3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H2 subunit A
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/replication
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
5AVBD 4NFTA 1WWIA 2AKLA 1ID3C 3CPWZ 1Q862 4J8XC 3X1VA 2RPRA 2AYDA 3MGQB 3MGPD 1TWHI 3G711 1WZNA 4MD9A 3NH8A 3AL0C 1N8R1 4NE3A 3EERA 4XUJD 2JIPA 3MGQD 3REKA 1P3IB 3EPLA 2F8NB 5B31C 4WNNB 1QYPA 2VF1A 4HH4A 3S1MI 1VQM1 3WTPC 3MNNB 1KX4C 1AOIB 3V9RB 2QA4Z 1Q821 1P3ID 2F8ND 1JJ2Y 4UPKA 5GT0A 2VUMI 3S1QI 1KX3C 3FDDA 1VQ91 3MNND 3UTBD 1S32A 4J8XB 1ID3B 1AOID 4Z5TA 3AZNC 3X1SB 3CPWY 3MGSC 2Y2HA 2E2II 3S2HI 4LD9C 4MH4A 3I561 5IT9f 1ID3D 3I4NI 2KPIA 4J8XD 4H9NA 3X1SD 1VQ41 5B31B 3AZGC 2YADA 3CXCY 2V8IA 3WTPB 3AFAC 1KX4B 1N1JA 4MONA 3W96B 5B31D 2R93I 3CCRZ 5B0ZA 4Z66C 3CD6Z 3WTPD 2JSSA 1KX4D 4A3JI 1YHQ1 2BG1A 3AZNB 3W96D 5IP7I 3CCLZ 4LD9B 1YJN1 3B6FC 1VQ81 3A1IA 2IO5B 1KU5A 3AZND 1HTAA 5AY8C 2JUBA 4MXUA 4NBBA 4A3DI 3AZGB 2Y2LA 4LD9D 4G92B 3CCV1 3AZIC 3AFAB 2IV2X 5CPJA 4H9QB 2Y2NA 2RHBA 3AZGD 4NBEA 1VQ6Z 4Z66B 1KX5C 2F8NG 5B2JC 3AFAD 3X1TC 2QA41 1Q812 4CSRB 3UT9A 2I3CA 3CCJZ 1KD11 1QF8A 1M902 4Z66D 3LZ0A 1JFIA 3M3YI 3VMGA 3VH5W 3CMAZ 5D1PA 5AY8B 5CPKC 5T64A 1NJI2 2NVXI 2OTJZ 3AZIB 5AVBA 5C4JI 1T3UA 1VLAA 5AY8D 1W2BY 3MGPA 2NZDC 2PMZA 3AZID 5B2JB 2B63I 5B40A 4XUJA 3AZEA 3AYWC 3MVDC 4YM6C 5AV6C 1P3AC 1P3BC 5B2JD 1KX5D 1S7MA 1USPA 2F4MA 2G2KA 4CL1A 2GU2A 5CPKB 1P3IA 1TWFI 5B33A 4WNNA 5C3IC 3B0CT 3AN2C 3MNNA 3UTBA 3UTAA 1AOIA 5CPKD 2JA8I 2NZDB 3VH6T 2V8KA 1ID3A 5T6BA 4DK1A 4J8XA 2JIOA 4QLCC 3W98C 2NZDD 3GTGI 1P3AB 5AV6B 1P3BB 2DE7A 1Q7Y1 3CCJ1 3EEDA 1FDIA 5F99C 3AZMC 3HOWI 5B31A 5C3IB 4X6AI 1P3BD 5AV6D 1P3AD 5AV5B 2QKDA 3WTPA 3G6EZ 3AN2B 5B0YC 3WA9C 4JJNC 1KX3A 4E30A 5AV5D 2VPWA 3AN2D 2WAQA 2VPZA 3AZNA 4H9RB 4KUDC 4QLCB 3MGSA 3W98B 3ESWA 2PYOC 3GTMI 5BNXB 4LD9A 3D6WA 5BO0B 3REJA 3GTJI 1S72Z 5F99B 4QLCD 3AZMB 3W98D 1VQKZ 3GCFA 2XD5A 3NH4A 1M1K1 2QEXZ 1P3LC 4A93I 5B0YB 4NBGA 3WA9B 5F99D 4H9QA 3AZMD 4NFRA 4JJNB 5A2Qf 4Z66A 5JA4A 4WV4B 2F2AC 4EO5C 5B0YD 2JCHA 4CSRA 4E45A 5AVCC 3RELC 4JJND 2PYOB 3WA9D 3G71Z 3M4OI 4BBSI 3IX0A 2GTIA 2Y2MA 3B6FA 2FJ7C 5AY8A 1B67A 2PYOD 2JE5A 1VQMZ 3AZIA 1Z2CB 1P3LB 2E2JI 3PO3S 1KC82 2Y2PA 4NOZA 3EG5B 2W8SA 1VQPZ 1KX5A 1WW9A 1VQ9Z 2DE5A 2E9HA 3X1TA 1P3LD 1AA6A 2OTL1 3RELB 4EO5B 1P3FC 5AVCB 1ML8A 1TAFA 5B2IA 1M19A 1Y1WI 3I56Z 4TNUA 4H9OB 3RELD 2FJ7B 3MGQC 5AVCD 5CPKA 1Y1VI 5B32B 3Q87A 5BNVB 2Y2OA 3CC71 2YFVB 5B1MC 2FJ7D 5B32D 3TU4A 1WCMI 2ZY2A 1M18B 1YHQZ 3H0RC 3CCS1 1P3FB 3AYWA 2R6MA 2JA5I 1JJ2Z 3MVDA 2G5IC 4YM6A 5AV6A 5B24B 2YFWB 3AV2C 1P3AA 1P3BA 4G91B 1M18D 5GSUC 1VQ8Z 1P3FD 3AV1C 3X1SC 2F8NH 4RVGA 4J8UC 2R7ZI 2V45A 3NQJA 2KI7B 2JIQA 2VUGA 4HGAB 4ZBJC 5B24D 1QVGZ 3CCVZ 3LELC 3AN2A 5B1MB 5KDMB 3CCQ1 5E5AC 2PK7A 3KIHA 3CXCZ 2W03A 2Y2KA 4E31A 3KWQC 2PM9A 5B1MD 3W96C 3H3VJ 2BYMA 1M1AB 2W04A 4QLCA 3W98A 1VQP1 5GXQA 4AWLC 4X23C 5BNXA 2V8JA 3GTLI 3AV2B 1X3WA 1P3MC 1YIJ1 1K8A2 5GSUB 3HOZI 3AV1B 1M1AD 4J8UB 3AZMA 4UUZB 1QVGY 4ZBJB 4H9PB 3CC41 3AV2D 2EGTA 3LELB 3HOYI 3I551 2IO5C 5GSUD 3AV1D 5B0YA 3WA9A 5E5AB 4J8UD 4E2YA 5AV9B 3LUSA 4KHAB 4G92C 4J8WB 2Y2QA 3S15I 5B32G 3LELD 3KWQB 1BH8B 1P3PB 4RVFA 3IR7A 4KUDA 5E5AD 3MGRC 5AV9D 4AWLB 4X23B 4J8VB 2JNYA 4CAYB 2OOYB 1P3MB 4M6BA 3KWQD 1P3PD 3EPHA 2O4HA 3C1CC 3AZFB 4X23D 4J8VD 4YS3A 3FKII 3C1BC 1P3MD 2ZAEB 3HOVI 3REIA 1P3LA 1ZB8A 3F6TA 1L1OC 3A1KA 3AZFD 1P34C 2NQBC 3BG0B 3AZHB 2FFFB 1W2BZ 3RELA 2J8PA 5AVCA 3MGRB 1RO4A 4MRIA 3AZHD 3F3FC 4A3CI 2DE6A 4BBRI 3J7A4 2QLVB 4H9OA 4NBDA 3C1CB 2FJ7A 2P3YA 3MGRD 5DNMC 4A3FI 4KGCA 3C1BB 1NUIA 5BNVA 5C44I 2YFVA 1YIT1 3X1UB 3C1CD 3O62B 1X0TA 2YU9I 3LZ1C 1P34B 2NQBB 1N2FA 1RLYA 3EPJA 3C1BD 3B0BA 3S2DI 4WU8B 3NQUA 1ZLAC 5LL6f 3X1UD 3EPKA 3O62D 3AZJC 1Z01A 1P34D 2NQBD 4WU8D 2Q4ZA 3MGQA 1I3QI 5C4XI 5DNMB 1N8R2 2K5RA 1FDOA 3HKZA 5B1MA 2Y2IA 4Z2MH 3LZ1B 5DNMD 2F8NA 2BYKB 5AV5C 5D1OB 1Q822 3JAMb 2G5HC 3V9RA 1ZLAB 3WAAC 2AROB 3AZJB 3LZ1D 2JMOA 3GTOI 3B6GB 3AV2A 5T67A 5GSUA 1ZLAD 4MD8A 2RVQD 3X1SA 2AROD 3B0CW 3AZJD 1H3OB 3AV1A 3U50C 1YJ91 4UUZA 3IP4C 4NBFA 4A3EI 3B6GD 3RZOI 3HOUI 3LELA 1WJ2A 2E2HI 4E32A 3CQZI 4WZSB 3S1NI 5E5AA 5CHLB 4KHAA 2HIOB 1KX4A 2RBLA 3KWQA 1BH8A 2NAPA 3MZLB 2OTLZ 3W96A 3WAAB 5GT3C 4HGYA 4X23A 2HIOD 1YI2Z 4CAYA 1K9M1 1P3MA 1VQN1 1K731 3WAAD 3A6NC 1Y8CA 5A2Qb 3CME1 2HUEC 4QTUA 1QVFY 3CC7Z 4DRAA 4NBHA 3WKJC 3QWUA 3AZGA 4XZQC 3AZLC 4WU9C 3AFAA 4NH1C 3PO2I 3CCSZ 2UWXA 4NB9A 5GT3B 3MGRA 4R8PC 4AYBA 2ZY4A 1Q861 2QRCB 1KD12 4A3II 3A6NB 3C1CA 5GT3D 2HUEB 3C1BA 2J6AA 3B0DB 3A6ND 3WKJB 3NDIA 4NBCA 5B32C 4XZQB 5AV8C 3AZLB 1X3ZA 3CCQZ 4WU9B 4EWCA 3KUYC 2VPYA 3WKJD 3K7AI 4XZQD 4R8PB 3AZLD 4Z5TB 4WU9D 1K8A1 5B2JA 1M18C 1YIJZ 1TWAI 3H0MC 4R8PD 2HF1A 2VQRA 2QREB 4H9NB 4Z5TD 5B24C 3CCE1 1YI21 3CC4Z 4G91C 2WB1A 3I55Z 3VMHA 3J81f 