3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H2 subunit A
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/replication
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
4DGLA 1N1JA 4XUJA 2AROB 3C1BA 1P3KB 5CP6B 5DNND 2GU2A 1Q811 1RNIA 1P3BB 4A3II 5B2IA 5B0ZC 5AVCB 3LZ1D 4YM6C 3B6FD 1M1AA 1YHQZ 3MGRA 1P3LA 1K9M1 1Q822 1WW9A 3OW2Z 3CCE1 3UT9C 5D1PA 1Y8CA 1WWSA 4WU9D 5GSUA 5B24D 3WKJB 3MGQD 3MNND 3AZJC 5B32G 3X1TA 5B0ZA 5GT3D 1P3LD 1P3FC 4CSRB 1HQ3C 3X1UC 1P3PB 3X1VA 5AV5B 3MZKB 4NH1C 5A2Qf 2HUEB 3GTOI 1K8A2 1KQSY 2Q51A 3I56Z 3NQJB 3KXBC 3HOVI 3AZED 3AZJA 4A93I 4A3FI 5KDMA 4J8VD 1P3FA 1ID3C 4J8XC 3X1UA 3ESWA 2YADA 3RELC 3EPJA 5B32D 4H9OA 1VQ9Z 1P3AC 1W2BZ 3LJAD 1VQPZ 3C1CB 3KXBA 1TZYC 3GTKI 3WTPB 1KX4D 2O53A 2RIQA 2L5AA 4J8XA 1EQZC 2RPRA 5DNNB 4MXUA 2K5RA 1YJ9Z 1P3AA 1VLAA 3AZGC 1P9NA 1VQO1 4Y52I 1VQMZ 5B2JC 3LZ1B 3B6FB 3CCJ1 3CC7Z 2E2HI 3FKII 4YS3C 3H0MC 5B31A 5AV6C 3KFUG 5C44I 4WU9B 2NVYI 5B24B 3TU4A 3S15I 3MGQB 3MNNB 3WA9A 3AZGA 1YJW1 1YJ91 5GT3B 1M1K1 3AZID 3RZOI 5B2JA 3MONA 5AY8B 3G4S1 2F8NA 3CC71 3AN2C 2NZDA 3G6EZ 3VTNA 5AV6A 1KX5D 2R7ZI 3AZEB 1U35D 3B0CT 3LELD 4J8VB 4LD9C 1TFIA 1VQ4Z 5LL6f 5B32B 3EG5B 2JIQA 3CD6Z 3FQQA 3LJAB 1K732 3CXCY 5CPKD 3W96D 4BY1I 1P34D 1KX4B 5CPJD 3VH6T 4E45A 3AZNC 2FJ7D 1JWHC 1WIIA 3V9RA 4LD9A 2VPWA 2W04A 3I55Z 3CMA1 2R92I 5C3IB 4Z66D 3O62D 3S2HI 3CC2Z 3CD61 3CCSZ 4WJ3C 1P3KC 4CAYB 5B1MA 3F3FC 4NB8A 1P3BC 3REHA 2E2II 3K7AI 3I551 3PO3S 4BY7I 2HU9A 1L1OC 2ZAEB 3QWUA 5AVCC 4R8PD 1HQ3B 4A3KI 3AZIB 3VH5A 2AROA 1USPB 3W97D 1P3KA 1AA6A 3REKD 1P3MD 1NJI1 5CP6A 3GTGI 4XZQD 1KX5B 2CV5D 2BJOA 2DQNC 3WKJC 3NDJA 4AWLC 4NBCA 4NFRA 3VMIA 2JA7I 3HOZI 5AVCA 1U35B 2G5HC 1P3PC 2JNYA 5JRGD 5AV5C 3LELB 3F3PC 2O4HA 2HUEC 4NOZA 1KC82 5IT9f 2V8KA 1AOID 3WKJA 1P3IA 4X23A 5CPKB 3W96B 2JMOA 3S1MI 5FUGB 4CSRA 1VQ61 5AV8D 1P34B 5AV5A 5CPJB 2FJ7B 2I3CA 1QF8A 5CPID 4MD8A 5A2Qb 1VQ81 4QLCA 5DNMA 3AZFA 3J81f 4E2ZA 3C1CC 3NQJA 5FLMI 2AYDA 2JA6I 4Z66B 5BS7C 2RVQD 3O62B 3AV2D 4NBBA 4UUZB 1FDIA 3W99D 1S72Z 2G5IC 5DNNC 2OTL1 4WNNB 2ZM5A 5CHLB 3MGPD 1NP6A 5B1LD 1P3OD 5FLXb 3C1CA 3Q87A 4R8PB 3LZ1C 3B6FC 3AL0C 4QTUA 5BS7A 1TWFI 3WTPA 1KX3D 1KQSZ 3H3VJ 3REKB 3NH4A 1P3MB 1S721 5DNNA 4XZQB 2BG1A 4WU9C 2CV5B 5B24C 2R6MA 3MGQC 3MNNC 5GT3C 1Q862 3VH5W 5AVBD 4H9NB 5F99D 3LZ1A 1BH8B 4ZUXD 5JRGB 1FDOA 1TWAI 1ZB9A 3D6WA 3IR7A 4KUDD 1QVGY 4WU9A 1VQ7Z 3AZEC 3MGQA 1KRLA 3CMEZ 2IO5B 2JA8I 3I4MI 1VQKZ 4J8VC 1YJN1 5AY8A 5AV8B 1QXFA 3A1KA 3VB9A 3UTBD 3CCRZ 5CPIB 5B32C 2KPIA 3P5JB 2XD5A 2YFWB 3LJAC 2F2AC 2QREB 2AKLA 4A3EI 5BNXB 2Y2HA 1JFIB 4G91B 3AV2B 1KX4C 4HGAB 1M19D 1Y1VS 4HGZA 5E5AD 3W99B 4MRIA 5JA4B 3B6GD 1KD11 3LZ0A 1YI2Z 3CCQ1 5B32A 3MGPB 4NBFA 5B1LB 3FDDA 1P3OB 5C3IC 3WTPE 3LJAA 5B0YD 2KI7B 4Z2MH 5GT0D 3HOXI 1TAFB 1YIT1 3U50C 4X6AI 1KX3B 1KX4A 4AWLB 3AV1D 1N8R1 1X3WA 4YM6A 5AVBB 3AZIC 5F99B 1YHQ1 2NQBD 4ZUXB 2VF1A 5AV9D 3G71Z 3UT9A 4CAYA 3AZLD 3B0BA 3J80f 1KX5C 3KWQD 4KUDB 2NAPA 1I6HI 2WAQA 3CXCZ 1Q812 3RZDI 2RT9A 3AZHD 4Z5TD 1T3UA 1U35C 1HQ3A 5CM2M 3T4NB 3LELC 2Y2KA 1W2EA 3IX0A 4RVGA 4BBSI 1USPA 2YFVB 3UTBB 2QLVB 4MD9A 3G711 4A3MI 1VQ5Z 1KX5A 2PMZA 3I561 1M18D 1M901 1Y1VI 3GTJI 5CPKC 3W96C 1ID3A 1P34C 2Y2PA 3LELA 3AZKD 5CPJC 1P3GD 5E5AB 3RELA 1M19B 2F8NH 2FJ7C 4MH4A 1VQ91 5C3EI 5IT9b 1TZYA 3VMHA 1VQP1 4TNUA 4Z66C 3O62C 5B0YB 4G92B 5GT0B 5CPKA 3W96A 4NB9A 5FUGA 1EQZA 4NBDA 2G2KA 3CCMZ 2JSSA 4RVDA 2Y2GA 1QYPA 2BYKB 1Q9CA 4H9PB 3AV1B 3J81b 1VQLZ 5D1OB 4R8PC 3AFAD 1VQM1 4DRBA 4Z66A 4YS3A 2Y0SA 2W8SA 5AV9B 3MGRD 4J8UD 3REID 2DF4C 4Z2MG 4EO5B 3REKC 3AZLB 4XZQC 1P3MC 3KWQB 2CV5C 4WU8D 2RBLA 4DK1A 3CCM1 3UTAD 1Q7Y1 3KUYD 3AZHB 4Z5TB 5GSUD 1K83I 2VUGA 3X1TD 5JRGC 3HOUI 4E2XA 3AN2A 3CCUZ 3X1VD 2ZY5A 3REKA 1P3MA 2M6NA 3G6E1 2Y2MA 3AZMD 4XZQA 2QA4Z 2CV5A 1AOIC 3D9XA 1S7MA 2LY8A 3GKQA 3PO3I 3NFZA 2BYMB 2IO5C 3JAMf 5IP9I 4H9NA 1M1K2 1BH8A 5AV8C 5JRGA 3AZKB 5CPIC 3IP4C 1S32D 4NBAA 1VQ41 4M6BA 4E30A 3X1SD 2UWXA 4H9QA 2PK7A 2RVQC 4G91C 1QVFY 3AV2C 4KGCD 4HGAC 3AZNA 5T67A 3W99C 1N1JB 5AV8A 1M1AD 2JCHA 4UPKA 5C4JI 5T6BA 3MGPC 5B1LC 2YFWA 1P3OC 1JJ2Z 3A6ND 4NBGA 5BNXA 3AFAB 3CC4Z 1JFIA 3CC21 3AV2A 1KX3C 3CCS1 1QVGZ 4J8UB 3VH6W 3MGRB 5JA4A 5BT1D 3REIB 1P3BA 1P3LB 3W99A 2GTIA 3TDHB 5B31D 4WU8B 3BG1B 5B1LA 3UTAB 3KUYB 1P3OA 2OTJZ 5AVBC 5GSUB 5F99C 3TU4D 1WCMI 4ZUXC 1TAFA 3X1TB 3WA9D 2Y2QA 1KX3A 5B2JD 1X0TA 1WZNA 2VPYA 3X1VB 2YU9I 2F8ND 4KUDC 4NFTA 3CQZI 1VQNZ 3AZMB 2NZDD 4XX2A 2Y2NA 2HIOD 1P3PA 3NH5A 2P3YA 4NBEA 5C4XI 5AVBA 2OTJ1 5F99A 2GTHA 3HOWI 4ZUXA 3UTBC 1PZRA 2H85A 3GCFA 3AYWD 3J80b 1S32B 4KUDA 1F66D 4QTTA 1NJI2 4A3DI 3X1SB 3H0LC 4H9OB 1SIWA 2ZY2A 1LQLA 4J8WD 4KGCB 1KU5A 1M19C 3MGSD 5E5AC 2VPXA 4E33A 3B6GC 2E7ZA 3CCVZ 3UTBA 2V8IA 1ML8A 1WJ2A 4HGYA 2F8NK 3A6NB 4G92C 5B0YC 5GT0C 4A3BI 3MVDD 3W97B 3W98D 3EPHA 