3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
b'AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H2 subunit A
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/replication
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
2BG1A 4ZUXC 4A3KI 3F3PC 5GT3B 5B33A 3REID 3IFUA 5D1PA 4J8WD 2LEXA 1HQ3D 4YM6A 4EO5B 5B33C 3CCM1 1W2BY 1P3AA 4YM6C 3CPWZ 2F8NK 1VQ9Z 1P3AC 4HGAB 2YFVA 1YIT1 3CCL1 5FLMI 1YJNZ 4MD7A 1AOIA 3I551 5E5AC 4J8XA 4YS3A 3NQJB 3AV2B 2F8NH 4J8XC 4YS3C 3REKB 5CHLB 3WAAC 3WAAA 1RO0A 3FKII 4NBGA 5B32D 5AY8B 3CME1 1VQNZ 3CCE1 3BG1B 4H9QB 2Y2HA 4Z2MG 5GT0B 5DNND 1P3OA 4J8UB 3LJAD 3S2DI 3OW2Y 1P3OC 3WTPD 2OTL1 2VQRA 3MVDB 5CP6D 3S1NI 1Q821 3GTMI 4WU8B 1M19B 1KU5A 1S32B 2QRDB 2W04A 3J80f 2O4HA 4RVGA 3MGQB 4S1TA 3WKJA 3WKJC 4XZQD 3MGPD 2JA8I 3UTAA 1TFIA 4A3DI 3AFAD 3H0LC 3UTAC 3LELA 2KPIA 2IO5B 3AYWA 2VPYA 3LELC 4R8PB 2IV2X 3AYWC 4KGCD 4NBHA 4NE5A 4BBSI 1M18A 3AZIA 1P3GD 3HOXI 3CCRZ 1M18C 3AZIC 3AZNB 2H85A 4E33A 2ZY4A 1K8A2 1TAFB 3G711 3KWQB 4A3CI 1WZNA 3KUYD 1SIWA 3X1SD 2J6AA 2R93I 4NBCA 5B1MC 3J7A4 3KXBD 3EG5B 4LD9B 3ESWA 3C1CA 4X23B 2I3CA 3P5JB 5JRGA 3C1CC 1ID3B 2FJ7D 2F4OA 1P3MA 5JRGC 2OOYB 5C4XI 3CC7Z 3MZKB 1P3MC 2BYMA 3TU4A 1WWIA 4CSRB 3AV1D 3TU4C 1FDIA 1ZLAD 1QF8A 5JA4B 2AYDA 2F2AC 4E2YA 1VQ61 3AL0C 1EQZB 1Q861 1Z03A 3AZJA 5B31A 3AZLD 3O62A 3AZJC 5CPKD 3F3FC 5B31C 3AZKD 3O62C 3CCUZ 3S1MI 1TWFI 1X3WA 1K83I 1P3IB 4WU9B 1VQ8Z 3S15I 1RLYA 4XUJA 5AV6B 3CMAZ 5B2ID 4XUJC 3REIA 2NZDD 1TWAI 3S1RI 4J8WA 4E45A 1HQ3A 1U35B 3MNNB 4J8WC 1HQ3C 3UT9D 1YIJZ 1KX4B 4A3EI 4H9SA 2V8JA 3REHD 2JE5A 1I50I 4H9SC 1R4VA 2HIOD 4KHAB 5BT1C 2PYOA 5BO0B 2PYOC 3W99A 2VPXA 5FLXf 4Z66D 3UTBB 3W99C 5B32A 2F8NG 3CXCY 4DK1A 2LIYA 3B0CW 3GTPI 5B31G 4A3II 5DNNA 3LJAA 5DNNC 3A6ND 3WTPA 2W03A 3LJAC 1M1K2 2GTHA 3WTPC 4E32A 2R92I 3AZHD 5CP6A 2P3YA 1YI2Z 3AN2C 3EERA 5CP6C 3EPHA 2YU9I 3HOUI 3M4OI 3MGRD 4H9OB 4XZQA 3MGPA 3LZ1A 5FUGA 3GKQA 4XZQC 3MGPC 3AFAA 3LZ1C 1P3KB 3VTNA 3AFAC 3MGSB 4H9RA 4KGCA 3W97D 3KIFA 2JS4A 3H3VJ 3LZ0D 1P3GA 5B32G 1P3GC 1VQK1 5BNVA 3X1TB 3REJD 4LD9D 1ML8A 1N8R1 1KD12 5GSUB 3W98B 4NE6A 3KUYA 5G49B 3X1SA 5B2JD 3MONA 3KUYC 4E2XA 3X1SC 4KUDB 5T6BA 5IT9f 5B40B 5CPJB 1VQ4Z 3AZED 2PK7A 3KXBA 4NFRA 1P3PC 2NQBB 2Y2OA 3KXBC 2BYKB 4DRBA 2HF1A 5CPID 3B0DC 3M3YI 3AV2D 2FJ7A 4H9PA 5B24B 2RHBA 1NJI2 4NBFA 3X1UD 1P3FB 3AV1A 1QYPA 1H3OA 2RT9A 4UPKA 1ZLAA 3AV1C 2E7ZA 1FDOA 2E9HA 1ZLAC 1YJWZ 3GTLI 2OTJ1 4J8UD 5A2Qb 5CPKA 2LY8A 4G91B 5AV9B 3AZKA 5CPKC 2PYOD 1M19D 2JNYA 3AZKC 1BH9A 2DE5A 1S7MA 2WAQA 3QWUA 1YJ91 3MGQD 2EGTA 1VQO1 4A3LI 5BNXB 5B2IA 2E2JI 5B2IC 1M902 4ZBJB 4J8VD 3UT9A 1P3BB 2M48A 3UT9C 3CCV1 2JA7I 1KX5B 3R45A 2F8ND 3VMGA 2Q4ZA 2E2II 3J81b 3REHA 4JJNA 2XD1A 1KX3B 2HIOA 3REHC 2Y2MA 4JJNC 1W2BZ 3G6EZ 3RZDI 4ZUXB 3HOVI 1L1OC 2Y2KA 4Z66A 3HOWI 4EWCA 4Z66C 3GTGI 5B33B 3CD61 3KWQD 5AV8D 3RELD 4YM6B 1YHQZ 1P3AB 4QLCD 4RS4A 4WZSB 2YFVB 2R7ZI 2QKDA 2O53A 5E5AB 4J8XB 4YS3B 1S721 3WAAB 4X23D 1VQM1 1AOIC 1YUKA 5D1OA 4WJ3C 1VQ91 1PFTA 1VLAA 4Y52I 1P3OB 2VF1A 4NB9A 1EQZD 3B6FA 4MXUA 2G2KA 3W97A 3B6FC 3LZ0A 3CCMZ 3W97C 3LZ0C 1YITZ 5B1LD 3REJA 3WKJB 3AZFD 2JR6A 3KSYA 3REJC 2P28A 3GTJI 3CCLZ 1KC81 5AV6D 3WTPE 3I55Z 5B2JA 1K9M2 3D6WA 4CAYA 3LELB 5B2JC 1Z02A 3CC21 3AYWB 1U35D 3CMEZ 4AYBA 3AZEA 1KX4D 2Y0SA 3CCEZ 3AZEC 3AZIB 1F66D 4MH4A 4BXXI 5GXQD 5CPIA 2NVXI 3VH6T 2V45A 1VQ71 5CPIC 3AV2A 2OTLZ 4A3GI 1WCMI 4A3MI 3AV2C 5BS7A 3UTBD 1DL6A 3X1UA 1YUAA 5BS7C 1N1JA 3X1UC 5B1MB 2L5AA 5B0YD 2JIRA 2JA6I 1Q9CA 5KDMA 5DNMD 4J8UA 1Q822 4J8UC 2Y2JA 2PMZA 4NBBA 4A3JI 1QVFY 3PO2I 2CV5D 2ZY3A 5AVCA 2Y2IA 3W96B 1AA6A 5AVCC 3C1CB 2AROD 5JRGB 3MGQA 4AWLC 3HOZI 4DRAA 1P3MB 1M1AD 3NDJA 1R9TI 2BYMB 2W8SA 2JIPA 5AVBB 3CC41 4J8VA 4E44A 3TDHB 4J8VC 3MGSD 3G71Z 1Q7Y2 3AZJB 2F8NA 5B31B 3O62B 2YFWB 5F99D 2F4MA 4Z5TB 3VH5T 2NVQI 3F6TA 4XUJB 1TAFA 4UUZA 2QR1B 3W98D 3KWQA 2AKLA 5AV8A 4J8WB 1HQ3B 4G92C 3RELA 3J81f 5AV8C 3RELC 1VQOZ 3REIC 1P34D 4RVHA 4QLCA 4KUDD 3U50C 3JAMf 5CPJD 5AV5D 4QLCC 1TZYD 3CXCZ 3C1BB 3KFUG 1K731 1TWHI 5C3IC 1VQ6Z 2PYOB 3BG0B 3CCSZ 3W99B 1JFIA 3NH5A 4NBEA 1I6HI 5B24D 1VQP1 1Q862 1N2FA 1P3LD 4WNNA 3FQQA 5B32C 3B0BA 1USPA 2V8KA 3LJAB 3TE5B 3X1VD 3WTPB 2QEX1 3AN2B 1VQLZ 5CP6B 2NVYI 5AV9D 2PM9A 5B1LA 3S1QI 3AZFA 5B1LC 4HGYA 3RZOI 2Y2NA 4XZQB 3MGPB 5AV6A 3LZ1B 5FUGB 3AZFC 4MD8A 5CM2M 3AFAB 3AZMD 2ZM5A 3AZGD 2ZY2A 1U35A 2V3VA 4H9RB 3B6GD 1KX4A 2R6MA 1P3GB 1KX4C 1F66A 5B0ZD 1F66C 5GXQA 4KGCC 2HUEB 5GXQC 1P9NA 3WA9D 4E2WA 4ZUXD 2RPRA 3KUYB 3X1SB 3G4S1 2BJOA 5GT3D 5B0YA 4HH4A 5B0YC 1P3AD 5DNMA 1Y8CA 1Y1WI 1P3PB 5DNMC 3KXBB 1NP6A 2CV5A 2JA5I 2Q51A 3B0DB 5E5AD 2CV5C 2AROA 4X6AI 2AROC 4H9PB 2QREB 1M1AA 1RQFA 3FQMA 3REKD 1M1AC 1VQKZ 3AV1B 2FJ7C 1H3OB 2K5RA 1ZLAB 5AY8D 3CCJZ 2JIQA 1P3OD 2NAPA 3I4NI 3I561 3NQUA 5GT0D 1Q811 2G5HC 5CPKB 2QA41 