3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/replication
molecule keywords Ribonuclease H2 subunit A
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
3H0LC 2F8ND 3G71Z 2FJ7D 5JA4B 3MVDB 3W98B 5AV5B 5JRGD 2NZDB 2PYOC 1YITZ 5GT3A 5AV9C 2BG1A 4YM6C 5E5AA 2AROB 1P3FC 4Z2MG 2NVYI 2NVQI 2W03A 1WWIA 3NQUA 4JJND 2P3YA 1HQ3A 2RPRA 3MZLB 2FJ7A 3X1VC 3HOUI 5AVCD 4KUDB 5AV5A 4HGAC 1K9M1 3WKJD 5IT9b 1FDOA 2JCHA 1VQ41 1M1AD 4KUDD 3AZGA 5B0YA 4WU9B 1P3PD 1JFIB 1YJ9Z 5AV6D 2F8NG 3FQMA 1YJW1 3W97A 5BNVA 4J8XB 2V3VA 4NBEA 4JJNA 5GT3B 4BBRI 3REIB 1KX3B 4DRAA 3I56Z 1S32D 3MVDA 3AZMD 3CMEZ 3EG5B 1ULYA 3I561 4E30A 1P3IA 3CPWZ 3MGSC 3AZKC 4WJ3C 1P3AB 1WJ2A 2GU2A 3IX0A 5AVCA 3RZDI 2DE5A 5FUGB 4H9SC 4LD9B 2PK7A 2W04A 3I551 1YJNZ 2Y2NA 4WU8D 1VQ5Z 2B63I 5IP9I 3UTBB 1USPB 1VQMZ 4LD9D 4ZBJC 2NVTI 2JA5I 1P3FD 3UTBD 3C1BA 1P3BA 1TWHI 3S1QI 4YS3B 1QYPA 3D2LA 5G49B 2WB1A 3REKB 1TAFB 2HIOD 1P3PB 5B32D 3REJC 1M1AC 2K5RA 3A1IA 3GTPI 1P34C 2IV2X 4G91B 3LZ1C 3AZHA 1P34B 3TE5B 5GXQA 1BFMA 1P3BD 3JAMb 2Y2LA 1VQKZ 3CCEZ 3AZNA 5B1LC 3V9RB 5AV9B 5B1LB 3MGPD 5DNND 1TZYC 5JRGA 3C1BB 5CP6C 3RELC 3AN2A 3G6E1 3AZLD 1AOIA 5F99D 2WAQA 3LELA 4A3CI 4XZQA 3AV1C 3MNNC 1M19D 4KUDA 1F66B 2VUMI 4R8PB 1ZLAC 4XUJA 4NFRA 1VQO1 1Q7Y1 1QVGZ 1PFTA 1M901 2G2KA 1W2BZ 1QVFY 2V8IA 4A3FI 1K9M2 3KXBD 4J8UD 3UT9A 3VMIA 3S1RI 1Q862 3X1TC 3PO2I 4H9PB 5GSUA 5AY8A 3G711 3REIC 4XUJB 3H0MC 1TWCI 5F99A 3AZFC 3B6GB 3AZFB 3B6GC 2QKDA 4RV9A 3CCS1 1U35B 4J8WC 4A3DI 5B1LD 3CC41 3AZLB 2AROC 5CPKB 3P5JB 5B0YB 4WU9A 2ZM5A 2EGTA 3AV1D 1M19C 5A2Qb 2OTJ1 5B0YD 3GTMS 1KX5B 2O4HA 3GTQI 2ZY2A 3MONA 4G92B 4NB9A 3FQQA 2RHBA 3CCJ1 1BH9A 4ZUXC 3AZIA 1WW9A 3KXBC 4J8UC 1S32C 1ZH1A 1P3KC 4HGZA 2L5AA 2XD5A 2IZ4A 2LFUA 3KUYA 1K8A1 3EERA 5DNMD 4E33A 1DL6A 5B0ZB 2IO5B 5BS7C 3MGSB 3AZKB 4BY1I 5B33D 5C3EI 3TU4C 3WA9D 3I55Z 1YJN1 4WU8C 1KX5A 1H3OB 4Z66B 4Z5TC 4YS3A 1RNIA 1S7MA 4BBSI 2G5IC 4ZBJB 3J81b 2BYMB 1Z2CB 3AV2A 5AV8D 3W96B 4RVFA 3GTOI 4UUZB 3UTBA 1USPA 4J8XD 1ID3A 1RLYA 5GSUD 5IT9f 5GT3D 4H9RB 3A6NB 3C1CD 1BH9B 1KX3D 2VF1A 3LZ1D 2K3RA 3CCU1 3AZMB 5B40A 4X23C 2IZ3A 3PO3I 1M18C 1P3GC 1HQ3D 3B6FD 2ZY5A 3MGRA 5AV6A 2G5HC 4J8WB 1VQK1 3CCE1 2NQBA 1AOIB 2FFFB 4M6BA 4CSRA 3H3VJ 2DQNC 5CPID 4JJNB 1P3MD 2PMZA 3LJAA 4QLCC 2JE5A 1AOID 3G6EZ 4R8PA 1VQN1 2F8NA 3UTAA 2Y0SA 1KRLA 4MH4A 3HOWI 3UTAC 3CCRZ 3REKD 3O62B 4R8PC 1ZLAB 2QR1B 3S2DI 3CC71 3A6NA 4QLCA 2JIMA 2M6NA 4CSRB 3KUYD 3X1TD 2QEX1 1P3AD 2R7ZI 3MGRB 3REID 2QREB 3MGRC 3BG1B 3CXCZ 4J8VD 1M18D 1P3GA 3B6FC 2R93I 4X23A 4TNUA 3CCLZ 2I3CA 4LD9C 3CMAZ 4Z5TB 4YM6D 5CPJD 5B24D 5CPIB 5GT0C 1P3MB 2QRCB 4DK1A 5DNNC 3UTBC 2YFWB 3X1UD 3LZ0B 3REHB 3AN2B 3VMGA 1JWHC 3CCV1 3AV2C 3AZLC 3AFAD 4MD7A 4J8VA 3CPWY 2V8JA 3WTPC 1PZRA 3AN2D 1KX3A 1N1JA 5FLXb 3J80b 4YS3C 3M4OI 2RVQD 4Z5TA 3MGPA 1VQ4Z 1P3PC 1M1AB 4WU8A 3REKC 1KX5C 4BXXI 3TU4A 3CCJZ 4KGCB 4XUJD 5B32B 4MD8A 3KUYC 2H85A 1X3WA 1TZYD 1P3KA 4HGYA 2HU9A 3KXBA 5DNMC 1F1EA 5B31B 4J8UA 5B33A 1KU5A 4J8VB 3AZIC 2RBLA 3HKZA 4RVGA 3S14I 4CL1A 5B0ZC 4WZSB 3QWUA 3G4S1 3LJAD 5AVBA 1ZB8A 2VPYA 3KIFA 4Z5TD 4WU8B 5G49A 2W8SA 5GT0D 3UTAB 1VQM1 2J6AA 3WAAC 4DQYB 4WU9C 5GXQD 3WAAB 2QA4Z 4J8XC 3AYWA 4X6AI 4NE5A 3AYWC 4A3LI 1X3ZA 4J8WA 5BNVB 4J8XA 1ID3D 3W97B 2Q4ZA 3CCUZ 3WAAA 3I4NI 1NUIA 4CAYB 3REIA 1P3GB 3GCFA 4NBCA 4RVDA 5BO0B 5AY8C 2V8KA 3GTKI 2DE7A 4Y7NI 1KC81 5C4JI 4QTTA 3CC2Z 5AVBC 5DNNB 5IP7I 5AVBB 3J80f 5B0ZA 1YHQZ 4E2XA 5E5AB 5B33C 5DNMA 1ZLAA 3EEDA 4S1TA 3MNNA 4KUDC 3CCR1 4XZQC 5GXQB 3A6ND 3C1CB 3WAAD 1NJI1 2Y2KA 4G91C 3LZ1B 3REKA 3NQJB 5CP6A 3AZGD 1P3PA 1TZYA 2YFVB 3MGPC 3V9RA 3RELD 1P3KD 5B1LA 3MVDD 5B32G 3AZNC 2QRDB 1KX3C 4EWCA 1VQ61 3WTPA 1RQFA 1P3KB 3MGSD 3RELB 3AZKD 4J8VC 1QXFA 3AZLA 1Y1VI 4BY7I 5C3IC 2YFWA 2ZY3A 3LZ1A 3EPLA 5DNNA 3CCMZ 5GT0A 2Y2IA 4H9NA 3REJA 1Y8CA 3NH4A 5C44I 4LD9A 1VQ8Z 1K731 1QF8A 2E9HA 5AVBD 1JJ2Z 3WA9B 1N1JB 3CC4Z 3EPJA 3B6FA 4NE3A 2F8NH 2OTJZ 4EO5C 5D1OB 3TDHB 2F8NK 3S1MI 4AYBA 3F3FC 3AYWB 1KX5D 1P3OB 3CCQ1 1Q861 3M3YI 3A6NC 4KHAB 2NAPA 4J8WD 2E2JI 1VQPZ 1M18B 5AY8B 3AZED 4Z2MH 3MVDC 3AZND 2BJOA 2Y2QA 1HQ3B 2AROD 2FJ7B 3HOVI 3FDDA 4YM6B 4JJNC 3W98D 3G4SZ 5JRGB 2NZDD 3LJAC 3R45A 1P3FB 2JIPA 3D9XA 5B0YC 2J8PA 1JFIA 5B2JB 3MNND 2NQBC 1ZLAD 4XZQB 5JA4A 5AV6C 5B2JD 3MNNB 2QLVB 3X1VA 4E2WA 3I4MI 1M18A 5B40B 4G92C 1WIIA 5B40C 2YADA 1ML8A 3NDIA 3R45B 1P3FA 4ZUXB 1HTAA 5A2Qf 5T6BA 3O62D 1Q821 5GT3C 5BNXA 2VQRA 4YM6A 4NFTA 5B2IB 4NE6A 1ID3C 1FDIA 2OOXB 2CWEA 4RVHA 3AZJB 3VB9A 2Y2JA 3C1BD 1AA6A 1Q811 1Q812 5AY8D 3AZEB 1VQ91 1B6WA 2Y2OA 1KX4B 2GTIA 1TAFA 3CC21 1KD11 3CQZI 5CPIC 1P3MC 1LQLA 1EQZB 4WNNB 3AFAC 3NH5A 5BS7A 4E32A 1EQZD 3X1UB 3LZ0D 3REHD 5BT1C 3VH6A 5KDMA 1S32A 4NBDA 2YFVA 2RT9A 2JIQA 4ZUXA 3KWQB 5FUGA 2F4OA 2OOYB 3KIHA 3HOYI 3EPHA 3CC7Z 2GTHA 2E7ZA 1QVGY 2HIOB 2JA7I 