1M19A 5E5AA 3GTQI 2Y2LA 1Z03A 2IZ4A 2JIPA 2OOYB 4BXXI 1YUKA 3AV1C 5B31B 2ZY3A 5B1MD 2DE5A 4A3CI 1NUIA 5B40D 3REHD 3B6FA 2QEXZ 2B63I 4ZBJB 2NVXI 5GT0A 3WA9B 2NQBC 3VH5T 5AV9C 3S1RI 3CPWY 2LIYA 2AROD 1BH9B 4EO5C 3AZLC 3KWQC 1AOIB 5B24A 2F8NB 2JIRA 2BYKA 1F1EA 4H9PA 5CP6D 3MNNA 5GT3A 5B33D 4Z5TC 2HIOB 3AZHC 3AV1A 2V45A 3LUSA 5D1OA 2QEX1 1A7WA 4JJND 1TWHI 4A3LI 2R93I 5AV9A 3S1NI 3AZLA 3AYWB 5T64A 4KHAB 3KWQA 1M18C 3AZEA 1F66B 1ZLAD 4NE5A 1VQ71 4DRAA 3AZHA 2CWEA 4Z5TA 4J8VA 3CME1 1YIJ1 1P3ID 4J8WB 4X23D 5BO0B 3AZKC 2V3VA 3MGSB 1K9M2 1VQK1 3CCR1 5GXQD 4AYBA 2VUMI 2VPZA 2JE5A 3REJD 2JA5I 4QLCD 5DNMD 3AZFD 3CCLZ 2PYOD 3I07A 3MVDB 3W98B 1Q821 3AZKA 1BFMA 1ZH1A 1YI21 3KIHA 4E44A 3S2DI 3H0GI 5B40B 3AFAC 1I50I 3WAAD 3S1QI 3CCL1 3HKZA 4J8UC 1M1AC 3MGRC 1P3LC 3WTPD 3REIC 1RO4A 2LFUA 4E2WA 2HF1A 3CCEZ 3KSYA 2V8JA 1K8A1 4WU8C 1KD12 2NVTI 1B67A 1RO2A 3UTAC 2F4OA 3KUYC 5B33B 5GSUC 3AZIA 4MD7A 3AFAA 3X1TC 1TWCI 2IZ3A 4JJNB 3X1VC 4J8UA 3REIA 1Q16A 2RHBA 3AZMC 2IV2X 1QVFZ 4WU8A 4NE3A 1HTAA 1U35A 3UTAA 1ZLAB 3KUYA 3NH8A 5AN9F 3W97C 5IP7I 1N8R2 1P3IB 3B6GB 4X23B 4E31A 3EEDA 3D2LA 2F4MA 5GXQB 5AY8D 5G49B 1S32C 4H9RB 1VQ51 3REJB 3AZMA 3X1SC 2J8PA 4QLCB 5DNMB 3B0DB 3AZFB 2JIOA 2P28A 1Y1WI 3NDIA 2PYOB 4XUJD 1P34A 5CPJA 2FJ7A 4KGCC 2EGTA 3R45B 3C1BD 3VH6A 2E9HA 4Y7NI 1S32A 3LZ0D 5B2ID 3S16I 3A6NC 3X1SA 3O62A 4E32A 1M902 2NQBB 5FLXf 4UUZA 1VQOZ 1Z02A 3WAAB 2W03A 4KGCA 1WWIA 1Z01A 3CCJZ 1ULYA 4WNNA 5BT1C 5B31C 4NE6A 2OZKA 3S14I 3EPKA 2JS4A 3NQUB 4R8PA 2Y2OA 1VQL1 5B0ZD 3A6NA 3TU4C 4ZBJC 1YJWZ 3WA9C 4YM6D 4WV4B 3W97A 2DE6A 3G4SZ 1YIJZ 4WZSB 1M18B 3UT9D 2NZDC 2HIOC 3EERA 1K731 3AZJD 1P3GB 2Y2JA 5BNVB 1H3OB 1P3FD 1HQ3D 3X1UD 1Z2CB 2XD1A 3CCU1 4RS4A 1BH9A 3AYWC 2QA41 3H0RC 1AOIA 1F66C 4HH4A 1JJ2Y 3J7A4 5B31G 3OW2Y 3GTMS 2JIMA 3KXBD 3B0CW 2HIOA 2VQRA 1Q7Y2 1I3QI 4XUJB 4J8WC 3MGSC 3C1BB 5CPIA 4J8XD 1ID3D 1VQ8Z 2FFFB 1R9TI 3RELD 3AYWA 2F8NG 3CMAZ 4KHAA 3LZ0B 1P3AD 5B2IB 1F66A 4E2YA 3CPWZ 1TZYD 3MVDC 1M1AB 3W98C 4J8WA 5BO0A 3I4NI 4RVHA 3MGSA 4BBRI 1EQZD 3MGPA 5B1MC 2Q4ZA 3REHC 5B40C 3AZGD 5B0ZB 1YUAA 1ZB8A 3CC41 1W2BY 4YM6B 3MVDA 3W98A 3M4OI 1KC81 4YS3D 2AROC 5AV6D 3UT9B 5CP6C 4H9SC 5B33C 2QR1B 3BG0B 5B40A 3AZJB 1SFOI 5KDMB 1P3FB 4JJNC 4RV9A 3X1UB 1PFTA 3GTMI 3AN2D 1VQN1 1ZLAC 4H9SA 3KXBB 5B33A 3F6TA 1P3IC 4X23C 2JR6A 2YFVA 1VQ6Z 4JJNA 1ID3B 5GXQC 4J8XB 4LD9D 3RELB 3REJC 3GTLI 4QLCC 5DNMC 3TE5B 3A1IA 3B0DC 3AZFC 1P3AB 1R4VA 1ZLAA 1TWGI 2PYOC 4A3GI 1TZYB 2J6AA 2PM9A 3IFUA 3B6GA 2E2JI 3S17I 1DL6A 3AZND 3CCV1 1EQZB 5GXQA 2OTLZ 2DE7A 5G49A 4H9RA 4EWCA 3REJA 3TU4B 5B0YA 2NVQI 2NZDB 1B6WA 4DQYB 3AZGB 3KIFA 1Q861 3VMGA 2LEXA 3WAAC 2PYOA 1RQFA 5B2JB 4S1TA 3GTPI 3R45A 1P3KD 3WTPC 4YS3B 2JUBA 2K3RA 5AV6B 3PO2I 1P3BD 2OOXB 1N2FA 3MZLB 5AVCD 2NQBA 2M48A 3FQMA 3WAAA 2QRDB 4CL1A 1RLYA 1RO0A 3AN2B 3EPLA 3WKJD 3NQUA 4A3JI 1P3GC 1P3PD 2WB1A 3HOYI 5AV5D 1YJNZ 5AY8C 3V9RB 4LD9B 2Y2IA 2QKDA 1M18A 2BYMA 2ZY4A 2QRCB 3JAMb 3IF8A 1X3ZA 4XUJC 4NBHA 4H9QB 1P3GA 5BNVA 1H3OA 3C1BC 3AZNB 4RVFA 5B1MB 3REHB 3LZ0C 3CCQZ 5B2IC 3M3YI 4MONA 3C1CD 1YITZ
chains in the Genus database with same CATH topology
4DGLA 1N1JA 4XUJA 2AROB 3C1BA 1P3KB 5CP6B 5DNND 2GU2A 1Q811 1RNIA 1P3BB 4A3II 5B2IA 5B0ZC 5AVCB 3LZ1D 4YM6C 3B6FD 1M1AA 1YHQZ 3MGRA 1P3LA 1K9M1 1Q822 1WW9A 3OW2Z 3CCE1 3UT9C 5D1PA 1WWSA 4WU9D 5GSUA 5B24D 3WKJB 3MGQD 3MNND 3AZJC 5B32G 3X1TA 5B0ZA 5GT3D 1P3LD 1P3FC 4CSRB 1HQ3C 3X1UC 1P3PB 3X1VA 5AV5B 3MZKB 4NH1C 5A2Qf 2HUEB 3GTOI 1K8A2 1KQSY 2Q51A 3I56Z 3NQJB 3KXBC 3HOVI 3AZED 3AZJA 4A93I 4A3FI 5KDMA 4J8VD 1P3FA 1ID3C 4J8XC 3X1UA 3ESWA 2YADA 3RELC 3EPJA 5B32D 4H9OA 1VQ9Z 1P3AC 1W2BZ 3LJAD 1VQPZ 3C1CB 3KXBA 1TZYC 3GTKI 3WTPB 1KX4D 2O53A 2RIQA 2L5AA 4J8XA 1EQZC 2RPRA 5DNNB 4MXUA 2K5RA 1YJ9Z 1P3AA 1VLAA 3AZGC 1P9NA 1VQO1 4Y52I 1VQMZ 5B2JC 3LZ1B 3B6FB 3CCJ1 3CC7Z 2E2HI 3FKII 4YS3C 3H0MC 5B31A 5AV6C 3KFUG 5C44I 4WU9B 2NVYI 5B24B 3TU4A 3S15I 3MGQB 3MNNB 3WA9A 3AZGA 1YJW1 1YJ91 5GT3B 1M1K1 3AZID 3RZOI 5B2JA 3MONA 5AY8B 3G4S1 2F8NA 3CC71 3AN2C 2NZDA 3G6EZ 3VTNA 5AV6A 1KX5D 2R7ZI 3AZEB 1U35D 3B0CT 3LELD 4J8VB 4LD9C 1TFIA 1VQ4Z 5LL6f 5B32B 3EG5B 3CD6Z 3FQQA 3LJAB 1K732 3CXCY 5CPKD 3W96D 4BY1I 1P34D 1KX4B 5CPJD 3VH6T 4E45A 3AZNC 2FJ7D 1JWHC 1WIIA 3V9RA 4LD9A 2W04A 3I55Z 1VQ81 3CMA1 2R92I 5C3IB 4Z66D 3O62D 3S2HI 3CC2Z 3CD61 3CCSZ 4WJ3C 1P3KC 4CAYB 5B1MA 3F3FC 4NB8A 1P3BC 3REHA 2E2II 3K7AI 3I551 3PO3S 4BY7I 2HU9A 1L1OC 2ZAEB 3QWUA 5AVCC 4R8PD 1HQ3B 4A3KI 3AZIB 3VH5A 2AROA 1USPB 3W97D 1P3KA 3REKD 1P3MD 1NJI1 5CP6A 3GTGI 4XZQD 1KX5B 2CV5D 2BJOA 2DQNC 3WKJC 3NDJA 4AWLC 4NBCA 4NFRA 3VMIA 2JA7I 3HOZI 5AVCA 1U35B 2G5HC 1P3PC 2JNYA 5JRGD 5AV5C 3LELB 3F3PC 2O4HA 2HUEC 4NOZA 1KC82 5IT9f 2V8KA 1AOID 3WKJA 1P3IA 4X23A 5CPKB 3W96B 2JMOA 3S1MI 5FUGB 4CSRA 1VQ61 5AV8D 1P34B 5AV5A 5CPJB 2FJ7B 