3AZLA 3MVDD 1T3UA 3AZLC 1BH9B 5F99A 3KIHA 4WU8D 1S32D 3HOYI 5F99C 3IX0A 5B2IB 2XD5A 4NFTA 4RVFA 2NZDA 1VQ51 1P34A 2NZDC 3AYWD 1P34C 1M901 5AV5A 1TZYA 3R45B 4R8PD 5AV5C 1TZYC 3REHB 2VPZA 4JJNB 2OTJZ 2JSSA 5LL6f 3AZND 2HIOC 2DQNC 5B24A 5B24C 1P3LA 1JJ2Y 1YJ9Z 1WJ2A 1P3LC 5C44I 5B1MD 5T67A 3X1VA 2NVTI 4NBDA 3X1VC 3A6NA 3CCQ1 3A6NC 2GU2A 3NH4A 3A1IA 3AZHA 5AV9A 2Y2LA 3V9RA 3AZHC 3W96D 1AOIB 3C1CD 5C3EI 3CCVZ 3S2HI 1KQSY 3OW2Z 1ID3D 2FFFB 3MGRA 1QVGY 3AZMA 4H9NA 3MGRC 1TWGI 3AZMC 3AZGA 5AVBD 3VMHA 5C4JI 3AZGC 3B6FB 3B6GA 1YJN1 3CD6Z 3B6GC 3W97B 3AZJD 2IZ3A 3LZ0B 4A3BI 5B0ZA 2RBLA 1VQN1 5B0ZC 1BH8A 3GCFA 5IP7I 3REJB 3WA9A 1BFMA 4ZUXA 3EEDA 4Z5TD 3WA9C 4LD9A 4XUJD 1P3ID 4WU9D 4LD9C 2DE7A 5IP9I 4CL1A 5B2JB 1S72Z 1N8R2 3UTAB 4CAYB 5GT3A 2LFUA 2M6NA 1VQMZ 3S16I 5GT3C 5FLXb 2G5IC 3MNND 3AZEB 1K9M1 4EO5C 3C1BD 4Y7NI 1M18B 5BT1D 5E5AA 4HGAC 5T64A 5CPIB 2RIQA 3S14I 3W99D 3NQJA 3CPWY 1QVFZ 3REKA 2UWXA 3X1UB 1ULYA 2ZY5A 3REKC 1N1JB 5AY8A 1KRLA 1WW9A 2HU9A 5AY8C 4H9QA 2Y2GA 5KDMB 1TWCI 3CQZI 3CCR1 5GT0A 1K8A1 2B63I 3VH6W 1RO2A 5GT0C 4NB8A 4BY1I 1W2EA 3AN2D 4BBRI 5AVCB 3CC2Z 3MVDA 1KC82 4AWLB 3MVDC 3GTQI 4WU8A 1M19A 1S32A 4WU8C 1M19C 1S32C 2JMOA 3GTOI 2JIOA 4MD9A 3MGQC 3LZ1D 3TU4B 1VQ7Z 4J8VB 5A2Qf 1P3KD 4MONA 2F8NB 3IF8A 4R8PA 2IO5C 1Y1VS 3CC71 4R8PC 1Q7Y1 5IT9b 3D9XA 3AZNA 3HKZA 3X1TD 3AZNC 4UUZB 3PO3S 4G92B 5AV8B 3RELB 5GSUD 3REIB 2QLVB 4WV4B 5B1MA 3KWQC 4QLCB 2JUBA 3CCU1 1HTAA 2VPWA 3EPJA 5C3IB 1P3PD 5B40D 3VH5W 4E2ZA 3CC4Z 1F1EA 2VUGA 1VQ81 3W96A 2Y2QA 2NQBD 3MZLB 4TNUA 3W96C 1X3ZA 3IR7A 1JFIB 3PO3I 4X23A 1ID3A 4X23C 5B32B 1ID3C 1YIJ1 4WNNB 1LQLA 1P3FD 4CSRA 5AVBA 1USPB 5DNNB 3LUSA 4NH1C 1ZB8A 5AVBC 5JA4A 3T4NB 3VMIA 2K3RA 3CCS1 1EQZA 1EQZC 4M6BA 2YADA 4NBAA 2CWEA 2YFWA 5B1LB 1WIIA 1M1K1 3AZFB 1SFOI 3S17I 4Z5TA 1P3IA 4Z5TC 4WU9A 1JWHC 2RVQD 2Y2PA 3VH6A 4WU9C 1P3IC 1Y1VI 1VQL1 5AV6C 2OZKA 2IZ4A 1K732 1YI21 4A93I 3MNNA 1VQPZ 1U35C 3MNNC 1P3BD 3NFZA 3B0CT 3C1BA 1F66B 4KGCB 1NUIA 1KX5D 4QTTA 5GXQB 3C1BC 4JJND 2QEXZ 4E31A 1KX3D 5BNVB 4KHAA 5BO0A 3UTBA 3I4MI 5B0YB 3UTBC 5B33D 3NDIA 1KD11 5DNMB 4YM6D 3H0MC 3NH8A 3AN2A 2CV5B 2KI7B 3I07A 2VUMI 4DQYB 2AROB 4MRIA 1ZB9A 1AOID 2V8IA 4J8XD 4YS3D 1M1AB 1I3QI 3WAAD 2FJ7B 1X0TA 3CCQZ 4NE3A 4Z2MH 4H9OA 4DGLA 4E30A 1VQ41 3VH5A 1WWSA 3EPLA 2GTIA 1P3KA 3J80b 2E2HI 1NJI1 3NQUB 1P3KC 3A1KA 3B6FD 3MGSA 3G4SZ 3MGSC 3AZLB 1Q16A 2DE6A 3H0GI 3AZKB 5F99B 4XX2A 4A3FI 2JCHA 3GTKI 4QTUA 3CCJ1 2HUEC 3X1TA 4BY7I 1YJW1 3X1TC 3WKJD 5GSUA 3W98A 2NZDB 1QXFA 3UTAD 3FDDA 5GSUC 5G49A 1P34B 3W98C 3UT9B 1RNIA 1B67A 3LELD 5AV5B 4KUDA 1TZYB 1P3PA 3CMA1 5B40A 2DF4C 5CPJA 4KUDC 2QRCB 4NOZA 5B40C 5CPJC 1JJ2Z 2OOXB 1M18D 3AZID 2NQBA 3I56Z 2BYKA 2HIOB 2NQBC 3VB9A 2QA4Z 4Z66B 1Z01A 1P3LB 1RO4A 4RV9A 1Q812 1P3FA 3H0RC 3X1VB 1P3FC 1KQSZ 3A6NB 2J8PA 3G6E1 1QVGZ 1VQ5Z 3AZHB 1A7WA 5AVCD 3IP4C 3V9RB 3Q87A 3D2LA 2WB1A 4RVDA 4G91C 5AV9C 5JRGD 4HGZA 1YHQ1 3MGRB 1P3MD 5D1OB 1B6WA 3AZMB 4H9NB 5BNXA 3GTMS 2RVQC 3TU4D 3AZGB 3B6GB 3EPKA 4ZBJC 1P3BA 5B0ZB 1P3BC 1KX5A 1PZRA 5B31D 1BH8B 3O62D 2ZAEB 1KX5C 1Z2CB 3JAMb 1KX3A 3WA9B 1ZH1A 3K7AI 5AN9F 1KX3C 2JIMA
chains in the Genus database with same CATH topology
2BG1A 4ZUXC 4A3KI 3F3PC 5GT3B 5B33A 3REID 3IFUA 5D1PA 4J8WD 1N8R1 1HQ3D 4YM6A 4EO5B 5B33C 3CCM1 1W2BY 1P3AA 4YM6C 3CPWZ 2F8NK 1VQ9Z 1P3AC 4HGAB 2YFVA 1YIT1 3CCL1 5FLMI 1YJNZ 4MD7A 1AOIA 3I551 5E5AC 4J8XA 4YS3A 3NQJB 3AV2B 2F8NH 4J8XC 4YS3C 3REKB 5CHLB 3WAAC 3WAAA 1RO0A 3FKII 4NBGA 5B32D 5AY8B 3CME1 1VQNZ 3CCE1 3BG1B 4H9QB 2Y2HA 4Z2MG 5GT0B 5DNND 1P3OA 4J8UB 3LJAD 3S2DI 3OW2Y 1P3OC 3WTPD 2OTL1 2VQRA 3MVDB 5CP6D 3S1NI 1Q821 3GTMI 4WU8B 1M19B 1KU5A 1S32B 2QRDB 2W04A 3J80f 2O4HA 4RVGA 3MGQB 4S1TA 3WKJA 3WKJC 4XZQD 3MGPD 2JA8I 3UTAA 1TFIA 4A3DI 3AFAD 3H0LC 3UTAC 3LELA 2KPIA 2IO5B 3AYWA 3LELC 4R8PB 3AYWC 4KGCD 4NBHA 4NE5A 4BBSI 1M18A 3AZIA 1P3GD 3HOXI 3CCRZ 1M18C 3AZIC 3AZNB 2H85A 4E33A 2ZY4A 1K8A2 1TAFB 3G711 3KWQB 4A3CI 3KUYD 3X1SD 2J6AA 2R93I 4NBCA 5B1MC 3J7A4 3KXBD 3EG5B 4LD9B 3ESWA 3C1CA 4X23B 2I3CA 3P5JB 5JRGA 3C1CC 1ID3B 2FJ7D 2F4OA 1P3MA 5JRGC 2OOYB 5C4XI 3CC7Z 3MZKB 1P3MC 2BYMA 3TU4A 1WWIA 4CSRB 3AV1D 3TU4C 4E2YA 1ZLAD 1QF8A 5JA4B 3PO3I 2F2AC 1VQ61 3AL0C 1EQZB 1Q861 1Z03A 3AZJA 5B31A 3AZLD 3O62A 3AZJC 5CPKD 3F3FC 5B31C 3AZKD 3O62C 3CCUZ 3S1MI 1TWFI 1X3WA 1K83I 1P3IB 4WU9B 1VQ8Z 3S15I 1RLYA 4XUJA 5AV6B 3CMAZ 5B2ID 4XUJC 3REIA 2NZDD 1TWAI 3S1RI 4J8WA 4E45A 1HQ3A 1U35B 3MNNB 4J8WC 1HQ3C 3UT9D 1YIJZ 1KX4B 4A3EI 4H9SA 2V8JA 3REHD 2JE5A 1I50I 4H9SC 1R4VA 2HIOD 4KHAB 5BT1C 2PYOA 5BO0B 2PYOC 3W99A 5FLXf 4Z66D 3UTBB 3W99C 5B32A 2F8NG 3CXCY 4DK1A 2LIYA 3B0CW 3GTPI 5B31G 4A3II 5DNNA 3LJAA 5DNNC 3A6ND 3WTPA 2W03A 3LJAC 1M1K2 2GTHA 3WTPC 4E32A 2R92I 3AZHD 5CP6A 2P3YA 1YI2Z 3AN2C 3EERA 5CP6C 3EPHA 2YU9I 3HOUI 3M4OI 3MGRD 4H9OB 4XZQA 