5AV8B 4E44A 1N1JB 3LZ1A 4HGAC 2E7ZA 2V3VA 3KUYB 5D1OA 3J80f 3KIFA 1ZLAA 5CP6C 2NZDA 5AV8D 1Z02A 1P9NA 4NB8A 3KUYD 1P3GC 1RO2A 2RT9A 1SIWA 1M1AC 1H3OA 2GTHA 4NE6A 2JR6A 1Q7Y2 5G49B 2IZ4A 2OOXB 4E2ZA 4ZUXC 3AZKC 3CC21 5AV5A 1U35C 5CP6B 3WAAA 5B40C 5AV9C 1KQSY 2CV5C 2JIMA 4J8WC 4QTTA 5IT9b 1P3GB 1P3PC 1Q811 2OZKA 1M901 3LZ0B 3IF8A 4H9RA 5CP6D 1I50I 3CCM1 3CCU1 1ZH1A 3P5JB 4J8VC 1P3GD 5BO0A 4NBAA 5B33C 4DGLA 3OW2Y 3LZ0D 1DL6A 1YITZ 5F99A 4ZUXB 3GKQA 3AZFC 3W99C 3AZKB 2IZ3A 3NDJA 4HGZA 4H9SC 5FLXf 1NJI1 1U35B 1TWGI 4A3BI 4ZUXD 5B40B 5GT3A 4JJNA 3AZKD 2CV5B 4XUJB 3AZEB 3AZHC 4A3MI 1U35D 1YUKA 4BY7I 3A6NA 5BT1D 5JRGC 5B40D 2PYOA 3VH6A 2CV5D 1USPB 4J8WD 3AZED 2DQNC 1RNIA 3I07A 3MZKB 5B33B 2JA6I 2ZY3A 4NE5A 1R4VA 3WKJA 1NP6A 1BH9B 3UTBB 4XZQA 3UTAB 3AZLA 3W99B 4S1TA 4WU9A 3PO3I 5B33D 5DNNC 2M6NA 1YJW1 3X1UC 3IFUA 3O62C 3W99D 3UTAD 4R8PA 3KFUG 1I6HI 4DRBA 1R9TI 3W97C 1VQ71 4DQYB 4WU8C 3RZDI 1Q9CA 5JRGB 3REJC 1YJ9Z 1WWSA 4A3KI 5CPIC 5JRGD 1F66C 3D9XA 5B32A 5AV8A 4XX2A 3KUYA 3G4S1 5DNNB 1KX3B 3WTPE 1TFIA 3W97B 1ZB9A 3MGSB 1M18A 3REHC 5DNND 1KX3D 2VPXA 1P3FA 2RVQC 1VQNZ 2AROC 3GTMS 3REJB 4RVHA 3KXBC 1QXFA 3CMEZ 5B24A 2YFWA 1B6WA 5G49A 3MGSD 1P3OC 3B6GC 3W97D 3TE5B 3VTNA 5CPIB 3REJD 1F66B 5B1LC 3VH5T 1EQZC 4RS4A 5KDMA 5JA4B 5CPID 2LEXA 5CP6A 1P3KC 1F66D 5FUGB 1VQ5Z 4A3GI 2HIOC 5C3EI 1A7WA 1HQ3C 1P3GA 3REHB 3TDHB 5B2IC 1M19C 3LJAC 1TZYC 1M1AA 3B6FB 3GTPI 3KXBB 4BXXI 2P28A 1P3OB 3REHD 3B6FD 4J8UA 4ZUXA 1RQFA 2NVQI 5B1LB 3KXBD 3AZKA 2RIQA 4H9PA 1Z03A 1QVFZ 2LY8A 1U35A 3VH6W 1P3OD 1EQZB 3TU4C 5IP9I 1KX5B 1KC81 5B31G 3X1TB 1P3KB 5AV9A 5B1LD 2Q51A 4Y52I 2CV5A 4J8WA 1HQ3B 1P3PA 1TAFB 3KSYA 5BS7C 5B2IB 1M19B 1EQZD 3LJAB 2JIRA 1TZYB 3CCR1 3CD61 3X1TD 1P3KD 3X1VC 4J8VA 4E2XA 3CCEZ 2M48A 1HQ3D 4MD7A 3CCL1 5B2ID 1M19D 2F4OA 3LJAD 1Y1VS 1TZYD 3FQQA 2L5AA 1VQOZ 2JA7I 3AZFA 1BH9A 3R45B 3W99A 3BG1B 4Y7NI 3H0LC 4H9SA 3REKC 2LIYA 3S17I 3TU4B 3B0DC 2DF4C 1YJNZ 2O53A 1VQLZ 2ZY5A 3AYWB 3AZHA 3H0GI 3I4MI 5GT0C 3MVDB 1VQ61 5GXQC 2CWEA 3TU4D 4YM6B 2F8NK 1VQ51 1S32C 5JRGA 3X1VB 3D2LA 4Z5TC 3AYWD 2LFUA 4RVDA 3JAMf 1K83I 3MVDD 3NQJB 4E33A 1RO0A 4YM6D 3CMA1 2Y2JA 2Y2GA 3X1VD 3CC2Z 3REKB 2BJOA 5DNNA 3FQMA 2OTJ1 3X1UA 3O62A 1LQLA 1F1EA 1P34A 2NQBA 3S14I 3REKD 2BYMB 2R92I 3W97A 5GT0B 5GXQB 5B0ZC 4WU8A 3J81b 3S1RI 1S32B 3CCUZ 3CCMZ 2ZM5A 2QR1B 5GT0D 3J80b 5GXQD 4YS3C 1SFOI 3GTKI 1W2EA 5CPIA 1S32D 1F66A 5DNMA 3REIC 1Q16A 3NFZA 1PFTA 4BY1I 3S16I 2HU9A 1VQO1 1BFMA 4RV9A 5FUGA 2BYKA 5CPJC 4KUDB 3REHA 5B0ZB 3AZJA 2AROA 4Z2MG 3HOXI 1VQL1 1KQSZ 2JS4A 3KXBA 3UT9C 1YUAA 4KUDD 3MONA 3B6GA 1P3OA 2NVYI 5B0ZD 3LZ0C 4YS3B 4KGCC 3F3PC 2H85A 2QRDB 3REIB 5B1LA 2Y0SA 4A3LI 3OW2Z 1EQZA 3G6E1 4YS3D 4E2WA 1YJWZ 5AVBC 3VMIA 1KRLA 1ULYA 3REID 1P3KA 5CPJB 2HIOA 3T4NB 3VB9A 1HQ3A 3MGPC 2K3RA 1VQ7Z 3LJAA 1TZYA 5BT1C 1K9M2 5FLXb 4XUJC 5CPJD 2XD1A 3UT9B 3AZEC 1WIIA 5AN9F 5FLMI 3NH5A 1K732 1VQ4Z 4KGCB 1JFIB 1PZRA 5CM2M 2NVTI 1S721 3R45A 3UT9D 1P3IC 3GTQI 1VQK1 4WJ3C 3G4SZ 4KGCD 1TWCI 5AVBB 2QEX1 3MNNC 3UTAC 3UTBC 3NQUB 1AOIC 1M1K2 3MGPB 3VH5A 5BS7A 1JWHC
chains in the Genus database with same CATH topology
5AVBD 4NFTA 1WWIA 2AKLA 1ID3C 3CPWZ 1Q862 4J8XC 3X1VA 2RPRA 3MGQB 3MGPD 1TWHI 3G711 4MD9A 3NH8A 3AL0C 1N8R1 4NE3A 3EERA 4XUJD 2VF1A 3MGQD 3REKA 1P3IB 3EPLA 2F8NB 5B31C 4WNNB 1QYPA 4HH4A 3S1MI 1VQM1 3WTPC 3MNNB 1KX4C 1AOIB 3V9RB 2QA4Z 1Q821 1P3ID 2F8ND 1JJ2Y 4UPKA 5GT0A 2VUMI 3S1QI 1KX3C 3FDDA 1VQ91 3MNND 3UTBD 1S32A 4J8XB 1ID3B 1AOID 4Z5TA 3AZNC 3X1SB 3CPWY 3MGSC 2Y2HA 2E2II 3S2HI 4LD9C 4MH4A 3I561 5IT9f 1ID3D 3I4NI 2KPIA 4J8XD 4H9NA 3X1SD 1VQ41 5B31B 3AZGC 2YADA 3CXCY 2V8IA 3WTPB 3AFAC 1KX4B 1N1JA 4MONA 3W96B 5B31D 2R93I 3CCRZ 5B0ZA 4Z66C 3CD6Z 3WTPD 2JSSA 1KX4D 4A3JI 1YHQ1 2BG1A 3AZNB 3W96D 5IP7I 3CCLZ 4LD9B 1YJN1 3B6FC 1VQ81 3A1IA 2IO5B 1KU5A 3AZND 1HTAA 5AY8C 2JUBA 4MXUA 4NBBA 4A3DI 3AZGB 2Y2LA 4LD9D 4G92B 3CCV1 3AZIC 3AFAB 5CPJA 4H9QB 2Y2NA 2RHBA 3AZGD 4NBEA 1VQ6Z 4Z66B 1KX5C 2F8NG 5B2JC 3AFAD 3X1TC 2QA41 1Q812 4CSRB 3UT9A 2I3CA 3CCJZ 1KD11 1QF8A 1M902 4Z66D 3LZ0A 1JFIA 3M3YI 3VMGA 3VH5W 3CMAZ 5D1PA 5AY8B 5CPKC 5T64A 1NJI2 2NVXI 2OTJZ 3AZIB 5AVBA 5C4JI 1T3UA 1VLAA 5AY8D 1W2BY 3MGPA 2NZDC 2PMZA 3AZID 5B2JB 2B63I 5B40A 4XUJA 3AZEA 3AYWC 3MVDC 4YM6C 5AV6C 1P3AC 1P3BC 5B2JD 1KX5D 1S7MA 1USPA 2F4MA 2G2KA 4CL1A 2GU2A 5CPKB 1P3IA 1TWFI 5B33A 4WNNA 5C3IC 3B0CT 3AN2C 3MNNA 3UTBA 3UTAA 1AOIA 5CPKD 2JA8I 2NZDB 3VH6T 2V8KA 1ID3A 5T6BA 4DK1A 4J8XA 4QLCC 3W98C 2NZDD 3GTGI 1P3AB 5AV6B 1P3BB 2DE7A 1Q7Y1 3CCJ1 3EEDA 5F99C 3AZMC 3HOWI 5B31A 5C3IB 4X6AI 1P3BD 5AV6D 1P3AD 5AV5B 2QKDA 3WTPA 3G6EZ 3AN2B 5B0YC 3WA9C 4JJNC 1KX3A 4E30A 5AV5D 3AN2D 2WAQA 3AZNA 4H9RB 4KUDC 4QLCB 3MGSA 3W98B 3ESWA 2PYOC 3GTMI 5BNXB 4LD9A 3D6WA 5BO0B 3REJA 3GTJI 1S72Z 5F99B 4QLCD 3AZMB 3W98D 1VQKZ 3GCFA 