NBG A;  2NVQ H;  1Y14 B;  2E5L L;  2JA7 H;  2F4V Q;  3NH8 A;  3KF6 A;  4JI7 Q;  1VQ4 A;  3LGJ A;  3HOU I;  4DV6 L;  2MNA A;  4IPH A;  4E2W A;  3HOW G;  1CKN B;  5HY6 A;  1ASY A;  5C4J H;  1CKM A;  1P8L A;  1Q1E A;  4DK6 C;  5C0X G;  4A3F I;  1E1T A;  4R4C A;  1VQL 1;  1PA6 A;  3AYH B;  2VUG A;  1UE1 A;  2AMC B;  1WII A;  2F4O A;  4YWL A;  2UU9 Q;  3M4O H;  1X65 A;  4GNX A;  1YUK A;  3CC2 Z;  1EOV A;  2QA4 A;  1TWH I;  3AFP A;  4P74 A;  1YHQ 1;  3CCV A;  3RN5 A;  2Z6K A;  4LF4 Q;  2UUB L;  1QYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...