3MGPA 3LZ1A 5FUGA 3GKQA 4XZQC 3MGPC 3AFAA 3LZ1C 1P3KB 3VTNA 3AFAC 3MGSB 4H9RA 4KGCA 3W97D 3KIFA 2JS4A 3H3VJ 3LZ0D 1P3GA 5B32G 1P3GC 1VQK1 5BNVA 3X1TB 3REJD 4LD9D 1ML8A 1KD12 5GSUB 3W98B 4NE6A 3KUYA 5G49B 3X1SA 5B2JD 3MONA 3KUYC 4E2XA 3X1SC 4KUDB 5T6BA 5IT9f 5B40B 5CPJB 1VQ4Z 3AZED 2PK7A 3KXBA 4NFRA 1P3PC 2NQBB 2Y2OA 3KXBC 2BYKB 4DRBA 2HF1A 5CPID 3B0DC 3M3YI 3AV2D 2FJ7A 4H9PA 5B24B 2RHBA 1NJI2 4NBFA 3X1UD 1P3FB 3AV1A 1QYPA 1H3OA 2RT9A 4UPKA 1ZLAA 3AV1C 1YJWZ 2E9HA 3GTLI 1ZLAC 2OTJ1 4J8UD 5A2Qb 5CPKA 2LY8A 4G91B 5AV9B 3AZKA 5CPKC 2PYOD 1M19D 2JNYA 3AZKC 1BH9A 2DE5A 1S7MA 2WAQA 3QWUA 1YJ91 3MGQD 2EGTA 1VQO1 4A3LI 5BNXB 5B2IA 2E2JI 5B2IC 1M902 4ZBJB 4J8VD 3UT9A 1P3BB 2M48A 3UT9C 3CCV1 2JA7I 1KX5B 3R45A 2F8ND 3VMGA 2Q4ZA 2E2II 3J81b 3REHA 4JJNA 2XD1A 1KX3B 2HIOA 3REHC 2Y2MA 4JJNC 1W2BZ 3G6EZ 3RZDI 4ZUXB 3HOVI 1L1OC 2Y2KA 4Z66A 3HOWI 4EWCA 4Z66C 3GTGI 5B33B 3CD61 3KWQD 5AV8D 3RELD 4YM6B 1YHQZ 1P3AB 4QLCD 4RS4A 4WZSB 2YFVB 2R7ZI 2QKDA 2O53A 5E5AB 4J8XB 4YS3B 1S721 3WAAB 4X23D 1VQM1 1AOIC 1YUKA 5D1OA 4WJ3C 1VQ91 1PFTA 1VLAA 4Y52I 1P3OB 2VF1A 4NB9A 1EQZD 3B6FA 4MXUA 2G2KA 3W97A 3B6FC 3LZ0A 3CCMZ 3W97C 3LZ0C 1YITZ 5B1LD 3REJA 3WKJB 3AZFD 2JR6A 3KSYA 3REJC 2P28A 3GTJI 3CCLZ 1KC81 5AV6D 3WTPE 3I55Z 5B2JA 1K9M2 3D6WA 4CAYA 3LELB 5B2JC 1Z02A 3CC21 3AYWB 1U35D 3CMEZ 4AYBA 3AZEA 1KX4D 2Y0SA 3CCEZ 3AZEC 3AZIB 1F66D 4MH4A 4BXXI 5GXQD 5CPIA 2NVXI 3VH6T 1VQ71 2OTLZ 5CPIC 3AV2A 4A3GI 1WCMI 4A3MI 3AV2C 5BS7A 3UTBD 1DL6A 3X1UA 1YUAA 5BS7C 1N1JA 3X1UC 5B1MB 2L5AA 5B0YD 2JA6I 1Q9CA 5KDMA 5DNMD 4J8UA 1Q822 4J8UC 2Y2JA 2PMZA 4NBBA 4A3JI 1QVFY 3PO2I 2CV5D 2ZY3A 5AVCA 2Y2IA 3W96B 5AVCC 3C1CB 2AROD 5JRGB 3MGQA 4AWLC 3HOZI 4DRAA 1P3MB 1M1AD 3NDJA 1R9TI 2BYMB 2W8SA 5AVBB 3CC41 4J8VA 4E44A 3TDHB 4J8VC 3MGSD 3G71Z 1Q7Y2 3AZJB 2F8NA 5B31B 3O62B 2YFWB 5F99D 2F4MA 4Z5TB 3VH5T 2NVQI 3F6TA 4XUJB 1TAFA 4UUZA 2QR1B 3W98D 3KWQA 2AKLA 5AV8A 4J8WB 1HQ3B 4G92C 3RELA 3J81f 5AV8C 3RELC 1VQOZ 3REIC 1P34D 4RVHA 4QLCA 4KUDD 3U50C 3JAMf 5CPJD 5AV5D 4QLCC 1TZYD 3CXCZ 3C1BB 3KFUG 1K731 1TWHI 5C3IC 1VQ6Z 2PYOB 3BG0B 3CCSZ 3W99B 1JFIA 3NH5A 4NBEA 1I6HI 5B24D 1VQP1 1Q862 1N2FA 1P3LD 4WNNA 3FQQA 5B32C 3B0BA 1USPA 2V8KA 3LJAB 3TE5B 3X1VD 3WTPB 2QEX1 3AN2B 1VQLZ 5CP6B 2NVYI 5AV9D 2PM9A 5B1LA 3S1QI 3AZFA 5B1LC 4HGYA 3RZOI 2Y2NA 4XZQB 3MGPB 5AV6A 3LZ1B 5FUGB 3AZFC 4MD8A 5CM2M 3AFAB 3AZMD 2ZM5A 3AZGD 2ZY2A 1U35A 4H9RB 3B6GD 1KX4A 2R6MA 1P3GB 1KX4C 1F66A 5B0ZD 1F66C 5GXQA 4KGCC 2HUEB 5GXQC 1P9NA 3WA9D 4E2WA 4ZUXD 2RPRA 3KUYB 3X1SB 3G4S1 2BJOA 5GT3D 5B0YA 4HH4A 5B0YC 1P3AD 5DNMA 1Y1WI 1P3PB 5DNMC 3KXBB 1NP6A 2CV5A 2JA5I 2Q51A 3B0DB 5E5AD 2CV5C 2AROA 4X6AI 2AROC 4H9PB 2QREB 1M1AA 1RQFA 3FQMA 3REKD 1M1AC 1VQKZ 3AV1B 2FJ7C 1H3OB 2K5RA 1ZLAB 5AY8D 3CCJZ 1P3OD 3I4NI 3I561 3NQUA 5GT0D 1Q811 2G5HC 5CPKB 2QA41 3AZLA 3MVDD 1T3UA 3AZLC 1BH9B 5F99A 3KIHA 4WU8D 1S32D 3HOYI 5F99C 3IX0A 5B2IB 2XD5A 4NFTA 4RVFA 2NZDA 1VQ51 1P34A 2NZDC 3AYWD 1P34C 1M901 5AV5A 1TZYA 3R45B 4R8PD 5AV5C 1TZYC 3REHB 2OTJZ 4JJNB 2JSSA 5LL6f 3AZND 2HIOC 2DQNC 5B24A 5B24C 1P3LA 1JJ2Y 1YJ9Z 5C44I 1P3LC 5B1MD 5T67A 3X1VA 2NVTI 4NBDA 3X1VC 3A6NA 3CCQ1 3A6NC 2GU2A 3NH4A 3A1IA 3AZHA 5AV9A 2Y2LA 3V9RA 3AZHC 3W96D 1AOIB 3C1CD 5C3EI 3CCVZ 3S2HI 1KQSY 3OW2Z 1ID3D 2FFFB 3MGRA 1QVGY 3AZMA 4H9NA 3MGRC 1TWGI 3AZMC 3AZGA 5AVBD 3VMHA 5C4JI 3AZGC 3B6FB 3B6GA 1YJN1 3CD6Z 3B6GC 3W97B 3AZJD 2IZ3A 3LZ0B 4A3BI 5B0ZA 2RBLA 1VQN1 5B0ZC 1BH8A 3GCFA 5IP7I 3REJB 3WA9A 1BFMA 4ZUXA 3EEDA 4Z5TD 3WA9C 4LD9A 4XUJD 1P3ID 4WU9D 4LD9C 2DE7A 5IP9I 4CL1A 5B2JB 1S72Z 1N8R2 3UTAB 4CAYB 5GT3A 2LFUA 2M6NA 1VQMZ 3S16I 5GT3C 5FLXb 2G5IC 3MNND 3AZEB 1K9M1 4EO5C 3C1BD 4Y7NI 1M18B 5BT1D 5E5AA 4HGAC 5T64A 5CPIB 2RIQA 3S14I 3W99D 3NQJA 3CPWY 1QVFZ 3REKA 2UWXA 3X1UB 1ULYA 2ZY5A 3REKC 1N1JB 5AY8A 1KRLA 1WW9A 2HU9A 5AY8C 4H9QA 2Y2GA 5KDMB 1TWCI 3CQZI 3CCR1 5GT0A 1K8A1 2B63I 3VH6W 1RO2A 5GT0C 4NB8A 4BY1I 1W2EA 3AN2D 4BBRI 5AVCB 3CC2Z 3MVDA 1KC82 4AWLB 3MVDC 3GTQI 4WU8A 1M19A 1S32A 4WU8C 1M19C 1S32C 2JMOA 3GTOI 4MD9A 3MGQC 3LZ1D 3TU4B 1VQ7Z 4J8VB 5A2Qf 1P3KD 4MONA 2F8NB 3IF8A 4R8PA 2IO5C 1Y1VS 3CC71 4R8PC 1Q7Y1 5IT9b 3D9XA 3AZNA 3HKZA 3X1TD 3AZNC 4UUZB 3PO3S 4G92B 5AV8B 3RELB 5GSUD 3REIB 2QLVB 4WV4B 5B1MA 3KWQC 4QLCB 2JUBA 3CCU1 1HTAA 3EPJA 5C3IB 1P3PD 5B40D 3VH5W 4E2ZA 3CC4Z 1F1EA 2VUGA 1VQ81 3W96A 2Y2QA 2NQBD 3MZLB 4TNUA 3W96C 1X3ZA 1JFIB 4X23A 1ID3A 4X23C 5B32B 1ID3C 1YIJ1 4WNNB 1LQLA 1P3FD 4CSRA 5AVBA 1USPB 5DNNB 3LUSA 4NH1C 1ZB8A 5AVBC 5JA4A 3T4NB 3VMIA 2K3RA 3CCS1 1EQZA 1EQZC 4M6BA 2YADA 4NBAA 2CWEA 2YFWA 5B1LB 1WIIA 1M1K1 3AZFB 1SFOI 3S17I 4Z5TA 1P3IA 4Z5TC 4WU9A 1JWHC 2RVQD 2Y2PA 3VH6A 4WU9C 1P3IC 1Y1VI 1VQL1 5AV6C 2OZKA 2IZ4A 1K732 1YI21 4A93I 3MNNA 1VQPZ 1U35C 3MNNC 1P3BD 3NFZA 3B0CT 3C1BA 1F66B 4KGCB 1NUIA 1KX5D 4QTTA 5GXQB 3C1BC 4JJND 