3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/replication
molecule keywords Ribonuclease H2 subunit A
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
3KUYB 2R93I 4XUJD 5DNND 3C1BC 5AVBC 3S15I 3GTOI 1K732 4Z66D 3NQUA 2JA7I 1WCMI 1YIJZ 3MZKB 1YJ91 3FQQA 4X6AI 2CV5B 3REIC 5AV9D 5B24A 2PK7A 3W98D 3J81f 3OW2Z 3REID 2F8NG 2GU2A 3REIB 3WA9C 1Z01A 5FUGA 4NBGA 1P3AB 4E30A 1K731 5FLXf 3KFUG 1QYPA 1Q821 3AZMD 2PYOD 5B1LB 1TAFA 5CPKC 3ESWA 4WU8D 3M3YI 1KX4B 5A2Qb 2CV5A 5CP6A 3PO3S 3KWQA 3AZJD 5B1MB 3NH8A 5F99B 1KC81 1P3LD 2E2HI 1M19C 1P3AA 4NBDA 1M1AD 3J80b 3WA9A 1TFIA 3CPWZ 4H9NA 1P3LC 1Y1WI 4HGAB 3X1UC 3LZ0D 4J8WA 1VQLZ 5BS7A 1WJ2A 3MGSD 3X1VD 5CM2M 3OW2Y 1HQ3B 2E2II 2ZAEB 3G711 1AOIC 2V8IA 2NZDB 3AZEB 3LUSA 5D1PA 2V3VA 1VQM1 1FDOA 4Y7NI 5AY8A 3UTBD 1P3IB 3WAAA 5AV9A 3LJAC 3MGPC 3C1CB 1EQZC 1BH8B 3KIFA 3VMGA 4BBRI 5B32B 5KDMA 1W2BZ 4A3DI 1VQ4Z 5B40D 4YS3D 5GT3D 2AYDA 3MGRB 2HIOD 5B1LA 4NBAA 3J80f 3REKD 4QTTA 4EWCA 3CMA1 2ZM5A 5AV8C 4J8XA 3REKC 2FJ7C 2QRDB 3WAAD 1BFMA 1BH8A 3MNNA 5AV6B 3W99A 4DQYB 2V45A 3F3PC 5G49A 5B0YD 2PM9A 1YJ9Z 1I6HI 2LEXA 5AV5C 4E33A 3A6ND 3REHD 3B6FB 3X1VA 3X1SD 3B6GD 1S7MA 3JAMb 2VPZA 1X3WA 2NQBB 5IT9f 5AV6A 3W99B 1Y1VI 1KRLA 4J8XC 3REKA 3MNNC 1KX5C 4H9OB 1F66D 2FJ7B 2Y0SA 5AVCA 3CC7Z 5BS7C 5AV8B 3AYWD 5JRGD 4YS3A 2Y2PA 4ZUXC 1ZLAB 2Y2MA 5AV5A 1BH9B 4NE5A 3NQUB 3MGRD 3AV1B 4EO5C 1QXFA 3D6WA 4BY1I 1P3BC 3AFAB 3UT9B 1VLAA 1WW9A 3UTBA 4AYBA 3AV2A 3H3VJ 1P3OD 1M1K2 5GXQA 3F3FC 3O62C 2BYMA 5BT1D 3RELD 5C4XI 3CCS1 2W04A 2VQRA 1ZB8A 3EPLA 3LJAB 2VPYA 5B2JC 3LELD 1U35C 1TWHI 1VQMZ 4R8PA 1VQP1 4BY7I 3H0RC 5IT9b 3AZEC 3WTPB 3BG1B 3G6E1 3I4NI 5B40A 4MXUA 4E2XA 2Y2LA 3W97B 3VH6A 4NBFA 1Q862 1HQ3C 1VQ51 5DNMC 4DK1A 3CXCZ 4KGCB 3J81b 3VH6W 2JS4A 4UPKA 5F99A 1P3GA 1YIJ1 2VF1A 1R9TI 4YM6A 2IO5B 3H0LC 3CCJ1 4CAYA 5GT0A 3AZMA 3AZKD 3CC41 4CL1A 2GTHA 4Y52I 5FUGB 1ZLAA 2QRCB 3AZHD 3EPHA 3CCVZ 1N1JA 1VQ7Z 1VQ8Z 1HQ3A 3LELB 5CPKB 1RO2A 5B0YB 1RNIA 4Z2MH 3VH5W 4WZSB 4RVFA 3CCJZ 3W98C 3EERA 1U35B 3AZJA 1JFIA 3AL0C 5B0ZD 2BYMB 3WKJB 2GTIA 1KD12 5AY8C 3F6TA 5AVCC 1KX3A 2DE5A 3HOWI 3AN2B 2CV5D 3W96D 1USPA 1YUAA 3G4SZ 4BBSI 3MVDB 3S1QI 3AFAC 3UT9C 1RO0A 2CV5C 3KIHA 2YU9I 4EO5B 4R8PD 2PMZA 4H9RA 4MD8A 4RVHA 1ZLAC 4ZUXB 1VQ41 5B2IB 4CSRA 4Z5TB 2WB1A 4J8XB 1H3OA 3JAMf 2DE6A 3W99C 2IZ4A 2Q4ZA 1YJW1 4X23B 2NQBC 1Y8CA 3X1UD 2R7ZI 3CCUZ 3C1CA 4NFTA 4A3EI 1P34C 2AROA 3B6FC 5B31C 2JCHA 4H9SC 3G6EZ 2YFWA 2O4HA 5AV6C 1ID3D 4YM6C 3REKB 1P3MA 1X3ZA 2QKDA 2L5AA 3W96A 4J8UD 1SFOI 1M18A 1BH9A 1S32B 3UTAC 1K83I 5E5AC 3MVDD 3AV2B 5B31A 5BO0B 5B2IA 5AV8D 3AYWB 1WIIA 1K8A2 3RZOI 1RQFA 4CSRB 4NB9A 3AZHB 1Q16A 5AV9B 3AFAD 3UT9D 2NZDC 4J8WD 2QLVB 4G92C 1KD11 4E44A 3WTPA 3MONA 1S32A 1Z03A 2HUEC 3VMHA 1F1EA 3X1UB 3I56Z 5FLMI 1P3LB 5B1MD 3AZFC 4KGCA 1VQ9Z 5F99C 1R4VA 5B1MC 4NBCA 3TDHB 4DRAA 2E2JI 3LZ0A 2E9HA 4G91C 5CP6C 2G5IC 3B6FA 4XZQC 4R8PB 3TU4C 3UTBC 2KPIA 5B1LC 4NBBA 3CC2Z 1P3AD 3CCEZ 2RVQC 4WU9C 3AV2D 3WTPD 1P3PB 4Z66C 1P3AC 2WAQA 3CCV1 5JA4A 1VQ71 1QVFY 4J8VA 1U35A 1JJ2Y 1TWCI 3HOYI 1YJNZ 1P3PD 5GSUC 3C1BA 1Q7Y2 3EG5B 2IV2X 1S721 2JIOA 3CMEZ 3S2HI 4NB8A 5JRGB 4YS3B 1N8R1 3MVDA 3T4NB 4NBHA 1HTAA 1F66B 5B32D 1AOIA 4H9RB 4ZBJB 5E5AA 5DNNB 4JJNC 2F8NH 2RHBA 4MD7A 2JA6I 2OTJZ 3AZGA 4WU9A 5AVBB 3I07A 4A3KI 4H9PB 3AZID 3AZLD 3MGPA 3CCMZ 3G4S1 1B6WA 3CC71 5B0YA 1S72Z 3X1SC 3B6GB 5GT0C 2FFFB 1KX5A 3S17I 5JRGA 3AZJB 1JFIB 3A6NB 3REHB 2LFUA 5BNXA 3MGSB 3IF8A 5B33A 3CCRZ 1F66A 2F8NK 3S1MI 2NVYI 2W8SA 1VQ91 3B0DB 3X1SB 4J8XD 3B6GC 3CCSZ 2AROC 4KUDB 3AZFD 4JJNA 3KXBC 1ML8A 2F4MA 1P3PA 2AROD 3AZGC 3NH4A 3CC4Z 2Y2KA 3R45A 1Y1VS 5JA4B 5B32G 5T6BA 3HOUI 5GXQB 1P3GB 1FDIA 4LD9C 1P3FD 2F8NA 1ZB9A 3AZNC 3GTMS 1P3OB 5GT3B 5JRGC 3AZMB 1P3FC 1KC82 5B32A 3LJAD 3CCL1 2HIOC 1M18B 1YHQ1 5B40B 4Z66B 