2I3CA 1QF8A 5CPID 4MD8A 5A2Qb 4QLCA 5DNMA 3AZFA 3J81f 4E2ZA 3C1CC 3NQJA 5FLMI 2JA6I 4Z66B 5BS7C 2RVQD 3O62B 3AV2D 4NBBA 4UUZB 3W99D 1S72Z 2G5IC 5DNNC 2OTL1 4WNNB 2ZM5A 5CHLB 3MGPD 1NP6A 5B1LD 1P3OD 5FLXb 3C1CA 3Q87A 4R8PB 3LZ1C 3B6FC 3AL0C 4QTUA 5BS7A 1TWFI 3WTPA 1KX3D 1KQSZ 3H3VJ 3REKB 3NH4A 1P3MB 1S721 5DNNA 4XZQB 2BG1A 4WU9C 2CV5B 5B24C 2R6MA 3MGQC 3MNNC 5GT3C 1Q862 3VH5W 5AVBD 4H9NB 5F99D 3LZ1A 1BH8B 4ZUXD 5JRGB 1TWAI 1ZB9A 3D6WA 1JJ2Y 4KUDD 1QVGY 4WU9A 1VQ7Z 3AZEC 3MGQA 1KRLA 3CMEZ 2IO5B 2JA8I 3I4MI 1VQKZ 4J8VC 1YJN1 5AY8A 5AV8B 3A1KA 3VB9A 3UTBD 3CCRZ 5CPIB 5B32C 2KPIA 3P5JB 2XD5A 2YFWB 3LJAC 2F2AC 2QREB 2AKLA 4A3EI 5BNXB 2Y2HA 1JFIB 4G91B 3AV2B 1KX4C 4HGAB 1M19D 1Y1VS 4HGZA 5E5AD 3W99B 4MRIA 5JA4B 3B6GD 1KD11 3LZ0A 1YI2Z 3CCQ1 5B32A 3MGPB 4NBFA 5B1LB 3FDDA 1P3OB 5C3IC 3WTPE 3LJAA 5B0YD 2KI7B 4Z2MH 5GT0D 3HOXI 1TAFB 1YIT1 3U50C 4X6AI 1KX3B 1KX4A 4AWLB 3AV1D 1N8R1 1X3WA 4YM6A 5AVBB 3AZIC 5F99B 1YHQ1 2NQBD 4ZUXB 2VF1A 5AV9D 3G71Z 3UT9A 4CAYA 3AZLD 3B0BA 3J80f 1KX5C 3KWQD 4KUDB 1I6HI 2WAQA 3CXCZ 1Q812 3RZDI 2RT9A 3AZHD 4Z5TD 1T3UA 1U35C 1HQ3A 5CM2M 3T4NB 3LELC 2Y2KA 1W2EA 3IX0A 4RVGA 4BBSI 1USPA 2YFVB 3UTBB 2QLVB 4MD9A 3G711 4A3MI 1VQ5Z 1KX5A 2PMZA 3I561 1M18D 1M901 1Y1VI 3GTJI 5CPKC 3W96C 1ID3A 1P34C 2Y2PA 3LELA 3AZKD 5CPJC 1P3GD 5E5AB 3RELA 1M19B 2F8NH 2FJ7C 4MH4A 1VQ91 5C3EI 5IT9b 1TZYA 3VMHA 1VQP1 4TNUA 4Z66C 3O62C 5B0YB 4G92B 5GT0B 5CPKA 3W96A 4NB9A 5FUGA 1EQZA 4NBDA 2G2KA 3CCMZ 2JSSA 4RVDA 2Y2GA 1QYPA 2BYKB 1Q9CA 4H9PB 3AV1B 3J81b 1VQLZ 5D1OB 4R8PC 3AFAD 1VQM1 4DRBA 4Z66A 4YS3A 2Y0SA 2W8SA 5AV9B 3MGRD 4J8UD 3REID 2DF4C 4Z2MG 4EO5B 3REKC 3AZLB 4XZQC 1P3MC 3KWQB 2CV5C 4WU8D 2RBLA 4DK1A 3CCM1 3UTAD 1Q7Y1 3KUYD 3AZHB 4Z5TB 5GSUD 1K83I 2VUGA 3X1TD 5JRGC 3HOUI 4E2XA 3AN2A 3CCUZ 3X1VD 2ZY5A 3REKA 1P3MA 2M6NA 3G6E1 2Y2MA 3AZMD 4XZQA 2QA4Z 2CV5A 1AOIC 3D9XA 1S7MA 2LY8A 3GKQA 3PO3I 3NFZA 2BYMB 2IO5C 3JAMf 5IP9I 4H9NA 1M1K2 1BH8A 5AV8C 5JRGA 3AZKB 5CPIC 3IP4C 1S32D 4NBAA 1VQ41 4M6BA 4E30A 3X1SD 2UWXA 4H9QA 2PK7A 2RVQC 4G91C 1QVFY 3AV2C 4KGCD 4HGAC 3AZNA 5T67A 3W99C 1N1JB 5AV8A 1M1AD 2JCHA 4UPKA 5C4JI 5T6BA 3MGPC 5B1LC 2YFWA 1P3OC 1JJ2Z 3A6ND 4NBGA 5BNXA 3AFAB 3CC4Z 1JFIA 3CC21 3AV2A 1KX3C 3CCS1 1QVGZ 4J8UB 3VH6W 3MGRB 5JA4A 5BT1D 3REIB 1P3BA 1P3LB 3W99A 2GTIA 3TDHB 5B31D 4WU8B 3BG1B 5B1LA 3UTAB 3KUYB 1P3OA 2OTJZ 5AVBC 5GSUB 5F99C 3TU4D 1WCMI 4ZUXC 1TAFA 3X1TB 3WA9D 2Y2QA 1KX3A 5B2JD 1X0TA 2YU9I 3X1VB 2F8ND 4KUDC 4NFTA 3CQZI 1VQNZ 3AZMB 2NZDD 4XX2A 2Y2NA 2HIOD 1P3PA 3NH5A 2P3YA 4NBEA 5C4XI 5AVBA 2OTJ1 5F99A 2GTHA 3HOWI 4ZUXA 3UTBC 1PZRA 2H85A 3GCFA 3AYWD 3J80b 1S32B 4KUDA 1F66D 4QTTA 1NJI2 4A3DI 3X1SB 3H0LC 4H9OB 2ZY2A 1LQLA 4J8WD 4KGCB 1KU5A 1M19C 3MGSD 5E5AC 4E33A 3B6GC 3CCVZ 3UTBA 2V8IA 1ML8A 4HGYA 2F8NK 3A6NB 4G92C 5B0YC 5GT0C 4A3BI 3MVDD 3W97B 3W98D 3EPHA 1M19A 5E5AA 3GTQI 2Y2LA 1Z03A 2IZ4A 2OOYB 4BXXI 1YUKA 3AV1C 5B31B 2ZY3A 5B1MD 2DE5A 4A3CI 1NUIA 5B40D 3REHD 3B6FA 2QEXZ 2B63I 4ZBJB 2NVXI 5GT0A 3WA9B 2NQBC 3VH5T 5AV9C 3S1RI 3CPWY 2LIYA 2AROD 1BH9B 4EO5C 3AZLC 3KWQC 1AOIB 5B24A 2F8NB 2BYKA 1F1EA 4H9PA 5CP6D 3MNNA 5GT3A 5B33D 4Z5TC 2HIOB 3AZHC 3AV1A 3LUSA 5D1OA 1YIJZ 2QEX1 1A7WA 4JJND 1TWHI 4A3LI 2R93I 5AV9A 3S1NI 3AZLA 3AYWB 5T64A 4KHAB 3KWQA 1M18C 3AZEA 1F66B 1ZLAD 4NE5A 1VQ71 4DRAA 3AZHA 2CWEA 4Z5TA 4J8VA 3CME1 1YIJ1 1P3ID 4J8WB 4X23D 5BO0B 3AZKC 1K9M2 3MGSB 1VQK1 2VUMI 3CCR1 5GXQD 4AYBA 2JE5A 3REJD 2JA5I 4QLCD 5DNMD 3AZFD 3CCLZ 2PYOD 3I07A 3MVDB 3W98B 1Q821 3AZKA 1BFMA 1ZH1A 1YI21 3KIHA 4E44A 3S2DI 3H0GI 5B40B 3AFAC 1I50I 3WAAD 3S1QI 3CCL1 3HKZA 4J8UC 1M1AC 3MGRC 1P3LC 3WTPD 3REIC 1RO4A 2LFUA 4E2WA 2HF1A 3CCEZ 3KSYA 2V8JA 1K8A1 4WU8C 1KD12 2NVTI 1B67A 1RO2A 3UTAC 2F4OA 3KUYC 5B33B 5GSUC 3AZIA 4MD7A 3AFAA 3X1TC 1TWCI 2IZ3A 4JJNB 3X1VC 4J8UA 3REIA 2RHBA 3AZMC 1QVFZ 4WU8A 4NE3A 1HTAA 1U35A 3UTAA 1ZLAB 3KUYA 3NH8A 5AN9F 3W97C 5IP7I 1N8R2 1P3IB 3B6GB 4X23B 4E31A 3EEDA 2F4MA 5GXQB 5AY8D 5G49B 1S32C 4H9RB 1VQ51 3REJB 3AZMA 3X1SC 2J8PA 4QLCB 5DNMB 3B0DB 3AZFB 2P28A 1Y1WI 3NDIA 2PYOB 4XUJD 1P34A 5CPJA 2FJ7A 4KGCC 2EGTA 3R45B 3C1BD 3VH6A 2E9HA 4Y7NI 1S32A 3LZ0D 5B2ID 3S16I 3A6NC 3X1SA 3O62A 4E32A 1M902 2NQBB 5FLXf 4UUZA 1VQOZ 1Z02A 3WAAB 2W03A 4KGCA 1WWIA 1Z01A 3CCJZ 1ULYA 4WNNA 5BT1C 5B31C 4NE6A 2OZKA 3S14I 3EPKA 2JS4A 3NQUB 4R8PA 2Y2OA 1VQL1 5B0ZD 3A6NA 3TU4C 4ZBJC 1YJWZ 3WA9C 4YM6D 4WV4B 3W97A 2DE6A 3G4SZ 4WZSB 1M18B 3UT9D 2NZDC 2HIOC 3EERA 1K731 3AZJD 1P3GB 2Y2JA 5BNVB 1H3OB 1P3FD 1HQ3D 3X1UD 1Z2CB 2XD1A 3CCU1 4RS4A 1BH9A 3AYWC 2QA41 3H0RC 1AOIA 1F66C 4HH4A 3J7A4 5B31G 3OW2Y 3GTMS 3KXBD 3B0CW 2HIOA 2VQRA 1Q7Y2 1I3QI 4XUJB 4J8WC 3MGSC 3C1BB 5CPIA 4J8XD 1ID3D 1VQ8Z 2FFFB 1R9TI 3RELD 3AYWA 2F8NG 3CMAZ 4KHAA 3LZ0B 1P3AD 5B2IB 1F66A 4E2YA 3CPWZ 1TZYD 3MVDC 1M1AB 3W98C 4J8WA 5BO0A 3I4NI 4RVHA 