2QEXZ 4E31A 1KX3D 5BNVB 4KHAA 5BO0A 3UTBA 3I4MI 5B0YB 3UTBC 5B33D 3NDIA 1KD11 5DNMB 4YM6D 3H0MC 3NH8A 3AN2A 2CV5B 2KI7B 3I07A 2VUMI 4DQYB 2AROB 4MRIA 1ZB9A 1AOID 2V8IA 4J8XD 4YS3D 1M1AB 1I3QI 3WAAD 2FJ7B 1X0TA 3CCQZ 4NE3A 4Z2MH 4H9OA 4DGLA 4E30A 1VQ41 3VH5A 1WWSA 3EPLA 2GTIA 1P3KA 3J80b 2E2HI 1NJI1 3NQUB 1P3KC 3A1KA 3B6FD 3MGSA 3G4SZ 3MGSC 3AZLB 2DE6A 3H0GI 3AZKB 5F99B 4XX2A 4A3FI 2JCHA 3GTKI 4QTUA 3CCJ1 2HUEC 3X1TA 4BY7I 1YJW1 3X1TC 3WKJD 5GSUA 3W98A 2NZDB 3UTAD 3FDDA 5GSUC 5G49A 1P34B 3W98C 3UT9B 1RNIA 1B67A 3LELD 5AV5B 4KUDA 1TZYB 1P3PA 3CMA1 5B40A 2DF4C 5CPJA 4KUDC 2QRCB 4NOZA 5B40C 5CPJC 1JJ2Z 2OOXB 1M18D 3AZID 2NQBA 3I56Z 2BYKA 2HIOB 2NQBC 3VB9A 2QA4Z 4Z66B 1Z01A 1P3LB 1RO4A 4RV9A 1Q812 1P3FA 3H0RC 3X1VB 1P3FC 1KQSZ 3A6NB 2J8PA 3G6E1 1QVGZ 1VQ5Z 3AZHB 1A7WA 5AVCD 3IP4C 3V9RB 3Q87A 2WB1A 4RVDA 4G91C 5AV9C 5JRGD 4HGZA 1YHQ1 3MGRB 1P3MD 5D1OB 1B6WA 3AZMB 4H9NB 5BNXA 3GTMS 2RVQC 3TU4D 3AZGB 3B6GB 3EPKA 4ZBJC 1P3BA 5B0ZB 1P3BC 1KX5A 1PZRA 5B31D 1BH8B 3O62D 2ZAEB 1KX5C 1Z2CB 3JAMb 1KX3A 3WA9B 1ZH1A 3K7AI 5AN9F 1KX3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 2BG1 A;  4ZUX C;  4A3K I;  3F3P C;  5GT3 B;  5B33 A;  3REI D;  3IFU A;  5D1P A;  4J8W D;  2LEX A;  1HQ3 D;  4YM6 A;  4EO5 B;  5B33 C;  3CCM 1;  1W2B Y;  1P3A A;  4YM6 C;  3CPW Z;  2F8N K;  1VQ9 Z;  1P3A C;  4HGA B;  2YFV A;  1YIT 1;  3CCL 1;  5FLM I;  1YJN Z;  4MD7 A;  1AOI A;  3I55 1;  5E5A C;  4J8X A;  4YS3 A;  3NQJ B;  3AV2 B;  2F8N H;  4J8X C;  4YS3 C;  3REK B;  5CHL B;  3WAA C;  3WAA A;  1RO0 A;  3FKI I;  4NBG A;  5B32 D;  5AY8 B;  3CME 1;  1VQN Z;  3CCE 1;  3BG1 B;  4H9Q B;  2Y2H A;  4Z2M G;  5GT0 B;  5DNN D;  1P3O A;  4J8U B;  3LJA D;  3S2D I;  3OW2 Y;  1P3O C;  3WTP D;  2OTL 1;  2VQR A;  3MVD B;  5CP6 D;  3S1N I;  1Q82 1;  3GTM I;  4WU8 B;  1M19 B;  1KU5 A;  1S32 B;  2QRD B;  2W04 A;  3J80 f;  2O4H A;  4RVG A;  3MGQ B;  4S1T A;  3WKJ A;  3WKJ C;  4XZQ D;  3MGP D;  2JA8 I;  3UTA A;  1TFI A;  4A3D I;  3AFA D;  3H0L C;  3UTA C;  3LEL A;  2KPI A;  2IO5 B;  3AYW A;  2VPY A;  3LEL C;  4R8P B;  2IV2 X;  3AYW C;  4KGC D;  4NBH A;  4NE5 A;  4BBS I;  1M18 A;  3AZI A;  1P3G D;  3HOX I;  3CCR Z;  1M18 C;  3AZI C;  3AZN B;  2H85 A;  4E33 A;  2ZY4 A;  1K8A 2;  1TAF B;  3G71 1;  3KWQ B;  4A3C I;  1WZN A;  3KUY D;  1SIW A;  3X1S D;  2J6A A;  2R93 I;  4NBC A;  5B1M C;  3J7A 4;  3KXB D;  3EG5 B;  4LD9 B;  3ESW A;  3C1C A;  4X23 B;  2I3C A;  3P5J B;  5JRG A;  3C1C C;  1ID3 B;  2FJ7 D;  2F4O A;  1P3M A;  5JRG C;  2OOY B;  5C4X I;  3CC7 Z;  3MZK B;  1P3M C;  2BYM A;  3TU4 A;  1WWI A;  4CSR B;  3AV1 D;  3TU4 C;  1FDI A;  1ZLA D;  1QF8 A;  5JA4 B;  2AYD A;  2F2A C;  4E2Y A;  1VQ6 1;  3AL0 C;  1EQZ B;  1Q86 1;  1Z03 A;  3AZJ A;  5B31 A;  3AZL D;  3O62 A;  3AZJ C;  5CPK D;  3F3F C;  5B31 C;  3AZK D;  3O62 C;  3CCU Z;  3S1M I;  1TWF I;  1X3W A;  1K83 I;  1P3I B;  4WU9 B;  1VQ8 Z;  3S15 I;  1RLY A;  4XUJ A;  5AV6 B;  3CMA Z;  5B2I D;  4XUJ C;  3REI A;  2NZD D;  1TWA I;  3S1R I;  4J8W A;  4E45 A;  1HQ3 A;  1U35 B;  3MNN B;  4J8W C;  1HQ3 C;  3UT9 D;  1YIJ Z;  1KX4 B;  4A3E I;  4H9S A;  2V8J A;  3REH D;  2JE5 A;  1I50 I;  4H9S C;  1R4V A;  2HIO D;  4KHA B;  5BT1 C;  2PYO A;  5BO0 B;  2PYO C;  3W99 A;  2VPX A;  5FLX f;  4Z66 D;  3UTB B;  3W99 C;  5B32 A;  2F8N G;  3CXC Y;  4DK1 A;  2LIY A;  3B0C W;  3GTP I;  5B31 G;  4A3I I;  5DNN A;  3LJA A;  5DNN C;  3A6N D;  3WTP A;  2W03 A;  3LJA C;  1M1K 2;  2GTH A;  3WTP C;  4E32 A;  2R92 I;  3AZH D;  5CP6 A;  2P3Y A;  1YI2 Z;  3AN2 C;  3EER A;  5CP6 C;  3EPH A;  2YU9 I;  3HOU I;  3M4O I;  3MGR D;  4H9O B;  4XZQ A;  3MGP A;  3LZ1 A;  5FUG A;  3GKQ A;  4XZQ C;  3MGP C;  3AFA A;  3LZ1 C;  1P3K B;  3VTN A;  3AFA C;  3MGS B;  4H9R A;  4KGC A;  3W97 D;  3KIF A;  2JS4 A;  3H3V J;  3LZ0 D;  1P3G A;  5B32 G;  1P3G C;  1VQK 1;  5BNV A;  3X1T B;  3REJ D;  4LD9 D;  1ML8 A;  1N8R 1;  1KD1 2;  5GSU B;  3W98 B;  4NE6 A;  3KUY A;  5G49 B;  3X1S A;  5B2J D;  3MON A;  3KUY C;  4E2X A;  3X1S C;  4KUD B;  5T6B A;  5IT9 f;  5B40 B;  5CPJ B;  1VQ4 Z;  3AZE D;  2PK7 A;  3KXB A;  4NFR A;  1P3P C;  2NQB B;  2Y2O A;  3KXB C;  2BYK B;  4DRB A;  2HF1 A;  5CPI D;  3B0D C;  3M3Y I;  3AV2 D;  2FJ7 A;  4H9P A;  5B24 B;  2RHB A;  1NJI 2;  4NBF A;  3X1U D;  1P3F B;  3AV1 A;  1QYP A;  1H3O A;  2RT9 A;  4UPK A;  1ZLA A;  3AV1 C;  2E7Z A;  1FDO A;  2E9H A;  1ZLA C;  1YJW Z;  3GTL I;  2OTJ 1;  4J8U D;  5A2Q b;  5CPK A;  2LY8 A;  4G91 B;  5AV9 B;  3AZK A;  5CPK C;  2PYO D;  1M19 D;  2JNY A;  3AZK C;  1BH9 A;  2DE5 A;  1S7M A;  2WAQ A;  3QWU A;  1YJ9 1;  3MGQ D;  2EGT A;  1VQO 1;  4A3L I;  5BNX B;  5B2I A;  2E2J I;  5B2I C;  1M90 2;  4ZBJ B;  4J8V D;  3UT9 A;  1P3B B;  2M48 A;  3UT9 C;  3CCV 1;  2JA7 I;  1KX5 B;  3R45 A;  2F8N D;  3VMG A;  2Q4Z A;  2E2I