2XD5A 3NH4A 1M1K1 2QEXZ 1P3LC 4A93I 5B0YB 4NBGA 3WA9B 5F99D 4H9QA 3AZMD 4NFRA 4JJNB 5A2Qf 4Z66A 5JA4A 4WV4B 2F2AC 4EO5C 5B0YD 2JCHA 4CSRA 4E45A 5AVCC 3RELC 4JJND 2PYOB 3WA9D 3G71Z 3M4OI 4BBSI 3IX0A 2GTIA 2Y2MA 3B6FA 2FJ7C 5AY8A 1B67A 2PYOD 2JE5A 1VQMZ 3AZIA 1Z2CB 1P3LB 2E2JI 3PO3S 1KC82 2Y2PA 4NOZA 3EG5B 2W8SA 1VQPZ 1KX5A 1WW9A 1VQ9Z 2DE5A 2E9HA 3X1TA 1P3LD 2OTL1 3RELB 4EO5B 1P3FC 5AVCB 1ML8A 1TAFA 5B2IA 1M19A 1Y1WI 3I56Z 4TNUA 4H9OB 3RELD 2FJ7B 3MGQC 5AVCD 5CPKA 1Y1VI 5B32B 3Q87A 5BNVB 2Y2OA 3CC71 2YFVB 5B1MC 2FJ7D 5B32D 3TU4A 1WCMI 2ZY2A 1M18B 1YHQZ 3H0RC 3CCS1 1P3FB 3AYWA 2R6MA 2JA5I 1JJ2Z 3MVDA 2G5IC 4YM6A 5AV6A 5B24B 2YFWB 3AV2C 1P3AA 1P3BA 4G91B 1M18D 5GSUC 1VQ8Z 1P3FD 3AV1C 3X1SC 2F8NH 4RVGA 4J8UC 2R7ZI 3NQJA 2KI7B 2VUGA 1QVGZ 4HGAB 4ZBJC 5B24D 3CCVZ 3LELC 3AN2A 5B1MB 5KDMB 3CCQ1 5E5AC 2PK7A 3KIHA 3CXCZ 2W03A 2Y2KA 4E31A 3KWQC 2PM9A 5B1MD 3W96C 3H3VJ 2BYMA 1M1AB 2W04A 4QLCA 3W98A 1VQP1 5GXQA 4AWLC 4X23C 5BNXA 2V8JA 3GTLI 3AV2B 1X3WA 1P3MC 1YIJ1 1K8A2 5GSUB 3HOZI 3AV1B 1M1AD 4J8UB 3AZMA 4UUZB 1QVGY 4ZBJB 4H9PB 3CC41 3AV2D 2EGTA 3LELB 3HOYI 3I551 2IO5C 5GSUD 3AV1D 5B0YA 3WA9A 5E5AB 4J8UD 4E2YA 5AV9B 3LUSA 4KHAB 4G92C 4J8WB 2Y2QA 3S15I 5B32G 3LELD 3KWQB 1BH8B 1P3PB 4RVFA 4KUDA 5E5AD 3MGRC 5AV9D 4AWLB 4X23B 4J8VB 2JNYA 4CAYB 2OOYB 1P3MB 4M6BA 3KWQD 1P3PD 3EPHA 2O4HA 3C1CC 3AZFB 4X23D 4J8VD 4YS3A 3FKII 3C1BC 1P3MD 2ZAEB 3HOVI 3REIA 1P3LA 1ZB8A 3F6TA 1L1OC 3A1KA 3AZFD 1P34C 2NQBC 3BG0B 3AZHB 2FFFB 1W2BZ 3RELA 2J8PA 5AVCA 3MGRB 1RO4A 4MRIA 3AZHD 3F3FC 4A3CI 2DE6A 4BBRI 3J7A4 2QLVB 4H9OA 4NBDA 3C1CB 2FJ7A 2P3YA 3MGRD 5DNMC 4A3FI 4KGCA 3C1BB 1NUIA 5BNVA 5C44I 2YFVA 1YIT1 3X1UB 3C1CD 3O62B 1X0TA 2YU9I 3LZ1C 1P34B 2NQBB 1N2FA 1RLYA 3EPJA 3C1BD 3B0BA 3S2DI 4WU8B 3NQUA 1ZLAC 5LL6f 3X1UD 3EPKA 3O62D 3AZJC 1Z01A 1P34D 2NQBD 4WU8D 2Q4ZA 3MGQA 1I3QI 5C4XI 5DNMB 1N8R2 2K5RA 3HKZA 5B1MA 2Y2IA 4Z2MH 3LZ1B 5DNMD 2F8NA 2BYKB 5AV5C 5D1OB 1Q822 3JAMb 2G5HC 3V9RA 1ZLAB 3WAAC 2AROB 3AZJB 3LZ1D 2JMOA 3GTOI 3B6GB 3AV2A 5T67A 5GSUA 1ZLAD 4MD8A 2RVQD 3X1SA 2AROD 3B0CW 3AZJD 1H3OB 3AV1A 3U50C 1YJ91 4UUZA 3IP4C 4NBFA 4A3EI 3B6GD 3RZOI 3HOUI 3LELA 2E2HI 4E32A 3CQZI 4WZSB 3S1NI 5E5AA 5CHLB 4KHAA 2HIOB 1KX4A 2RBLA 3KWQA 1BH8A 3MZLB 2OTLZ 3W96A 3WAAB 5GT3C 4HGYA 4X23A 2HIOD 1YI2Z 4CAYA 1K9M1 1P3MA 1VQN1 1K731 3WAAD 3A6NC 5A2Qb 3CME1 2HUEC 4QTUA 1QVFY 3CC7Z 4DRAA 4NBHA 3WKJC 3QWUA 3AZGA 4XZQC 3AZLC 4WU9C 3AFAA 4NH1C 3PO2I 3CCSZ 2UWXA 4NB9A 5GT3B 3MGRA 4R8PC 4AYBA 2ZY4A 1Q861 2QRCB 1KD12 4A3II 3A6NB 3C1CA 5GT3D 2HUEB 3C1BA 2J6AA 3B0DB 3A6ND 3WKJB 3NDIA 4NBCA 5B32C 4XZQB 5AV8C 3AZLB 1X3ZA 3CCQZ 4WU9B 4EWCA 3KUYC 3WKJD 3K7AI 4XZQD 4R8PB 3AZLD 4Z5TB 4WU9D 1K8A1 5B2JA 1M18C 1YIJZ 1TWAI 3H0MC 4R8PD 2HF1A 2VQRA 2QREB 4H9NB 4Z5TD 5B24C 3CCE1 1YI21 3CC4Z 4G91C 2WB1A 3I55Z 3VMHA 3J81f 5AV8B 4E44A 1N1JB 3LZ1A 4HGAC 3KUYB 5D1OA 3J80f 3KIFA 1ZLAA 5CP6C 2NZDA 5AV8D 1Z02A 1P9NA 4NB8A 3KUYD 1P3GC 1RO2A 2RT9A 1M1AC 1H3OA 2GTHA 4NE6A 2JR6A 1Q7Y2 5G49B 2IZ4A 2OOXB 4E2ZA 4ZUXC 3AZKC 3CC21 5AV5A 1U35C 5CP6B 3WAAA 5B40C 5AV9C 1KQSY 2CV5C 5IT9b 4J8WC 4QTTA 1P3GB 1P3PC 1Q811 2OZKA 1M901 3LZ0B 3IF8A 4H9RA 5CP6D 1I50I 3CCM1 3CCU1 1ZH1A 3P5JB 4J8VC 1P3GD 5BO0A 4NBAA 5B33C 4DGLA 3OW2Y 3LZ0D 1DL6A 1YITZ 5F99A 4ZUXB 3GKQA 3AZFC 3W99C 3AZKB 2IZ3A 3NDJA 4HGZA 4H9SC 5FLXf 1NJI1 1U35B 1TWGI 4A3BI 4ZUXD 5B40B 5GT3A 4JJNA 3AZKD 2CV5B 4XUJB 3AZEB 3AZHC 4A3MI 1U35D 1YUKA 4BY7I 3A6NA 5BT1D 5JRGC 5B40D 2PYOA 3VH6A 2CV5D 1USPB 4J8WD 3AZED 2DQNC 1RNIA 3I07A 3MZKB 5B33B 2JA6I 2ZY3A 4NE5A 1R4VA 3WKJA 1NP6A 1BH9B 3UTBB 4XZQA 3UTAB 3AZLA 3W99B 4S1TA 4WU9A 3PO3I 5B33D 5DNNC 2M6NA 1YJW1 3X1UC 3IFUA 3O62C 3W99D 3UTAD 4R8PA 3KFUG 1I6HI 4DRBA 1R9TI 3W97C 1VQ71 4DQYB 4WU8C 3RZDI 1Q9CA 5JRGB 3REJC 1YJ9Z 1WWSA 4A3KI 5CPIC 5JRGD 1F66C 3D9XA 5B32A 5AV8A 4XX2A 3KUYA 3G4S1 5DNNB 1KX3B 3WTPE 1TFIA 3W97B 1ZB9A 3MGSB 1M18A 3REHC 5DNND 1KX3D 1VQNZ 1P3FA 2RVQC 2AROC 3GTMS 3REJB 4RVHA 3KXBC 3CMEZ 5B24A 2YFWA 1B6WA 5G49A 3MGSD 1P3OC 3B6GC 3W97D 3TE5B 3VTNA 5CPIB 3REJD 1F66B 5B1LC 3VH5T 1EQZC 4RS4A 5KDMA 5JA4B 5CPID 5CP6A 1P3KC 1F66D 5FUGB 1VQ5Z 4A3GI 2HIOC 5C3EI 1A7WA 1HQ3C 1P3GA 3REHB 3TDHB 5B2IC 1M19C 3LJAC 1TZYC 1M1AA 3B6FB 3GTPI 3KXBB 4BXXI 2P28A 1P3OB 3REHD 3B6FD 4J8UA 4ZUXA 1RQFA 2NVQI 5B1LB 3KXBD 3AZKA 2RIQA 4H9PA 1Z03A 1QVFZ 2LY8A 1U35A 3VH6W 1P3OD 1EQZB 3TU4C 5IP9I 1KX5B 1KC81 5B31G 3X1TB 1P3KB 5AV9A 5B1LD 2Q51A 4Y52I 2CV5A 4J8WA 1HQ3B 1P3PA 1TAFB 3KSYA 5BS7C 5B2IB 1M19B 1EQZD 3LJAB 3CCR1 1TZYB 3CD61 3X1TD 1P3KD 3X1VC 4J8VA 4E2XA 3CCEZ 2M48A 1HQ3D 4MD7A 3CCL1 5B2ID 1M19D 2F4OA 3LJAD 1Y1VS 1TZYD 3FQQA 2L5AA 1VQOZ 2JA7I 3AZFA 1BH9A 3R45B 3W99A 3BG1B 4Y7NI 3H0LC 4H9SA 3REKC 2LIYA 3S17I 3TU4B 3B0DC 2DF4C 1YJNZ 2O53A 1VQLZ 2ZY5A 3AYWB 3AZHA 3H0GI 3I4MI 5GT0C 3MVDB 1VQ61 5GXQC 