2F2AC 1YIJ1 3AZJA 4DGLA 2PM9A 1M19A 5CP6D 1S32B 2PYOB 3MGRD 1KD12 5CP6B 2AROA 1TZYB 2VPXA 2PYOD 5AN9F 3CCL1 3CCM1 1VQ81 3Q87A 3UTAD 4WNNA 5E5AD 3CMA1 1TWFI 3T4NB 2CV5B 4R8PD 1M1K1 1VQ71 4E45A 3CCVZ 5B31G 2BYKA 3AV1B 5BO0A 5F99B 3B6GA 5F99C 3AZFA 2JR6A 1JJ2Y 1WCMI 4KHAA 4QTUA 5GSUC 3X1TA 5B1MB 1NJI2 3IR7A 3UT9C 2JA8I 3CCQZ 3S17I 4UUZA 1I50I 1P3GD 1T3UA 3H0RC 3LUSA 4NB8A 4A3JI 1BH8A 4XUJC 3CXCY 2P28A 1VQP1 1P3AA 3GTLI 3AZMA 4A3KI 3CD61 1KX4C 3IF8A 2BYKB 3AV1A 3JAMf 3LELC 3AZID 3AZFD 1AOIC 4A3GI 3NQUB 3WTPD 3AN2C 2Y2PA 5B1MA 5CPKC 5JRGC 4NBAA 3LJAB 3RELA 5CHLB 4A93I 3WA9A 2DE6A 1YI21 3GTMI 1P3LB 5GXQC 4H9NB 3REJB 5T67A 3AZHC 3F3PC 3B0DB 3AZHB 5B2JA 3B0DC 1P34A 3GKQA 4NOZA 1M1AA 5B32C 3REJD 1RO2A 2OZKA 2LEXA 5LL6f 3KXBB 4J8UB 3BG0B 5B31A 1Q9CA 2Y2GA 2LY8A 3AZNB 1S72Z 5B0ZD 1P3BC 2ZY4A 3VH5T 3C1BC 3B0CT 1YUAA 3VH5A 4MXUA 2R6MA 1VQ9Z 4HH4A 2IO5C 3AZEC 1QVFZ 2OTLZ 3PO3S 4E2YA 1P3LA 1I6HI 3W99D 3VH5W 4H9SA 5AVCB 2O53A 5KDMB 5AVCC 4MD9A 1YHQ1 4A3II 3GTJI 3MGSA 3AZKA 1W2EA 5CPKD 1P3IC 1P3IB 3W96C 3AYWD 4EO5B 4A3BI 4AWLB 2NQBD 3UT9B 1EQZA 1YJWZ 3EPKA 1P3OC 5AV8B 2JS4A 5FLMI 5B2ID 3W97C 1VLAA 3AZHD 3AZJD 2HUEC 3AZGC 2HUEB 3AZGB 3ESWA 3CME1 4H9QA 2HIOC 1KQSY 1VQ6Z 2R92I 5AV5C 2KPIA 4QLCD 3W98C 2F8NB 2FJ7C 1KC82 1HQ3C 3A1KA 3KFUG 4H9OA 5DNMB 5BNXB 4QLCB 4NH1C 1VQ51 2JA6I 3GTGI 3S16I 5E5AC 5B33B 2JUBA 4A3EI 5AV9A 3WTPE 4XZQD 3O62A 3FKII 1N8R2 2PYOA 1N8R1 1F66A 2F4MA 1Q822 3F6TA 4WU9D 5AV6B 1F66C 4H9QB 3KWQD 1P3ID 4XX2A 3O62C 3WKJC 3WKJB 4KGCD 3UT9D 1L1OC 1P34D 3AL0C 1TWAI 3K7AI 1W2BY 4H9OB 1P3OD 3W98A 3X1UA 1Z02A 3H0GI 4NBHA 4RS4A 3RZOI 1YIT1 3NFZA 5CM2M 5AV9D 3B6FB 2HIOA 1WZNA 4NBFA 3LZ0A 5B24C 3REHA 5CPJC 5B24B 1WWSA 5CPJB 2JMOA 5T64A 1R4VA 5AV5D 3X1SD 1H3OA 2XD1A 4Z66A 4NBGA 3VTNA 5C4XI 3X1VD 4A3MI 3HOZI 1P3OA 2CV5D 3NH8A 3AFAB 5GT0B 2ZAEB 1EQZC 3W99A 5D1OA 2BYMA 4E44A 4YS3D 3W96A 3AV2B 1Z01A 4AWLC 1VQOZ 5B2IA 3MZKB 1YI2Z 2NVXI 3AV2D 5AV8C 2HF1A 5B40D 3KSYA 1P3LC 3KWQC 3J81f 2E2HI 1VQLZ 2KI7B 3AZEA 3C1CA 2RVQC 2JSSA 2Y2MA 4KGCC 5FLXf 3IFUA 1TFIA 3KUYB 1S721 3MGPB 3CCSZ 3I07A 4MONA 2DF4C 5B31C 3AZIB 1P3BB 3S15I 5B32A 1K83I 2OTL1 3NDJA 1KX4D 1YUKA 3X1SB 5B2JC 3X1SC 3TU4B 2NZDA 1TWGI 3X1VB 1P9NA 1U35A 2CV5C 3TU4D 3WA9C 3VH6W 2VPWA 3MGQC 4E2ZA 1RO0A 3MGQB 3VMHA 5CPKA 5B1MC 4H9RA 1SIWA 4E31A 1Z03A 1YJ91 1SFOI 3VH6T 2YU9I 3OW2Z 3J7A4 1X0TA 1KX4A 3S2HI 3AZMC 3MGQA 4X23B 1P3AC 1YIJZ 3LELD 1U35C 2CV5A 4X23D 1N2FA 3B6GD 3LELB 2NZDC 5B31D 3X1SA 4Z66D 2AYDA 2V45A 5BT1D 3D6WA 2JIOA 1M1K2 3WTPB 1VQ7Z 1M19B 2NQBB 2JIRA 3B0BA 3IP4C 4HGAB 4DRBA 1F66D 5D1PA 3MGQD 4KGCA 1RO4A 3C1CC 1ZB9A 2Q51A 5B1MD 3KWQA 2JNYA 4NBBA 4UPKA 5AV8A 2E2II 1A7WA 5B2IC 1ID3B 3W97D 3AZJC 1Q16A 5C3IB 3NQJA 1Y1VS 2LIYA 3CD6Z 3S1NI 3W99B 3W99C 1U35D 2VPZA 1R9TI 3OW2Y 1K8A2 1VQNZ 2UWXA 3B0CW 4Z66C 2VUGA 3HOXI 3W96D 2Y2HA 5B24A 1B67A 3LZ0C 3REHC 1BH8B 5CPJA 1I3QI 3U50C 1M902 1KQSZ 4H9PA 5GSUB 2QA41 1Q7Y2 4WV4B 4Y52I 3X1UC 2AKLA 2M48A 4ZUXD 3AFAA 4MRIA 1Y1WI 1K732 1P3LD 5CPIA 1P3MA 3X1TB 1NP6A 2QEXZ 1VQL1 2RIQA 3WKJA 4CAYA
chains in the Genus database with same CATH topology
3H0LC 2F8ND 3G71Z 2FJ7D 5JA4B 3MVDB 3W98B 5AV5B 5JRGD 2NZDB 2PYOC 1YITZ 5GT3A 5AV9C 2BG1A 4YM6C 5E5AA 2AROB 1P3FC 4Z2MG 2NVYI 2NVQI 2W03A 1WWIA 3NQUA 4JJND 2P3YA 1HQ3A 2RPRA 3MZLB 2FJ7A 3X1VC 3HOUI 5AVCD 4KUDB 5AV5A 4HGAC 1K9M1 3WKJD 5IT9b 2JCHA 1VQ41 1M1AD 4KUDD 3AZGA 5B0YA 4WU9B 1P3PD 1JFIB 1YJ9Z 5AV6D 2F8NG 3FQMA 1YJW1 3W97A 5BNVA 4J8XB 4NBEA 4JJNA 5GT3B 4BBRI 3REIB 1KX3B 4DRAA 3I56Z 1S32D 3MVDA 3AZMD 3CMEZ 3EG5B 1ULYA 3I561 4E30A 1P3IA 3CPWZ 3MGSC 3AZKC 4WJ3C 1P3AB 2GU2A 3IX0A 5AVCA 3RZDI 2DE5A 5FUGB 4H9SC 4LD9B 2PK7A 2W04A 3I551 1YJNZ 2Y2NA 4WU8D 1VQ5Z 2B63I 5IP9I 3UTBB 1USPB 1VQMZ 4LD9D 4ZBJC 2NVTI 2JA5I 1P3FD 3UTBD 3C1BA 1P3BA 1TWHI 3S1QI 4YS3B 1QYPA 5G49B 2WB1A 3REKB 1TAFB 2HIOD 1P3PB 5B32D 3REJC 1M1AC 2K5RA 3A1IA 3GTPI 1P34C 4G91B 3LZ1C 3AZHA 1P34B 3TE5B 5GXQA 1BFMA 1P3BD 3JAMb 2Y2LA 1VQKZ 3CCEZ 3AZNA 5B1LC 3V9RB 5AV9B 5B1LB 3MGPD 5DNND 1TZYC 5JRGA 3C1BB 5CP6C 3RELC 3AN2A 3G6E1 3AZLD 1AOIA 5F99D 2WAQA 3LELA 4A3CI 4XZQA 3AV1C 3MNNC 1M19D 4KUDA 1F66B 2VUMI 4R8PB 1ZLAC 4XUJA 4NFRA 1VQO1 1Q7Y1 1QVGZ 1PFTA 1M901 2G2KA 1W2BZ 1QVFY 2V8IA 4A3FI 1K9M2 3KXBD 4J8UD 3UT9A 3VMIA 3S1RI 1Q862 3X1TC 3PO2I 4H9PB 5GSUA 5AY8A 3G711 3REIC 4XUJB 3H0MC 1TWCI 5F99A 3AZFC 3B6GB 3AZFB 3B6GC 2QKDA 4RV9A 3CCS1 1U35B 4J8WC 4A3DI 5B1LD 3CC41 3AZLB 2AROC 5CPKB 3P5JB 5B0YB 4WU9A 2ZM5A 2EGTA 3AV1D 1M19C 5A2Qb 2OTJ1 5B0YD 3GTMS 1KX5B 2O4HA 3GTQI 2ZY2A 3MONA 4G92B 4NB9A 3FQQA 2RHBA 3CCJ1 1BH9A 4ZUXC 3AZIA 1WW9A 3KXBC 4J8UC 1S32C 1ZH1A 1P3KC 4HGZA 2L5AA 2XD5A 2IZ4A 2LFUA 3KUYA 1K8A1 3EERA 5DNMD 4E33A 1DL6A 5B0ZB 2IO5B 5BS7C 3MGSB 3AZKB 4BY1I 5B33D 5C3EI 3TU4C 3WA9D 3I55Z 1YJN1 4WU8C 1KX5A 1H3OB 4Z66B 