I;  3J81 b;  3REH A;  4JJN A;  2XD1 A;  1KX3 B;  2HIO A;  3REH C;  2Y2M A;  4JJN C;  1W2B Z;  3G6E Z;  3RZD I;  4ZUX B;  3HOV I;  1L1O C;  2Y2K A;  4Z66 A;  3HOW I;  4EWC A;  4Z66 C;  3GTG I;  5B33 B;  3CD6 1;  3KWQ D;  5AV8 D;  3REL D;  4YM6 B;  1YHQ Z;  1P3A B;  4QLC D;  4RS4 A;  4WZS B;  2YFV B;  2R7Z I;  2QKD A;  2O53 A;  5E5A B;  4J8X B;  4YS3 B;  1S72 1;  3WAA B;  4X23 D;  1VQM 1;  1AOI C;  1YUK A;  5D1O A;  4WJ3 C;  1VQ9 1;  1PFT A;  1VLA A;  4Y52 I;  1P3O B;  2VF1 A;  4NB9 A;  1EQZ D;  3B6F A;  4MXU A;  2G2K A;  3W97 A;  3B6F C;  3LZ0 A;  3CCM Z;  3W97 C;  3LZ0 C;  1YIT Z;  5B1L D;  3REJ A;  3WKJ B;  3AZF D;  2JR6 A;  3KSY A;  3REJ C;  2P28 A;  3GTJ I;  3CCL Z;  1KC8 1;  5AV6 D;  3WTP E;  3I55 Z;  5B2J A;  1K9M 2;  3D6W A;  4CAY A;  3LEL B;  5B2J C;  1Z02 A;  3CC2 1;  3AYW B;  1U35 D;  3CME Z;  4AYB A;  3AZE A;  1KX4 D;  2Y0S A;  3CCE Z;  3AZE C;  3AZI B;  1F66 D;  4MH4 A;  4BXX I;  5GXQ D;  5CPI A;  2NVX I;  3VH6 T;  2V45 A;  1VQ7 1;  5CPI C;  3AV2 A;  2OTL Z;  4A3G I;  1WCM I;  4A3M I;  3AV2 C;  5BS7 A;  3UTB D;  1DL6 A;  3X1U A;  1YUA A;  5BS7 C;  1N1J A;  3X1U C;  5B1M B;  2L5A A;  5B0Y D;  2JIR A;  2JA6 I;  1Q9C A;  5KDM A;  5DNM D;  4J8U A;  1Q82 2;  4J8U C;  2Y2J A;  2PMZ A;  4NBB A;  4A3J I;  1QVF Y;  3PO2 I;  2CV5 D;  2ZY3 A;  5AVC A;  2Y2I A;  3W96 B;  1AA6 A;  5AVC C;  3C1C B;  2ARO D;  5JRG B;  3MGQ A;  4AWL C;  3HOZ I;  4DRA A;  1P3M B;  1M1A D;  3NDJ A;  1R9T I;  2BYM B;  2W8S A;  2JIP A;  5AVB B;  3CC4 1;  4J8V A;  4E44 A;  3TDH B;  4J8V C;  3MGS D;  3G71 Z;  1Q7Y 2;  3AZJ B;  2F8N A;  5B31 B;  3O62 B;  2YFW B;  5F99 D;  2F4M A;  4Z5T B;  3VH5 T;  2NVQ I;  3F6T A;  4XUJ B;  1TAF A;  4UUZ A;  2QR1 B;  3W98 D;  3KWQ A;  2AKL A;  5AV8 A;  4J8W B;  1HQ3 B;  4G92 C;  3REL A;  3J81 f;  5AV8 C;  3REL C;  1VQO Z;  3REI C;  1P34 D;  4RVH A;  4QLC A;  4KUD D;  3U50 C;  3JAM f;  5CPJ D;  5AV5 D;  4QLC C;  1TZY D;  3CXC Z;  3C1B B;  3KFU G;  1K73 1;  1TWH I;  5C3I C;  1VQ6 Z;  2PYO B;  3BG0 B;  3CCS Z;  3W99 B;  1JFI A;  3NH5 A;  4NBE A;  1I6H I;  5B24 D;  1VQP 1;  1Q86 2;  1N2F A;  1P3L D;  4WNN A;  3FQQ A;  5B32 C;  3B0B A;  1USP A;  2V8K A;  3LJA B;  3TE5 B;  3X1V D;  3WTP B;  2QEX 1;  3AN2 B;  1VQL Z;  5CP6 B;  2NVY I;  5AV9 D;  2PM9 A;  5B1L A;  3S1Q I;  3AZF A;  5B1L C;  4HGY A;  3RZO I;  2Y2N A;  4XZQ B;  3MGP B;  5AV6 A;  3LZ1 B;  5FUG B;  3AZF C;  4MD8 A;  5CM2 M;  3AFA B;  3AZM D;  2ZM5 A;  3AZG D;  2ZY2 A;  1U35 A;  2V3V A;  4H9R B;  3B6G D;  1KX4 A;  2R6M A;  1P3G B;  1KX4 C;  1F66 A;  5B0Z D;  1F66 C;  5GXQ A;  4KGC C;  2HUE B;  5GXQ C;  1P9N A;  3WA9 D;  4E2W A;  4ZUX D;  2RPR A;  3KUY B;  3X1S B;  3G4S 1;  2BJO A;  5GT3 D;  5B0Y A;  4HH4 A;  5B0Y C;  1P3A D;  5DNM A;  1Y8C A;  1Y1W I;  1P3P B;  5DNM C;  3KXB B;  1NP6 A;  2CV5 A;  2JA5 I;  2Q51 A;  3B0D B;  5E5A D;  2CV5 C;  2ARO A;  4X6A I;  2ARO C;  4H9P B;  2QRE B;  1M1A A;  1RQF A;  3FQM A;  3REK D;  1M1A C;  1VQK Z;  3AV1 B;  2FJ7 C;  1H3O B;  2K5R A;  1ZLA B;  5AY8 D;  3CCJ Z;  2JIQ A;  1P3O D;  2NAP A;  3I4N I;  3I56 1;  3NQU A;  5GT0 D;  1Q81 1;  2G5H C;  5CPK B;  2QA4 1;  3AZL A;  3MVD D;  1T3U A;  3AZL C;  1BH9 B;  5F99 A;  3KIH A;  4WU8 D;  1S32 D;  3HOY I;  5F99 C;  3IX0 A;  5B2I B;  2XD5 A;  4NFT A;  4RVF A;  2NZD A;  1VQ5 1;  1P34 A;  2NZD C;  3AYW D;  1P34 C;  1M90 1;  5AV5 A;  1TZY A;  3R45 B;  4R8P D;  5AV5 C;  1TZY C;  3REH B;  2VPZ A;  4JJN B;  2OTJ Z;  2JSS A;  5LL6 f;  3AZN D;  2HIO C;  2DQN C;  5B24 A;  5B24 C;  1P3L A;  1JJ2 Y;  1YJ9 Z;  1WJ2 A;  1P3L C;  5C44 I;  5B1M D;  5T67 A;  3X1V A;  2NVT I;  4NBD A;  3X1V C;  3A6N A;  3CCQ 1;  3A6N C;  2GU2 A;  3NH4 A;  3A1I A;  3AZH A;  5AV9 A;  2Y2L A;  3V9R A;  3AZH C;  3W96 D;  1AOI B;  3C1C D;  5C3E I;  3CCV Z;  3S2H I;  1KQS Y;  3OW2 Z;  1ID3 D;  2FFF B;  3MGR A;  1QVG Y;  3AZM A;  4H9N A;  3MGR C;  1TWG I;  3AZM C;  3AZG A;  5AVB D;  3VMH A;  5C4J I;  3AZG C;  3B6F B;  3B6G A;  1YJN 1;  3CD6 Z;  3B6G C;  3W97 B;  3AZJ D;  2IZ3 A;  3LZ0 B;  4A3B I;  5B0Z A;  2RBL A;  1VQN 1;  5B0Z C;  1BH8 A;  3GCF A;  5IP7 I;  3REJ B;  3WA9 A;  1BFM A;  4ZUX A;  3EED A;  4Z5T D;  3WA9 C;  4LD9 A;  4XUJ D;  1P3I D;  4WU9 D;  4LD9 C;  2DE7 A;  5IP9 I;  4CL1 A;  5B2J B;  1S72 Z;  1N8R 2;  3UTA B;  4CAY B;  5GT3 A;  2LFU A;  2M6N A;  1VQM Z;  3S16 I;  5GT3 C;  5FLX b;  2G5I C;  3MNN D;  3AZE B;  1K9M 1;  4EO5 C;  3C1B D;  4Y7N I;  1M18 B;  5BT1 D;  5E5A A;  4HGA C;  5T64 A;  5CPI B;  2RIQ A;  3S14 I;  3W99 D;  3NQJ A;  3CPW Y;  1QVF Z;  3REK A;  2UWX A;  3X1U B;  1ULY A;  2ZY5 A;  3REK C;  1N1J B;  5AY8 A;  1KRL A;  1WW9 A;  2HU9 A;  5AY8 C;  4H9Q A;  2Y2G A;  5KDM B;  1TWC I;  3CQZ I;  3CCR 1;  5GT0 A;  1K8A 1;  2B63 I;  3VH6 W;  1RO2 A;  5GT0 C;  4NB8 A;  4BY1 I;  1W2E