2CWEA 3TU4D 4YM6B 2F8NK 1VQ51 1S32C 5JRGA 3X1VB 4Z5TC 3AYWD 2LFUA 4RVDA 3JAMf 1K83I 3MVDD 3NQJB 4E33A 1RO0A 4YM6D 3CMA1 2Y2JA 2Y2GA 3X1VD 3CC2Z 3REKB 2BJOA 5DNNA 3FQMA 2OTJ1 3X1UA 3O62A 1LQLA 1F1EA 1P34A 2NQBA 3S14I 3REKD 2BYMB 2R92I 3W97A 5GT0B 5GXQB 5B0ZC 4WU8A 3J81b 3S1RI 1S32B 3CCUZ 3CCMZ 2ZM5A 2QR1B 5GT0D 3J80b 5GXQD 4YS3C 1SFOI 3GTKI 1W2EA 5CPIA 1S32D 1F66A 5DNMA 3REIC 3NFZA 4BY1I 1PFTA 3S16I 2HU9A 1VQO1 1BFMA 4RV9A 5FUGA 2BYKA 5CPJC 4KUDB 3REHA 5B0ZB 3AZJA 2AROA 4Z2MG 3HOXI 1VQL1 1KQSZ 2JS4A 3KXBA 3UT9C 1YUAA 4KUDD 3MONA 3B6GA 1P3OA 2NVYI 5B0ZD 3LZ0C 4YS3B 4KGCC 3F3PC 2H85A 2QRDB 3REIB 5B1LA 2Y0SA 4A3LI 3OW2Z 1EQZA 3G6E1 4YS3D 4E2WA 1YJWZ 5AVBC 3VMIA 1KRLA 1ULYA 3REID 1P3KA 5CPJB 2HIOA 3T4NB 3VB9A 1HQ3A 3MGPC 2K3RA 1VQ7Z 3LJAA 1TZYA 5BT1C 1K9M2 5FLXb 4XUJC 5CPJD 2XD1A 3UT9B 3AZEC 1WIIA 5AN9F 5FLMI 3NH5A 1K732 1VQ4Z 4KGCB 1JFIB 1PZRA 5CM2M 2NVTI 1S721 3R45A 3UT9D 1P3IC 3GTQI 1VQK1 4WJ3C 3G4SZ 4KGCD 1TWCI 5AVBB 2QEX1 3MNNC 3UTAC 3UTBC 3NQUB 1AOIC 1M1K2 3MGPB 3VH5A 5BS7A 1JWHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 5AVB D;  4NFT A;  1WWI A;  2AKL A;  1ID3 C;  3CPW Z;  1Q86 2;  4J8X C;  3X1V A;  2RPR A;  2AYD A;  3MGQ B;  3MGP D;  1TWH I;  3G71 1;  1WZN A;  4MD9 A;  3NH8 A;  3AL0 C;  1N8R 1;  4NE3 A;  3EER A;  4XUJ D;  2JIP A;  3MGQ D;  3REK A;  1P3I B;  3EPL A;  2F8N B;  5B31 C;  4WNN B;  1QYP A;  2VF1 A;  4HH4 A;  3S1M I;  1VQM 1;  3WTP C;  3MNN B;  1KX4 C;  1AOI B;  3V9R B;  2QA4 Z;  1Q82 1;  1P3I D;  2F8N D;  1JJ2 Y;  4UPK A;  5GT0 A;  2VUM I;  3S1Q I;  1KX3 C;  3FDD A;  1VQ9 1;  3MNN D;  3UTB D;  1S32 A;  4J8X B;  1ID3 B;  1AOI D;  4Z5T A;  3AZN C;  3X1S B;  3CPW Y;  3MGS C;  2Y2H A;  2E2I I;  3S2H I;  4LD9 C;  4MH4 A;  3I56 1;  5IT9 f;  1ID3 D;  3I4N I;  2KPI A;  4J8X D;  4H9N A;  3X1S D;  1VQ4 1;  5B31 B;  3AZG C;  2YAD A;  3CXC Y;  2V8I A;  3WTP B;  3AFA C;  1KX4 B;  1N1J A;  4MON A;  3W96 B;  5B31 D;  2R93 I;  3CCR Z;  5B0Z A;  4Z66 C;  3CD6 Z;  3WTP D;  2JSS A;  1KX4 D;  4A3J I;  1YHQ 1;  2BG1 A;  3AZN B;  3W96 D;  5IP7 I;  3CCL Z;  4LD9 B;  1YJN 1;  3B6F C;  1VQ8 1;  3A1I A;  2IO5 B;  1KU5 A;  3AZN D;  1HTA A;  5AY8 C;  2JUB A;  4MXU A;  4NBB A;  4A3D I;  3AZG B;  2Y2L A;  4LD9 D;  4G92 B;  3CCV 1;  3AZI C;  3AFA B;  2IV2 X;  5CPJ A;  4H9Q B;  2Y2N A;  2RHB A;  3AZG D;  4NBE A;  1VQ6 Z;  4Z66 B;  1KX5 C;  2F8N G;  5B2J C;  3AFA D;  3X1T C;  2QA4 1;  1Q81 2;  4CSR B;  3UT9 A;  2I3C A;  3CCJ Z;  1KD1 1;  1QF8 A;  1M90 2;  4Z66 D;  3LZ0 A;  1JFI A;  3M3Y I;  3VMG A;  3VH5 W;  3CMA Z;  5D1P A;  5AY8 B;  5CPK C;  5T64 A;  1NJI 2;  2NVX I;  2OTJ Z;  3AZI B;  5AVB A;  5C4J I;  1T3U A;  1VLA A;  5AY8 D;  1W2B Y;  3MGP A;  2NZD C;  2PMZ A;  3AZI D;  5B2J B;  2B63 I;  5B40 A;  4XUJ A;  3AZE A;  3AYW C;  3MVD C;  4YM6 C;  5AV6 C;  1P3A C;  1P3B C;  5B2J D;  1KX5 D;  1S7M A;  1USP A;  2F4M A;  2G2K A;  4CL1 A;  2GU2 A;  5CPK B;  1P3I A;  1TWF I;  5B33 A;  4WNN A;  5C3I C;  3B0C T;  3AN2 C;  3MNN A;  3UTB A;  3UTA A;  1AOI A;  5CPK D;  2JA8 I;  2NZD B;  3VH6 T;  2V8K A;  1ID3 A;  5T6B A;  4DK1 A;  4J8X A;  2JIO A;  4QLC C;  3W98 C;  2NZD D;  3GTG I;  1P3A B;  5AV6 B;  1P3B B;  2DE7 A;  1Q7Y 1;  3CCJ 1;  3EED A;  1FDI A;  5F99 C;  3AZM C;  3HOW I;  5B31 A;  5C3I B;  4X6A I;  1P3B D;  5AV6 D;  1P3A D;  5AV5 B;  2QKD A;  3WTP A;  3G6E Z;  3AN2 B;  5B0Y C;  3WA9 C;  4JJN C;  1KX3 A;  4E30 A;  5AV5 D;  2VPW A;  3AN2 D;  2WAQ A;  2VPZ A;  3AZN A;  4H9R B;  4KUD C;  4QLC B;  3MGS A;  3W98 B;  3ESW A;  2PYO C;  3GTM I;  5BNX B;  4LD9 A;  3D6W A;  5BO0 B;  3REJ A;  3GTJ I;  1S72 Z;  5F99 B;  4QLC D;  3AZM B;  3W98 D;  1VQK Z;  3GCF A;  2XD5 A;  3NH4 A;  1M1K 1;  2QEX Z;  1P3L C;  4A93 I;  5B0Y B;  4NBG A;  3WA9 B;  5F99 D;  4H9Q A;  3AZM D;  4NFR A;  4JJN B;  5A2Q f;  4Z66 A;  5JA4 A;  4WV4 B;  2F2A C;  4EO5 C;  5B0Y D;  2JCH A;  4CSR A;  4E45 A;  5AVC C;  3REL C;  4JJN D;  2PYO B;  3WA9 D;  3G71 Z;  3M4O I;  4BBS I;  3IX0 A;  2GTI A;  2Y2M A;  3B6F A;  2FJ7 C;  5AY8 A;  1B67 A;  2PYO D;  2JE5 A;  1VQM Z;  3AZI A;  1Z2C B;  1P3L B;  2E2J I;  3PO3 S;  1KC8 2;  2Y2P A;  4NOZ A;  3EG5 B;  2W8S A;  1VQP Z;  1KX5 A;  1WW9 A;  1VQ9 Z;  2DE5 A;  2E9H A;  3X1T A;  1P3L D;  1AA6 A;  2OTL 1;  3REL B;  4EO5 B;  1P3F C;  5AVC B;  1ML8 A;  1TAF A;  5B2I A;  1M19 A;  1Y1W I;  3I56 Z;  4TNU A;  4H9O B;  3REL D;  2FJ7 B;  3MGQ C;  5AVC D;  5CPK A;  1Y1V I;  5B32 B;  3Q87 A;  5BNV B;  2Y2O A;  3CC7 1;  2YFV B;  5B1M C;  2FJ7 D;  5B32 D;  3TU4 A;  1WCM I;  2ZY2 A;  1M18 B;  1YHQ Z;  3H0R C;  3CCS 1;  1P3F B;  3AYW A;  2R6M A;  2JA5 I;  1JJ2 Z;  3MVD A;  2G5I C;  4YM6 A;  5AV6 A;  5B24 B;  2YFW B;  3AV2 C;  1P3A A;  1P3B A;  4G91 B;  1M18 D;  5GSU C;  1VQ8 Z;  1P3F D;  3AV1 C;  3X1S C;  2F8N H;  4RVG A;  