4Z5TC 4YS3A 1RNIA 1S7MA 4BBSI 2G5IC 4ZBJB 3J81b 2BYMB 1Z2CB 3AV2A 5AV8D 3W96B 4RVFA 3GTOI 4UUZB 3UTBA 1USPA 4J8XD 1ID3A 1RLYA 5GSUD 5IT9f 5GT3D 4H9RB 3A6NB 3C1CD 1BH9B 1KX3D 2VF1A 3LZ1D 2K3RA 3CCU1 3AZMB 5B40A 4X23C 2IZ3A 3PO3I 1M18C 1P3GC 1HQ3D 3B6FD 2ZY5A 3MGRA 5AV6A 2G5HC 4J8WB 1VQK1 3CCE1 2NQBA 1AOIB 2FFFB 4M6BA 4CSRA 3H3VJ 2DQNC 5CPID 4JJNB 1P3MD 2PMZA 3LJAA 4QLCC 2JE5A 1AOID 3G6EZ 4R8PA 1VQN1 2F8NA 3UTAA 2Y0SA 1KRLA 4MH4A 3HOWI 3UTAC 3CCRZ 3REKD 3O62B 4R8PC 1ZLAB 2QR1B 3S2DI 3CC71 3A6NA 4QLCA 2M6NA 4CSRB 3KUYD 3X1TD 2QEX1 1P3AD 2R7ZI 3MGRB 3REID 2QREB 3MGRC 3BG1B 3CXCZ 4J8VD 1M18D 1P3GA 3B6FC 2R93I 4X23A 4TNUA 3CCLZ 2I3CA 4LD9C 3CMAZ 4Z5TB 4YM6D 5CPJD 5B24D 5CPIB 5GT0C 1P3MB 2QRCB 4DK1A 5DNNC 3UTBC 2YFWB 3X1UD 3LZ0B 3REHB 3AN2B 3VMGA 1JWHC 3CCV1 3AV2C 3AZLC 3AFAD 4MD7A 4J8VA 3CPWY 2V8JA 3WTPC 1PZRA 3AN2D 1KX3A 1N1JA 5FLXb 3J80b 4YS3C 3M4OI 2RVQD 4Z5TA 3MGPA 1VQ4Z 1P3PC 1M1AB 4WU8A 3REKC 1KX5C 4BXXI 3TU4A 3CCJZ 4KGCB 4XUJD 5B32B 4MD8A 3KUYC 2H85A 1X3WA 1TZYD 1P3KA 4HGYA 2HU9A 3KXBA 5DNMC 1F1EA 5B31B 4J8UA 5B33A 1KU5A 4J8VB 3AZIC 2RBLA 3HKZA 4RVGA 3S14I 4CL1A 5B0ZC 4WZSB 3QWUA 3G4S1 3LJAD 5AVBA 1ZB8A 3KIFA 4Z5TD 4WU8B 5G49A 2W8SA 5GT0D 3UTAB 1VQM1 2J6AA 3WAAC 4DQYB 4WU9C 5GXQD 3WAAB 2QA4Z 4J8XC 3AYWA 4X6AI 4NE5A 3AYWC 4A3LI 1X3ZA 4J8WA 5BNVB 4J8XA 1ID3D 3W97B 2Q4ZA 3CCUZ 3WAAA 3I4NI 1NUIA 4CAYB 3REIA 1P3GB 3GCFA 4NBCA 4RVDA 5BO0B 5AY8C 2V8KA 3GTKI 2DE7A 4Y7NI 1KC81 5C4JI 4QTTA 3CC2Z 5AVBC 5DNNB 5IP7I 5AVBB 3J80f 5B0ZA 1YHQZ 4E2XA 5E5AB 5B33C 5DNMA 1ZLAA 3EEDA 4S1TA 3MNNA 4KUDC 3CCR1 4XZQC 5GXQB 3A6ND 3C1CB 3WAAD 1NJI1 2Y2KA 4G91C 3LZ1B 3REKA 3NQJB 5CP6A 3AZGD 1P3PA 1TZYA 2YFVB 3MGPC 3V9RA 3RELD 1P3KD 5B1LA 3MVDD 5B32G 3AZNC 2QRDB 1KX3C 4EWCA 1VQ61 3WTPA 1RQFA 1P3KB 3MGSD 3RELB 3AZKD 4J8VC 3AZLA 1Y1VI 4BY7I 5C3IC 2YFWA 2ZY3A 3LZ1A 3EPLA 5DNNA 3CCMZ 5GT0A 2Y2IA 4H9NA 3REJA 3NH4A 5C44I 1VQ8Z 4LD9A 1K731 1QF8A 2E9HA 5AVBD 1JJ2Z 3WA9B 1N1JB 3CC4Z 3EPJA 3B6FA 4NE3A 2F8NH 2OTJZ 4EO5C 5D1OB 3TDHB 2F8NK 3S1MI 4AYBA 3F3FC 3AYWB 1KX5D 1P3OB 3CCQ1 1Q861 3M3YI 3A6NC 4KHAB 4J8WD 2E2JI 1VQPZ 1M18B 5AY8B 3AZED 4Z2MH 3MVDC 3AZND 2BJOA 2Y2QA 1HQ3B 2AROD 2FJ7B 3HOVI 3FDDA 4YM6B 4JJNC 3W98D 3G4SZ 5JRGB 2NZDD 3LJAC 3R45A 1P3FB 3D9XA 5B0YC 2J8PA 1JFIA 5B2JB 3MNND 2NQBC 1ZLAD 4XZQB 5JA4A 5AV6C 5B2JD 3MNNB 2QLVB 3X1VA 4E2WA 3I4MI 1M18A 5B40B 4G92C 1WIIA 5B40C 2YADA 1ML8A 3NDIA 3R45B 1P3FA 4ZUXB 1HTAA 5A2Qf 5T6BA 3O62D 1Q821 5GT3C 5BNXA 2VQRA 4YM6A 4NFTA 5B2IB 4NE6A 1ID3C 2OOXB 2CWEA 4RVHA 3AZJB 3VB9A 2Y2JA 3C1BD 1Q811 1Q812 5AY8D 3AZEB 1VQ91 1B6WA 2Y2OA 1KX4B 2GTIA 1TAFA 3CC21 1KD11 3CQZI 5CPIC 1P3MC 1LQLA 1EQZB 4WNNB 3AFAC 3NH5A 5BS7A 4E32A 1EQZD 3X1UB 3LZ0D 3REHD 5BT1C 3VH6A 5KDMA 1S32A 4NBDA 2YFVA 2RT9A 4ZUXA 3KWQB 5FUGA 2F4OA 2OOYB 3KIHA 3HOYI 3EPHA 3CC7Z 2GTHA 1QVGY 2HIOB 2JA7I 2F2AC 1YIJ1 3AZJA 4DGLA 2PM9A 1M19A 5CP6D 1S32B 2PYOB 3MGRD 1KD12 5CP6B 2AROA 1TZYB 5AN9F 2PYOD 3CCL1 3CCM1 1VQ81 3Q87A 3UTAD 4WNNA 5E5AD 3CMA1 1TWFI 3T4NB 2CV5B 4R8PD 1M1K1 1VQ71 4E45A 3CCVZ 5B31G 2BYKA 3AV1B 5BO0A 5F99B 3B6GA 5F99C 3AZFA 2JR6A 1JJ2Y 1WCMI 4KHAA 4QTUA 5GSUC 3X1TA 5B1MB 1NJI2 3UT9C 2JA8I 3CCQZ 3S17I 4UUZA 1I50I 1P3GD 1T3UA 3H0RC 3LUSA 4NB8A 4A3JI 1BH8A 4XUJC 3CXCY 2P28A 1VQP1 1P3AA 3GTLI 3AZMA 4A3KI 3CD61 1KX4C 3IF8A 2BYKB 3AV1A 3JAMf 3LELC 3AZID 3AZFD 1AOIC 4A3GI 3NQUB 3WTPD 3AN2C 2Y2PA 5B1MA 5CPKC 5JRGC 4NBAA 3LJAB 3RELA 5CHLB 4A93I 3WA9A 2DE6A 1YI21 3GTMI 1P3LB 5GXQC 4H9NB 3REJB 5T67A 3AZHC 3F3PC 3B0DB 3AZHB 5B2JA 3B0DC 1P34A 3GKQA 4NOZA 1M1AA 5B32C 3REJD 1RO2A 2OZKA 5LL6f 3KXBB 4J8UB 3BG0B 5B31A 1Q9CA 2Y2GA 2LY8A 3AZNB 1S72Z 5B0ZD 1P3BC 2ZY4A 3VH5T 3C1BC 3B0CT 1YUAA 3VH5A 4MXUA 2R6MA 1VQ9Z 4HH4A 2IO5C 3AZEC 1QVFZ 2OTLZ 3PO3S 4E2YA 1P3LA 1I6HI 3W99D 3VH5W 4H9SA 5AVCB 2O53A 5KDMB 5AVCC 4MD9A 1YHQ1 4A3II 3GTJI 3MGSA 3AZKA 1W2EA 5CPKD 1P3IC 1P3IB 3W96C 3AYWD 4EO5B 4A3BI 4AWLB 2NQBD 3UT9B 1EQZA 1YJWZ 3EPKA 1P3OC 5AV8B 2JS4A 5FLMI 5B2ID 3W97C 1VLAA 3AZHD 3AZJD 2HUEC 3AZGC 2HUEB 3AZGB 3ESWA 3CME1 4H9QA 2HIOC 1KQSY 1VQ6Z 2R92I 5AV5C 2KPIA 4QLCD 3W98C 2F8NB 2FJ7C 1KC82 1HQ3C 3A1KA 3KFUG 4H9OA 5DNMB 5BNXB 4QLCB 4NH1C 1VQ51 2JA6I 3GTGI 3S16I 5E5AC 5B33B 2JUBA 4A3EI 5AV9A 3WTPE 4XZQD 3O62A 3FKII 1N8R2 2PYOA 1N8R1 1F66A 2F4MA 1Q822 3F6TA 4WU9D 5AV6B 1F66C 4H9QB 3KWQD 1P3ID 4XX2A 3O62C 3WKJC 3WKJB 4KGCD 3UT9D 1L1OC 1P34D 3AL0C 1TWAI 3K7AI 1W2BY 4H9OB 1P3OD 3W98A 3X1UA 1Z02A 3H0GI 4NBHA 4RS4A 3RZOI 1YIT1 3NFZA 5CM2M 5AV9D 3B6FB 2HIOA 4NBFA 3LZ0A 5B24C 3REHA 5CPJC 5B24B 1WWSA 5CPJB 2JMOA 5T64A 1R4VA 5AV5D 3X1SD 1H3OA 2XD1A 4Z66A 4NBGA 3VTNA 5C4XI 3X1VD 4A3MI 3HOZI 1P3OA 2CV5D 3NH8A 3AFAB 5GT0B 2ZAEB 1EQZC 3W99A 5D1OA 2BYMA 4E44A 4YS3D 3W96A 3AV2B 1Z01A 4AWLC 1VQOZ 5B2IA 3MZKB 1YI2Z 2NVXI 3AV2D 5AV8C 2HF1A 5B40D 3KSYA 1P3LC 