3MGSA 4BBRI 1EQZD 3MGPA 5B1MC 2Q4ZA 3REHC 5B40C 3AZGD 5B0ZB 1YUAA 1ZB8A 3CC41 1W2BY 4YM6B 3MVDA 3W98A 3M4OI 1KC81 4YS3D 2AROC 5AV6D 3UT9B 5CP6C 4H9SC 5B33C 2QR1B 3BG0B 5B40A 3AZJB 1SFOI 5KDMB 1P3FB 4JJNC 4RV9A 3X1UB 1PFTA 3GTMI 3AN2D 1VQN1 1ZLAC 4H9SA 3KXBB 5B33A 3F6TA 1P3IC 4X23C 2JR6A 2YFVA 1VQ6Z 4JJNA 1ID3B 5GXQC 4J8XB 4LD9D 3RELB 3REJC 3GTLI 4QLCC 5DNMC 3TE5B 3A1IA 3B0DC 3AZFC 1P3AB 1R4VA 1ZLAA 1TWGI 2PYOC 4A3GI 1TZYB 2J6AA 2PM9A 3IFUA 3B6GA 2E2JI 3S17I 1DL6A 3AZND 3CCV1 1EQZB 5GXQA 2OTLZ 2DE7A 5G49A 4H9RA 4EWCA 3REJA 3TU4B 5B0YA 2NVQI 2NZDB 1B6WA 4DQYB 3AZGB 3KIFA 1Q861 3VMGA 3GTPI 3WAAC 2PYOA 1RQFA 5B2JB 4S1TA 3R45A 1P3KD 3WTPC 4YS3B 2JUBA 2K3RA 5AV6B 3PO2I 1P3BD 2OOXB 1N2FA 3MZLB 5AVCD 2NQBA 2M48A 3FQMA 3WAAA 2QRDB 4CL1A 1RLYA 1RO0A 3AN2B 3EPLA 3WKJD 3NQUA 4A3JI 1P3GC 1P3PD 2WB1A 3HOYI 5AV5D 1YJNZ 5AY8C 3V9RB 4LD9B 2Y2IA 2QKDA 1M18A 2BYMA 2ZY4A 2QRCB 3JAMb 3IF8A 1X3ZA 4XUJC 4NBHA 4H9QB 1P3GA 5BNVA 1H3OA 3C1BC 3AZNB 4RVFA 5B1MB 3REHB 3LZ0C 3CCQZ 5B2IC 3M3YI 4MONA 3C1CD 1YITZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 4DGL A;  1N1J A;  4XUJ A;  2ARO B;  3C1B A;  1P3K B;  5CP6 B;  5DNN D;  2GU2 A;  1Q81 1;  1RNI A;  1P3B B;  4A3I I;  5B2I A;  5B0Z C;  5AVC B;  3LZ1 D;  4YM6 C;  3B6F D;  1M1A A;  1YHQ Z;  3MGR A;  1P3L A;  1K9M 1;  1Q82 2;  1WW9 A;  3OW2 Z;  3CCE 1;  3UT9 C;  5D1P A;  1Y8C A;  1WWS A;  4WU9 D;  5GSU A;  5B24 D;  3WKJ B;  3MGQ D;  3MNN D;  3AZJ C;  5B32 G;  3X1T A;  5B0Z A;  5GT3 D;  1P3L D;  1P3F C;  4CSR B;  1HQ3 C;  3X1U C;  1P3P B;  3X1V A;  5AV5 B;  3MZK B;  4NH1 C;  5A2Q f;  2HUE B;  3GTO I;  1K8A 2;  1KQS Y;  2Q51 A;  3I56 Z;  3NQJ B;  3KXB C;  3HOV I;  3AZE D;  3AZJ A;  4A93 I;  4A3F I;  5KDM A;  4J8V D;  1P3F A;  1ID3 C;  4J8X C;  3X1U A;  3ESW A;  2YAD A;  3REL C;  3EPJ A;  5B32 D;  4H9O A;  1VQ9 Z;  1P3A C;  1W2B Z;  3LJA D;  1VQP Z;  3C1C B;  3KXB A;  1TZY C;  3GTK I;  3WTP B;  1KX4 D;  2O53 A;  2RIQ A;  2L5A A;  4J8X A;  1EQZ C;  2RPR A;  5DNN B;  4MXU A;  2K5R A;  1YJ9 Z;  1P3A A;  1VLA A;  3AZG C;  1P9N A;  1VQO 1;  4Y52 I;  1VQM Z;  5B2J C;  3LZ1 B;  3B6F B;  3CCJ 1;  3CC7 Z;  2E2H I;  3FKI I;  4YS3 C;  3H0M C;  5B31 A;  5AV6 C;  3KFU G;  5C44 I;  4WU9 B;  2NVY I;  5B24 B;  3TU4 A;  3S15 I;  3MGQ B;  3MNN B;  3WA9 A;  3AZG A;  1YJW 1;  1YJ9 1;  5GT3 B;  1M1K 1;  3AZI D;  3RZO I;  5B2J A;  3MON A;  5AY8 B;  3G4S 1;  2F8N A;  3CC7 1;  3AN2 C;  2NZD A;  3G6E Z;  3VTN A;  5AV6 A;  1KX5 D;  2R7Z I;  3AZE B;  1U35 D;  3B0C T;  3LEL D;  4J8V B;  4LD9 C;  1TFI A;  1VQ4 Z;  5LL6 f;  5B32 B;  3EG5 B;  2JIQ A;  3CD6 Z;  3FQQ A;  3LJA B;  1K73 2;  3CXC Y;  5CPK D;  3W96 D;  4BY1 I;  1P34 D;  1KX4 B;  5CPJ D;  3VH6 T;  4E45 A;  3AZN C;  2FJ7 D;  1JWH C;  1WII A;  3V9R A;  4LD9 A;  2VPW A;  2W04 A;  3I55 Z;  3CMA 1;  2R92 I;  5C3I B;  4Z66 D;  3O62 D;  3S2H I;  3CC2 Z;  3CD6 1;  3CCS Z;  4WJ3 C;  1P3K C;  4CAY B;  5B1M A;  3F3F C;  4NB8 A;  1P3B C;  3REH A;  2E2I I;  3K7A I;  3I55 1;  3PO3 S;  4BY7 I;  2HU9 A;  1L1O C;  2ZAE B;  3QWU A;  5AVC C;  4R8P D;  1HQ3 B;  4A3K I;  3AZI B;  3VH5 A;  2ARO A;  1USP B;  3W97 D;  1P3K A;  1AA6 A;  3REK D;  1P3M D;  1NJI 1;  5CP6 A;  3GTG I;  4XZQ D;  1KX5 B;  2CV5 D;  2BJO A;  2DQN C;  3WKJ C;  3NDJ A;  4AWL C;  4NBC A;  4NFR A;  3VMI A;  2JA7 I;  3HOZ I;  5AVC A;  1U35 B;  2G5H C;  1P3P C;  2JNY A;  5JRG D;  5AV5 C;  3LEL B;  3F3P C;  2O4H A;  2HUE C;  4NOZ A;  1KC8 2;  5IT9 f;  2V8K A;  1AOI D;  3WKJ A;  1P3I A;  4X23 A;  5CPK B;  3W96 B;  2JMO A;  3S1M I;  5FUG B;  4CSR A;  1VQ6 1;  5AV8 D;  1P34 B;  5AV5 A;  5CPJ B;  2FJ7 B;  2I3C A;  1QF8 A;  5CPI D;  4MD8 A;  5A2Q b;  1VQ8 1;  4QLC A;  5DNM A;  3AZF A;  3J81 f;  4E2Z A;  3C1C C;  3NQJ A;  5FLM I;  2AYD A;  2JA6 I;  4Z66 B;  5BS7 C;  2RVQ D;  3O62 B;  3AV2 D;  4NBB A;  4UUZ B;  1FDI A;  3W99 D;  1S72 Z;  2G5I C;  5DNN C;  2OTL 1;  4WNN B;  2ZM5 A;  5CHL B;  3MGP D;  1NP6 A;  5B1L D;  1P3O D;  5FLX b;  3C1C A;  3Q87 A;  4R8P B;  3LZ1 C;  3B6F C;  3AL0 C;  4QTU A;  5BS7 A;  1TWF I;  3WTP A;  1KX3 D;  1KQS Z;  3H3V J;  3REK B;  3NH4 A;  1P3M B;  1S72 1;  5DNN A;  4XZQ B;  2BG1 A;  4WU9 C;  2CV5 B;  5B24 C;  2R6M A;  3MGQ C;  3MNN C;  5GT3 C;  1Q86 2;  3VH5 W;  5AVB D;  4H9N B;  5F99 D;  3LZ1 A;  1BH8 B;  4ZUX D;  5JRG B;  1FDO A;  1TWA I;  1ZB9 A;  3D6W A;  3IR7 A;  4KUD D;  1QVG Y;  4WU9 A;  1VQ7 Z;  3AZE C;  3MGQ A;  1KRL A;  3CME Z;  2IO5 B;  2JA8 I;  3I4M I;  1VQK Z;  4J8V C;  1YJN 1;  5AY8 A;  5AV8 B;  1QXF A;  3A1K A;  3VB9 A;  3UTB D;  3CCR Z;  5CPI B;  5B32 C;  2KPI A;  3P5J B;  2XD5 A;  2YFW B;  3LJA C;  2F2A C;  2QRE B;  2AKL A;  4A3E I;  5BNX B;  2Y2H A;  1JFI B;  4G91 B;  3AV2 B;  1KX4 C;  4HGA B;  1M19 D;  1Y1V S;  4HGZ A;  5E5A D;  3W99 B;  4MRI A;  5JA4 