2Y2NA 3UTAA 3S14I 1K9M1 2JIRA 1ID3B 1YIT1 4WU9B 1P3PC 2JIPA 1VQ61 4XUJB 2H85A 2HU9A 3CD6Z 3WAAC 2J8PA 3WA9D 4J8UB 4LD9A 2K5RA 3AN2A 3AZED 1USPB 1KQSY 3PO3I 3GTQI 3KWQD 3MGQA 3X1TC 1HQ3D 4WU8C 4E2ZA 4A3II 3KWQC 5C3EI 3WTPE 3PO2I 1TAFB 4TNUA 4H9QA 1VQL1 5GT0D 2YFVB 5T64A 4YM6D 1Q861 5B2ID 3M4OI 4E45A 5B1MA 4KGCD 3K7AI 3I551 5B33C 2PYOB 3HOVI 5B24B 1B67A 5C3IC 3LZ1C 2OOYB 3GTMI 3AZHC 3X1VC 2W03A 4NFRA 2DQNC 4J8WB 5BNVB 4NBEA 4A3MI 3RELB 1X0TA 2QR1B 2K3RA 2F4OA 3AYWC 5AN9F 4UUZA 4Z66A 3UTAB 4AWLC 1KQSZ 4QTUA 4J8VB 1KX4A 2NZDA 4XUJA 3AZMC 2BG1A 5GSUA 1P3OC 2G2KA 2Y2IA 3VH5T 1QF8A 3GCFA 4LD9B 1Z02A 1L1OC 2QEXZ 3MGQB 1P3BA 5GXQD 3LZ0B 3W98A 4H9NB 2J6AA 2NQBD 5DNMD 2QREB 2QA4Z 2AROB 5B31B 3AYWA 4KUDC 1P3KB 3B0DC 2Y2HA 3U50C 1PFTA 3FDDA 1P3MC 3AZKB 2B63I 3AZEA 2QEX1 3X1TA 2ZY5A 4X23C 4QLCC 2M48A 5AV6D 1P34D 3KUYA 1JJ2Z 2JA8I 4DRBA 1I50I 1N2FA 1M901 2RIQA 3H0GI 2KI7B 3GTPI 1ZH1A 3B0BA 4KHAA 3KXBA 4JJNB 3VTNA 4ZBJC 5DNNC 5B2IC 4WJ3C 3FQMA 3R45B 5B0ZC 2F2AC 2NQBA 5IP9I 3VH5A 4YS3C 5BO0A 2VPXA 4H9PA 2E7ZA 1NJI2 2EGTA 2NAPA 3FKII 5E5AD 3MVDC 1VQKZ 5GSUB 3REJA 3AZHA 1P3FA 2F8ND 5AVCB 2RBLA 3D2LA 2M6NA 1TZYD 4A3LI 5BNXB 3MGSA 5G49B 2FJ7D 3I55Z 3RZDI 2NZDD 1YITZ 3A1KA 4NE6A 1TZYC 3W98B 2HF1A 2JR6A 3MZLB 3VMIA 5B0YC 3S16I 3AZFA 3UTBB 4R8PC 3CC21 1M1AA 5CPJA 1YUKA 2JIQA 5CP6B 1NJI1 2OTLZ 4HGYA 1KX3C 5CPKD 5B31G 3NFZA 2UWXA 1KU5A 3HKZA 2IO5C 3IR7A 2P3YA 4S1TA 3BG0B 2JA5I 4A3BI 3TE5B 1K9M2 3HOXI 3GTJI 3KXBD 4NOZA 1Q7Y1 4KHAB 1M1AB 3I561 1P3KC 2QA41 4XZQD 3TU4D 1Q822 4ZUXD 3W97C 3NDJA 3AZND 4RV9A 4G92B 5T67A 4DGLA 3WTPC 2I3CA 1YHQZ 1W2BY 3W97D 3S1RI 3IP4C 1EQZD 1QVFZ 2LIYA 3C1BD 5C4JI 1VQN1 3REJB 5B2JB 3AN2D 3W96B 1VQO1 3I4MI 3AV2C 5BNVA 3H0MC 2RPRA 3V9RA 1P3ID 4NH1C 1A7WA 1QVGZ 3LELA 1PZRA 4AWLB 2OZKA 4A93I 1WZNA 1VQ81 1VQK1 2OTJ1 1RO4A 3KSYA 3W96C 3REJC 4J8WC 1P3OA 3VH6T 4XZQA 5B24D 3TU4A 3C1CD 5LL6f 4MD9A 3LZ1B 3REIA 1KX5B 1I3QI 2Y2QA 2ZY3A 3MNNB 3CCR1 5B24C 5AV5D 5B33B 3V9RB 2PYOC 3S1NI 3EEDA 2BJOA 1TWAI 2VUMI 1M1AC 4KUDA 1ID3A 5CHLB 1EQZA 4HGZA 2OOXB 5CPKA 4RVDA 4A3JI 3AZNA 1JWHC 3KWQB 3LZ1A 2ZY4A 3X1TB 3WKJA 4X23A 1T3UA 2V8KA 4Z5TC 5GT3A 1QVGY 4E31A 1KX3B 2JSSA 2RVQD 4Z5TD 5B31D 5AV8A 3IX0A 1SIWA 4H9QB 3CD61 2V8JA 3MGPD 1DL6A 4XUJC 1TZYB 2YFVA 1ID3C 1M18D 3MGRC 5B40C 3CCLZ 1M902 3AV1D 5A2Qf 3AN2C 2HIOB 4Z2MG 1M18C 1ZLAD 2JE5A 4E32A 2VPWA 5AY8B 3AZKA 1P3FB 1H3OB 3WKJC 5BT1C 1P3IC 2NVQI 5GT3C 4JJND 5B0ZB 3UTAD 3WKJD 3KUYD 3LELC 1U35D 1TZYA 4WV4B 1P3GC 1AOIB 4MRIA 4UUZB 2YADA 4RS4A 5D1OA 1Z2CB 3X1TD 4E2YA 3REJD 2Y2OA 3AZGB 3CPWY 2R92I 3KXBB 2IZ3A 2G5HC 3A1IA 3B6FD 4HGAC 4QLCB 3D9XA 3GKQA 3P5JB 4QLCD 2YFWB 5FLXb 2PYOA 4A3GI 1Q9CA 3AZKC 1P3MB 3A6NC 3REHC 3AZJC 1M19B 2DF4C 4KGCC 1TWGI 1VQ6Z 4CAYB 2BYKA 4WNNB 5GT0B 4H9SA 3O62A 5DNMB 1TWFI 2AKLA 1WWSA 4E2WA 1YI21 1VQ5Z 3LZ1D 3RELA 1P3KA 3GTKI 1KX4C 1P3LA 3LZ0C 2LY8A 5B33D 3MGQC 1KX4D 1ULYA 1KX5D 1F66C 4NE3A 5CP6D 2XD1A 3VB9A 4J8VD 3HOZI 3WA9B 4H9OA 1AA6A 2BYKB 5DNMA 3O62B 3AZIA 3AZLA 3EPJA 4J8VC 4WU9D 1YJN1 4XX2A 1Q812 1P3BD 4MH4A 1P3BB 5D1OB 3AV1C 2Q51A 1NP6A 3O62D 3RELC 4ZUXA 3NQJA 2JUBA 5GSUD 3X1VB 1LQLA 4RVGA 1YI2Z 5C3IB 3IFUA 5IP7I 4XZQB 3TU4B 3C1BB 4QLCA 1P3IA 4J8UA 3B0CT 4G91B 4MONA 3CCU1 3KUYC 1P3GD 3NH5A 1K8A1 3GTLI 5KDMB 1P3MD 1M19A 3W99D 5B2JA 5DNNA 2Y2GA 4WNNA 1P3KD 2JIMA 3W97A 2R6MA 3AZFB 5AVBA 5AV5B 2VUGA 1Q811 5CPIA 4WU8B 1N8R2 5B1LD 2XD5A 3AFAA 3UT9A 2HUEB 3B6GA 3CCQZ 3B0CW 3A6NA 3REHA 4J8UC 2Y2JA 3CQZI 3WAAB 5AV9C 3LJAA 3AZIB 2CWEA 3AZLB 5AY8D 1RLYA 3CMAZ 3MNND 2OTL1 4BXXI 3MGQD 5CPJC 1S32D 5CPIB 2NVTI 2NVXI 2RT9A 5E5AB 3GTGI 3MGRA 4LD9D 3NQJB 5CPJD 5B32C 5CPIC 1S32C 5CPJB 2DE7A 5AVCD 3C1CC 2HIOA 3MGPB 1EQZB 2F8NB 3NDIA 5C44I 1P34A 3CXCY 5CPID 3CME1 3S2DI 3AZNB 1WWIA 3AZLC 3AZIC 2FJ7A 1KX3D 5GXQC 5B0ZA 4YM6B 1NUIA 5B2JD 3AV1A 2O53A 4KUDD 3G71Z 3Q87A 4A3CI 1M19D 3X1SA 1P9NA 4A3FI 1W2EA 3CCM1 4HH4A 3CCE1 3X1UA 2JMOA 3J7A4 4M6BA 3QWUA 2P28A 1N1JB 4WU8A 1P34B 1VQOZ 4Z5TA 3EPKA 2JNYA 3MGSC 4X23D 3AZGD 2ZY2A 1YJWZ 1VQNZ 1VQPZ 3CCQ1 1M1K1 5AVBD 1AOID 5F99D