3KWQC 3J81f 2E2HI 1VQLZ 2KI7B 3AZEA 3C1CA 2RVQC 2JSSA 2Y2MA 4KGCC 5FLXf 3IFUA 1TFIA 3KUYB 1S721 3MGPB 3CCSZ 3I07A 4MONA 2DF4C 5B31C 3AZIB 1P3BB 3S15I 5B32A 1K83I 2OTL1 3NDJA 1KX4D 1YUKA 3X1SB 5B2JC 3X1SC 3TU4B 2NZDA 1TWGI 3X1VB 1P9NA 1U35A 2CV5C 3TU4D 3WA9C 3VH6W 3MGQC 4E2ZA 1RO0A 3MGQB 3VMHA 5CPKA 5B1MC 4H9RA 4E31A 1YJ91 1Z03A 1SFOI 3VH6T 2YU9I 3OW2Z 3J7A4 1X0TA 1KX4A 3S2HI 3AZMC 3MGQA 4X23B 1P3AC 1YIJZ 3LELD 1U35C 2CV5A 4X23D 1N2FA 3B6GD 3LELB 2NZDC 5B31D 3X1SA 4Z66D 5BT1D 3D6WA 1M1K2 3WTPB 1VQ7Z 1M19B 2NQBB 3B0BA 3IP4C 4HGAB 4DRBA 1F66D 5D1PA 3MGQD 4KGCA 1RO4A 3C1CC 1ZB9A 2Q51A 5B1MD 3KWQA 2JNYA 4NBBA 4UPKA 5AV8A 2E2II 1A7WA 5B2IC 1ID3B 3W97D 3AZJC 1Y1VS 5C3IB 3NQJA 3CD6Z 2LIYA 3S1NI 3W99B 3W99C 1U35D 1R9TI 3OW2Y 1K8A2 1VQNZ 2UWXA 3B0CW 4Z66C 2VUGA 3HOXI 3W96D 2Y2HA 5B24A 1B67A 3LZ0C 3REHC 1BH8B 5CPJA 1I3QI 3U50C 1M902 1KQSZ 4H9PA 5GSUB 2QA41 1Q7Y2 4WV4B 4Y52I 3X1UC 2AKLA 2M48A 4ZUXD 3AFAA 4MRIA 1Y1WI 1K732 1P3LD 5CPIA 1P3MA 3X1TB 1NP6A 2QEXZ 1VQL1 2RIQA 3WKJA 4CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 3H0L C;  2F8N D;  3G71 Z;  2FJ7 D;  5JA4 B;  3MVD B;  3W98 B;  5AV5 B;  5JRG D;  2NZD B;  2PYO C;  1YIT Z;  5GT3 A;  5AV9 C;  2BG1 A;  4YM6 C;  5E5A A;  2ARO B;  1P3F C;  4Z2M G;  2NVY I;  2NVQ I;  2W03 A;  1WWI A;  3NQU A;  4JJN D;  2P3Y A;  1HQ3 A;  2RPR A;  3MZL B;  2FJ7 A;  3X1V C;  3HOU I;  5AVC D;  4KUD B;  5AV5 A;  4HGA C;  1K9M 1;  3WKJ D;  5IT9 b;  1FDO A;  2JCH A;  1VQ4 1;  1M1A D;  4KUD D;  3AZG A;  5B0Y A;  4WU9 B;  1P3P D;  1JFI B;  1YJ9 Z;  5AV6 D;  2F8N G;  3FQM A;  1YJW 1;  3W97 A;  5BNV A;  4J8X B;  2V3V A;  4NBE A;  4JJN A;  5GT3 B;  4BBR I;  3REI B;  1KX3 B;  4DRA A;  3I56 Z;  1S32 D;  3MVD A;  3AZM D;  3CME Z;  3EG5 B;  1ULY A;  3I56 1;  4E30 A;  1P3I A;  3CPW Z;  3MGS C;  3AZK C;  4WJ3 C;  1P3A B;  1WJ2 A;  2GU2 A;  3IX0 A;  5AVC A;  3RZD I;  2DE5 A;  5FUG B;  4H9S C;  4LD9 B;  2PK7 A;  2W04 A;  3I55 1;  1YJN Z;  2Y2N A;  4WU8 D;  1VQ5 Z;  2B63 I;  5IP9 I;  3UTB B;  1USP B;  1VQM Z;  4LD9 D;  4ZBJ C;  2NVT I;  2JA5 I;  1P3F D;  3UTB D;  3C1B A;  1P3B A;  1TWH I;  3S1Q I;  4YS3 B;  1QYP A;  3D2L A;  5G49 B;  2WB1 A;  3REK B;  1TAF B;  2HIO D;  1P3P B;  5B32 D;  3REJ C;  1M1A C;  2K5R A;  3A1I A;  3GTP I;  1P34 C;  2IV2 X;  4G91 B;  3LZ1 C;  3AZH A;  1P34 B;  3TE5 B;  5GXQ A;  1BFM A;  1P3B D;  3JAM b;  2Y2L A;  1VQK Z;  3CCE Z;  3AZN A;  5B1L C;  3V9R B;  5AV9 B;  5B1L B;  3MGP D;  5DNN D;  1TZY C;  5JRG A;  3C1B B;  5CP6 C;  3REL C;  3AN2 A;  3G6E 1;  3AZL D;  1AOI A;  5F99 D;  2WAQ A;  3LEL A;  4A3C I;  4XZQ A;  3AV1 C;  3MNN C;  1M19 D;  4KUD A;  1F66 B;  2VUM I;  4R8P B;  1ZLA C;  4XUJ A;  4NFR A;  1VQO 1;  1Q7Y 1;  1QVG Z;  1PFT A;  1M90 1;  2G2K A;  1W2B Z;  1QVF Y;  2V8I A;  4A3F I;  1K9M 2;  3KXB D;  4J8U D;  3UT9 A;  3VMI A;  3S1R I;  1Q86 2;  3X1T C;  3PO2 I;  4H9P B;  5GSU A;  5AY8 A;  3G71 1;  3REI C;  4XUJ B;  3H0M C;  1TWC I;  5F99 A;  3AZF C;  3B6G B;  3AZF B;  3B6G C;  2QKD A;  4RV9 A;  3CCS 1;  1U35 B;  4J8W C;  4A3D I;  5B1L D;  3CC4 1;  3AZL B;  2ARO C;  5CPK B;  3P5J B;  5B0Y B;  4WU9 A;  2ZM5 A;  2EGT A;  3AV1 D;  1M19 C;  5A2Q b;  2OTJ 1;  5B0Y D;  3GTM S;  1KX5 B;  2O4H A;  3GTQ I;  2ZY2 A;  3MON A;  4G92 B;  4NB9 A;  3FQQ A;  2RHB A;  3CCJ 1;  1BH9 A;  4ZUX C;  3AZI A;  1WW9 A;  3KXB C;  4J8U C;  1S32 C;  1ZH1 A;  1P3K C;  4HGZ A;  2L5A A;  2XD5 A;  2IZ4 A;  2LFU A;  3KUY A;  1K8A 1;  3EER A;  5DNM D;  4E33 A;  1DL6 A;  5B0Z B;  2IO5 B;  5BS7 C;  3MGS B;  3AZK B;  4BY1 I;  5B33 D;  5C3E I;  3TU4 C;  3WA9 D;  3I55 Z;  1YJN 1;  4WU8 C;  1KX5 A;  1H3O B;  4Z66 B;  4Z5T C;  4YS3 A;  1RNI A;  1S7M A;  4BBS I;  2G5I C;  4ZBJ B;  3J81 b;  2BYM B;  1Z2C B;  3AV2 A;  5AV8 D;  3W96 B;  4RVF A;  3GTO I;  4UUZ B;  3UTB A;  1USP A;  4J8X D;  1ID3 A;  1RLY A;  5GSU D;  5IT9 f;  5GT3 D;  4H9R B;  3A6N B;  3C1C D;  1BH9 B;  1KX3 D;  2VF1 A;  3LZ1 D;  2K3R A;  3CCU 1;  3AZM B;  5B40 A;  4X23 C;  2IZ3 A;  3PO3 I;  1M18 C;  1P3G C;  1HQ3 D;  3B6F D;  2ZY5 A;  3MGR A;  5AV6 A;  2G5H C;  4J8W B;  1VQK 1;  3CCE 1;  2NQB A;  1AOI B;  2FFF B;  4M6B A;  4CSR A;  3H3V J;  2DQN C;  5CPI D;  4JJN B;  1P3M D;  2PMZ A;  3LJA A;  4QLC C;  2JE5 A;  1AOI D;  3G6E Z;  4R8P A;  1VQN 1;  2F8N A;  3UTA A;  2Y0S A;  1KRL A;  4MH4 A;  3HOW I;  3UTA C;  3CCR Z;  3REK D;  3O62 B;  4R8P C;  1ZLA B;  2QR1 B;  3S2D I;  3CC7 1;  3A6N A;  4QLC A;  2JIM A;  2M6N A;  4CSR B;  3KUY D;  3X1T D;  2QEX 1;  1P3A D;  2R7Z I;  3MGR B;  3REI D;  2QRE B;  3MGR C;  3BG1 B;  3CXC Z;  4J8V D;  1M18 D;  1P3G A;  3B6F C;  2R93 I;  4X23 A;  4TNU A;  3CCL Z;  2I3C A;  4LD9 C;  3CMA Z;  4Z5T B;  4YM6 D;  5CPJ D;  5B24 D;  5CPI B;  5GT0 C;  1P3M B;  2QRC B;  4DK1 A;  5DNN C;  3UTB C;  2YFW B;  