A;  3AN2 D;  4BBR I;  5AVC B;  3CC2 Z;  3MVD A;  1KC8 2;  4AWL B;  3MVD C;  3GTQ I;  4WU8 A;  1M19 A;  1S32 A;  4WU8 C;  1M19 C;  1S32 C;  2JMO A;  3GTO I;  2JIO A;  4MD9 A;  3MGQ C;  3LZ1 D;  3TU4 B;  1VQ7 Z;  4J8V B;  5A2Q f;  1P3K D;  4MON A;  2F8N B;  3IF8 A;  4R8P A;  2IO5 C;  1Y1V S;  3CC7 1;  4R8P C;  1Q7Y 1;  5IT9 b;  3D9X A;  3AZN A;  3HKZ A;  3X1T D;  3AZN C;  4UUZ B;  3PO3 S;  4G92 B;  5AV8 B;  3REL B;  5GSU D;  3REI B;  2QLV B;  4WV4 B;  5B1M A;  3KWQ C;  4QLC B;  2JUB A;  3CCU 1;  1HTA A;  2VPW A;  3EPJ A;  5C3I B;  1P3P D;  5B40 D;  3VH5 W;  4E2Z A;  3CC4 Z;  1F1E A;  2VUG A;  1VQ8 1;  3W96 A;  2Y2Q A;  2NQB D;  3MZL B;  4TNU A;  3W96 C;  1X3Z A;  3IR7 A;  1JFI B;  3PO3 I;  4X23 A;  1ID3 A;  4X23 C;  5B32 B;  1ID3 C;  1YIJ 1;  4WNN B;  1LQL A;  1P3F D;  4CSR A;  5AVB A;  1USP B;  5DNN B;  3LUS A;  4NH1 C;  1ZB8 A;  5AVB C;  5JA4 A;  3T4N B;  3VMI A;  2K3R A;  3CCS 1;  1EQZ A;  1EQZ C;  4M6B A;  2YAD A;  4NBA A;  2CWE A;  2YFW A;  5B1L B;  1WII A;  1M1K 1;  3AZF B;  1SFO I;  3S17 I;  4Z5T A;  1P3I A;  4Z5T C;  4WU9 A;  1JWH C;  2RVQ D;  2Y2P A;  3VH6 A;  4WU9 C;  1P3I C;  1Y1V I;  1VQL 1;  5AV6 C;  2OZK A;  2IZ4 A;  1K73 2;  1YI2 1;  4A93 I;  3MNN A;  1VQP Z;  1U35 C;  3MNN C;  1P3B D;  3NFZ A;  3B0C T;  3C1B A;  1F66 B;  4KGC B;  1NUI A;  1KX5 D;  4QTT A;  5GXQ B;  3C1B C;  4JJN D;  2QEX Z;  4E31 A;  1KX3 D;  5BNV B;  4KHA A;  5BO0 A;  3UTB A;  3I4M I;  5B0Y B;  3UTB C;  5B33 D;  3NDI A;  1KD1 1;  5DNM B;  4YM6 D;  3H0M C;  3NH8 A;  3AN2 A;  2CV5 B;  2KI7 B;  3I07 A;  2VUM I;  4DQY B;  2ARO B;  4MRI A;  1ZB9 A;  1AOI D;  2V8I A;  4J8X D;  4YS3 D;  1M1A B;  1I3Q I;  3WAA D;  2FJ7 B;  1X0T A;  3CCQ Z;  4NE3 A;  4Z2M H;  4H9O A;  4DGL A;  4E30 A;  1VQ4 1;  3VH5 A;  1WWS A;  3EPL A;  2GTI A;  1P3K A;  3J80 b;  2E2H I;  1NJI 1;  3NQU B;  1P3K C;  3A1K A;  3B6F D;  3MGS A;  3G4S Z;  3MGS C;  3AZL B;  1Q16 A;  2DE6 A;  3H0G I;  3AZK B;  5F99 B;  4XX2 A;  4A3F I;  2JCH A;  3GTK I;  4QTU A;  3CCJ 1;  2HUE C;  3X1T A;  4BY7 I;  1YJW 1;  3X1T C;  3WKJ D;  5GSU A;  3W98 A;  2NZD B;  1QXF A;  3UTA D;  3FDD A;  5GSU C;  5G49 A;  1P34 B;  3W98 C;  3UT9 B;  1RNI A;  1B67 A;  3LEL D;  5AV5 B;  4KUD A;  1TZY B;  1P3P A;  3CMA 1;  5B40 A;  2DF4 C;  5CPJ A;  4KUD C;  2QRC B;  4NOZ A;  5B40 C;  5CPJ C;  1JJ2 Z;  2OOX B;  1M18 D;  3AZI D;  2NQB A;  3I56 Z;  2BYK A;  2HIO B;  2NQB C;  3VB9 A;  2QA4 Z;  4Z66 B;  1Z01 A;  1P3L B;  1RO4 A;  4RV9 A;  1Q81 2;  1P3F A;  3H0R C;  3X1V B;  1P3F C;  1KQS Z;  3A6N B;  2J8P A;  3G6E 1;  1QVG Z;  1VQ5 Z;  3AZH B;  1A7W A;  5AVC D;  3IP4 C;  3V9R B;  3Q87 A;  3D2L A;  2WB1 A;  4RVD A;  4G91 C;  5AV9 C;  5JRG D;  4HGZ A;  1YHQ 1;  3MGR B;  1P3M D;  5D1O B;  1B6W A;  3AZM B;  4H9N B;  5BNX A;  3GTM S;  2RVQ C;  3TU4 D;  3AZG B;  3B6G B;  3EPK A;  4ZBJ C;  1P3B A;  5B0Z B;  1P3B C;  1KX5 A;  1PZR A;  5B31 D;  1BH8 B;  3O62 D;  2ZAE B;  1KX5 C;  1Z2C B;  3JAM b;  1KX3 A;  3WA9 B;  1ZH1 A;  3K7A I;  5AN9 F;  1KX3 C;  2JIM A; 
#chains in the Genus database with same CATH homology
 2BG1 A;  4ZUX C;  4A3K I;  3F3P C;  5GT3 B;  5B33 A;  3REI D;  3IFU A;  5D1P A;  4J8W D;  1N8R 1;  1HQ3 D;  4YM6 A;  4EO5 B;  5B33 C;  3CCM 1;  1W2B Y;  1P3A A;  4YM6 C;  3CPW Z;  2F8N K;  1VQ9 Z;  1P3A C;  4HGA B;  2YFV A;  1YIT 1;  3CCL 1;  5FLM I;  1YJN Z;  4MD7 A;  1AOI A;  3I55 1;  5E5A C;  4J8X A;  4YS3 A;  3NQJ B;  3AV2 B;  2F8N H;  4J8X C;  4YS3 C;  3REK B;  5CHL B;  3WAA C;  3WAA A;  1RO0 A;  3FKI I;  4NBG A;  5B32 D;  5AY8 B;  3CME 1;  1VQN Z;  3CCE 1;  3BG1 B;  4H9Q B;  2Y2H A;  4Z2M G;  5GT0 B;  5DNN D;  1P3O A;  4J8U B;  3LJA D;  3S2D I;  3OW2 Y;  1P3O C;  3WTP D;  2OTL 1;  2VQR A;  3MVD B;  5CP6 D;  3S1N I;  1Q82 1;  3GTM I;  4WU8 B;  1M19 B;  1KU5 A;  1S32 B;  2QRD B;  2W04 A;  3J80 f;  2O4H A;  4RVG A;  3MGQ B;  4S1T A;  3WKJ A;  3WKJ C;  4XZQ D;  3MGP D;  2JA8 I;  3UTA A;  1TFI A;  4A3D I;  3AFA D;  3H0L C;  3UTA C;  3LEL A;  2KPI A;  2IO5 B;  3AYW A;  3LEL C;  4R8P B;  3AYW C;  4KGC D;  4NBH A;  4NE5 A;  4BBS I;  1M18 A;  3AZI A;  1P3G D;  3HOX I;  3CCR Z;  1M18 C;  3AZI C;  3AZN B;  2H85 A;  4E33 A;  2ZY4 A;  1K8A 2;  1TAF B;  3G71 1;  3KWQ B;  4A3C I;  3KUY D;  3X1S D;  2J6A A;  2R93 I;  4NBC A;  5B1M C;  3J7A 4;  3KXB D;  3EG5 B;  4LD9 B;  3ESW A;  3C1C A;  4X23 B;  2I3C A;  3P5J B;  5JRG A;  3C1C C;  1ID3 B;  2FJ7 D;  2F4O A;  1P3M A;  5JRG C;  2OOY B;  5C4X I;  3CC7 Z;  3MZK B;  1P3M C;  2BYM A;  3TU4 A;  1WWI A;  4CSR B;  3AV1 D;  3TU4 C;  4E2Y A;  1ZLA D;  1QF8 A;  5JA4 B;  3PO3 I;  2F2A C;  1VQ6 1;  3AL0 C;  1EQZ B;  1Q86 1;  1Z03 A;  3AZJ A;  5B31 A;  3AZL D;  3O62 A;  3AZJ C;  5CPK D;  3F3F C;  5B31 C;  3AZK D;  3O62 C;  3CCU Z;  3S1M I;  1TWF I;  1X3W A;  1K83 I;  1P3I