B;  3B6G D;  1KD1 1;  3LZ0 A;  1YI2 Z;  3CCQ 1;  5B32 A;  3MGP B;  4NBF A;  5B1L B;  3FDD A;  1P3O B;  5C3I C;  3WTP E;  3LJA A;  5B0Y D;  2KI7 B;  4Z2M H;  5GT0 D;  3HOX I;  1TAF B;  1YIT 1;  3U50 C;  4X6A I;  1KX3 B;  1KX4 A;  4AWL B;  3AV1 D;  1N8R 1;  1X3W A;  4YM6 A;  5AVB B;  3AZI C;  5F99 B;  1YHQ 1;  2NQB D;  4ZUX B;  2VF1 A;  5AV9 D;  3G71 Z;  3UT9 A;  4CAY A;  3AZL D;  3B0B A;  3J80 f;  1KX5 C;  3KWQ D;  4KUD B;  2NAP A;  1I6H I;  2WAQ A;  3CXC Z;  1Q81 2;  3RZD I;  2RT9 A;  3AZH D;  4Z5T D;  1T3U A;  1U35 C;  1HQ3 A;  5CM2 M;  3T4N B;  3LEL C;  2Y2K A;  1W2E A;  3IX0 A;  4RVG A;  4BBS I;  1USP A;  2YFV B;  3UTB B;  2QLV B;  4MD9 A;  3G71 1;  4A3M I;  1VQ5 Z;  1KX5 A;  2PMZ A;  3I56 1;  1M18 D;  1M90 1;  1Y1V I;  3GTJ I;  5CPK C;  3W96 C;  1ID3 A;  1P34 C;  2Y2P A;  3LEL A;  3AZK D;  5CPJ C;  1P3G D;  5E5A B;  3REL A;  1M19 B;  2F8N H;  2FJ7 C;  4MH4 A;  1VQ9 1;  5C3E I;  5IT9 b;  1TZY A;  3VMH A;  1VQP 1;  4TNU A;  4Z66 C;  3O62 C;  5B0Y B;  4G92 B;  5GT0 B;  5CPK A;  3W96 A;  4NB9 A;  5FUG A;  1EQZ A;  4NBD A;  2G2K A;  3CCM Z;  2JSS A;  4RVD A;  2Y2G A;  1QYP A;  2BYK B;  1Q9C A;  4H9P B;  3AV1 B;  3J81 b;  1VQL Z;  5D1O B;  4R8P C;  3AFA D;  1VQM 1;  4DRB A;  4Z66 A;  4YS3 A;  2Y0S A;  2W8S A;  5AV9 B;  3MGR D;  4J8U D;  3REI D;  2DF4 C;  4Z2M G;  4EO5 B;  3REK C;  3AZL B;  4XZQ C;  1P3M C;  3KWQ B;  2CV5 C;  4WU8 D;  2RBL A;  4DK1 A;  3CCM 1;  3UTA D;  1Q7Y 1;  3KUY D;  3AZH B;  4Z5T B;  5GSU D;  1K83 I;  2VUG A;  3X1T D;  5JRG C;  3HOU I;  4E2X A;  3AN2 A;  3CCU Z;  3X1V D;  2ZY5 A;  3REK A;  1P3M A;  2M6N A;  3G6E 1;  2Y2M A;  3AZM D;  4XZQ A;  2QA4 Z;  2CV5 A;  1AOI C;  3D9X A;  1S7M A;  2LY8 A;  3GKQ A;  3PO3 I;  3NFZ A;  2BYM B;  2IO5 C;  3JAM f;  5IP9 I;  4H9N A;  1M1K 2;  1BH8 A;  5AV8 C;  5JRG A;  3AZK B;  5CPI C;  3IP4 C;  1S32 D;  4NBA A;  1VQ4 1;  4M6B A;  4E30 A;  3X1S D;  2UWX A;  4H9Q A;  2PK7 A;  2RVQ C;  4G91 C;  1QVF Y;  3AV2 C;  4KGC D;  4HGA C;  3AZN A;  5T67 A;  3W99 C;  1N1J B;  5AV8 A;  1M1A D;  2JCH A;  4UPK A;  5C4J I;  5T6B A;  3MGP C;  5B1L C;  2YFW A;  1P3O C;  1JJ2 Z;  3A6N D;  4NBG A;  5BNX A;  3AFA B;  3CC4 Z;  1JFI A;  3CC2 1;  3AV2 A;  1KX3 C;  3CCS 1;  1QVG Z;  4J8U B;  3VH6 W;  3MGR B;  5JA4 A;  5BT1 D;  3REI B;  1P3B A;  1P3L B;  3W99 A;  2GTI A;  3TDH B;  5B31 D;  4WU8 B;  3BG1 B;  5B1L A;  3UTA B;  3KUY B;  1P3O A;  2OTJ Z;  5AVB C;  5GSU B;  5F99 C;  3TU4 D;  1WCM I;  4ZUX C;  1TAF A;  3X1T B;  3WA9 D;  2Y2Q A;  1KX3 A;  5B2J D;  1X0T A;  1WZN A;  2VPY A;  3X1V B;  2YU9 I;  2F8N D;  4KUD C;  4NFT A;  3CQZ I;  1VQN Z;  3AZM B;  2NZD D;  4XX2 A;  2Y2N A;  2HIO D;  1P3P A;  3NH5 A;  2P3Y A;  4NBE A;  5C4X I;  5AVB A;  2OTJ 1;  5F99 A;  2GTH A;  3HOW I;  4ZUX A;  3UTB C;  1PZR A;  2H85 A;  3GCF A;  3AYW D;  3J80 b;  1S32 B;  4KUD A;  1F66 D;  4QTT A;  1NJI 2;  4A3D I;  3X1S B;  3H0L C;  4H9O B;  1SIW A;  2ZY2 A;  1LQL A;  4J8W D;  4KGC B;  1KU5 A;  1M19 C;  3MGS D;  5E5A C;  2VPX A;  4E33 A;  3B6G C;  2E7Z A;  3CCV Z;  3UTB A;  2V8I A;  1ML8 A;  1WJ2 A;  4HGY A;  2F8N K;  3A6N B;  4G92 C;  5B0Y C;  5GT0 C;  4A3B I;  3MVD D;  3W97 B;  3W98 D;  3EPH A;  1M19 A;  5E5A A;  3GTQ I;  2Y2L A;  1Z03 A;  2IZ4 A;  2JIP A;  2OOY B;  4BXX I;  1YUK A;  3AV1 C;  5B31 B;  2ZY3 A;  5B1M D;  2DE5 A;  4A3C I;  1NUI A;  5B40 D;  3REH D;  3B6F A;  2QEX Z;  2B63 I;  4ZBJ B;  2NVX I;  5GT0 A;  3WA9 B;  2NQB C;  3VH5 T;  5AV9 C;  3S1R I;  3CPW Y;  2LIY A;  2ARO D;  1BH9 B;  4EO5 C;  3AZL C;  3KWQ C;  1AOI B;  5B24 A;  2F8N B;  2JIR A;  2BYK A;  1F1E A;  4H9P A;  5CP6 D;  3MNN A;  5GT3 A;  5B33 D;  4Z5T C;  2HIO B;  3AZH C;  3AV1 A;  2V45 A;  3LUS A;  5D1O A;  2QEX 1;  1A7W A;  4JJN D;  1TWH I;  4A3L I;  2R93 I;  5AV9 A;  3S1N I;  3AZL A;  3AYW B;  5T64 A;  4KHA B;  3KWQ A;  1M18 C;  3AZE A;  1F66 B;  1ZLA D;  4NE5 A;  1VQ7 1;  4DRA A;  3AZH A;  2CWE A;  4Z5T A;  4J8V A;  3CME 1;  1YIJ 1;  1P3I D;  4J8W B;  4X23 D;  5BO0 B;  3AZK C;  2V3V A;  3MGS B;  1K9M 2;  1VQK 1;  3CCR 1;  5GXQ D;  4AYB A;  2VUM I;  2VPZ A;  2JE5 A;  3REJ D;  2JA5 I;  4QLC D;  5DNM D;  3AZF D;  3CCL Z;  2PYO D;  3I07 A;  3MVD B;  3W98 B;  1Q82 1;  3AZK A;  1BFM A;  1ZH1 A;  1YI2 1;  3KIH A;  4E44 A;  3S2D I;  3H0G I;  5B40 B;  3AFA C;  1I50 I;  3WAA D;  3S1Q I;  3CCL 1;  3HKZ A;  4J8U C;  1M1A C;  3MGR C;  1P3L C;  3WTP D;  3REI C;  1RO4 A;  2LFU A;  4E2W A;  2HF1 A;  3CCE Z;  3KSY A;  2V8J A;  1K8A 1;  4WU8 C;  1KD1 2;  2NVT I;  1B67 A;  1RO2 A;  3UTA C;  2F4O A;  3KUY C;  5B33 B;  5GSU C;  3AZI A;  4MD7 A;  3AFA A;  3X1T C;  1TWC I;  2IZ3 A;  4JJN B;  3X1V C;  4J8U A;  3REI A;  1Q16 A;  2RHB A;  3AZM C;  2IV2 X;  1QVF Z;  4WU8 A;  4NE3 A;  1HTA A;  1U35 A;  3UTA A;  1ZLA B;  3KUY A;  3NH8 A;  