3X1U D;  3LZ0 B;  3REH B;  3AN2 B;  3VMG A;  1JWH C;  3CCV 1;  3AV2 C;  3AZL C;  3AFA D;  4MD7 A;  4J8V A;  3CPW Y;  2V8J A;  3WTP C;  1PZR A;  3AN2 D;  1KX3 A;  1N1J A;  5FLX b;  3J80 b;  4YS3 C;  3M4O I;  2RVQ D;  4Z5T A;  3MGP A;  1VQ4 Z;  1P3P C;  1M1A B;  4WU8 A;  3REK C;  1KX5 C;  4BXX I;  3TU4 A;  3CCJ Z;  4KGC B;  4XUJ D;  5B32 B;  4MD8 A;  3KUY C;  2H85 A;  1X3W A;  1TZY D;  1P3K A;  4HGY A;  2HU9 A;  3KXB A;  5DNM C;  1F1E A;  5B31 B;  4J8U A;  5B33 A;  1KU5 A;  4J8V B;  3AZI C;  2RBL A;  3HKZ A;  4RVG A;  3S14 I;  4CL1 A;  5B0Z C;  4WZS B;  3QWU A;  3G4S 1;  3LJA D;  5AVB A;  1ZB8 A;  2VPY A;  3KIF A;  4Z5T D;  4WU8 B;  5G49 A;  2W8S A;  5GT0 D;  3UTA B;  1VQM 1;  2J6A A;  3WAA C;  4DQY B;  4WU9 C;  5GXQ D;  3WAA B;  2QA4 Z;  4J8X C;  3AYW A;  4X6A I;  4NE5 A;  3AYW C;  4A3L I;  1X3Z A;  4J8W A;  5BNV B;  4J8X A;  1ID3 D;  3W97 B;  2Q4Z A;  3CCU Z;  3WAA A;  3I4N I;  1NUI A;  4CAY B;  3REI A;  1P3G B;  3GCF A;  4NBC A;  4RVD A;  5BO0 B;  5AY8 C;  2V8K A;  3GTK I;  2DE7 A;  4Y7N I;  1KC8 1;  5C4J I;  4QTT A;  3CC2 Z;  5AVB C;  5DNN B;  5IP7 I;  5AVB B;  3J80 f;  5B0Z A;  1YHQ Z;  4E2X A;  5E5A B;  5B33 C;  5DNM A;  1ZLA A;  3EED A;  4S1T A;  3MNN A;  4KUD C;  3CCR 1;  4XZQ C;  5GXQ B;  3A6N D;  3C1C B;  3WAA D;  1NJI 1;  2Y2K A;  4G91 C;  3LZ1 B;  3REK A;  3NQJ B;  5CP6 A;  3AZG D;  1P3P A;  1TZY A;  2YFV B;  3MGP C;  3V9R A;  3REL D;  1P3K D;  5B1L A;  3MVD D;  5B32 G;  3AZN C;  2QRD B;  1KX3 C;  4EWC A;  1VQ6 1;  3WTP A;  1RQF A;  1P3K B;  3MGS D;  3REL B;  3AZK D;  4J8V C;  1QXF A;  3AZL A;  1Y1V I;  4BY7 I;  5C3I C;  2YFW A;  2ZY3 A;  3LZ1 A;  3EPL A;  5DNN A;  3CCM Z;  5GT0 A;  2Y2I A;  4H9N A;  3REJ A;  1Y8C A;  3NH4 A;  5C44 I;  4LD9 A;  1VQ8 Z;  1K73 1;  1QF8 A;  2E9H A;  5AVB D;  1JJ2 Z;  3WA9 B;  1N1J B;  3CC4 Z;  3EPJ A;  3B6F A;  4NE3 A;  2F8N H;  2OTJ Z;  4EO5 C;  5D1O B;  3TDH B;  2F8N K;  3S1M I;  4AYB A;  3F3F C;  3AYW B;  1KX5 D;  1P3O B;  3CCQ 1;  1Q86 1;  3M3Y I;  3A6N C;  4KHA B;  2NAP A;  4J8W D;  2E2J I;  1VQP Z;  1M18 B;  5AY8 B;  3AZE D;  4Z2M H;  3MVD C;  3AZN D;  2BJO A;  2Y2Q A;  1HQ3 B;  2ARO D;  2FJ7 B;  3HOV I;  3FDD A;  4YM6 B;  4JJN C;  3W98 D;  3G4S Z;  5JRG B;  2NZD D;  3LJA C;  3R45 A;  1P3F B;  2JIP A;  3D9X A;  5B0Y C;  2J8P A;  1JFI A;  5B2J B;  3MNN D;  2NQB C;  1ZLA D;  4XZQ B;  5JA4 A;  5AV6 C;  5B2J D;  3MNN B;  2QLV B;  3X1V A;  4E2W A;  3I4M I;  1M18 A;  5B40 B;  4G92 C;  1WII A;  5B40 C;  2YAD A;  1ML8 A;  3NDI A;  3R45 B;  1P3F A;  4ZUX B;  1HTA A;  5A2Q f;  5T6B A;  3O62 D;  1Q82 1;  5GT3 C;  5BNX A;  2VQR A;  4YM6 A;  4NFT A;  5B2I B;  4NE6 A;  1ID3 C;  1FDI A;  2OOX B;  2CWE A;  4RVH A;  3AZJ B;  3VB9 A;  2Y2J A;  3C1B D;  1AA6 A;  1Q81 1;  1Q81 2;  5AY8 D;  3AZE B;  1VQ9 1;  1B6W A;  2Y2O A;  1KX4 B;  2GTI A;  1TAF A;  3CC2 1;  1KD1 1;  3CQZ I;  5CPI C;  1P3M C;  1LQL A;  1EQZ B;  4WNN B;  3AFA C;  3NH5 A;  5BS7 A;  4E32 A;  1EQZ D;  3X1U B;  3LZ0 D;  3REH D;  5BT1 C;  3VH6 A;  5KDM A;  1S32 A;  4NBD A;  2YFV A;  2RT9 A;  2JIQ A;  4ZUX A;  3KWQ B;  5FUG A;  2F4O A;  2OOY B;  3KIH A;  3HOY I;  3EPH A;  3CC7 Z;  2GTH A;  2E7Z A;  1QVG Y;  2HIO B;  2JA7 I;  2F2A C;  1YIJ 1;  3AZJ A;  4DGL A;  2PM9 A;  1M19 A;  5CP6 D;  1S32 B;  2PYO B;  3MGR D;  1KD1 2;  5CP6 B;  2ARO A;  1TZY B;  2VPX A;  2PYO D;  5AN9 F;  3CCL 1;  3CCM 1;  1VQ8 1;  3Q87 A;  3UTA D;  4WNN A;  5E5A D;  3CMA 1;  1TWF I;  3T4N B;  2CV5 B;  4R8P D;  1M1K 1;  1VQ7 1;  4E45 A;  3CCV Z;  5B31 G;  2BYK A;  3AV1 B;  5BO0 A;  5F99 B;  3B6G A;  5F99 C;  3AZF A;  2JR6 A;  1JJ2 Y;  1WCM I;  4KHA A;  4QTU A;  5GSU C;  3X1T A;  5B1M B;  1NJI 2;  3IR7 A;  3UT9 C;  2JA8 I;  3CCQ Z;  3S17 I;  4UUZ A;  1I50 I;  1P3G D;  1T3U A;  3H0R C;  3LUS A;  4NB8 A;  4A3J I;  1BH8 A;  4XUJ C;  3CXC Y;  2P28 A;  1VQP 1;  1P3A A;  3GTL I;  3AZM A;  4A3K I;  3CD6 1;  1KX4 C;  3IF8 A;  2BYK B;  3AV1 A;  3JAM f;  3LEL C;  3AZI D;  3AZF D;  1AOI C;  4A3G I;  3NQU B;  3WTP D;  3AN2 C;  2Y2P A;  5B1M A;  5CPK C;  5JRG C;  4NBA A;  3LJA B;  3REL A;  5CHL B;  4A93 I;  3WA9 A;  2DE6 A;  1YI2 1;  3GTM I;  1P3L B;  5GXQ C;  4H9N B;  3REJ B;  5T67 A;  3AZH C;  3F3P C;  3B0D B;  3AZH B;  5B2J A;  3B0D C;  1P34 A;  3GKQ A;  4NOZ A;  1M1A A;  5B32 C;  3REJ D;  1RO2 A;  2OZK A;  2LEX A;  5LL6 f;  3KXB B;  4J8U B;  3BG0 B;  5B31 A;  1Q9C A;  2Y2G A;  2LY8 A;  3AZN B;  1S72 Z;  5B0Z D;  1P3B C;  2ZY4 A;  3VH5 T;  3C1B C;  3B0C T;  1YUA A;  3VH5 A;  4MXU A;  2R6M A;  1VQ9 Z;  4HH4 A;  2IO5 C;  3AZE C;  1QVF Z;  2OTL Z;  3PO3 S;  4E2Y A;  1P3L A;  1I6H I;  3W99 D;  3VH5 W;  4H9S A;  5AVC B;  2O53 A;  5KDM B;  5AVC C;  4MD9 A;  1YHQ 1;  4A3I I;  3GTJ I;  3MGS A;  3AZK A;  1W2E A;  5CPK D;  1P3I C;  1P3I B;  3W96 C;  