B;  4WU9 B;  1VQ8 Z;  3S15 I;  1RLY A;  4XUJ A;  5AV6 B;  3CMA Z;  5B2I D;  4XUJ C;  3REI A;  2NZD D;  1TWA I;  3S1R I;  4J8W A;  4E45 A;  1HQ3 A;  1U35 B;  3MNN B;  4J8W C;  1HQ3 C;  3UT9 D;  1YIJ Z;  1KX4 B;  4A3E I;  4H9S A;  2V8J A;  3REH D;  2JE5 A;  1I50 I;  4H9S C;  1R4V A;  2HIO D;  4KHA B;  5BT1 C;  2PYO A;  5BO0 B;  2PYO C;  3W99 A;  5FLX f;  4Z66 D;  3UTB B;  3W99 C;  5B32 A;  2F8N G;  3CXC Y;  4DK1 A;  2LIY A;  3B0C W;  3GTP I;  5B31 G;  4A3I I;  5DNN A;  3LJA A;  5DNN C;  3A6N D;  3WTP A;  2W03 A;  3LJA C;  1M1K 2;  2GTH A;  3WTP C;  4E32 A;  2R92 I;  3AZH D;  5CP6 A;  2P3Y A;  1YI2 Z;  3AN2 C;  3EER A;  5CP6 C;  3EPH A;  2YU9 I;  3HOU I;  3M4O I;  3MGR D;  4H9O B;  4XZQ A;  3MGP A;  3LZ1 A;  5FUG A;  3GKQ A;  4XZQ C;  3MGP C;  3AFA A;  3LZ1 C;  1P3K B;  3VTN A;  3AFA C;  3MGS B;  4H9R A;  4KGC A;  3W97 D;  3KIF A;  2JS4 A;  3H3V J;  3LZ0 D;  1P3G A;  5B32 G;  1P3G C;  1VQK 1;  5BNV A;  3X1T B;  3REJ D;  4LD9 D;  1ML8 A;  1KD1 2;  5GSU B;  3W98 B;  4NE6 A;  3KUY A;  5G49 B;  3X1S A;  5B2J D;  3MON A;  3KUY C;  4E2X A;  3X1S C;  4KUD B;  5T6B A;  5IT9 f;  5B40 B;  5CPJ B;  1VQ4 Z;  3AZE D;  2PK7 A;  3KXB A;  4NFR A;  1P3P C;  2NQB B;  2Y2O A;  3KXB C;  2BYK B;  4DRB A;  2HF1 A;  5CPI D;  3B0D C;  3M3Y I;  3AV2 D;  2FJ7 A;  4H9P A;  5B24 B;  2RHB A;  1NJI 2;  4NBF A;  3X1U D;  1P3F B;  3AV1 A;  1QYP A;  1H3O A;  2RT9 A;  4UPK A;  1ZLA A;  3AV1 C;  1YJW Z;  2E9H A;  3GTL I;  1ZLA C;  2OTJ 1;  4J8U D;  5A2Q b;  5CPK A;  2LY8 A;  4G91 B;  5AV9 B;  3AZK A;  5CPK C;  2PYO D;  1M19 D;  2JNY A;  3AZK C;  1BH9 A;  2DE5 A;  1S7M A;  2WAQ A;  3QWU A;  1YJ9 1;  3MGQ D;  2EGT A;  1VQO 1;  4A3L I;  5BNX B;  5B2I A;  2E2J I;  5B2I C;  1M90 2;  4ZBJ B;  4J8V D;  3UT9 A;  1P3B B;  2M48 A;  3UT9 C;  3CCV 1;  2JA7 I;  1KX5 B;  3R45 A;  2F8N D;  3VMG A;  2Q4Z A;  2E2I I;  3J81 b;  3REH A;  4JJN A;  2XD1 A;  1KX3 B;  2HIO A;  3REH C;  2Y2M A;  4JJN C;  1W2B Z;  3G6E Z;  3RZD I;  4ZUX B;  3HOV I;  1L1O C;  2Y2K A;  4Z66 A;  3HOW I;  4EWC A;  4Z66 C;  3GTG I;  5B33 B;  3CD6 1;  3KWQ D;  5AV8 D;  3REL D;  4YM6 B;  1YHQ Z;  1P3A B;  4QLC D;  4RS4 A;  4WZS B;  2YFV B;  2R7Z I;  2QKD A;  2O53 A;  5E5A B;  4J8X B;  4YS3 B;  1S72 1;  3WAA B;  4X23 D;  1VQM 1;  1AOI C;  1YUK A;  5D1O A;  4WJ3 C;  1VQ9 1;  1PFT A;  1VLA A;  4Y52 I;  1P3O B;  2VF1 A;  4NB9 A;  1EQZ D;  3B6F A;  4MXU A;  2G2K A;  3W97 A;  3B6F C;  3LZ0 A;  3CCM Z;  3W97 C;  3LZ0 C;  1YIT Z;  5B1L D;  3REJ A;  3WKJ B;  3AZF D;  2JR6 A;  3KSY A;  3REJ C;  2P28 A;  3GTJ I;  3CCL Z;  1KC8 1;  5AV6 D;  3WTP E;  3I55 Z;  5B2J A;  1K9M 2;  3D6W A;  4CAY A;  3LEL B;  5B2J C;  1Z02 A;  3CC2 1;  3AYW B;  1U35 D;  3CME Z;  4AYB A;  3AZE A;  1KX4 D;  2Y0S A;  3CCE Z;  3AZE C;  3AZI B;  1F66 D;  4MH4 A;  4BXX I;  5GXQ D;  5CPI A;  2NVX I;  3VH6 T;  1VQ7 1;  2OTL Z;  5CPI C;  3AV2 A;  4A3G I;  1WCM I;  4A3M I;  3AV2 C;  5BS7 A;  3UTB D;  1DL6 A;  3X1U A;  1YUA A;  5BS7 C;  1N1J A;  3X1U C;  5B1M B;  2L5A A;  5B0Y D;  2JA6 I;  1Q9C A;  5KDM A;  5DNM D;  4J8U A;  1Q82 2;  4J8U C;  2Y2J A;  2PMZ A;  4NBB A;  4A3J I;  1QVF Y;  3PO2 I;  2CV5 D;  2ZY3 A;  5AVC A;  2Y2I A;  3W96 B;  5AVC C;  3C1C B;  2ARO D;  5JRG B;  3MGQ A;  4AWL C;  3HOZ I;  4DRA A;  1P3M B;  1M1A D;  3NDJ A;  1R9T I;  2BYM B;  2W8S A;  5AVB B;  3CC4 1;  4J8V A;  4E44 A;  3TDH B;  4J8V C;  3MGS D;  3G71 Z;  1Q7Y 2;  3AZJ B;  2F8N A;  5B31 B;  3O62 B;  2YFW B;  5F99 D;  2F4M A;  4Z5T B;  3VH5 T;  2NVQ I;  3F6T A;  4XUJ B;  1TAF A;  4UUZ A;  2QR1 B;  3W98 D;  3KWQ A;  2AKL A;  5AV8 A;  4J8W B;  1HQ3 B;  4G92 C;  3REL A;  3J81 f;  5AV8 C;  3REL C;  1VQO Z;  3REI C;  1P34 D;  4RVH A;  4QLC A;  4KUD D;  3U50 C;  3JAM f;  5CPJ D;  5AV5 D;  4QLC C;  1TZY D;  3CXC Z;  3C1B B;  3KFU G;  1K73 1;  1TWH I;  5C3I C;  1VQ6 Z;  2PYO B;  3BG0 B;  3CCS Z;  3W99 B;  1JFI A;  3NH5 A;  4NBE A;  1I6H I;  5B24 D;  1VQP 1;  1Q86 2;  1N2F A;  1P3L D;  4WNN A;  3FQQ A;  5B32 C;  3B0B A;  1USP A;  2V8K A;  3LJA B;  3TE5 B;  3X1V D;  3WTP B;  2QEX 1;  3AN2 B;  1VQL Z;  5CP6 B;  2NVY I;  5AV9 D;  2PM9 A;  5B1L A;  3S1Q I;  3AZF A;  5B1L C;  4HGY A;  3RZO I;  2Y2N A;  4XZQ B;  3MGP B;  5AV6 A;  3LZ1 B;  5FUG B;  3AZF C;  4MD8 A;  5CM2 M;  3AFA B;  3AZM D;  2ZM5 A;  3AZG D;  2ZY2 A;  1U35 A;  4H9R B;  3B6G D;  1KX4 A;  2R6M A;  1P3G B;  1KX4 C;  1F66 A;  5B0Z D;  1F66 C;  5GXQ A;  4KGC C;  2HUE B;  5GXQ C;  1P9N A;  3WA9 D;  4E2W A;  4ZUX D;  2RPR A;  3KUY B;  3X1S B;  3G4S 1;  2BJO A;  5GT3 D;  5B0Y A;  4HH4 A;  5B0Y C;  1P3A D;  5DNM A;  1Y1W I;  1P3P B;  5DNM C;  3KXB B;  1NP6 A;  2CV5 A;  2JA5 I;  2Q51 A;  3B0D B;  5E5A D;  2CV5 C;  2ARO A;  4X6A I;  2ARO C;  4H9P B;  2QRE B;  1M1A A;  1RQF A;  3FQM A;  3REK D;  1M1A C;  1VQK