5AN9 F;  3W97 C;  5IP7 I;  1N8R 2;  1P3I B;  3B6G B;  4X23 B;  4E31 A;  3EED A;  3D2L A;  2F4M A;  5GXQ B;  5AY8 D;  5G49 B;  1S32 C;  4H9R B;  1VQ5 1;  3REJ B;  3AZM A;  3X1S C;  2J8P A;  4QLC B;  5DNM B;  3B0D B;  3AZF B;  2JIO A;  2P28 A;  1Y1W I;  3NDI A;  2PYO B;  4XUJ D;  1P34 A;  5CPJ A;  2FJ7 A;  4KGC C;  2EGT A;  3R45 B;  3C1B D;  3VH6 A;  2E9H A;  4Y7N I;  1S32 A;  3LZ0 D;  5B2I D;  3S16 I;  3A6N C;  3X1S A;  3O62 A;  4E32 A;  1M90 2;  2NQB B;  5FLX f;  4UUZ A;  1VQO Z;  1Z02 A;  3WAA B;  2W03 A;  4KGC A;  1WWI A;  1Z01 A;  3CCJ Z;  1ULY A;  4WNN A;  5BT1 C;  5B31 C;  4NE6 A;  2OZK A;  3S14 I;  3EPK A;  2JS4 A;  3NQU B;  4R8P A;  2Y2O A;  1VQL 1;  5B0Z D;  3A6N A;  3TU4 C;  4ZBJ C;  1YJW Z;  3WA9 C;  4YM6 D;  4WV4 B;  3W97 A;  2DE6 A;  3G4S Z;  1YIJ Z;  4WZS B;  1M18 B;  3UT9 D;  2NZD C;  2HIO C;  3EER A;  1K73 1;  3AZJ D;  1P3G B;  2Y2J A;  5BNV B;  1H3O B;  1P3F D;  1HQ3 D;  3X1U D;  1Z2C B;  2XD1 A;  3CCU 1;  4RS4 A;  1BH9 A;  3AYW C;  2QA4 1;  3H0R C;  1AOI A;  1F66 C;  4HH4 A;  1JJ2 Y;  3J7A 4;  5B31 G;  3OW2 Y;  3GTM S;  2JIM A;  3KXB D;  3B0C W;  2HIO A;  2VQR A;  1Q7Y 2;  1I3Q I;  4XUJ B;  4J8W C;  3MGS C;  3C1B B;  5CPI A;  4J8X D;  1ID3 D;  1VQ8 Z;  2FFF B;  1R9T I;  3REL D;  3AYW A;  2F8N G;  3CMA Z;  4KHA A;  3LZ0 B;  1P3A D;  5B2I B;  1F66 A;  4E2Y A;  3CPW Z;  1TZY D;  3MVD C;  1M1A B;  3W98 C;  4J8W A;  5BO0 A;  3I4N I;  4RVH A;  3MGS A;  4BBR I;  1EQZ D;  3MGP A;  5B1M C;  2Q4Z A;  3REH C;  5B40 C;  3AZG D;  5B0Z B;  1YUA A;  1ZB8 A;  3CC4 1;  1W2B Y;  4YM6 B;  3MVD A;  3W98 A;  3M4O I;  1KC8 1;  4YS3 D;  2ARO C;  5AV6 D;  3UT9 B;  5CP6 C;  4H9S C;  5B33 C;  2QR1 B;  3BG0 B;  5B40 A;  3AZJ B;  1SFO I;  5KDM B;  1P3F B;  4JJN C;  4RV9 A;  3X1U B;  1PFT A;  3GTM I;  3AN2 D;  1VQN 1;  1ZLA C;  4H9S A;  3KXB B;  5B33 A;  3F6T A;  1P3I C;  4X23 C;  2JR6 A;  2YFV A;  1VQ6 Z;  4JJN A;  1ID3 B;  5GXQ C;  4J8X B;  4LD9 D;  3REL B;  3REJ C;  3GTL I;  4QLC C;  5DNM C;  3TE5 B;  3A1I A;  3B0D C;  3AZF C;  1P3A B;  1R4V A;  1ZLA A;  1TWG I;  2PYO C;  4A3G I;  1TZY B;  2J6A A;  2PM9 A;  3IFU A;  3B6G A;  2E2J I;  3S17 I;  1DL6 A;  3AZN D;  3CCV 1;  1EQZ B;  5GXQ A;  2OTL Z;  2DE7 A;  5G49 A;  4H9R A;  4EWC A;  3REJ A;  3TU4 B;  5B0Y A;  2NVQ I;  2NZD B;  1B6W A;  4DQY B;  3AZG B;  3KIF A;  1Q86 1;  3VMG A;  2LEX A;  3WAA C;  2PYO A;  1RQF A;  5B2J B;  4S1T A;  3GTP I;  3R45 A;  1P3K D;  3WTP C;  4YS3 B;  2JUB A;  2K3R A;  5AV6 B;  3PO2 I;  1P3B D;  2OOX B;  1N2F A;  3MZL B;  5AVC D;  2NQB A;  2M48 A;  3FQM A;  3WAA A;  2QRD B;  4CL1 A;  1RLY A;  1RO0 A;  3AN2 B;  3EPL A;  3WKJ D;  3NQU A;  4A3J I;  1P3G C;  1P3P D;  2WB1 A;  3HOY I;  5AV5 D;  1YJN Z;  5AY8 C;  3V9R B;  4LD9 B;  2Y2I A;  2QKD A;  1M18 A;  2BYM A;  2ZY4 A;  2QRC B;  3JAM b;  3IF8 A;  1X3Z A;  4XUJ C;  4NBH A;  4H9Q B;  1P3G A;  5BNV A;  1H3O A;  3C1B C;  3AZN B;  4RVF A;  5B1M B;  3REH B;  3LZ0 C;  3CCQ Z;  5B2I C;  3M3Y I;  4MON A;  3C1C D;  1YIT Z; 
#chains in the Genus database with same CATH homology
 4DGL A;  1N1J A;  4XUJ A;  2ARO B;  3C1B A;  1P3K B;  5CP6 B;  5DNN D;  2GU2 A;  1Q81 1;  1RNI A;  1P3B B;  4A3I I;  5B2I A;  5B0Z C;  5AVC B;  3LZ1 D;  4YM6 C;  3B6F D;  1M1A A;  1YHQ Z;  3MGR A;  1P3L A;  1K9M 1;  1Q82 2;  1WW9 A;  3OW2 Z;  3CCE 1;  3UT9 C;  5D1P A;  1WWS A;  4WU9 D;  5GSU A;  5B24 D;  3WKJ B;  3MGQ D;  3MNN D;  3AZJ C;  5B32 G;  3X1T A;  5B0Z A;  5GT3 D;  1P3L D;  1P3F C;  4CSR B;  1HQ3 C;  3X1U C;  1P3P B;  3X1V A;  5AV5 B;  3MZK B;  4NH1 C;  5A2Q f;  2HUE B;  3GTO I;  1K8A 2;  1KQS Y;  2Q51 A;  3I56 Z;  3NQJ B;  3KXB C;  3HOV I;  3AZE D;  3AZJ A;  4A93 I;  4A3F I;  5KDM A;  4J8V D;  1P3F A;  1ID3 C;  4J8X C;  3X1U A;  3ESW A;  2YAD A;  3REL C;  3EPJ A;  5B32 D;  4H9O A;  1VQ9 Z;  1P3A C;  1W2B Z;  3LJA D;  1VQP Z;  3C1C B;  3KXB A;  1TZY C;  3GTK I;  3WTP B;  1KX4 D;  2O53 A;  2RIQ A;  2L5A A;  4J8X A;  1EQZ C;  2RPR A;  5DNN B;  4MXU A;  2K5R A;  1YJ9 Z;  1P3A A;  1VLA A;  3AZG C;  1P9N A;  1VQO 1;  4Y52 I;  1VQM Z;  5B2J C;  3LZ1 B;  3B6F B;  3CCJ 1;  3CC7 Z;  2E2H I;  3FKI I;  4YS3 C;  3H0M C;  5B31 A;  5AV6 C;  3KFU G;  5C44 I;  4WU9 B;  2NVY I;  5B24 B;  3TU4 A;  3S15 I;  3MGQ B;  3MNN B;  3WA9 A;  3AZG A;  1YJW 1;  1YJ9 1;  5GT3 B;  1M1K 1;  3AZI D;  3RZO I;  5B2J A;  3MON A;  5AY8 B;  3G4S 1;  2F8N A;  3CC7 1;  3AN2 C;  2NZD A;  3G6E Z;  3VTN A;  5AV6 A;  1KX5 D;  2R7Z I;  3AZE B;  1U35 D;  3B0C T;  3LEL D;  4J8V B;  4LD9 C;  1TFI A;  1VQ4 Z;  5LL6 f;  5B32 B;  3EG5 B;  3CD6 Z;  3FQQ A;  3LJA B;  1K73 2;  3CXC Y;  5CPK D;  3W96 D;  4BY1 I;  1P34 D;  1KX4 B;  5CPJ D;  3VH6 T;  4E45 A;  3AZN C;  2FJ7 D;  1JWH C;  1WII A;  3V9R A;  4LD9 A;  2W04 A;  3I55 Z;  1VQ8 1;  3CMA 1;  2R92 I;  