chains in the Genus database with same CATH topology
3KUYB 2R93I 4XUJD 5DNND 3C1BC 5AVBC 3S15I 3GTOI 1K732 4Z66D 3NQUA 2JA7I 1WCMI 1YIJZ 3MZKB 1YJ91 3FQQA 4X6AI 2CV5B 3REIC 5AV9D 5B24A 2PK7A 3W98D 3J81f 3OW2Z 3REID 2F8NG 2GU2A 3REIB 3WA9C 1Z01A 5FUGA 4NBGA 1P3AB 4E30A 1K731 5FLXf 3KFUG 1QYPA 1Q821 3AZMD 2PYOD 5B1LB 1TAFA 5CPKC 3ESWA 4WU8D 3M3YI 1KX4B 5A2Qb 2CV5A 5CP6A 3PO3S 3KWQA 3AZJD 5B1MB 3NH8A 5F99B 1KC81 1P3LD 2E2HI 1M19C 1P3AA 4NBDA 1M1AD 3J80b 3WA9A 1TFIA 3CPWZ 4H9NA 1P3LC 1Y1WI 4HGAB 3X1UC 3LZ0D 4J8WA 1VQLZ 5BS7A 3MGSD 3X1VD 5CM2M 3OW2Y 1HQ3B 2E2II 2ZAEB 3G711 1AOIC 2V8IA 2NZDB 3AZEB 3LUSA 5D1PA 1VQM1 4Y7NI 5AY8A 3UTBD 1P3IB 3WAAA 5AV9A 3LJAC 3MGPC 3C1CB 1EQZC 1BH8B 3KIFA 3VMGA 4BBRI 5B32B 5KDMA 1W2BZ 4A3DI 1VQ4Z 5B40D 4YS3D 5GT3D 3MGRB 2HIOD 5B1LA 4NBAA 3J80f 3REKD 4QTTA 4EWCA 3CMA1 2ZM5A 5AV8C 4J8XA 3REKC 2FJ7C 2QRDB 3WAAD 1BFMA 1BH8A 3MNNA 5AV6B 3W99A 4DQYB 3F3PC 5G49A 5B0YD 2PM9A 1YJ9Z 1I6HI 5AV5C 4E33A 3A6ND 3REHD 3B6FB 3X1VA 3X1SD 3B6GD 1S7MA 3JAMb 1X3WA 2NQBB 5IT9f 5AV6A 3W99B 1Y1VI 1KRLA 4J8XC 3REKA 3MNNC 1KX5C 4H9OB 1F66D 2FJ7B 2Y0SA 5AVCA 3CC7Z 5BS7C 5AV8B 3AYWD 5JRGD 4YS3A 2Y2PA 4ZUXC 1ZLAB 2Y2MA 5AV5A 1BH9B 4NE5A 3NQUB 3MGRD 3AV1B 4EO5C 3D6WA 4BY1I 1P3BC 3AFAB 3UT9B 1VLAA 1WW9A 3UTBA 4AYBA 3AV2A 3H3VJ 1P3OD 1M1K2 5GXQA 3F3FC 3O62C 2BYMA 5BT1D 3RELD 5C4XI 3CCS1 2W04A 2VQRA 1ZB8A 3EPLA 3LJAB 1VQMZ 5B2JC 3LELD 1U35C 1TWHI 1VQP1 4R8PA 4BY7I 3H0RC 5IT9b 3AZEC 3WTPB 3BG1B 3G6E1 3I4NI 5B40A 4MXUA 4E2XA 2Y2LA 3W97B 3VH6A 4NBFA 1Q862 1HQ3C 1VQ51 5DNMC 4DK1A 3CXCZ 4KGCB 3J81b 3VH6W 2JS4A 4UPKA 5F99A 1P3GA 1YIJ1 2VF1A 1R9TI 4YM6A 2IO5B 3H0LC 3CCJ1 4CAYA 5GT0A 3AZMA 3AZKD 3CC41 4CL1A 2GTHA 4Y52I 5FUGB 1ZLAA 2QRCB 3AZHD 3EPHA 3CCVZ 1N1JA 1VQ7Z 1VQ8Z 1HQ3A 3LELB 5CPKB 1RO2A 5B0YB 1RNIA 4Z2MH 3VH5W 4WZSB 4RVFA 3CCJZ 3W98C 3EERA 1U35B 3AZJA 1JFIA 3AL0C 5B0ZD 2BYMB 3WKJB 2GTIA 1KD12 5AY8C 3F6TA 5AVCC 1KX3A 2DE5A 3HOWI 3AN2B 2CV5D 3W96D 1USPA 1YUAA 3G4SZ 4BBSI 3MVDB 3S1QI 3AFAC 3UT9C 1RO0A 2CV5C 3KIHA 2YU9I 4EO5B 4R8PD 2PMZA 4H9RA 4MD8A 4RVHA 1ZLAC 4ZUXB 1VQ41 5B2IB 4CSRA 4Z5TB 2WB1A 4J8XB 1H3OA 3JAMf 2DE6A 3W99C 2IZ4A 2Q4ZA 1YJW1 4X23B 2NQBC 3X1UD 2R7ZI 3CCUZ 3C1CA 4NFTA 4A3EI 1P34C 2AROA 3B6FC 5B31C 2JCHA 4H9SC 3G6EZ 2YFWA 2O4HA 5AV6C 1ID3D 4YM6C 3REKB 1P3MA 1X3ZA 2QKDA 2L5AA 3W96A 4J8UD 1SFOI 1M18A 1BH9A 1S32B 3UTAC 1K83I 5E5AC 3MVDD 3AV2B 5B31A 5BO0B 5B2IA 5AV8D 3AYWB 1WIIA 1K8A2 3RZOI 1RQFA 4CSRB 4NB9A 3AZHB 5AV9B 3AFAD 3UT9D 2NZDC 4J8WD 2QLVB 4G92C 1KD11 4E44A 3WTPA 3MONA 1S32A 1Z03A 2HUEC 3VMHA 1F1EA 3X1UB 3I56Z 5FLMI 1P3LB 5B1MD 3AZFC 4KGCA 1VQ9Z 5F99C 1R4VA 5B1MC 4NBCA 3TDHB 4DRAA 2E2JI 3LZ0A 2E9HA 4G91C 5CP6C 2G5IC 3B6FA 4XZQC 4R8PB 3TU4C 3UTBC 2KPIA 5B1LC 4NBBA 3CC2Z 1P3AD 3CCEZ 2RVQC 4WU9C 3AV2D 3WTPD 1P3PB 4Z66C 1P3AC 2WAQA 3CCV1 5JA4A 1VQ71 1QVFY 4J8VA 1U35A 1JJ2Y 1TWCI 3HOYI 1YJNZ 1P3PD 5GSUC 3C1BA 1Q7Y2 3EG5B 1S721 3S2HI 3CMEZ 4NB8A 5JRGB 4YS3B 1N8R1 3MVDA 3T4NB 4NBHA 1HTAA 1F66B 5B32D 1AOIA 4H9RB 4ZBJB 5E5AA 5DNNB 4JJNC 2F8NH 2RHBA 4MD7A 2JA6I 2OTJZ 3AZGA 4WU9A 5AVBB 3I07A 4A3KI 4H9PB 3AZID 3AZLD 3MGPA 3CCMZ 3G4S1 1B6WA 3CC71 5B0YA 1S72Z 3X1SC 3B6GB 5GT0C 2FFFB 1KX5A 3S17I 5JRGA 3AZJB 1JFIB 3A6NB 3REHB 2LFUA 5BNXA 3MGSB 3IF8A 5B33A 3CCRZ 1F66A 2F8NK 3S1MI 2NVYI 2W8SA 1VQ91 3B0DB 3X1SB 4J8XD 3B6GC 3CCSZ 2AROC 4KUDB 3AZFD 4JJNA 3KXBC 1ML8A 2F4MA 1P3PA 2AROD 3AZGC 3NH4A 3CC4Z 2Y2KA 3R45A 1Y1VS 5JA4B 5B32G 5T6BA 3HOUI 5GXQB 1P3GB 4LD9C 1P3FD 2F8NA 1ZB9A 3AZNC 3GTMS 1P3OB 5GT3B 5JRGC 3AZMB 1P3FC 