3AYW D;  4EO5 B;  4A3B I;  4AWL B;  2NQB D;  3UT9 B;  1EQZ A;  1YJW Z;  3EPK A;  1P3O C;  5AV8 B;  2JS4 A;  5FLM I;  5B2I D;  3W97 C;  1VLA A;  3AZH D;  3AZJ D;  2HUE C;  3AZG C;  2HUE B;  3AZG B;  3ESW A;  3CME 1;  4H9Q A;  2HIO C;  1KQS Y;  1VQ6 Z;  2R92 I;  5AV5 C;  2KPI A;  4QLC D;  3W98 C;  2F8N B;  2FJ7 C;  1KC8 2;  1HQ3 C;  3A1K A;  3KFU G;  4H9O A;  5DNM B;  5BNX B;  4QLC B;  4NH1 C;  1VQ5 1;  2JA6 I;  3GTG I;  3S16 I;  5E5A C;  5B33 B;  2JUB A;  4A3E I;  5AV9 A;  3WTP E;  4XZQ D;  3O62 A;  3FKI I;  1N8R 2;  2PYO A;  1N8R 1;  1F66 A;  2F4M A;  1Q82 2;  3F6T A;  4WU9 D;  5AV6 B;  1F66 C;  4H9Q B;  3KWQ D;  1P3I D;  4XX2 A;  3O62 C;  3WKJ C;  3WKJ B;  4KGC D;  3UT9 D;  1L1O C;  1P34 D;  3AL0 C;  1TWA I;  3K7A I;  1W2B Y;  4H9O B;  1P3O D;  3W98 A;  3X1U A;  1Z02 A;  3H0G I;  4NBH A;  4RS4 A;  3RZO I;  1YIT 1;  3NFZ A;  5CM2 M;  5AV9 D;  3B6F B;  2HIO A;  1WZN A;  4NBF A;  3LZ0 A;  5B24 C;  3REH A;  5CPJ C;  5B24 B;  1WWS A;  5CPJ B;  2JMO A;  5T64 A;  1R4V A;  5AV5 D;  3X1S D;  1H3O A;  2XD1 A;  4Z66 A;  4NBG A;  3VTN A;  5C4X I;  3X1V D;  4A3M I;  3HOZ I;  1P3O A;  2CV5 D;  3NH8 A;  3AFA B;  5GT0 B;  2ZAE B;  1EQZ C;  3W99 A;  5D1O A;  2BYM A;  4E44 A;  4YS3 D;  3W96 A;  3AV2 B;  1Z01 A;  4AWL C;  1VQO Z;  5B2I A;  3MZK B;  1YI2 Z;  2NVX I;  3AV2 D;  5AV8 C;  2HF1 A;  5B40 D;  3KSY A;  1P3L C;  3KWQ C;  3J81 f;  2E2H I;  1VQL Z;  2KI7 B;  3AZE A;  3C1C A;  2RVQ C;  2JSS A;  2Y2M A;  4KGC C;  5FLX f;  3IFU A;  1TFI A;  3KUY B;  1S72 1;  3MGP B;  3CCS Z;  3I07 A;  4MON A;  2DF4 C;  5B31 C;  3AZI B;  1P3B B;  3S15 I;  5B32 A;  1K83 I;  2OTL 1;  3NDJ A;  1KX4 D;  1YUK A;  3X1S B;  5B2J C;  3X1S C;  3TU4 B;  2NZD A;  1TWG I;  3X1V B;  1P9N A;  1U35 A;  2CV5 C;  3TU4 D;  3WA9 C;  3VH6 W;  2VPW A;  3MGQ C;  4E2Z A;  1RO0 A;  3MGQ B;  3VMH A;  5CPK A;  5B1M C;  4H9R A;  1SIW A;  4E31 A;  1Z03 A;  1YJ9 1;  1SFO I;  3VH6 T;  2YU9 I;  3OW2 Z;  3J7A 4;  1X0T A;  1KX4 A;  3S2H I;  3AZM C;  3MGQ A;  4X23 B;  1P3A C;  1YIJ Z;  3LEL D;  1U35 C;  2CV5 A;  4X23 D;  1N2F A;  3B6G D;  3LEL B;  2NZD C;  5B31 D;  3X1S A;  4Z66 D;  2AYD A;  2V45 A;  5BT1 D;  3D6W A;  2JIO A;  1M1K 2;  3WTP B;  1VQ7 Z;  1M19 B;  2NQB B;  2JIR A;  3B0B A;  3IP4 C;  4HGA B;  4DRB A;  1F66 D;  5D1P A;  3MGQ D;  4KGC A;  1RO4 A;  3C1C C;  1ZB9 A;  2Q51 A;  5B1M D;  3KWQ A;  2JNY A;  4NBB A;  4UPK A;  5AV8 A;  2E2I I;  1A7W A;  5B2I C;  1ID3 B;  3W97 D;  3AZJ C;  1Q16 A;  5C3I B;  3NQJ A;  1Y1V S;  2LIY A;  3CD6 Z;  3S1N I;  3W99 B;  3W99 C;  1U35 D;  2VPZ A;  1R9T I;  3OW2 Y;  1K8A 2;  1VQN Z;  2UWX A;  3B0C W;  4Z66 C;  2VUG A;  3HOX I;  3W96 D;  2Y2H A;  5B24 A;  1B67 A;  3LZ0 C;  3REH C;  1BH8 B;  5CPJ A;  1I3Q I;  3U50 C;  1M90 2;  1KQS Z;  4H9P A;  5GSU B;  2QA4 1;  1Q7Y 2;  4WV4 B;  4Y52 I;  3X1U C;  2AKL A;  2M48 A;  4ZUX D;  3AFA A;  4MRI A;  1Y1W I;  1K73 2;  1P3L D;  5CPI A;  1P3M A;  3X1T B;  1NP6 A;  2QEX Z;  1VQL 1;  2RIQ A;  3WKJ A;  4CAY A; 
#chains in the Genus database with same CATH homology
 3H0L C;  2F8N D;  3G71 Z;  2FJ7 D;  5JA4 B;  3MVD B;  3W98 B;  5AV5 B;  5JRG D;  2NZD B;  2PYO C;  1YIT Z;  5GT3 A;  5AV9 C;  2BG1 A;  4YM6 C;  5E5A A;  2ARO B;  1P3F C;  4Z2M G;  2NVY I;  2NVQ I;  2W03 A;  1WWI A;  3NQU A;  4JJN D;  2P3Y A;  1HQ3 A;  2RPR A;  3MZL B;  2FJ7 A;  3X1V C;  3HOU I;  5AVC D;  4KUD B;  5AV5 A;  4HGA C;  1K9M 1;  3WKJ D;  5IT9 b;  2JCH A;  1VQ4 1;  1M1A D;  4KUD D;  3AZG A;  5B0Y A;  4WU9 B;  1P3P D;  1JFI B;  1YJ9 Z;  5AV6 D;  2F8N G;  3FQM A;  1YJW 1;  3W97 A;  5BNV A;  4J8X B;  4NBE A;  4JJN A;  5GT3 B;  4BBR I;  3REI B;  1KX3 B;  4DRA A;  3I56 Z;  1S32 D;  3MVD A;  3AZM D;  3CME Z;  3EG5 B;  1ULY A;  3I56 1;  4E30 A;  1P3I A;  3CPW Z;  3MGS C;  3AZK C;  4WJ3 C;  1P3A B;  2GU2 A;  3IX0 A;  5AVC A;  3RZD I;  2DE5 A;  5FUG B;  4H9S C;  4LD9 B;  2PK7 A;  2W04 A;  3I55 1;  1YJN Z;  2Y2N A;  4WU8 D;  1VQ5 Z;  2B63 I;  5IP9 I;  3UTB B;  1USP B;  1VQM Z;  4LD9 D;  4ZBJ C;  2NVT I;  2JA5 I;  1P3F D;  3UTB D;  3C1B A;  1P3B A;  1TWH I;  3S1Q I;  4YS3 B;  1QYP A;  5G49 B;  2WB1 A;  3REK B;  1TAF B;  2HIO D;  1P3P B;  5B32 D;  3REJ C;  1M1A C;  2K5R A;  3A1I A;  3GTP I;  1P34 C;  4G91 B;  3LZ1 C;  3AZH A;  1P34 B;  3TE5 B;  5GXQ A;  1BFM A;  1P3B D;  3JAM b;  2Y2L A;  1VQK Z;  3CCE Z;  3AZN A;  5B1L C;  3V9R B;  5AV9 B;  5B1L B;  3MGP D;  5DNN D;  1TZY C;  5JRG A;  3C1B B;  5CP6 C;  3REL C;  3AN2 A;  3G6E 1;  3AZL D;  1AOI A;  5F99 D;  2WAQ A;  3LEL A;  4A3C I;  4XZQ A;  3AV1 C;  3MNN C;  1M19 D;  4KUD A;  1F66 B;  2VUM I;  4R8P B;  1ZLA C;  4XUJ A;  4NFR A;  1VQO 1;  1Q7Y 1;  1QVG Z;  1PFT A;  1M90 1;  2G2K A;  1W2B Z;  1QVF Y;  2V8I A;  4A3F I;  1K9M 2;  3KXB D;  4J8U D;  3UT9 A;  3VMI A;  3S1R