4J8U C;  2R7Z I;  2V45 A;  3NQJ A;  2KI7 B;  2JIQ A;  2VUG A;  4HGA B;  4ZBJ C;  5B24 D;  1QVG Z;  3CCV Z;  3LEL C;  3AN2 A;  5B1M B;  5KDM B;  3CCQ 1;  5E5A C;  2PK7 A;  3KIH A;  3CXC Z;  2W03 A;  2Y2K A;  4E31 A;  3KWQ C;  2PM9 A;  5B1M D;  3W96 C;  3H3V J;  2BYM A;  1M1A B;  2W04 A;  4QLC A;  3W98 A;  1VQP 1;  5GXQ A;  4AWL C;  4X23 C;  5BNX A;  2V8J A;  3GTL I;  3AV2 B;  1X3W A;  1P3M C;  1YIJ 1;  1K8A 2;  5GSU B;  3HOZ I;  3AV1 B;  1M1A D;  4J8U B;  3AZM A;  4UUZ B;  1QVG Y;  4ZBJ B;  4H9P B;  3CC4 1;  3AV2 D;  2EGT A;  3LEL B;  3HOY I;  3I55 1;  2IO5 C;  5GSU D;  3AV1 D;  5B0Y A;  3WA9 A;  5E5A B;  4J8U D;  4E2Y A;  5AV9 B;  3LUS A;  4KHA B;  4G92 C;  4J8W B;  2Y2Q A;  3S15 I;  5B32 G;  3LEL D;  3KWQ B;  1BH8 B;  1P3P B;  4RVF A;  3IR7 A;  4KUD A;  5E5A D;  3MGR C;  5AV9 D;  4AWL B;  4X23 B;  4J8V B;  2JNY A;  4CAY B;  2OOY B;  1P3M B;  4M6B A;  3KWQ D;  1P3P D;  3EPH A;  2O4H A;  3C1C C;  3AZF B;  4X23 D;  4J8V D;  4YS3 A;  3FKI I;  3C1B C;  1P3M D;  2ZAE B;  3HOV I;  3REI A;  1P3L A;  1ZB8 A;  3F6T A;  1L1O C;  3A1K A;  3AZF D;  1P34 C;  2NQB C;  3BG0 B;  3AZH B;  2FFF B;  1W2B Z;  3REL A;  2J8P A;  5AVC A;  3MGR B;  1RO4 A;  4MRI A;  3AZH D;  3F3F C;  4A3C I;  2DE6 A;  4BBR I;  3J7A 4;  2QLV B;  4H9O A;  4NBD A;  3C1C B;  2FJ7 A;  2P3Y A;  3MGR D;  5DNM C;  4A3F I;  4KGC A;  3C1B B;  1NUI A;  5BNV A;  5C44 I;  2YFV A;  1YIT 1;  3X1U B;  3C1C D;  3O62 B;  1X0T A;  2YU9 I;  3LZ1 C;  1P34 B;  2NQB B;  1N2F A;  1RLY A;  3EPJ A;  3C1B D;  3B0B A;  3S2D I;  4WU8 B;  3NQU A;  1ZLA C;  5LL6 f;  3X1U D;  3EPK A;  3O62 D;  3AZJ C;  1Z01 A;  1P34 D;  2NQB D;  4WU8 D;  2Q4Z A;  3MGQ A;  1I3Q I;  5C4X I;  5DNM B;  1N8R 2;  2K5R A;  1FDO A;  3HKZ A;  5B1M A;  2Y2I A;  4Z2M H;  3LZ1 B;  5DNM D;  2F8N A;  2BYK B;  5AV5 C;  5D1O B;  1Q82 2;  3JAM b;  2G5H C;  3V9R A;  1ZLA B;  3WAA C;  2ARO B;  3AZJ B;  3LZ1 D;  2JMO A;  3GTO I;  3B6G B;  3AV2 A;  5T67 A;  5GSU A;  1ZLA D;  4MD8 A;  2RVQ D;  3X1S A;  2ARO D;  3B0C W;  3AZJ D;  1H3O B;  3AV1 A;  3U50 C;  1YJ9 1;  4UUZ A;  3IP4 C;  4NBF A;  4A3E I;  3B6G D;  3RZO I;  3HOU I;  3LEL A;  1WJ2 A;  2E2H I;  4E32 A;  3CQZ I;  4WZS B;  3S1N I;  5E5A A;  5CHL B;  4KHA A;  2HIO B;  1KX4 A;  2RBL A;  3KWQ A;  1BH8 A;  2NAP A;  3MZL B;  2OTL Z;  3W96 A;  3WAA B;  5GT3 C;  4HGY A;  4X23 A;  2HIO D;  1YI2 Z;  4CAY A;  1K9M 1;  1P3M A;  1VQN 1;  1K73 1;  3WAA D;  3A6N C;  1Y8C A;  5A2Q b;  3CME 1;  2HUE C;  4QTU A;  1QVF Y;  3CC7 Z;  4DRA A;  4NBH A;  3WKJ C;  3QWU A;  3AZG A;  4XZQ C;  3AZL C;  4WU9 C;  3AFA A;  4NH1 C;  3PO2 I;  3CCS Z;  2UWX A;  4NB9 A;  5GT3 B;  3MGR A;  4R8P C;  4AYB A;  2ZY4 A;  1Q86 1;  2QRC B;  1KD1 2;  4A3I I;  3A6N B;  3C1C A;  5GT3 D;  2HUE B;  3C1B A;  2J6A A;  3B0D B;  3A6N D;  3WKJ B;  3NDI A;  4NBC A;  5B32 C;  4XZQ B;  5AV8 C;  3AZL B;  1X3Z A;  3CCQ Z;  4WU9 B;  4EWC A;  3KUY C;  2VPY A;  3WKJ D;  3K7A I;  4XZQ D;  4R8P B;  3AZL D;  4Z5T B;  4WU9 D;  1K8A 1;  5B2J A;  1M18 C;  1YIJ Z;  1TWA I;  3H0M C;  4R8P D;  2HF1 A;  2VQR A;  2QRE B;  4H9N B;  4Z5T D;  5B24 C;  3CCE 1;  1YI2 1;  3CC4 Z;  4G91 C;  2WB1 A;  3I55 Z;  3VMH A;  3J81 f;  5AV8 B;  4E44 A;  1N1J B;  3LZ1 A;  4HGA C;  2E7Z A;  2V3V A;  3KUY B;  5D1O A;  3J80 f;  3KIF A;  1ZLA A;  5CP6 C;  2NZD A;  5AV8 D;  1Z02 A;  1P9N A;  4NB8 A;  3KUY D;  1P3G C;  1RO2 A;  2RT9 A;  1SIW A;  1M1A C;  1H3O A;  2GTH A;  4NE6 A;  2JR6 A;  1Q7Y 2;  5G49 B;  2IZ4 A;  2OOX B;  4E2Z A;  4ZUX C;  3AZK C;  3CC2 1;  5AV5 A;  1U35 C;  5CP6 B;  3WAA A;  5B40 C;  5AV9 C;  1KQS Y;  2CV5 C;  2JIM A;  4J8W C;  4QTT A;  5IT9 b;  1P3G B;  1P3P C;  1Q81 1;  2OZK A;  1M90 1;  3LZ0 B;  3IF8 A;  4H9R A;  5CP6 D;  1I50 I;  3CCM 1;  3CCU 1;  1ZH1 A;  3P5J B;  4J8V C;  1P3G D;  5BO0 A;  4NBA A;  5B33 C;  4DGL A;  3OW2 Y;  3LZ0 D;  1DL6 A;  1YIT Z;  5F99 A;  4ZUX B;  3GKQ A;  3AZF C;  3W99 C;  3AZK B;  2IZ3 A;  3NDJ A;  4HGZ A;  4H9S C;  5FLX f;  1NJI 1;  1U35 B;  1TWG I;  4A3B I;  4ZUX D;  5B40 B;  5GT3 A;  4JJN A;  3AZK D;  2CV5 B;  4XUJ B;  3AZE B;  3AZH C;  4A3M I;  1U35 D;  1YUK A;  4BY7 I;  3A6N A;  5BT1 D;  5JRG C;  5B40 D;  2PYO A;  3VH6 A;  2CV5 D;  1USP B;  4J8W D;  3AZE D;  2DQN C;  1RNI A;  3I07 A;  3MZK B;  5B33 B;  2JA6 I;  2ZY3 A;  4NE5 A;  1R4V A;  3WKJ A;  1NP6 A;  1BH9 B;  3UTB B;  4XZQ A;  3UTA B;  3AZL A;  3W99 B;  4S1T A;  4WU9 A;  3PO3 I;  5B33 D;  5DNN C;  2M6N A;  1YJW 1;  3X1U C;  3IFU A;  3O62 C;  3W99 D;  3UTA D;  4R8P A;  3KFU G;  1I6H I;  4DRB A;  1R9T I;  3W97 C;  1VQ7 1;  4DQY B;  4WU8 C;  3RZD I;  1Q9C A;  5JRG B;  3REJ C;  1YJ9 Z;  1WWS A;  4A3K I;  5CPI C;  5JRG D;  1F66 C;  3D9X A;  5B32 A;  5AV8 A;  4XX2 A;  3KUY A;  3G4S 1;  5DNN B;  1KX3 B;  3WTP E;  1TFI A;  3W97 B;  