1KC82 5B32A 3LJAD 3CCL1 2HIOC 1M18B 1YHQ1 5B40B 4Z66B 2Y2NA 3UTAA 3S14I 1K9M1 1ID3B 1YIT1 4WU9B 1P3PC 1VQ61 4XUJB 2H85A 2HU9A 3CD6Z 3WAAC 2J8PA 3WA9D 4J8UB 4LD9A 2K5RA 3AN2A 3AZED 1USPB 1KQSY 3PO3I 3GTQI 3KWQD 3MGQA 3X1TC 1HQ3D 4WU8C 4E2ZA 4A3II 3KWQC 5C3EI 3WTPE 3PO2I 1TAFB 4TNUA 4H9QA 1VQL1 5GT0D 2YFVB 5T64A 4YM6D 1Q861 5B2ID 3M4OI 4E45A 5B1MA 4KGCD 3K7AI 3I551 5B33C 2PYOB 3HOVI 5B24B 1B67A 5C3IC 3LZ1C 2OOYB 3GTMI 3AZHC 3X1VC 2W03A 4NFRA 2DQNC 4J8WB 5BNVB 4NBEA 4A3MI 3RELB 1X0TA 2QR1B 2K3RA 2F4OA 3AYWC 5AN9F 4UUZA 4Z66A 3UTAB 4AWLC 1KQSZ 4QTUA 4J8VB 1KX4A 2NZDA 4XUJA 3AZMC 2BG1A 5GSUA 1P3OC 2G2KA 2Y2IA 3VH5T 1QF8A 3GCFA 4LD9B 1Z02A 1L1OC 2QEXZ 3MGQB 1P3BA 5GXQD 3LZ0B 3W98A 4H9NB 2J6AA 2NQBD 5DNMD 2QREB 2QA4Z 2AROB 5B31B 3AYWA 4KUDC 1P3KB 3B0DC 2Y2HA 3U50C 1PFTA 3FDDA 1P3MC 3AZKB 2B63I 3AZEA 2QEX1 3X1TA 2ZY5A 4X23C 4QLCC 2M48A 5AV6D 1P34D 3KUYA 1JJ2Z 2JA8I 4DRBA 1I50I 1N2FA 1M901 2RIQA 3H0GI 2KI7B 3GTPI 1ZH1A 3B0BA 4KHAA 3KXBA 4JJNB 3VTNA 4ZBJC 5DNNC 5B2IC 4WJ3C 3FQMA 3R45B 5B0ZC 2F2AC 2NQBA 5IP9I 3VH5A 4YS3C 5BO0A 1NJI2 4H9PA 1VQKZ 2EGTA 3FKII 5E5AD 3MVDC 5GSUB 3REJA 3AZHA 1P3FA 2F8ND 5AVCB 2RBLA 2M6NA 1TZYD 4A3LI 5BNXB 3MGSA 5G49B 2FJ7D 3I55Z 3RZDI 2NZDD 1YITZ 3A1KA 4NE6A 1TZYC 3W98B 2HF1A 2JR6A 3MZLB 3VMIA 5B0YC 3S16I 3AZFA 3UTBB 4R8PC 3CC21 1M1AA 5CPJA 1YUKA 5CP6B 1NJI1 2OTLZ 4HGYA 1KX3C 5CPKD 5B31G 3NFZA 2UWXA 1KU5A 3HKZA 2IO5C 2P3YA 4S1TA 3BG0B 2JA5I 4A3BI 3TE5B 1K9M2 3HOXI 3GTJI 3KXBD 4NOZA 1Q7Y1 4KHAB 1M1AB 3I561 1P3KC 2QA41 4XZQD 3TU4D 1Q822 4ZUXD 3W97C 3NDJA 3AZND 4RV9A 4G92B 5T67A 4DGLA 3WTPC 2I3CA 1YHQZ 1W2BY 3W97D 3S1RI 3IP4C 1EQZD 1QVFZ 2LIYA 3C1BD 5C4JI 1VQN1 3REJB 5B2JB 3AN2D 3W96B 1VQO1 3I4MI 3AV2C 5BNVA 3H0MC 2RPRA 3V9RA 1P3ID 4NH1C 1A7WA 1QVGZ 3LELA 1PZRA 4AWLB 2OZKA 4A93I 2OTJ1 1VQ81 1VQK1 1RO4A 3KSYA 3W96C 3REJC 4J8WC 1P3OA 3VH6T 4XZQA 5B24D 3TU4A 3C1CD 5LL6f 4MD9A 3LZ1B 3REIA 1KX5B 1I3QI 2Y2QA 2ZY3A 3MNNB 3CCR1 5B24C 5AV5D 5B33B 3V9RB 2PYOC 3S1NI 3EEDA 2BJOA 1TWAI 2VUMI 1M1AC 4KUDA 1ID3A 5CHLB 1EQZA 4HGZA 2OOXB 5CPKA 4RVDA 4A3JI 3AZNA 1JWHC 3KWQB 3LZ1A 2ZY4A 3X1TB 3WKJA 4X23A 1T3UA 2V8KA 4Z5TC 5GT3A 1QVGY 4E31A 1KX3B 2JSSA 2RVQD 4Z5TD 5B31D 5AV8A 3IX0A 3CD61 4H9QB 1DL6A 2V8JA 3MGPD 4XUJC 1TZYB 2YFVA 1ID3C 1M18D 3MGRC 5B40C 3CCLZ 1M902 3AV1D 5A2Qf 3AN2C 2HIOB 4Z2MG 1M18C 1ZLAD 2JE5A 4E32A 5AY8B 3AZKA 1P3FB 1H3OB 3WKJC 5BT1C 1P3IC 2NVQI 5GT3C 4JJND 5B0ZB 3UTAD 3WKJD 3KUYD 3LELC 1U35D 1TZYA 4WV4B 1P3GC 1AOIB 4MRIA 4UUZB 2YADA 4RS4A 5D1OA 1Z2CB 3X1TD 4E2YA 3REJD 2Y2OA 3AZGB 3CPWY 2R92I 3KXBB 2IZ3A 2G5HC 3A1IA 3B6FD 4HGAC 4QLCB 3D9XA 3GKQA 3P5JB 4QLCD 2YFWB 5FLXb 2PYOA 4A3GI 1Q9CA 3AZKC 1P3MB 3A6NC 3REHC 3AZJC 1M19B 2DF4C 4KGCC 1TWGI 1VQ6Z 4CAYB 2BYKA 4WNNB 5GT0B 4H9SA 3O62A 5DNMB 1TWFI 2AKLA 1WWSA 4E2WA 1YI21 1VQ5Z 3LZ1D 3RELA 1P3KA 3GTKI 1KX4C 1P3LA 3LZ0C 2LY8A 5B33D 3MGQC 1KX4D 1ULYA 1KX5D 1F66C 4NE3A 5CP6D 2XD1A 3VB9A 4J8VD 3HOZI 3WA9B 4H9OA 2BYKB 5DNMA 3O62B 3AZIA 3AZLA 3EPJA 4J8VC 4WU9D 1YJN1 4XX2A 1Q812 1P3BD 4MH4A 1P3BB 5D1OB 3AV1C 2Q51A 1NP6A 3O62D 3RELC 4ZUXA 3NQJA 2JUBA 5GSUD 3X1VB 1LQLA 4RVGA 1YI2Z 5C3IB 3IFUA 5IP7I 4XZQB 3TU4B 3C1BB 4QLCA 1P3IA 4J8UA 3B0CT 4G91B 4MONA 3CCU1 3KUYC 1P3GD 3NH5A 1K8A1 3GTLI 5KDMB 1P3MD 1M19A 3W99D 5B2JA 5DNNA 2Y2GA 4WNNA 1P3KD 2R6MA 3W97A 3AZFB 5AVBA 5AV5B 2VUGA 1Q811 5CPIA 4WU8B 1N8R2 5B1LD 2XD5A 3AFAA 3UT9A 2HUEB 3B6GA 3CCQZ 3B0CW 3A6NA 3REHA 4J8UC 2Y2JA 3CQZI 3WAAB 5AV9C 3LJAA 3AZIB 2CWEA 3AZLB 5AY8D 1RLYA 3CMAZ 3MNND 2OTL1 4BXXI 3MGQD 5CPJC 1S32D 5CPIB 2NVTI 2NVXI 2RT9A 5E5AB 3GTGI 3MGRA 4LD9D 3NQJB 5CPJD 5B32C 5CPIC 1S32C 5CPJB 2DE7A 5AVCD 3C1CC 2HIOA 3MGPB 1EQZB 2F8NB 3NDIA 5C44I 1P34A 3CXCY 5CPID 3CME1 3S2DI 3AZNB 1WWIA 3AZLC 3AZIC 2FJ7A 1KX3D 5GXQC 5B0ZA 4YM6B 1NUIA 5B2JD 3AV1A 2O53A 4KUDD 