I;  1Q86 2;  3X1T C;  3PO2 I;  4H9P B;  5GSU A;  5AY8 A;  3G71 1;  3REI C;  4XUJ B;  3H0M C;  1TWC I;  5F99 A;  3AZF C;  3B6G B;  3AZF B;  3B6G C;  2QKD A;  4RV9 A;  3CCS 1;  1U35 B;  4J8W C;  4A3D I;  5B1L D;  3CC4 1;  3AZL B;  2ARO C;  5CPK B;  3P5J B;  5B0Y B;  4WU9 A;  2ZM5 A;  2EGT A;  3AV1 D;  1M19 C;  5A2Q b;  2OTJ 1;  5B0Y D;  3GTM S;  1KX5 B;  2O4H A;  3GTQ I;  2ZY2 A;  3MON A;  4G92 B;  4NB9 A;  3FQQ A;  2RHB A;  3CCJ 1;  1BH9 A;  4ZUX C;  3AZI A;  1WW9 A;  3KXB C;  4J8U C;  1S32 C;  1ZH1 A;  1P3K C;  4HGZ A;  2L5A A;  2XD5 A;  2IZ4 A;  2LFU A;  3KUY A;  1K8A 1;  3EER A;  5DNM D;  4E33 A;  1DL6 A;  5B0Z B;  2IO5 B;  5BS7 C;  3MGS B;  3AZK B;  4BY1 I;  5B33 D;  5C3E I;  3TU4 C;  3WA9 D;  3I55 Z;  1YJN 1;  4WU8 C;  1KX5 A;  1H3O B;  4Z66 B;  4Z5T C;  4YS3 A;  1RNI A;  1S7M A;  4BBS I;  2G5I C;  4ZBJ B;  3J81 b;  2BYM B;  1Z2C B;  3AV2 A;  5AV8 D;  3W96 B;  4RVF A;  3GTO I;  4UUZ B;  3UTB A;  1USP A;  4J8X D;  1ID3 A;  1RLY A;  5GSU D;  5IT9 f;  5GT3 D;  4H9R B;  3A6N B;  3C1C D;  1BH9 B;  1KX3 D;  2VF1 A;  3LZ1 D;  2K3R A;  3CCU 1;  3AZM B;  5B40 A;  4X23 C;  2IZ3 A;  3PO3 I;  1M18 C;  1P3G C;  1HQ3 D;  3B6F D;  2ZY5 A;  3MGR A;  5AV6 A;  2G5H C;  4J8W B;  1VQK 1;  3CCE 1;  2NQB A;  1AOI B;  2FFF B;  4M6B A;  4CSR A;  3H3V J;  2DQN C;  5CPI D;  4JJN B;  1P3M D;  2PMZ A;  3LJA A;  4QLC C;  2JE5 A;  1AOI D;  3G6E Z;  4R8P A;  1VQN 1;  2F8N A;  3UTA A;  2Y0S A;  1KRL A;  4MH4 A;  3HOW I;  3UTA C;  3CCR Z;  3REK D;  3O62 B;  4R8P C;  1ZLA B;  2QR1 B;  3S2D I;  3CC7 1;  3A6N A;  4QLC A;  2M6N A;  4CSR B;  3KUY D;  3X1T D;  2QEX 1;  1P3A D;  2R7Z I;  3MGR B;  3REI D;  2QRE B;  3MGR C;  3BG1 B;  3CXC Z;  4J8V D;  1M18 D;  1P3G A;  3B6F C;  2R93 I;  4X23 A;  4TNU A;  3CCL Z;  2I3C A;  4LD9 C;  3CMA Z;  4Z5T B;  4YM6 D;  5CPJ D;  5B24 D;  5CPI B;  5GT0 C;  1P3M B;  2QRC B;  4DK1 A;  5DNN C;  3UTB C;  2YFW B;  3X1U D;  3LZ0 B;  3REH B;  3AN2 B;  3VMG A;  1JWH C;  3CCV 1;  3AV2 C;  3AZL C;  3AFA D;  4MD7 A;  4J8V A;  3CPW Y;  2V8J A;  3WTP C;  1PZR A;  3AN2 D;  1KX3 A;  1N1J A;  5FLX b;  3J80 b;  4YS3 C;  3M4O I;  2RVQ D;  4Z5T A;  3MGP A;  1VQ4 Z;  1P3P C;  1M1A B;  4WU8 A;  3REK C;  1KX5 C;  4BXX I;  3TU4 A;  3CCJ Z;  4KGC B;  4XUJ D;  5B32 B;  4MD8 A;  3KUY C;  2H85 A;  1X3W A;  1TZY D;  1P3K A;  4HGY A;  2HU9 A;  3KXB A;  5DNM C;  1F1E A;  5B31 B;  4J8U A;  5B33 A;  1KU5 A;  4J8V B;  3AZI C;  2RBL A;  3HKZ A;  4RVG A;  3S14 I;  4CL1 A;  5B0Z C;  4WZS B;  3QWU A;  3G4S 1;  3LJA D;  5AVB A;  1ZB8 A;  3KIF A;  4Z5T D;  4WU8 B;  5G49 A;  2W8S A;  5GT0 D;  3UTA B;  1VQM 1;  2J6A A;  3WAA C;  4DQY B;  4WU9 C;  5GXQ D;  3WAA B;  2QA4 Z;  4J8X C;  3AYW A;  4X6A I;  4NE5 A;  3AYW C;  4A3L I;  1X3Z A;  4J8W A;  5BNV B;  4J8X A;  1ID3 D;  3W97 B;  2Q4Z A;  3CCU Z;  3WAA A;  3I4N I;  1NUI A;  4CAY B;  3REI A;  1P3G B;  3GCF A;  4NBC A;  4RVD A;  5BO0 B;  5AY8 C;  2V8K A;  3GTK I;  2DE7 A;  4Y7N I;  1KC8 1;  5C4J I;  4QTT A;  3CC2 Z;  5AVB C;  5DNN B;  5IP7 I;  5AVB B;  3J80 f;  5B0Z A;  1YHQ Z;  4E2X A;  5E5A B;  5B33 C;  5DNM A;  1ZLA A;  3EED A;  4S1T A;  3MNN A;  4KUD C;  3CCR 1;  4XZQ C;  5GXQ B;  3A6N D;  3C1C B;  3WAA D;  1NJI 1;  2Y2K A;  4G91 C;  3LZ1 B;  3REK A;  3NQJ B;  5CP6 A;  3AZG D;  1P3P A;  1TZY A;  2YFV B;  3MGP C;  3V9R A;  3REL D;  1P3K D;  5B1L A;  3MVD D;  5B32 G;  3AZN C;  2QRD B;  1KX3 C;  4EWC A;  1VQ6 1;  3WTP A;  1RQF A;  1P3K B;  3MGS D;  3REL B;  3AZK D;  4J8V C;  3AZL A;  1Y1V I;  4BY7 I;  5C3I C;  2YFW A;  2ZY3 A;  3LZ1 A;  3EPL A;  5DNN A;  3CCM Z;  5GT0 A;  2Y2I A;  4H9N A;  3REJ A;  3NH4 A;  5C44 I;  1VQ8 Z;  4LD9 A;  1K73 1;  1QF8 A;  2E9H A;  5AVB D;  1JJ2 Z;  3WA9 B;  1N1J B;  3CC4 Z;  3EPJ A;  3B6F A;  4NE3 A;  2F8N H;  2OTJ Z;  4EO5 C;  5D1O B;  3TDH B;  2F8N K;  3S1M I;  4AYB A;  3F3F C;  3AYW B;  1KX5 D;  1P3O B;  3CCQ 1;  1Q86 1;  3M3Y I;  3A6N C;  4KHA B;  4J8W D;  2E2J I;  1VQP Z;  1M18 B;  5AY8 B;  3AZE D;  4Z2M H;  3MVD C;  3AZN D;  2BJO A;  2Y2Q A;  1HQ3 B;  2ARO D;  2FJ7 B;  3HOV I;  3FDD A;  4YM6 B;  4JJN C;  3W98 D;  3G4S Z;  5JRG B;  2NZD D;  3LJA C;  3R45 A;  1P3F B;  3D9X A;  5B0Y C;  2J8P A;  1JFI A;  5B2J B;  3MNN D;  2NQB C;  1ZLA D;  4XZQ B;  5JA4 A;  5AV6 C;  5B2J D;  3MNN B;  2QLV B;  3X1V A;  4E2W A;  3I4M I;  1M18 A;  5B40 B;  4G92 C;  1WII A;  5B40 C;  2YAD A;  1ML8 A;  3NDI A;  3R45 B;  1P3F A;  4ZUX B;  1HTA A;  5A2Q f;  5T6B A;  3O62 D;  1Q82 1;  5GT3 C;  5BNX A;  2VQR A;  4YM6 A;  4NFT A;  5B2I B;  4NE6 A;  1ID3 C;  2OOX B;  2CWE A;  4RVH A;  3AZJ B;  3VB9 A;  2Y2J A;  3C1B D;  1Q81 1;  1Q81 2;  5AY8 D;  3AZE B;  1VQ9 1;  1B6W A;  2Y2O A;  1KX4 B;  2GTI A;  1TAF A;  3CC2 1;  1KD1 1;  3CQZ I;  5CPI C;  1P3M C;  1LQL A;  1EQZ B;  4WNN