1ZB9 A;  3MGS B;  1M18 A;  3REH C;  5DNN D;  1KX3 D;  2VPX A;  1P3F A;  2RVQ C;  1VQN Z;  2ARO C;  3GTM S;  3REJ B;  4RVH A;  3KXB C;  1QXF A;  3CME Z;  5B24 A;  2YFW A;  1B6W A;  5G49 A;  3MGS D;  1P3O C;  3B6G C;  3W97 D;  3TE5 B;  3VTN A;  5CPI B;  3REJ D;  1F66 B;  5B1L C;  3VH5 T;  1EQZ C;  4RS4 A;  5KDM A;  5JA4 B;  5CPI D;  2LEX A;  5CP6 A;  1P3K C;  1F66 D;  5FUG B;  1VQ5 Z;  4A3G I;  2HIO C;  5C3E I;  1A7W A;  1HQ3 C;  1P3G A;  3REH B;  3TDH B;  5B2I C;  1M19 C;  3LJA C;  1TZY C;  1M1A A;  3B6F B;  3GTP I;  3KXB B;  4BXX I;  2P28 A;  1P3O B;  3REH D;  3B6F D;  4J8U A;  4ZUX A;  1RQF A;  2NVQ I;  5B1L B;  3KXB D;  3AZK A;  2RIQ A;  4H9P A;  1Z03 A;  1QVF Z;  2LY8 A;  1U35 A;  3VH6 W;  1P3O D;  1EQZ B;  3TU4 C;  5IP9 I;  1KX5 B;  1KC8 1;  5B31 G;  3X1T B;  1P3K B;  5AV9 A;  5B1L D;  2Q51 A;  4Y52 I;  2CV5 A;  4J8W A;  1HQ3 B;  1P3P A;  1TAF B;  3KSY A;  5BS7 C;  5B2I B;  1M19 B;  1EQZ D;  3LJA B;  2JIR A;  1TZY B;  3CCR 1;  3CD6 1;  3X1T D;  1P3K D;  3X1V C;  4J8V A;  4E2X A;  3CCE Z;  2M48 A;  1HQ3 D;  4MD7 A;  3CCL 1;  5B2I D;  1M19 D;  2F4O A;  3LJA D;  1Y1V S;  1TZY D;  3FQQ A;  2L5A A;  1VQO Z;  2JA7 I;  3AZF A;  1BH9 A;  3R45 B;  3W99 A;  3BG1 B;  4Y7N I;  3H0L C;  4H9S A;  3REK C;  2LIY A;  3S17 I;  3TU4 B;  3B0D C;  2DF4 C;  1YJN Z;  2O53 A;  1VQL Z;  2ZY5 A;  3AYW B;  3AZH A;  3H0G I;  3I4M I;  5GT0 C;  3MVD B;  1VQ6 1;  5GXQ C;  2CWE A;  3TU4 D;  4YM6 B;  2F8N K;  1VQ5 1;  1S32 C;  5JRG A;  3X1V B;  3D2L A;  4Z5T C;  3AYW D;  2LFU A;  4RVD A;  3JAM f;  1K83 I;  3MVD D;  3NQJ B;  4E33 A;  1RO0 A;  4YM6 D;  3CMA 1;  2Y2J A;  2Y2G A;  3X1V D;  3CC2 Z;  3REK B;  2BJO A;  5DNN A;  3FQM A;  2OTJ 1;  3X1U A;  3O62 A;  1LQL A;  1F1E A;  1P34 A;  2NQB A;  3S14 I;  3REK D;  2BYM B;  2R92 I;  3W97 A;  5GT0 B;  5GXQ B;  5B0Z C;  4WU8 A;  3J81 b;  3S1R I;  1S32 B;  3CCU Z;  3CCM Z;  2ZM5 A;  2QR1 B;  5GT0 D;  3J80 b;  5GXQ D;  4YS3 C;  1SFO I;  3GTK I;  1W2E A;  5CPI A;  1S32 D;  1F66 A;  5DNM A;  3REI C;  1Q16 A;  3NFZ A;  1PFT A;  4BY1 I;  3S16 I;  2HU9 A;  1VQO 1;  1BFM A;  4RV9 A;  5FUG A;  2BYK A;  5CPJ C;  4KUD B;  3REH A;  5B0Z B;  3AZJ A;  2ARO A;  4Z2M G;  3HOX I;  1VQL 1;  1KQS Z;  2JS4 A;  3KXB A;  3UT9 C;  1YUA A;  4KUD D;  3MON A;  3B6G A;  1P3O A;  2NVY I;  5B0Z D;  3LZ0 C;  4YS3 B;  4KGC C;  3F3P C;  2H85 A;  2QRD B;  3REI B;  5B1L A;  2Y0S A;  4A3L I;  3OW2 Z;  1EQZ A;  3G6E 1;  4YS3 D;  4E2W A;  1YJW Z;  5AVB C;  3VMI A;  1KRL A;  1ULY A;  3REI D;  1P3K A;  5CPJ B;  2HIO A;  3T4N B;  3VB9 A;  1HQ3 A;  3MGP C;  2K3R A;  1VQ7 Z;  3LJA A;  1TZY A;  5BT1 C;  1K9M 2;  5FLX b;  4XUJ C;  5CPJ D;  2XD1 A;  3UT9 B;  3AZE C;  1WII A;  5AN9 F;  5FLM I;  3NH5 A;  1K73 2;  1VQ4 Z;  4KGC B;  1JFI B;  1PZR A;  5CM2 M;  2NVT I;  1S72 1;  3R45 A;  3UT9 D;  1P3I C;  3GTQ I;  1VQK 1;  4WJ3 C;  3G4S Z;  4KGC D;  1TWC I;  5AVB B;  2QEX 1;  3MNN C;  3UTA C;  3UTB C;  3NQU B;  1AOI C;  1M1K 2;  3MGP B;  3VH5 A;  5BS7 A;  1JWH C; 
#chains in the Genus database with same CATH homology
 5AVB D;  4NFT A;  1WWI A;  2AKL A;  1ID3 C;  3CPW Z;  1Q86 2;  4J8X C;  3X1V A;  2RPR A;  3MGQ B;  3MGP D;  1TWH I;  3G71 1;  4MD9 A;  3NH8 A;  3AL0 C;  1N8R 1;  4NE3 A;  3EER A;  4XUJ D;  2VF1 A;  3MGQ D;  3REK A;  1P3I B;  3EPL A;  2F8N B;  5B31 C;  4WNN B;  1QYP A;  4HH4 A;  3S1M I;  1VQM 1;  3WTP C;  3MNN B;  1KX4 C;  1AOI B;  3V9R B;  2QA4 Z;  1Q82 1;  1P3I D;  2F8N D;  1JJ2 Y;  4UPK A;  5GT0 A;  2VUM I;  3S1Q I;  1KX3 C;  3FDD A;  1VQ9 1;  3MNN D;  3UTB D;  1S32 A;  4J8X B;  1ID3 B;  1AOI D;  4Z5T A;  3AZN C;  3X1S B;  3CPW Y;  3MGS C;  2Y2H A;  2E2I I;  3S2H I;  4LD9 C;  4MH4 A;  3I56 1;  5IT9 f;  1ID3 D;  3I4N I;  2KPI A;  4J8X D;  4H9N A;  3X1S D;  1VQ4 1;  5B31 B;  3AZG C;  2YAD A;  3CXC Y;  2V8I A;  3WTP B;  3AFA C;  1KX4 B;  1N1J A;  4MON A;  3W96 B;  5B31 D;  2R93 I;  3CCR Z;  5B0Z A;  4Z66 C;  3CD6 Z;  3WTP D;  2JSS A;  1KX4 D;  4A3J I;  1YHQ 1;  2BG1 A;  3AZN B;  3W96 D;  5IP7 I;  3CCL Z;  4LD9 B;  1YJN 1;  3B6F C;  1VQ8 1;  3A1I A;  2IO5 B;  1KU5 A;  3AZN D;  1HTA A;  5AY8 C;  2JUB A;  4MXU A;  4NBB A;  4A3D I;  3AZG B;  2Y2L A;  4LD9 D;  4G92 B;  3CCV 1;  3AZI C;  3AFA B;  5CPJ A;  4H9Q B;  2Y2N A;  2RHB A;  3AZG D;  4NBE A;  1VQ6 Z;  4Z66 B;  1KX5 C;  2F8N G;  5B2J C;  3AFA D;  3X1T C;  2QA4 1;  1Q81 2;  4CSR B;  3UT9 A;  2I3C A;  3CCJ Z;  1KD1 1;  1QF8 A;  1M90 2;  4Z66 D;  3LZ0 A;  1JFI A;  3M3Y I;  3VMG A;  3VH5 W;  3CMA Z;  5D1P A;  5AY8 B;  5CPK C;  5T64 A;  1NJI 2;  2NVX I;  2OTJ Z;  3AZI B;  5AVB A;  5C4J I;  1T3U A;  1VLA A;  5AY8 D;  1W2B Y;  3MGP A;  2NZD C;  2PMZ A;  3AZI D;  5B2J B;  2B63 I;  5B40 A;  4XUJ A;  3AZE A;  3AYW C;  3MVD C;  4YM6 C;  5AV6 C;  1P3A C;  1P3B C;  5B2J D;  