3G71Z 3Q87A 4A3CI 1M19D 3X1SA 1P9NA 4A3FI 1W2EA 3CCM1 4HH4A 3CCE1 3X1UA 2JMOA 3J7A4 4M6BA 3QWUA 2P28A 1N1JB 4WU8A 1P34B 1VQOZ 4Z5TA 3EPKA 2JNYA 3MGSC 4X23D 3AZGD 2ZY2A 1YJWZ 1VQNZ 1VQPZ 3CCQ1 1M1K1 5AVBD 1AOID 5F99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 3KUY B;  2R93 I;  4XUJ D;  5DNN D;  3C1B C;  5AVB C;  3S15 I;  3GTO I;  1K73 2;  4Z66 D;  3NQU A;  2JA7 I;  1WCM I;  1YIJ Z;  3MZK B;  1YJ9 1;  3FQQ A;  4X6A I;  2CV5 B;  3REI C;  5AV9 D;  5B24 A;  2PK7 A;  3W98 D;  3J81 f;  3OW2 Z;  3REI D;  2F8N G;  2GU2 A;  3REI B;  3WA9 C;  1Z01 A;  5FUG A;  4NBG A;  1P3A B;  4E30 A;  1K73 1;  5FLX f;  3KFU G;  1QYP A;  1Q82 1;  3AZM D;  2PYO D;  5B1L B;  1TAF A;  5CPK C;  3ESW A;  4WU8 D;  3M3Y I;  1KX4 B;  5A2Q b;  2CV5 A;  5CP6 A;  3PO3 S;  3KWQ A;  3AZJ D;  5B1M B;  3NH8 A;  5F99 B;  1KC8 1;  1P3L D;  2E2H I;  1M19 C;  1P3A A;  4NBD A;  1M1A D;  3J80 b;  3WA9 A;  1TFI A;  3CPW Z;  4H9N A;  1P3L C;  1Y1W I;  4HGA B;  3X1U C;  3LZ0 D;  4J8W A;  1VQL Z;  5BS7 A;  1WJ2 A;  3MGS D;  3X1V D;  5CM2 M;  3OW2 Y;  1HQ3 B;  2E2I I;  2ZAE B;  3G71 1;  1AOI C;  2V8I A;  2NZD B;  3AZE B;  3LUS A;  5D1P A;  2V3V A;  1VQM 1;  1FDO A;  4Y7N I;  5AY8 A;  3UTB D;  1P3I B;  3WAA A;  5AV9 A;  3LJA C;  3MGP C;  3C1C B;  1EQZ C;  1BH8 B;  3KIF A;  3VMG A;  4BBR I;  5B32 B;  5KDM A;  1W2B Z;  4A3D I;  1VQ4 Z;  5B40 D;  4YS3 D;  5GT3 D;  2AYD A;  3MGR B;  2HIO D;  5B1L A;  4NBA A;  3J80 f;  3REK D;  4QTT A;  4EWC A;  3CMA 1;  2ZM5 A;  5AV8 C;  4J8X A;  3REK C;  2FJ7 C;  2QRD B;  3WAA D;  1BFM A;  1BH8 A;  3MNN A;  5AV6 B;  3W99 A;  4DQY B;  2V45 A;  3F3P C;  5G49 A;  5B0Y D;  2PM9 A;  1YJ9 Z;  1I6H I;  2LEX A;  5AV5 C;  4E33 A;  3A6N D;  3REH D;  3B6F B;  3X1V A;  3X1S D;  3B6G D;  1S7M A;  3JAM b;  2VPZ A;  1X3W A;  2NQB B;  5IT9 f;  5AV6 A;  3W99 B;  1Y1V I;  1KRL A;  4J8X C;  3REK A;  3MNN C;  1KX5 C;  4H9O B;  1F66 D;  2FJ7 B;  2Y0S A;  5AVC A;  3CC7 Z;  5BS7 C;  5AV8 B;  3AYW D;  5JRG D;  4YS3 A;  2Y2P A;  4ZUX C;  1ZLA B;  2Y2M A;  5AV5 A;  1BH9 B;  4NE5 A;  3NQU B;  3MGR D;  3AV1 B;  4EO5 C;  1QXF A;  3D6W A;  4BY1 I;  1P3B C;  3AFA B;  3UT9 B;  1VLA A;  1WW9 A;  3UTB A;  4AYB A;  3AV2 A;  3H3V J;  1P3O D;  1M1K 2;  5GXQ A;  3F3F C;  3O62 C;  2BYM A;  5BT1 D;  3REL D;  5C4X I;  3CCS 1;  2W04 A;  2VQR A;  1ZB8 A;  3EPL A;  3LJA B;  2VPY A;  5B2J C;  3LEL D;  1U35 C;  1TWH I;  1VQM Z;  4R8P A;  1VQP 1;  4BY7 I;  3H0R C;  5IT9 b;  3AZE C;  3WTP B;  3BG1 B;  3G6E 1;  3I4N I;  5B40 A;  4MXU A;  4E2X A;  2Y2L A;  3W97 B;  3VH6 A;  4NBF A;  1Q86 2;  1HQ3 C;  1VQ5 1;  5DNM C;  4DK1 A;  3CXC Z;  4KGC B;  3J81 b;  3VH6 W;  2JS4 A;  4UPK A;  5F99 A;  1P3G A;  1YIJ 1;  2VF1 A;  1R9T I;  4YM6 A;  2IO5 B;  3H0L C;  3CCJ 1;  4CAY A;  5GT0 A;  3AZM A;  3AZK D;  3CC4 1;  4CL1 A;  2GTH A;  4Y52 I;  5FUG B;  1ZLA A;  2QRC B;  3AZH D;  3EPH A;  3CCV Z;  1N1J A;  1VQ7 Z;  1VQ8 Z;  1HQ3 A;  3LEL B;  5CPK B;  1RO2 A;  5B0Y B;  1RNI A;  4Z2M H;  3VH5 W;  4WZS B;  4RVF A;  3CCJ Z;  3W98 C;  3EER A;  1U35 B;  3AZJ A;  1JFI A;  3AL0 C;  5B0Z D;  2BYM B;  3WKJ B;  2GTI A;  1KD1 2;  5AY8 C;  3F6T A;  5AVC C;  1KX3 A;  2DE5 A;  3HOW I;  3AN2 B;  2CV5 D;  3W96 D;  1USP A;  1YUA A;  3G4S Z;  4BBS I;  3MVD B;  3S1Q I;  3AFA C;  3UT9 C;  1RO0 A;  2CV5 C;  3KIH A;  2YU9 I;  4EO5 B;  4R8P D;  2PMZ A;  4H9R A;  4MD8 A;  4RVH A;  1ZLA C;  4ZUX B;  1VQ4 1;  5B2I B;  4CSR A;  4Z5T B;  2WB1 A;  4J8X B;  1H3O A;  3JAM f;  2DE6 A;  3W99 C;  2IZ4 A;  2Q4Z A;  1YJW 1;  4X23 B;  2NQB C;  1Y8C A;  3X1U D;  2R7Z I;  3CCU Z;  3C1C A;  4NFT A;  4A3E I;  1P34 C;  2ARO A;  3B6F C;  5B31 C;  2JCH A;  4H9S C;  3G6E Z;  2YFW A;  2O4H A;  5AV6 C;  1ID3 D;  4YM6 C;  3REK B;  1P3M A;  1X3Z A;  2QKD A;  2L5A A;  3W96 A;  