B;  3AFA C;  3NH5 A;  5BS7 A;  4E32 A;  1EQZ D;  3X1U B;  3LZ0 D;  3REH D;  5BT1 C;  3VH6 A;  5KDM A;  1S32 A;  4NBD A;  2YFV A;  2RT9 A;  4ZUX A;  3KWQ B;  5FUG A;  2F4O A;  2OOY B;  3KIH A;  3HOY I;  3EPH A;  3CC7 Z;  2GTH A;  1QVG Y;  2HIO B;  2JA7 I;  2F2A C;  1YIJ 1;  3AZJ A;  4DGL A;  2PM9 A;  1M19 A;  5CP6 D;  1S32 B;  2PYO B;  3MGR D;  1KD1 2;  5CP6 B;  2ARO A;  1TZY B;  5AN9 F;  2PYO D;  3CCL 1;  3CCM 1;  1VQ8 1;  3Q87 A;  3UTA D;  4WNN A;  5E5A D;  3CMA 1;  1TWF I;  3T4N B;  2CV5 B;  4R8P D;  1M1K 1;  1VQ7 1;  4E45 A;  3CCV Z;  5B31 G;  2BYK A;  3AV1 B;  5BO0 A;  5F99 B;  3B6G A;  5F99 C;  3AZF A;  2JR6 A;  1JJ2 Y;  1WCM I;  4KHA A;  4QTU A;  5GSU C;  3X1T A;  5B1M B;  1NJI 2;  3UT9 C;  2JA8 I;  3CCQ Z;  3S17 I;  4UUZ A;  1I50 I;  1P3G D;  1T3U A;  3H0R C;  3LUS A;  4NB8 A;  4A3J I;  1BH8 A;  4XUJ C;  3CXC Y;  2P28 A;  1VQP 1;  1P3A A;  3GTL I;  3AZM A;  4A3K I;  3CD6 1;  1KX4 C;  3IF8 A;  2BYK B;  3AV1 A;  3JAM f;  3LEL C;  3AZI D;  3AZF D;  1AOI C;  4A3G I;  3NQU B;  3WTP D;  3AN2 C;  2Y2P A;  5B1M A;  5CPK C;  5JRG C;  4NBA A;  3LJA B;  3REL A;  5CHL B;  4A93 I;  3WA9 A;  2DE6 A;  1YI2 1;  3GTM I;  1P3L B;  5GXQ C;  4H9N B;  3REJ B;  5T67 A;  3AZH C;  3F3P C;  3B0D B;  3AZH B;  5B2J A;  3B0D C;  1P34 A;  3GKQ A;  4NOZ A;  1M1A A;  5B32 C;  3REJ D;  1RO2 A;  2OZK A;  5LL6 f;  3KXB B;  4J8U B;  3BG0 B;  5B31 A;  1Q9C A;  2Y2G A;  2LY8 A;  3AZN B;  1S72 Z;  5B0Z D;  1P3B C;  2ZY4 A;  3VH5 T;  3C1B C;  3B0C T;  1YUA A;  3VH5 A;  4MXU A;  2R6M A;  1VQ9 Z;  4HH4 A;  2IO5 C;  3AZE C;  1QVF Z;  2OTL Z;  3PO3 S;  4E2Y A;  1P3L A;  1I6H I;  3W99 D;  3VH5 W;  4H9S A;  5AVC B;  2O53 A;  5KDM B;  5AVC C;  4MD9 A;  1YHQ 1;  4A3I I;  3GTJ I;  3MGS A;  3AZK A;  1W2E A;  5CPK D;  1P3I C;  1P3I B;  3W96 C;  3AYW D;  4EO5 B;  4A3B I;  4AWL B;  2NQB D;  3UT9 B;  1EQZ A;  1YJW Z;  3EPK A;  1P3O C;  5AV8 B;  2JS4 A;  5FLM I;  5B2I D;  3W97 C;  1VLA A;  3AZH D;  3AZJ D;  2HUE C;  3AZG C;  2HUE B;  3AZG B;  3ESW A;  3CME 1;  4H9Q A;  2HIO C;  1KQS Y;  1VQ6 Z;  2R92 I;  5AV5 C;  2KPI A;  4QLC D;  3W98 C;  2F8N B;  2FJ7 C;  1KC8 2;  1HQ3 C;  3A1K A;  3KFU G;  4H9O A;  5DNM B;  5BNX B;  4QLC B;  4NH1 C;  1VQ5 1;  2JA6 I;  3GTG I;  3S16 I;  5E5A C;  5B33 B;  2JUB A;  4A3E I;  5AV9 A;  3WTP E;  4XZQ D;  3O62 A;  3FKI I;  1N8R 2;  2PYO A;  1N8R 1;  1F66 A;  2F4M A;  1Q82 2;  3F6T A;  4WU9 D;  5AV6 B;  1F66 C;  4H9Q B;  3KWQ D;  1P3I D;  4XX2 A;  3O62 C;  3WKJ C;  3WKJ B;  4KGC D;  3UT9 D;  1L1O C;  1P34 D;  3AL0 C;  1TWA I;  3K7A I;  1W2B Y;  4H9O B;  1P3O D;  3W98 A;  3X1U A;  1Z02 A;  3H0G I;  4NBH A;  4RS4 A;  3RZO I;  1YIT 1;  3NFZ A;  5CM2 M;  5AV9 D;  3B6F B;  2HIO A;  4NBF A;  3LZ0 A;  5B24 C;  3REH A;  5CPJ C;  5B24 B;  1WWS A;  5CPJ B;  2JMO A;  5T64 A;  1R4V A;  5AV5 D;  3X1S D;  1H3O A;  2XD1 A;  4Z66 A;  4NBG A;  3VTN A;  5C4X I;  3X1V D;  4A3M I;  3HOZ I;  1P3O A;  2CV5 D;  3NH8 A;  3AFA B;  5GT0 B;  2ZAE B;  1EQZ C;  3W99 A;  5D1O A;  2BYM A;  4E44 A;  4YS3 D;  3W96 A;  3AV2 B;  1Z01 A;  4AWL C;  1VQO Z;  5B2I A;  3MZK B;  1YI2 Z;  2NVX I;  3AV2 D;  5AV8 C;  2HF1 A;  5B40 D;  3KSY A;  1P3L C;  3KWQ C;  3J81 f;  2E2H I;  1VQL Z;  2KI7 B;  3AZE A;  3C1C A;  2RVQ C;  2JSS A;  2Y2M A;  4KGC C;  5FLX f;  3IFU A;  1TFI A;  3KUY B;  1S72 1;  3MGP B;  3CCS Z;  3I07 A;  4MON A;  2DF4 C;  5B31 C;  3AZI B;  1P3B B;  3S15 I;  5B32 A;  1K83 I;  2OTL 1;  3NDJ A;  1KX4 D;  1YUK A;  3X1S B;  5B2J C;  3X1S C;  3TU4 B;  2NZD A;  1TWG I;  3X1V B;  1P9N A;  1U35 A;  2CV5 C;  3TU4 D;  3WA9 C;  3VH6 W;  3MGQ C;  4E2Z A;  1RO0 A;  3MGQ B;  3VMH A;  5CPK A;  5B1M C;  4H9R A;  4E31 A;  1YJ9 1;  1Z03 A;  1SFO I;  3VH6 T;  2YU9 I;  3OW2 Z;  3J7A 4;  1X0T A;  1KX4 A;  3S2H I;  3AZM C;  3MGQ A;  4X23 B;  1P3A C;  1YIJ Z;  3LEL D;  1U35 C;  2CV5 A;  4X23 D;  1N2F A;  3B6G D;  3LEL B;  2NZD C;  5B31 D;  3X1S A;  4Z66 D;  5BT1 D;  3D6W A;  1M1K 2;  3WTP B;  1VQ7 Z;  1M19 B;  2NQB B;  3B0B A;  3IP4 C;  4HGA B;  4DRB A;  1F66 D;  5D1P A;  3MGQ D;  4KGC A;  1RO4 A;  3C1C C;  1ZB9 A;  2Q51 A;  5B1M D;  3KWQ A;  2JNY A;  4NBB A;  4UPK A;  5AV8 A;  2E2I I;  1A7W A;  5B2I C;  1ID3 B;  3W97 D;  3AZJ C;  1Y1V S;  5C3I B;  3NQJ A;  3CD6 Z;  2LIY A;  3S1N I;  3W99 B;  3W99 C;  1U35 D;  1R9T I;  3OW2 Y;  1K8A 2;  1VQN Z;  2UWX A;  3B0C W;  4Z66 C;  2VUG A;  3HOX I;  3W96 D;  2Y2H A;  5B24 A;  1B67 A;  3LZ0 C;  3REH C;  1BH8 B;  5CPJ A;  1I3Q I;  3U50 C;  1M90 2;  1KQS Z;  4H9P A;  5GSU B;  2QA4 1;  1Q7Y 2;  4WV4 B;  4Y52 I;  3X1U C;  2AKL A;  2M48 A;  4ZUX D;  3AFA A;  4MRI A;  1Y1W I;  1K73 2;  1P3L D;  5CPI A;  1P3M A;  3X1T B;  1NP6 A;  2QEX Z;  1VQL 1;  2RIQ A;  3WKJ A;  4CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...