5C3I B;  4Z66 D;  3O62 D;  3S2H I;  3CC2 Z;  3CD6 1;  3CCS Z;  4WJ3 C;  1P3K C;  4CAY B;  5B1M A;  3F3F C;  4NB8 A;  1P3B C;  3REH A;  2E2I I;  3K7A I;  3I55 1;  3PO3 S;  4BY7 I;  2HU9 A;  1L1O C;  2ZAE B;  3QWU A;  5AVC C;  4R8P D;  1HQ3 B;  4A3K I;  3AZI B;  3VH5 A;  2ARO A;  1USP B;  3W97 D;  1P3K A;  3REK D;  1P3M D;  1NJI 1;  5CP6 A;  3GTG I;  4XZQ D;  1KX5 B;  2CV5 D;  2BJO A;  2DQN C;  3WKJ C;  3NDJ A;  4AWL C;  4NBC A;  4NFR A;  3VMI A;  2JA7 I;  3HOZ I;  5AVC A;  1U35 B;  2G5H C;  1P3P C;  2JNY A;  5JRG D;  5AV5 C;  3LEL B;  3F3P C;  2O4H A;  2HUE C;  4NOZ A;  1KC8 2;  5IT9 f;  2V8K A;  1AOI D;  3WKJ A;  1P3I A;  4X23 A;  5CPK B;  3W96 B;  2JMO A;  3S1M I;  5FUG B;  4CSR A;  1VQ6 1;  5AV8 D;  1P34 B;  5AV5 A;  5CPJ B;  2FJ7 B;  2I3C A;  1QF8 A;  5CPI D;  4MD8 A;  5A2Q b;  4QLC A;  5DNM A;  3AZF A;  3J81 f;  4E2Z A;  3C1C C;  3NQJ A;  5FLM I;  2JA6 I;  4Z66 B;  5BS7 C;  2RVQ D;  3O62 B;  3AV2 D;  4NBB A;  4UUZ B;  3W99 D;  1S72 Z;  2G5I C;  5DNN C;  2OTL 1;  4WNN B;  2ZM5 A;  5CHL B;  3MGP D;  1NP6 A;  5B1L D;  1P3O D;  5FLX b;  3C1C A;  3Q87 A;  4R8P B;  3LZ1 C;  3B6F C;  3AL0 C;  4QTU A;  5BS7 A;  1TWF I;  3WTP A;  1KX3 D;  1KQS Z;  3H3V J;  3REK B;  3NH4 A;  1P3M B;  1S72 1;  5DNN A;  4XZQ B;  2BG1 A;  4WU9 C;  2CV5 B;  5B24 C;  2R6M A;  3MGQ C;  3MNN C;  5GT3 C;  1Q86 2;  3VH5 W;  5AVB D;  4H9N B;  5F99 D;  3LZ1 A;  1BH8 B;  4ZUX D;  5JRG B;  1TWA I;  1ZB9 A;  3D6W A;  1JJ2 Y;  4KUD D;  1QVG Y;  4WU9 A;  1VQ7 Z;  3AZE C;  3MGQ A;  1KRL A;  3CME Z;  2IO5 B;  2JA8 I;  3I4M I;  1VQK Z;  4J8V C;  1YJN 1;  5AY8 A;  5AV8 B;  3A1K A;  3VB9 A;  3UTB D;  3CCR Z;  5CPI B;  5B32 C;  2KPI A;  3P5J B;  2XD5 A;  2YFW B;  3LJA C;  2F2A C;  2QRE B;  2AKL A;  4A3E I;  5BNX B;  2Y2H A;  1JFI B;  4G91 B;  3AV2 B;  1KX4 C;  4HGA B;  1M19 D;  1Y1V S;  4HGZ A;  5E5A D;  3W99 B;  4MRI A;  5JA4 B;  3B6G D;  1KD1 1;  3LZ0 A;  1YI2 Z;  3CCQ 1;  5B32 A;  3MGP B;  4NBF A;  5B1L B;  3FDD A;  1P3O B;  5C3I C;  3WTP E;  3LJA A;  5B0Y D;  2KI7 B;  4Z2M H;  5GT0 D;  3HOX I;  1TAF B;  1YIT 1;  3U50 C;  4X6A I;  1KX3 B;  1KX4 A;  4AWL B;  3AV1 D;  1N8R 1;  1X3W A;  4YM6 A;  5AVB B;  3AZI C;  5F99 B;  1YHQ 1;  2NQB D;  4ZUX B;  2VF1 A;  5AV9 D;  3G71 Z;  3UT9 A;  4CAY A;  3AZL D;  3B0B A;  3J80 f;  1KX5 C;  3KWQ D;  4KUD B;  1I6H I;  2WAQ A;  3CXC Z;  1Q81 2;  3RZD I;  2RT9 A;  3AZH D;  4Z5T D;  1T3U A;  1U35 C;  1HQ3 A;  5CM2 M;  3T4N B;  3LEL C;  2Y2K A;  1W2E A;  3IX0 A;  4RVG A;  4BBS I;  1USP A;  2YFV B;  3UTB B;  2QLV B;  4MD9 A;  3G71 1;  4A3M I;  1VQ5 Z;  1KX5 A;  2PMZ A;  3I56 1;  1M18 D;  1M90 1;  1Y1V I;  3GTJ I;  5CPK C;  3W96 C;  1ID3 A;  1P34 C;  2Y2P A;  3LEL A;  3AZK D;  5CPJ C;  1P3G D;  5E5A B;  3REL A;  1M19 B;  2F8N H;  2FJ7 C;  4MH4 A;  1VQ9 1;  5C3E I;  5IT9 b;  1TZY A;  3VMH A;  1VQP 1;  4TNU A;  4Z66 C;  3O62 C;  5B0Y B;  4G92 B;  5GT0 B;  5CPK A;  3W96 A;  4NB9 A;  5FUG A;  1EQZ A;  4NBD A;  2G2K A;  3CCM Z;  2JSS A;  4RVD A;  2Y2G A;  1QYP A;  2BYK B;  1Q9C A;  4H9P B;  3AV1 B;  3J81 b;  1VQL Z;  5D1O B;  4R8P C;  3AFA D;  1VQM 1;  4DRB A;  4Z66 A;  4YS3 A;  2Y0S A;  2W8S A;  5AV9 B;  3MGR D;  4J8U D;  3REI D;  2DF4 C;  4Z2M G;  4EO5 B;  3REK C;  3AZL B;  4XZQ C;  1P3M C;  3KWQ B;  2CV5 C;  4WU8 D;  2RBL A;  4DK1 A;  3CCM 1;  3UTA D;  1Q7Y 1;  3KUY D;  3AZH B;  4Z5T B;  5GSU D;  1K83 I;  2VUG A;  3X1T D;  5JRG C;  3HOU I;  4E2X A;  3AN2 A;  3CCU Z;  3X1V D;  2ZY5 A;  3REK A;  1P3M A;  2M6N A;  3G6E 1;  2Y2M A;  3AZM D;  4XZQ A;  2QA4 Z;  2CV5 A;  1AOI C;  3D9X A;  1S7M A;  2LY8 A;  3GKQ A;  3PO3 I;  3NFZ A;  2BYM B;  2IO5 C;  3JAM f;  5IP9 I;  4H9N A;  1M1K 2;  1BH8 A;  5AV8 C;  5JRG A;  3AZK B;  5CPI C;  3IP4 C;  1S32 D;  4NBA A;  1VQ4 1;  4M6B A;  4E30 A;  3X1S D;  2UWX A;  4H9Q A;  2PK7 A;  2RVQ C;  4G91 C;  1QVF Y;  3AV2 C;  4KGC D;  4HGA C;  3AZN A;  5T67 A;  3W99 C;  1N1J B;  5AV8 A;  1M1A D;  2JCH A;  4UPK A;  5C4J I;  5T6B A;  3MGP C;  5B1L C;  2YFW A;  1P3O C;  1JJ2 Z;  3A6N D;  4NBG A;  5BNX A;  3AFA B;  3CC4 Z;  1JFI A;  3CC2 1;  3AV2 A;  1KX3 C;  3CCS 1;  1QVG Z;  4J8U B;  3VH6 W;  3MGR B;  5JA4 A;  5BT1 D;  3REI B;  1P3B A;  1P3L B;  3W99 A;  2GTI A;  3TDH B;  5B31 D;  4WU8 B;  3BG1 B;  5B1L A;  3UTA B;  3KUY B;  1P3O A;  2OTJ Z;  5AVB C;  5GSU B;  5F99 C;  3TU4 D;  1WCM I;  4ZUX C;  1TAF A;  3X1T B;  3WA9 D;  2Y2Q A;  1KX3 A;  5B2J D;  1X0T A;  2YU9 I;  3X1V B;  2F8N D;  4KUD C;  4NFT A;  3CQZ I;  1VQN Z;  3AZM B;  2NZD D;  4XX2 A;  2Y2N A;  2HIO D;  1P3P A;  3NH5 A;  2P3Y A;  4NBE A;  5C4X I;  5AVB A;  2OTJ 1;  5F99 A;  2GTH A;  3HOW I;  4ZUX A;  3UTB C;  1PZR A;  2H85 A;  3GCF A;  3AYW D;  3J80 b;  1S32 B;  4KUD A;  1F66 D;  4QTT A;  1NJI 2;  4A3D I;  3X1S B;  3H0L C;  4H9O