4J8U D;  1SFO I;  1M18 A;  1BH9 A;  1S32 B;  3UTA C;  1K83 I;  5E5A C;  3MVD D;  3AV2 B;  5B31 A;  5BO0 B;  5B2I A;  5AV8 D;  3AYW B;  1WII A;  1K8A 2;  3RZO I;  1RQF A;  4CSR B;  4NB9 A;  3AZH B;  1Q16 A;  5AV9 B;  3AFA D;  3UT9 D;  2NZD C;  4J8W D;  2QLV B;  4G92 C;  1KD1 1;  4E44 A;  3WTP A;  3MON A;  1S32 A;  1Z03 A;  2HUE C;  3VMH A;  1F1E A;  3X1U B;  3I56 Z;  5FLM I;  1P3L B;  5B1M D;  3AZF C;  4KGC A;  1VQ9 Z;  5F99 C;  1R4V A;  5B1M C;  4NBC A;  3TDH B;  4DRA A;  2E2J I;  3LZ0 A;  2E9H A;  4G91 C;  5CP6 C;  2G5I C;  3B6F A;  4XZQ C;  4R8P B;  3TU4 C;  3UTB C;  2KPI A;  5B1L C;  4NBB A;  3CC2 Z;  1P3A D;  3CCE Z;  2RVQ C;  4WU9 C;  3AV2 D;  3WTP D;  1P3P B;  4Z66 C;  1P3A C;  2WAQ A;  3CCV 1;  5JA4 A;  1VQ7 1;  1QVF Y;  4J8V A;  1U35 A;  1JJ2 Y;  1TWC I;  3HOY I;  1YJN Z;  1P3P D;  5GSU C;  3C1B A;  1Q7Y 2;  3EG5 B;  2IV2 X;  1S72 1;  2JIO A;  3CME Z;  3S2H I;  4NB8 A;  5JRG B;  4YS3 B;  1N8R 1;  3MVD A;  3T4N B;  4NBH A;  1HTA A;  1F66 B;  5B32 D;  1AOI A;  4H9R B;  4ZBJ B;  5E5A A;  5DNN B;  4JJN C;  2F8N H;  2RHB A;  4MD7 A;  2JA6 I;  2OTJ Z;  3AZG A;  4WU9 A;  5AVB B;  3I07 A;  4A3K I;  4H9P B;  3AZI D;  3AZL D;  3MGP A;  3CCM Z;  3G4S 1;  1B6W A;  3CC7 1;  5B0Y A;  1S72 Z;  3X1S C;  3B6G B;  5GT0 C;  2FFF B;  1KX5 A;  3S17 I;  5JRG A;  3AZJ B;  1JFI B;  3A6N B;  3REH B;  2LFU A;  5BNX A;  3MGS B;  3IF8 A;  5B33 A;  3CCR Z;  1F66 A;  2F8N K;  3S1M I;  2NVY I;  2W8S A;  1VQ9 1;  3B0D B;  3X1S B;  4J8X D;  3B6G C;  3CCS Z;  2ARO C;  4KUD B;  3AZF D;  4JJN A;  3KXB C;  1ML8 A;  2F4M A;  1P3P A;  2ARO D;  3AZG C;  3NH4 A;  3CC4 Z;  2Y2K A;  3R45 A;  1Y1V S;  5JA4 B;  5B32 G;  5T6B A;  3HOU I;  5GXQ B;  1P3G B;  1FDI A;  4LD9 C;  1P3F D;  2F8N A;  1ZB9 A;  3AZN C;  3GTM S;  1P3O B;  5GT3 B;  5JRG C;  3AZM B;  1P3F C;  1KC8 2;  5B32 A;  3LJA D;  3CCL 1;  2HIO C;  1M18 B;  1YHQ 1;  5B40 B;  4Z66 B;  2Y2N A;  3UTA A;  3S14 I;  1K9M 1;  2JIR A;  1ID3 B;  1YIT 1;  4WU9 B;  1P3P C;  2JIP A;  1VQ6 1;  4XUJ B;  2H85 A;  2HU9 A;  3CD6 Z;  3WAA C;  2J8P A;  3WA9 D;  4J8U B;  4LD9 A;  2K5R A;  3AN2 A;  3AZE D;  1USP B;  1KQS Y;  3PO3 I;  3GTQ I;  3KWQ D;  3MGQ A;  3X1T C;  1HQ3 D;  4WU8 C;  4E2Z A;  4A3I I;  3KWQ C;  5C3E I;  3WTP E;  3PO2 I;  1TAF B;  4TNU A;  4H9Q A;  1VQL 1;  5GT0 D;  2YFV B;  5T64 A;  4YM6 D;  1Q86 1;  5B2I D;  3M4O I;  4E45 A;  5B1M A;  4KGC D;  3K7A I;  3I55 1;  5B33 C;  2PYO B;  3HOV I;  5B24 B;  1B67 A;  5C3I C;  3LZ1 C;  2OOY B;  3GTM I;  3AZH C;  3X1V C;  2W03 A;  4NFR A;  2DQN C;  4J8W B;  5BNV B;  4NBE A;  4A3M I;  3REL B;  1X0T A;  2QR1 B;  2K3R A;  2F4O A;  3AYW C;  5AN9 F;  4UUZ A;  4Z66 A;  3UTA B;  4AWL C;  1KQS Z;  4QTU A;  4J8V B;  1KX4 A;  2NZD A;  4XUJ A;  3AZM C;  2BG1 A;  5GSU A;  1P3O C;  2G2K A;  2Y2I A;  3VH5 T;  1QF8 A;  3GCF A;  4LD9 B;  1Z02 A;  1L1O C;  2QEX Z;  3MGQ B;  1P3B A;  5GXQ D;  3LZ0 B;  3W98 A;  4H9N B;  2J6A A;  2NQB D;  5DNM D;  2QRE B;  2QA4 Z;  2ARO B;  5B31 B;  3AYW A;  4KUD C;  1P3K B;  3B0D C;  2Y2H A;  3U50 C;  1PFT A;  3FDD A;  1P3M C;  3AZK B;  2B63 I;  3AZE A;  2QEX 1;  3X1T A;  2ZY5 A;  4X23 C;  4QLC C;  2M48 A;  5AV6 D;  1P34 D;  3KUY A;  1JJ2 Z;  2JA8 I;  4DRB A;  1I50 I;  1N2F A;  1M90 1;  2RIQ A;  3H0G I;  2KI7 B;  3GTP I;  1ZH1 A;  3B0B A;  4KHA A;  3KXB A;  4JJN B;  3VTN A;  4ZBJ C;  5DNN C;  5B2I C;  4WJ3 C;  3FQM A;  3R45 B;  5B0Z C;  2F2A C;  2NQB A;  5IP9 I;  3VH5 A;  4YS3 C;  5BO0 A;  2VPX A;  4H9P A;  2E7Z A;  1NJI 2;  2EGT A;  2NAP A;  3FKI I;  5E5A D;  3MVD C;  1VQK Z;  5GSU B;  3REJ A;  3AZH A;  1P3F A;  2F8N D;  5AVC B;  2RBL A;  3D2L A;  2M6N A;  1TZY D;  4A3L I;  5BNX B;  3MGS A;  5G49 B;  2FJ7 D;  3I55 Z;  3RZD I;  2NZD D;  1YIT Z;  3A1K A;  4NE6 A;  1TZY C;  3W98 B;  