Z;  3AV1 B;  2FJ7 C;  1H3O B;  2K5R A;  1ZLA B;  5AY8 D;  3CCJ Z;  1P3O D;  3I4N I;  3I56 1;  3NQU A;  5GT0 D;  1Q81 1;  2G5H C;  5CPK B;  2QA4 1;  3AZL A;  3MVD D;  1T3U A;  3AZL C;  1BH9 B;  5F99 A;  3KIH A;  4WU8 D;  1S32 D;  3HOY I;  5F99 C;  3IX0 A;  5B2I B;  2XD5 A;  4NFT A;  4RVF A;  2NZD A;  1VQ5 1;  1P34 A;  2NZD C;  3AYW D;  1P34 C;  1M90 1;  5AV5 A;  1TZY A;  3R45 B;  4R8P D;  5AV5 C;  1TZY C;  3REH B;  2OTJ Z;  4JJN B;  2JSS A;  5LL6 f;  3AZN D;  2HIO C;  2DQN C;  5B24 A;  5B24 C;  1P3L A;  1JJ2 Y;  1YJ9 Z;  5C44 I;  1P3L C;  5B1M D;  5T67 A;  3X1V A;  2NVT I;  4NBD A;  3X1V C;  3A6N A;  3CCQ 1;  3A6N C;  2GU2 A;  3NH4 A;  3A1I A;  3AZH A;  5AV9 A;  2Y2L A;  3V9R A;  3AZH C;  3W96 D;  1AOI B;  3C1C D;  5C3E I;  3CCV Z;  3S2H I;  1KQS Y;  3OW2 Z;  1ID3 D;  2FFF B;  3MGR A;  1QVG Y;  3AZM A;  4H9N A;  3MGR C;  1TWG I;  3AZM C;  3AZG A;  5AVB D;  3VMH A;  5C4J I;  3AZG C;  3B6F B;  3B6G A;  1YJN 1;  3CD6 Z;  3B6G C;  3W97 B;  3AZJ D;  2IZ3 A;  3LZ0 B;  4A3B I;  5B0Z A;  2RBL A;  1VQN 1;  5B0Z C;  1BH8 A;  3GCF A;  5IP7 I;  3REJ B;  3WA9 A;  1BFM A;  4ZUX A;  3EED A;  4Z5T D;  3WA9 C;  4LD9 A;  4XUJ D;  1P3I D;  4WU9 D;  4LD9 C;  2DE7 A;  5IP9 I;  4CL1 A;  5B2J B;  1S72 Z;  1N8R 2;  3UTA B;  4CAY B;  5GT3 A;  2LFU A;  2M6N A;  1VQM Z;  3S16 I;  5GT3 C;  5FLX b;  2G5I C;  3MNN D;  3AZE B;  1K9M 1;  4EO5 C;  3C1B D;  4Y7N I;  1M18 B;  5BT1 D;  5E5A A;  4HGA C;  5T64 A;  5CPI B;  2RIQ A;  3S14 I;  3W99 D;  3NQJ A;  3CPW Y;  1QVF Z;  3REK A;  2UWX A;  3X1U B;  1ULY A;  2ZY5 A;  3REK C;  1N1J B;  5AY8 A;  1KRL A;  1WW9 A;  2HU9 A;  5AY8 C;  4H9Q A;  2Y2G A;  5KDM B;  1TWC I;  3CQZ I;  3CCR 1;  5GT0 A;  1K8A 1;  2B63 I;  3VH6 W;  1RO2 A;  5GT0 C;  4NB8 A;  4BY1 I;  1W2E A;  3AN2 D;  4BBR I;  5AVC B;  3CC2 Z;  3MVD A;  1KC8 2;  4AWL B;  3MVD C;  3GTQ I;  4WU8 A;  1M19 A;  1S32 A;  4WU8 C;  1M19 C;  1S32 C;  2JMO A;  3GTO I;  4MD9 A;  3MGQ C;  3LZ1 D;  3TU4 B;  1VQ7 Z;  4J8V B;  5A2Q f;  1P3K D;  4MON A;  2F8N B;  3IF8 A;  4R8P A;  2IO5 C;  1Y1V S;  3CC7 1;  4R8P C;  1Q7Y 1;  5IT9 b;  3D9X A;  3AZN A;  3HKZ A;  3X1T D;  3AZN C;  4UUZ B;  3PO3 S;  4G92 B;  5AV8 B;  3REL B;  5GSU D;  3REI B;  2QLV B;  4WV4 B;  5B1M A;  3KWQ C;  4QLC B;  2JUB A;  3CCU 1;  1HTA A;  3EPJ A;  5C3I B;  1P3P D;  5B40 D;  3VH5 W;  4E2Z A;  3CC4 Z;  1F1E A;  2VUG A;  1VQ8 1;  3W96 A;  2Y2Q A;  2NQB D;  3MZL B;  4TNU A;  3W96 C;  1X3Z A;  1JFI B;  4X23 A;  1ID3 A;  4X23 C;  5B32 B;  1ID3 C;  1YIJ 1;  4WNN B;  1LQL A;  1P3F D;  4CSR A;  5AVB A;  1USP B;  5DNN B;  3LUS A;  4NH1 C;  1ZB8 A;  5AVB C;  5JA4 A;  3T4N B;  3VMI A;  2K3R A;  3CCS 1;  1EQZ A;  1EQZ C;  4M6B A;  2YAD A;  4NBA A;  2CWE A;  2YFW A;  5B1L B;  1WII A;  1M1K 1;  3AZF B;  1SFO I;  3S17 I;  4Z5T A;  1P3I A;  4Z5T C;  4WU9 A;  1JWH C;  2RVQ D;  2Y2P A;  3VH6 A;  4WU9 C;  1P3I C;  1Y1V I;  1VQL 1;  5AV6 C;  2OZK A;  2IZ4 A;  1K73 2;  1YI2 1;  4A93 I;  3MNN A;  1VQP Z;  1U35 C;  3MNN C;  1P3B D;  3NFZ A;  3B0C T;  3C1B A;  1F66 B;  4KGC B;  1NUI A;  1KX5 D;  4QTT A;  5GXQ B;  3C1B C;  4JJN D;  2QEX Z;  4E31 A;  1KX3 D;  5BNV B;  4KHA A;  5BO0 A;  3UTB A;  3I4M I;  5B0Y B;  3UTB C;  5B33 D;  3NDI A;  1KD1 1;  5DNM B;  4YM6 D;  3H0M C;  3NH8 A;  3AN2 A;  2CV5 B;  2KI7 B;  3I07 A;  2VUM I;  4DQY B;  2ARO B;  4MRI A;  1ZB9 A;  1AOI D;  2V8I A;  4J8X D;  4YS3 D;  1M1A B;  1I3Q I;  3WAA D;  2FJ7 B;  1X0T A;  3CCQ Z;  4NE3 A;  4Z2M H;  4H9O A;  4DGL A;  4E30 A;  1VQ4 1;  3VH5 A;  1WWS A;  3EPL A;  2GTI A;  1P3K A;  3J80 b;  2E2H I;  1NJI 1;  3NQU B;  1P3K C;  3A1K A;  3B6F D;  3MGS A;  3G4S Z;  3MGS C;  3AZL B;  2DE6 A;  3H0G I;  3AZK B;  5F99 B;  4XX2 A;  4A3F I;  2JCH A;  3GTK I;  4QTU A;  3CCJ 1;  2HUE C;  3X1T A;  4BY7 I;  1YJW 1;  3X1T C;  3WKJ D;  5GSU A;  3W98 A;  2NZD B;  3UTA D;  3FDD A;  5GSU C;  5G49 A;  1P34 B;  3W98 C;  3UT9 B;  1RNI A;  1B67 A;  3LEL D;  5AV5 B;  4KUD A;  1TZY B;  1P3P A;  3CMA 1;  5B40 A;  2DF4 C;  5CPJ A;  4KUD C;  2QRC B;  4NOZ A;  5B40 C;  5CPJ C;  1JJ2 Z;  2OOX B;  1M18 D;  3AZI D;  2NQB A;  3I56 Z;  2BYK A;  2HIO B;  2NQB C;  3VB9 A;  2QA4 Z;  4Z66 B;  1Z01 A;  1P3L B;  1RO4 A;  4RV9 A;  1Q81 2;  1P3F A;  3H0R C;  3X1V B;  1P3F C;  1KQS Z;  3A6N B;  2J8P A;  3G6E 1;  1QVG Z;  1VQ5 Z;  3AZH B;  1A7W A;  5AVC D;  3IP4 C;  3V9R B;  3Q87 A;  2WB1 A;  4RVD A;  4G91 C;  5AV9 C;  5JRG D;  4HGZ A;  1YHQ 1;  3MGR B;  1P3M D;  5D1O B;  1B6W A;  3AZM B;  4H9N B;  5BNX A;  3GTM S;  2RVQ C;  3TU4 D;  3AZG B;  3B6G B;  3EPK A;  4ZBJ C;  1P3B A;  5B0Z B;  1P3B C;  1KX5 A;  1PZR A;  5B31 D;  1BH8 B;  3O62 D;  2ZAE B;  1KX5 C;  1Z2C B;  3JAM b;  1KX3 A;  3WA9 B;  1ZH1 A;  3K7A I;  5AN9 F;  1KX3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...