1KX5 D;  1S7M A;  1USP A;  2F4M A;  2G2K A;  4CL1 A;  2GU2 A;  5CPK B;  1P3I A;  1TWF I;  5B33 A;  4WNN A;  5C3I C;  3B0C T;  3AN2 C;  3MNN A;  3UTB A;  3UTA A;  1AOI A;  5CPK D;  2JA8 I;  2NZD B;  3VH6 T;  2V8K A;  1ID3 A;  5T6B A;  4DK1 A;  4J8X A;  4QLC C;  3W98 C;  2NZD D;  3GTG I;  1P3A B;  5AV6 B;  1P3B B;  2DE7 A;  1Q7Y 1;  3CCJ 1;  3EED A;  5F99 C;  3AZM C;  3HOW I;  5B31 A;  5C3I B;  4X6A I;  1P3B D;  5AV6 D;  1P3A D;  5AV5 B;  2QKD A;  3WTP A;  3G6E Z;  3AN2 B;  5B0Y C;  3WA9 C;  4JJN C;  1KX3 A;  4E30 A;  5AV5 D;  3AN2 D;  2WAQ A;  3AZN A;  4H9R B;  4KUD C;  4QLC B;  3MGS A;  3W98 B;  3ESW A;  2PYO C;  3GTM I;  5BNX B;  4LD9 A;  3D6W A;  5BO0 B;  3REJ A;  3GTJ I;  1S72 Z;  5F99 B;  4QLC D;  3AZM B;  3W98 D;  1VQK Z;  3GCF A;  2XD5 A;  3NH4 A;  1M1K 1;  2QEX Z;  1P3L C;  4A93 I;  5B0Y B;  4NBG A;  3WA9 B;  5F99 D;  4H9Q A;  3AZM D;  4NFR A;  4JJN B;  5A2Q f;  4Z66 A;  5JA4 A;  4WV4 B;  2F2A C;  4EO5 C;  5B0Y D;  2JCH A;  4CSR A;  4E45 A;  5AVC C;  3REL C;  4JJN D;  2PYO B;  3WA9 D;  3G71 Z;  3M4O I;  4BBS I;  3IX0 A;  2GTI A;  2Y2M A;  3B6F A;  2FJ7 C;  5AY8 A;  1B67 A;  2PYO D;  2JE5 A;  1VQM Z;  3AZI A;  1Z2C B;  1P3L B;  2E2J I;  3PO3 S;  1KC8 2;  2Y2P A;  4NOZ A;  3EG5 B;  2W8S A;  1VQP Z;  1KX5 A;  1WW9 A;  1VQ9 Z;  2DE5 A;  2E9H A;  3X1T A;  1P3L D;  2OTL 1;  3REL B;  4EO5 B;  1P3F C;  5AVC B;  1ML8 A;  1TAF A;  5B2I A;  1M19 A;  1Y1W I;  3I56 Z;  4TNU A;  4H9O B;  3REL D;  2FJ7 B;  3MGQ C;  5AVC D;  5CPK A;  1Y1V I;  5B32 B;  3Q87 A;  5BNV B;  2Y2O A;  3CC7 1;  2YFV B;  5B1M C;  2FJ7 D;  5B32 D;  3TU4 A;  1WCM I;  2ZY2 A;  1M18 B;  1YHQ Z;  3H0R C;  3CCS 1;  1P3F B;  3AYW A;  2R6M A;  2JA5 I;  1JJ2 Z;  3MVD A;  2G5I C;  4YM6 A;  5AV6 A;  5B24 B;  2YFW B;  3AV2 C;  1P3A A;  1P3B A;  4G91 B;  1M18 D;  5GSU C;  1VQ8 Z;  1P3F D;  3AV1 C;  3X1S C;  2F8N H;  4RVG A;  4J8U C;  2R7Z I;  3NQJ A;  2KI7 B;  2VUG A;  1QVG Z;  4HGA B;  4ZBJ C;  5B24 D;  3CCV Z;  3LEL C;  3AN2 A;  5B1M B;  5KDM B;  3CCQ 1;  5E5A C;  2PK7 A;  3KIH A;  3CXC Z;  2W03 A;  2Y2K A;  4E31 A;  3KWQ C;  2PM9 A;  5B1M D;  3W96 C;  3H3V J;  2BYM A;  1M1A B;  2W04 A;  4QLC A;  3W98 A;  1VQP 1;  5GXQ A;  4AWL C;  4X23 C;  5BNX A;  2V8J A;  3GTL I;  3AV2 B;  1X3W A;  1P3M C;  1YIJ 1;  1K8A 2;  5GSU B;  3HOZ I;  3AV1 B;  1M1A D;  4J8U B;  3AZM A;  4UUZ B;  1QVG Y;  4ZBJ B;  4H9P B;  3CC4 1;  3AV2 D;  2EGT A;  3LEL B;  3HOY I;  3I55 1;  2IO5 C;  5GSU D;  3AV1 D;  5B0Y A;  3WA9 A;  5E5A B;  4J8U D;  4E2Y A;  5AV9 B;  3LUS A;  4KHA B;  4G92 C;  4J8W B;  2Y2Q A;  3S15 I;  5B32 G;  3LEL D;  3KWQ B;  1BH8 B;  1P3P B;  4RVF A;  4KUD A;  5E5A D;  3MGR C;  5AV9 D;  4AWL B;  4X23 B;  4J8V B;  2JNY A;  4CAY B;  2OOY B;  1P3M B;  4M6B A;  3KWQ D;  1P3P D;  3EPH A;  2O4H A;  3C1C C;  3AZF B;  4X23 D;  4J8V D;  4YS3 A;  3FKI I;  3C1B C;  1P3M D;  2ZAE B;  3HOV I;  3REI A;  1P3L A;  1ZB8 A;  3F6T A;  1L1O C;  3A1K A;  3AZF D;  1P34 C;  2NQB C;  3BG0 B;  3AZH B;  2FFF B;  1W2B Z;  3REL A;  2J8P A;  5AVC A;  3MGR B;  1RO4 A;  4MRI A;  3AZH D;  3F3F C;  4A3C I;  2DE6 A;  4BBR I;  3J7A 4;  2QLV B;  4H9O A;  4NBD A;  3C1C B;  2FJ7 A;  2P3Y A;  3MGR D;  5DNM C;  4A3F I;  4KGC A;  3C1B B;  1NUI A;  5BNV A;  5C44 I;  2YFV A;  1YIT 1;  3X1U B;  3C1C D;  3O62 B;  1X0T A;  2YU9 I;  3LZ1 C;  1P34 B;  2NQB B;  1N2F A;  1RLY A;  3EPJ A;  3C1B D;  3B0B A;  3S2D I;  4WU8 B;  3NQU A;  1ZLA C;  5LL6 f;  3X1U D;  3EPK A;  3O62 D;  3AZJ C;  1Z01 A;  1P34 D;  2NQB D;  4WU8 D;  2Q4Z A;  3MGQ A;  1I3Q I;  5C4X I;  5DNM B;  1N8R 2;  2K5R A;  3HKZ A;  5B1M A;  2Y2I A;  4Z2M H;  3LZ1 B;  5DNM D;  2F8N A;  2BYK B;  5AV5 C;  5D1O B;  1Q82 2;  3JAM b;  2G5H C;  3V9R A;  1ZLA B;  3WAA C;  2ARO B;  3AZJ B;  3LZ1 D;  2JMO A;  3GTO I;  3B6G B;  3AV2 A;  5T67 A;  5GSU A;  1ZLA D;  4MD8 A;  2RVQ D;  3X1S A;  2ARO D;  3B0C W;  3AZJ D;  1H3O B;  3AV1 A;  3U50 C;  1YJ9 1;  4UUZ A;  3IP4 C;  4NBF A;  4A3E I;  3B6G D;  3RZO I;  3HOU I;  3LEL A;  2E2H I;  4E32 A;  3CQZ I;  4WZS B;  3S1N I;  5E5A A;  5CHL B;  4KHA A;  2HIO B;  1KX4 A;  2RBL A;  3KWQ A;  1BH8 A;  3MZL B;  2OTL Z;  3W96 A;  3WAA B;  5GT3 C;  4HGY A;  4X23 A;  2HIO D;  1YI2 Z;  4CAY A;  1K9M 1;  1P3M A;  1VQN 1;  1K73 1;  3WAA D;  3A6N C;  5A2Q b;  3CME 1;  2HUE C;  4QTU A;  1QVF Y;  3CC7 Z;  4DRA A;  4NBH A;  3WKJ C;  3QWU A;  3AZG A;  4XZQ C;  3AZL C;  4WU9 C;  3AFA A;  4NH1 C;  3PO2 I;  3CCS Z;  2UWX A;  4NB9 A;  5GT3 B;  3MGR A;  4R8P C;  4AYB A;  2ZY4 A;  1Q86 1;  2QRC B;  1KD1 2;  4A3I I;  3A6N B;  3C1C A;  5GT3 D;  2HUE B;  3C1B A;  2J6A A;  3B0D B;  3A6N D;  3WKJ B;  3NDI A;  4NBC A;  5B32 C;  4XZQ B;  5AV8 C;  3AZL B;  1X3Z A;  3CCQ Z;  4WU9 B;  4EWC A;  3KUY C;  3WKJ D;  3K7A I;  4XZQ D;  4R8P B;  3AZL