2HF1 A;  2JR6 A;  3MZL B;  3VMI A;  5B0Y C;  3S16 I;  3AZF A;  3UTB B;  4R8P C;  3CC2 1;  1M1A A;  5CPJ A;  1YUK A;  2JIQ A;  5CP6 B;  1NJI 1;  2OTL Z;  4HGY A;  1KX3 C;  5CPK D;  5B31 G;  3NFZ A;  2UWX A;  1KU5 A;  3HKZ A;  2IO5 C;  3IR7 A;  2P3Y A;  4S1T A;  3BG0 B;  2JA5 I;  4A3B I;  3TE5 B;  1K9M 2;  3HOX I;  3GTJ I;  3KXB D;  4NOZ A;  1Q7Y 1;  4KHA B;  1M1A B;  3I56 1;  1P3K C;  2QA4 1;  4XZQ D;  3TU4 D;  1Q82 2;  4ZUX D;  3W97 C;  3NDJ A;  3AZN D;  4RV9 A;  4G92 B;  5T67 A;  4DGL A;  3WTP C;  2I3C A;  1YHQ Z;  1W2B Y;  3W97 D;  3S1R I;  3IP4 C;  1EQZ D;  1QVF Z;  2LIY A;  3C1B D;  5C4J I;  1VQN 1;  3REJ B;  5B2J B;  3AN2 D;  3W96 B;  1VQO 1;  3I4M I;  3AV2 C;  5BNV A;  3H0M C;  2RPR A;  3V9R A;  1P3I D;  4NH1 C;  1A7W A;  1QVG Z;  3LEL A;  1PZR A;  4AWL B;  2OZK A;  4A93 I;  1WZN A;  1VQ8 1;  1VQK 1;  2OTJ 1;  1RO4 A;  3KSY A;  3W96 C;  3REJ C;  4J8W C;  1P3O A;  3VH6 T;  4XZQ A;  5B24 D;  3TU4 A;  3C1C D;  5LL6 f;  4MD9 A;  3LZ1 B;  3REI A;  1KX5 B;  1I3Q I;  2Y2Q A;  2ZY3 A;  3MNN B;  3CCR 1;  5B24 C;  5AV5 D;  5B33 B;  3V9R B;  2PYO C;  3S1N I;  3EED A;  2BJO A;  1TWA I;  2VUM I;  1M1A C;  4KUD A;  1ID3 A;  5CHL B;  1EQZ A;  4HGZ A;  2OOX B;  5CPK A;  4RVD A;  4A3J I;  3AZN A;  1JWH C;  3KWQ B;  3LZ1 A;  2ZY4 A;  3X1T B;  3WKJ A;  4X23 A;  1T3U A;  2V8K A;  4Z5T C;  5GT3 A;  1QVG Y;  4E31 A;  1KX3 B;  2JSS A;  2RVQ D;  4Z5T D;  5B31 D;  5AV8 A;  3IX0 A;  1SIW A;  4H9Q B;  3CD6 1;  2V8J A;  3MGP D;  1DL6 A;  4XUJ C;  1TZY B;  2YFV A;  1ID3 C;  1M18 D;  3MGR C;  5B40 C;  3CCL Z;  1M90 2;  3AV1 D;  5A2Q f;  3AN2 C;  2HIO B;  4Z2M G;  1M18 C;  1ZLA D;  2JE5 A;  4E32 A;  2VPW A;  5AY8 B;  3AZK A;  1P3F B;  1H3O B;  3WKJ C;  5BT1 C;  1P3I C;  2NVQ I;  5GT3 C;  4JJN D;  5B0Z B;  3UTA D;  3WKJ D;  3KUY D;  3LEL C;  1U35 D;  1TZY A;  4WV4 B;  1P3G C;  1AOI B;  4MRI A;  4UUZ B;  2YAD A;  4RS4 A;  5D1O A;  1Z2C B;  3X1T D;  4E2Y A;  3REJ D;  2Y2O A;  3AZG B;  3CPW Y;  2R92 I;  3KXB B;  2IZ3 A;  2G5H C;  3A1I A;  3B6F D;  4HGA C;  4QLC B;  3D9X A;  3GKQ A;  3P5J B;  4QLC D;  2YFW B;  5FLX b;  2PYO A;  4A3G I;  1Q9C A;  3AZK C;  1P3M B;  3A6N C;  3REH C;  3AZJ C;  1M19 B;  2DF4 C;  4KGC C;  1TWG I;  1VQ6 Z;  4CAY B;  2BYK A;  4WNN B;  5GT0 B;  4H9S A;  3O62 A;  5DNM B;  1TWF I;  2AKL A;  1WWS A;  4E2W A;  1YI2 1;  1VQ5 Z;  3LZ1 D;  3REL A;  1P3K A;  3GTK I;  1KX4 C;  1P3L A;  3LZ0 C;  2LY8 A;  5B33 D;  3MGQ C;  1KX4 D;  1ULY A;  1KX5 D;  1F66 C;  4NE3 A;  5CP6 D;  2XD1 A;  3VB9 A;  4J8V D;  3HOZ I;  3WA9 B;  4H9O A;  1AA6 A;  2BYK B;  5DNM A;  3O62 B;  3AZI A;  3AZL A;  3EPJ A;  4J8V C;  4WU9 D;  1YJN 1;  4XX2 A;  1Q81 2;  1P3B D;  4MH4 A;  1P3B B;  5D1O B;  3AV1 C;  2Q51 A;  1NP6 A;  3O62 D;  3REL C;  4ZUX A;  3NQJ A;  2JUB A;  5GSU D;  3X1V B;  1LQL A;  4RVG A;  1YI2 Z;  5C3I B;  3IFU A;  5IP7 I;  4XZQ B;  3TU4 B;  3C1B B;  4QLC A;  1P3I A;  4J8U A;  3B0C T;  4G91 B;  4MON A;  3CCU 1;  3KUY C;  1P3G D;  3NH5 A;  1K8A 1;  3GTL I;  5KDM B;  1P3M D;  1M19 A;  3W99 D;  5B2J A;  5DNN A;  2Y2G A;  4WNN A;  1P3K D;  2JIM A;  3W97 A;  2R6M A;  3AZF B;  5AVB A;  5AV5 B;  2VUG A;  1Q81 1;  5CPI A;  4WU8 B;  1N8R 2;  5B1L D;  2XD5 A;  3AFA A;  3UT9 A;  2HUE B;  3B6G A;  3CCQ Z;  3B0C W;  3A6N A;  3REH A;  4J8U C;  2Y2J A;  3CQZ I;  3WAA B;  5AV9 C;  3LJA A;  3AZI B;  2CWE A;  3AZL B;  5AY8 D;  1RLY A;  3CMA Z;  3MNN D;  2OTL 1;  4BXX I;  3MGQ D;  5CPJ C;  1S32 D;  5CPI B;  2NVT I;  2NVX I;  2RT9 A;  5E5A B;  3GTG I;  3MGR A;  4LD9 D;  3NQJ B;  5CPJ D;  5B32 C;  5CPI C;  1S32 C;  5CPJ B;  2DE7 A;  5AVC D;  3C1C C;  2HIO A;  3MGP B;  1EQZ B;  2F8N B;  3NDI A;  5C44 I;  1P34 A;  3CXC Y;  5CPI D;  3CME 1;  3S2D I;  3AZN B;  1WWI A;  3AZL C;  3AZI C;  2FJ7 A;  1KX3 D;  5GXQ C;  5B0Z A;  4YM6 B;  1NUI A;  5B2J D;  3AV1 A;  2O53 A;  4KUD D;  3G71 Z;  3Q87 A;  4A3C I;  1M19 D;  3X1S A;  1P9N A;  4A3F I;  1W2E A;  3CCM 1;  4HH4 A;  3CCE 1;  3X1U A;  2JMO A;  3J7A 4;  4M6B A;  3QWU A;  2P28 A;  1N1J B;  4WU8 A;  1P34 B;  1VQO Z;  4Z5T A;  3EPK A;  2JNY A;  3MGS C;  4X23 D;  3AZG D;  2ZY2 A;  1YJW Z;  1VQN Z;  1VQP Z;  3CCQ 1;  1M1K 1;  5AVB D;  1AOI D;  5F99 D; 