B;  2ZY2 A;  1LQL A;  4J8W D;  4KGC B;  1KU5 A;  1M19 C;  3MGS D;  5E5A C;  4E33 A;  3B6G C;  3CCV Z;  3UTB A;  2V8I A;  1ML8 A;  4HGY A;  2F8N K;  3A6N B;  4G92 C;  5B0Y C;  5GT0 C;  4A3B I;  3MVD D;  3W97 B;  3W98 D;  3EPH A;  1M19 A;  5E5A A;  3GTQ I;  2Y2L A;  1Z03 A;  2IZ4 A;  2OOY B;  4BXX I;  1YUK A;  3AV1 C;  5B31 B;  2ZY3 A;  5B1M D;  2DE5 A;  4A3C I;  1NUI A;  5B40 D;  3REH D;  3B6F A;  2QEX Z;  2B63 I;  4ZBJ B;  2NVX I;  5GT0 A;  3WA9 B;  2NQB C;  3VH5 T;  5AV9 C;  3S1R I;  3CPW Y;  2LIY A;  2ARO D;  1BH9 B;  4EO5 C;  3AZL C;  3KWQ C;  1AOI B;  5B24 A;  2F8N B;  2BYK A;  1F1E A;  4H9P A;  5CP6 D;  3MNN A;  5GT3 A;  5B33 D;  4Z5T C;  2HIO B;  3AZH C;  3AV1 A;  3LUS A;  5D1O A;  1YIJ Z;  2QEX 1;  1A7W A;  4JJN D;  1TWH I;  4A3L I;  2R93 I;  5AV9 A;  3S1N I;  3AZL A;  3AYW B;  5T64 A;  4KHA B;  3KWQ A;  1M18 C;  3AZE A;  1F66 B;  1ZLA D;  4NE5 A;  1VQ7 1;  4DRA A;  3AZH A;  2CWE A;  4Z5T A;  4J8V A;  3CME 1;  1YIJ 1;  1P3I D;  4J8W B;  4X23 D;  5BO0 B;  3AZK C;  1K9M 2;  3MGS B;  1VQK 1;  2VUM I;  3CCR 1;  5GXQ D;  4AYB A;  2JE5 A;  3REJ D;  2JA5 I;  4QLC D;  5DNM D;  3AZF D;  3CCL Z;  2PYO D;  3I07 A;  3MVD B;  3W98 B;  1Q82 1;  3AZK A;  1BFM A;  1ZH1 A;  1YI2 1;  3KIH A;  4E44 A;  3S2D I;  3H0G I;  5B40 B;  3AFA C;  1I50 I;  3WAA D;  3S1Q I;  3CCL 1;  3HKZ A;  4J8U C;  1M1A C;  3MGR C;  1P3L C;  3WTP D;  3REI C;  1RO4 A;  2LFU A;  4E2W A;  2HF1 A;  3CCE Z;  3KSY A;  2V8J A;  1K8A 1;  4WU8 C;  1KD1 2;  2NVT I;  1B67 A;  1RO2 A;  3UTA C;  2F4O A;  3KUY C;  5B33 B;  5GSU C;  3AZI A;  4MD7 A;  3AFA A;  3X1T C;  1TWC I;  2IZ3 A;  4JJN B;  3X1V C;  4J8U A;  3REI A;  2RHB A;  3AZM C;  1QVF Z;  4WU8 A;  4NE3 A;  1HTA A;  1U35 A;  3UTA A;  1ZLA B;  3KUY A;  3NH8 A;  5AN9 F;  3W97 C;  5IP7 I;  1N8R 2;  1P3I B;  3B6G B;  4X23 B;  4E31 A;  3EED A;  2F4M A;  5GXQ B;  5AY8 D;  5G49 B;  1S32 C;  4H9R B;  1VQ5 1;  3REJ B;  3AZM A;  3X1S C;  2J8P A;  4QLC B;  5DNM B;  3B0D B;  3AZF B;  2P28 A;  1Y1W I;  3NDI A;  2PYO B;  4XUJ D;  1P34 A;  5CPJ A;  2FJ7 A;  4KGC C;  2EGT A;  3R45 B;  3C1B D;  3VH6 A;  2E9H A;  4Y7N I;  1S32 A;  3LZ0 D;  5B2I D;  3S16 I;  3A6N C;  3X1S A;  3O62 A;  4E32 A;  1M90 2;  2NQB B;  5FLX f;  4UUZ A;  1VQO Z;  1Z02 A;  3WAA B;  2W03 A;  4KGC A;  1WWI A;  1Z01 A;  3CCJ Z;  1ULY A;  4WNN A;  5BT1 C;  5B31 C;  4NE6 A;  2OZK A;  3S14 I;  3EPK A;  2JS4 A;  3NQU B;  4R8P A;  2Y2O A;  1VQL 1;  5B0Z D;  3A6N A;  3TU4 C;  4ZBJ C;  1YJW Z;  3WA9 C;  4YM6 D;  4WV4 B;  3W97 A;  2DE6 A;  3G4S Z;  4WZS B;  1M18 B;  3UT9 D;  2NZD C;  2HIO C;  3EER A;  1K73 1;  3AZJ D;  1P3G B;  2Y2J A;  5BNV B;  1H3O B;  1P3F D;  1HQ3 D;  3X1U D;  1Z2C B;  2XD1 A;  3CCU 1;  4RS4 A;  1BH9 A;  3AYW C;  2QA4 1;  3H0R C;  1AOI A;  1F66 C;  4HH4 A;  3J7A 4;  5B31 G;  3OW2 Y;  3GTM S;  3KXB D;  3B0C W;  2HIO A;  2VQR A;  1Q7Y 2;  1I3Q I;  4XUJ B;  4J8W C;  3MGS C;  3C1B B;  5CPI A;  4J8X D;  1ID3 D;  1VQ8 Z;  2FFF B;  1R9T I;  3REL D;  3AYW A;  2F8N G;  3CMA Z;  4KHA A;  3LZ0 B;  1P3A D;  5B2I B;  1F66 A;  4E2Y A;  3CPW Z;  1TZY D;  3MVD C;  1M1A B;  3W98 C;  4J8W A;  5BO0 A;  3I4N I;  4RVH A;  3MGS A;  4BBR I;  1EQZ D;  3MGP A;  5B1M C;  2Q4Z A;  3REH C;  5B40 C;  3AZG D;  5B0Z B;  1YUA A;  1ZB8 A;  3CC4 1;  1W2B Y;  4YM6 B;  3MVD A;  3W98 A;  3M4O I;  1KC8 1;  4YS3 D;  2ARO C;  5AV6 D;  3UT9 B;  5CP6 C;  4H9S C;  5B33 C;  2QR1 B;  3BG0 B;  5B40 A;  3AZJ B;  1SFO I;  5KDM B;  1P3F B;  4JJN C;  4RV9 A;  3X1U B;  1PFT A;  3GTM I;  3AN2 D;  1VQN 1;  1ZLA C;  4H9S A;  3KXB B;  5B33 A;  3F6T A;  1P3I C;  4X23 C;  2JR6 A;  2YFV A;  1VQ6 Z;  4JJN A;  1ID3 B;  5GXQ C;  4J8X B;  4LD9 D;  3REL B;  3REJ C;  3GTL I;  4QLC C;  5DNM C;  3TE5 B;  3A1I A;  3B0D C;  3AZF C;  1P3A B;  1R4V A;  1ZLA A;  1TWG I;  2PYO C;  4A3G I;  1TZY B;  2J6A A;  2PM9 A;  3IFU A;  3B6G A;  2E2J I;  3S17 I;  1DL6 A;  3AZN D;  3CCV 1;  1EQZ B;  5GXQ A;  2OTL Z;  2DE7 A;  5G49 A;  4H9R A;  4EWC A;  3REJ A;  3TU4 B;  5B0Y A;  2NVQ I;  2NZD B;  1B6W A;  4DQY B;  3AZG B;  3KIF A;  1Q86 1;  3VMG A;  3GTP I;  3WAA C;  2PYO A;  1RQF A;  5B2J B;  4S1T A;  3R45 A;  1P3K D;  3WTP C;  4YS3 B;  2JUB A;  2K3R A;  5AV6 B;  3PO2 I;  1P3B D;  2OOX B;  1N2F A;  3MZL B;  5AVC D;  2NQB A;  2M48 A;  3FQM A;  3WAA A;  2QRD B;  4CL1 A;  1RLY A;  1RO0 A;  3AN2 B;  3EPL A;  3WKJ D;  3NQU A;  4A3J I;  1P3G C;  1P3P D;  2WB1 A;  3HOY I;  5AV5 D;  1YJN Z;  5AY8 C;  3V9R B;  4LD9 B;  2Y2I A;  2QKD A;  1M18 A;  2BYM A;  2ZY4 A;  2QRC B;  3JAM b;  3IF8 A;  1X3Z A;  4XUJ C;  4NBH A;  4H9Q B;  1P3G A;  5BNV A;  1H3O A;  3C1B C;  3AZN B;  4RVF A;  5B1M B;  3REH B;  3LZ0 C;  3CCQ Z;  5B2I C;  3M3Y I;  4MON A;  3C1C D;  1YIT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...