D;  4Z5T B;  4WU9 D;  1K8A 1;  5B2J A;  1M18 C;  1YIJ Z;  1TWA I;  3H0M C;  4R8P D;  2HF1 A;  2VQR A;  2QRE B;  4H9N B;  4Z5T D;  5B24 C;  3CCE 1;  1YI2 1;  3CC4 Z;  4G91 C;  2WB1 A;  3I55 Z;  3VMH A;  3J81 f;  5AV8 B;  4E44 A;  1N1J B;  3LZ1 A;  4HGA C;  3KUY B;  5D1O A;  3J80 f;  3KIF A;  1ZLA A;  5CP6 C;  2NZD A;  5AV8 D;  1Z02 A;  1P9N A;  4NB8 A;  3KUY D;  1P3G C;  1RO2 A;  2RT9 A;  1M1A C;  1H3O A;  2GTH A;  4NE6 A;  2JR6 A;  1Q7Y 2;  5G49 B;  2IZ4 A;  2OOX B;  4E2Z A;  4ZUX C;  3AZK C;  3CC2 1;  5AV5 A;  1U35 C;  5CP6 B;  3WAA A;  5B40 C;  5AV9 C;  1KQS Y;  2CV5 C;  5IT9 b;  4J8W C;  4QTT A;  1P3G B;  1P3P C;  1Q81 1;  2OZK A;  1M90 1;  3LZ0 B;  3IF8 A;  4H9R A;  5CP6 D;  1I50 I;  3CCM 1;  3CCU 1;  1ZH1 A;  3P5J B;  4J8V C;  1P3G D;  5BO0 A;  4NBA A;  5B33 C;  4DGL A;  3OW2 Y;  3LZ0 D;  1DL6 A;  1YIT Z;  5F99 A;  4ZUX B;  3GKQ A;  3AZF C;  3W99 C;  3AZK B;  2IZ3 A;  3NDJ A;  4HGZ A;  4H9S C;  5FLX f;  1NJI 1;  1U35 B;  1TWG I;  4A3B I;  4ZUX D;  5B40 B;  5GT3 A;  4JJN A;  3AZK D;  2CV5 B;  4XUJ B;  3AZE B;  3AZH C;  4A3M I;  1U35 D;  1YUK A;  4BY7 I;  3A6N A;  5BT1 D;  5JRG C;  5B40 D;  2PYO A;  3VH6 A;  2CV5 D;  1USP B;  4J8W D;  3AZE D;  2DQN C;  1RNI A;  3I07 A;  3MZK B;  5B33 B;  2JA6 I;  2ZY3 A;  4NE5 A;  1R4V A;  3WKJ A;  1NP6 A;  1BH9 B;  3UTB B;  4XZQ A;  3UTA B;  3AZL A;  3W99 B;  4S1T A;  4WU9 A;  3PO3 I;  5B33 D;  5DNN C;  2M6N A;  1YJW 1;  3X1U C;  3IFU A;  3O62 C;  3W99 D;  3UTA D;  4R8P A;  3KFU G;  1I6H I;  4DRB A;  1R9T I;  3W97 C;  1VQ7 1;  4DQY B;  4WU8 C;  3RZD I;  1Q9C A;  5JRG B;  3REJ C;  1YJ9 Z;  1WWS A;  4A3K I;  5CPI C;  5JRG D;  1F66 C;  3D9X A;  5B32 A;  5AV8 A;  4XX2 A;  3KUY A;  3G4S 1;  5DNN B;  1KX3 B;  3WTP E;  1TFI A;  3W97 B;  1ZB9 A;  3MGS B;  1M18 A;  3REH C;  5DNN D;  1KX3 D;  1VQN Z;  1P3F A;  2RVQ C;  2ARO C;  3GTM S;  3REJ B;  4RVH A;  3KXB C;  3CME Z;  5B24 A;  2YFW A;  1B6W A;  5G49 A;  3MGS D;  1P3O C;  3B6G C;  3W97 D;  3TE5 B;  3VTN A;  5CPI B;  3REJ D;  1F66 B;  5B1L C;  3VH5 T;  1EQZ C;  4RS4 A;  5KDM A;  5JA4 B;  5CPI D;  5CP6 A;  1P3K C;  1F66 D;  5FUG B;  1VQ5 Z;  4A3G I;  2HIO C;  5C3E I;  1A7W A;  1HQ3 C;  1P3G A;  3REH B;  3TDH B;  5B2I C;  1M19 C;  3LJA C;  1TZY C;  1M1A A;  3B6F B;  3GTP I;  3KXB B;  4BXX I;  2P28 A;  1P3O B;  3REH D;  3B6F D;  4J8U A;  4ZUX A;  1RQF A;  2NVQ I;  5B1L B;  3KXB D;  3AZK A;  2RIQ A;  4H9P A;  1Z03 A;  1QVF Z;  2LY8 A;  1U35 A;  3VH6 W;  1P3O D;  1EQZ B;  3TU4 C;  5IP9 I;  1KX5 B;  1KC8 1;  5B31 G;  3X1T B;  1P3K B;  5AV9 A;  5B1L D;  2Q51 A;  4Y52 I;  2CV5 A;  4J8W A;  1HQ3 B;  1P3P A;  1TAF B;  3KSY A;  5BS7 C;  5B2I B;  1M19 B;  1EQZ D;  3LJA B;  3CCR 1;  1TZY B;  3CD6 1;  3X1T D;  1P3K D;  3X1V C;  4J8V A;  4E2X A;  3CCE Z;  2M48 A;  1HQ3 D;  4MD7 A;  3CCL 1;  5B2I D;  1M19 D;  2F4O A;  3LJA D;  1Y1V S;  1TZY D;  3FQQ A;  2L5A A;  1VQO Z;  2JA7 I;  3AZF A;  1BH9 A;  3R45 B;  3W99 A;  3BG1 B;  4Y7N I;  3H0L C;  4H9S A;  3REK C;  2LIY A;  3S17 I;  3TU4 B;  3B0D C;  2DF4 C;  1YJN Z;  2O53 A;  1VQL Z;  2ZY5 A;  3AYW B;  3AZH A;  3H0G I;  3I4M I;  5GT0 C;  3MVD B;  1VQ6 1;  5GXQ C;  2CWE A;  3TU4 D;  4YM6 B;  2F8N K;  1VQ5 1;  1S32 C;  5JRG A;  3X1V B;  4Z5T C;  3AYW D;  2LFU A;  4RVD A;  3JAM f;  1K83 I;  3MVD D;  3NQJ B;  4E33 A;  1RO0 A;  4YM6 D;  3CMA 1;  2Y2J A;  2Y2G A;  3X1V D;  3CC2 Z;  3REK B;  2BJO A;  5DNN A;  3FQM A;  2OTJ 1;  3X1U A;  3O62 A;  1LQL A;  1F1E A;  1P34 A;  2NQB A;  3S14 I;  3REK D;  2BYM B;  2R92 I;  3W97 A;  5GT0 B;  5GXQ B;  5B0Z C;  4WU8 A;  3J81 b;  3S1R I;  1S32 B;  3CCU Z;  3CCM Z;  2ZM5 A;  2QR1 B;  5GT0 D;  3J80 b;  5GXQ D;  4YS3 C;  1SFO I;  3GTK I;  1W2E A;  5CPI A;  1S32 D;  1F66 A;  5DNM A;  3REI C;  3NFZ A;  4BY1 I;  1PFT A;  3S16 I;  2HU9 A;  1VQO 1;  1BFM A;  4RV9 A;  5FUG A;  2BYK A;  5CPJ C;  4KUD B;  3REH A;  5B0Z B;  3AZJ A;  2ARO A;  4Z2M G;  3HOX I;  1VQL 1;  1KQS Z;  2JS4 A;  3KXB A;  3UT9 C;  1YUA A;  4KUD D;  3MON A;  3B6G A;  1P3O A;  2NVY I;  5B0Z D;  3LZ0 C;  4YS3 B;  4KGC C;  3F3P C;  2H85 A;  2QRD B;  3REI B;  5B1L A;  2Y0S A;  4A3L I;  3OW2 Z;  1EQZ A;  3G6E 1;  4YS3 D;  4E2W A;  1YJW Z;  5AVB C;  3VMI A;  1KRL A;  1ULY A;  3REI D;  1P3K A;  5CPJ B;  2HIO A;  3T4N B;  3VB9 A;  1HQ3 A;  3MGP C;  2K3R A;  1VQ7 Z;  3LJA A;  1TZY A;  5BT1 C;  1K9M 2;  5FLX b;  4XUJ C;  5CPJ D;  2XD1 A;  3UT9 B;  3AZE C;  1WII A;  5AN9 F;  5FLM I;  3NH5 A;  1K73 2;  1VQ4 Z;  4KGC B;  1JFI B;  1PZR A;  5CM2 M;  2NVT I;  1S72 1;  3R45 A;  3UT9 D;  1P3I C;  3GTQ I;  1VQK 1;  4WJ3 C;  3G4S Z;  4KGC D;  1TWC I;  5AVB B;  2QEX 1;  3MNN C;  3UTA C;  3UTB C;  3NQU B;  1AOI C;  1M1K 2;  3MGP B;  3VH5 A;  5BS7 A;  1JWH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...