#chains in the Genus database with same CATH homology
 3KUY B;  2R93 I;  4XUJ D;  5DNN D;  3C1B C;  5AVB C;  3S15 I;  3GTO I;  1K73 2;  4Z66 D;  3NQU A;  2JA7 I;  1WCM I;  1YIJ Z;  3MZK B;  1YJ9 1;  3FQQ A;  4X6A I;  2CV5 B;  3REI C;  5AV9 D;  5B24 A;  2PK7 A;  3W98 D;  3J81 f;  3OW2 Z;  3REI D;  2F8N G;  2GU2 A;  3REI B;  3WA9 C;  1Z01 A;  5FUG A;  4NBG A;  1P3A B;  4E30 A;  1K73 1;  5FLX f;  3KFU G;  1QYP A;  1Q82 1;  3AZM D;  2PYO D;  5B1L B;  1TAF A;  5CPK C;  3ESW A;  4WU8 D;  3M3Y I;  1KX4 B;  5A2Q b;  2CV5 A;  5CP6 A;  3PO3 S;  3KWQ A;  3AZJ D;  5B1M B;  3NH8 A;  5F99 B;  1KC8 1;  1P3L D;  2E2H I;  1M19 C;  1P3A A;  4NBD A;  1M1A D;  3J80 b;  3WA9 A;  1TFI A;  3CPW Z;  4H9N A;  1P3L C;  1Y1W I;  4HGA B;  3X1U C;  3LZ0 D;  4J8W A;  1VQL Z;  5BS7 A;  3MGS D;  3X1V D;  5CM2 M;  3OW2 Y;  1HQ3 B;  2E2I I;  2ZAE B;  3G71 1;  1AOI C;  2V8I A;  2NZD B;  3AZE B;  3LUS A;  5D1P A;  1VQM 1;  4Y7N I;  5AY8 A;  3UTB D;  1P3I B;  3WAA A;  5AV9 A;  3LJA C;  3MGP C;  3C1C B;  1EQZ C;  1BH8 B;  3KIF A;  3VMG A;  4BBR I;  5B32 B;  5KDM A;  1W2B Z;  4A3D I;  1VQ4 Z;  5B40 D;  4YS3 D;  5GT3 D;  3MGR B;  2HIO D;  5B1L A;  4NBA A;  3J80 f;  3REK D;  4QTT A;  4EWC A;  3CMA 1;  2ZM5 A;  5AV8 C;  4J8X A;  3REK C;  2FJ7 C;  2QRD B;  3WAA D;  1BFM A;  1BH8 A;  3MNN A;  5AV6 B;  3W99 A;  4DQY B;  3F3P C;  5G49 A;  5B0Y D;  2PM9 A;  1YJ9 Z;  1I6H I;  5AV5 C;  4E33 A;  3A6N D;  3REH D;  3B6F B;  3X1V A;  3X1S D;  3B6G D;  1S7M A;  3JAM b;  1X3W A;  2NQB B;  5IT9 f;  5AV6 A;  3W99 B;  1Y1V I;  1KRL A;  4J8X C;  3REK A;  3MNN C;  1KX5 C;  4H9O B;  1F66 D;  2FJ7 B;  2Y0S A;  5AVC A;  3CC7 Z;  5BS7 C;  5AV8 B;  3AYW D;  5JRG D;  4YS3 A;  2Y2P A;  4ZUX C;  1ZLA B;  2Y2M A;  5AV5 A;  1BH9 B;  4NE5 A;  3NQU B;  3MGR D;  3AV1 B;  4EO5 C;  3D6W A;  4BY1 I;  1P3B C;  3AFA B;  3UT9 B;  1VLA A;  1WW9 A;  3UTB A;  4AYB A;  3AV2 A;  3H3V J;  1P3O D;  1M1K 2;  5GXQ A;  3F3F C;  3O62 C;  2BYM A;  5BT1 D;  3REL D;  5C4X I;  3CCS 1;  2W04 A;  2VQR A;  1ZB8 A;  3EPL A;  3LJA B;  1VQM Z;  5B2J C;  3LEL D;  1U35 C;  1TWH I;  1VQP 1;  4R8P A;  4BY7 I;  3H0R C;  5IT9 b;  3AZE C;  3WTP B;  3BG1 B;  3G6E 1;  3I4N I;  5B40 A;  4MXU A;  4E2X A;  2Y2L A;  3W97 B;  3VH6 A;  4NBF A;  1Q86 2;  1HQ3 C;  1VQ5 1;  5DNM C;  4DK1 A;  3CXC Z;  4KGC B;  3J81 b;  3VH6 W;  2JS4 A;  4UPK A;  5F99 A;  1P3G A;  1YIJ 1;  2VF1 A;  1R9T I;  4YM6 A;  2IO5 B;  3H0L C;  3CCJ 1;  4CAY A;  5GT0 A;  3AZM A;  3AZK D;  3CC4 1;  4CL1 A;  2GTH A;  4Y52 I;  5FUG B;  1ZLA A;  2QRC B;  3AZH D;  3EPH A;  3CCV Z;  1N1J A;  1VQ7 Z;  1VQ8 Z;  1HQ3 A;  3LEL B;  5CPK B;  1RO2 A;  5B0Y B;  1RNI A;  4Z2M H;  3VH5 W;  4WZS B;  4RVF A;  3CCJ Z;  3W98 C;  3EER A;  1U35 B;  3AZJ A;  1JFI A;  3AL0 C;  5B0Z D;  2BYM B;  3WKJ B;  2GTI A;  1KD1 2;  5AY8 C;  3F6T A;  5AVC C;  1KX3 A;  2DE5 A;  3HOW I;  3AN2 B;  2CV5 D;  3W96 D;  1USP A;  1YUA A;  3G4S Z;  4BBS I;  3MVD B;  3S1Q I;  3AFA C;  3UT9 C;  1RO0 A;  2CV5 C;  3KIH A;  2YU9 I;  4EO5 B;  4R8P D;  2PMZ A;  4H9R A;  4MD8 A;  4RVH A;  1ZLA C;  4ZUX B;  1VQ4 1;  5B2I B;  4CSR A;  4Z5T B;  2WB1 A;  4J8X B;  1H3O A;  3JAM f;  2DE6 A;  3W99 C;  2IZ4 A;  2Q4Z A;  1YJW 1;  4X23 B;  2NQB C;  3X1U D;  2R7Z I;  3CCU Z;  3C1C A;  4NFT A;  4A3E I;  1P34 C;  2ARO A;  3B6F C;  5B31 C;  2JCH A;  4H9S C;  3G6E Z;  2YFW A;  2O4H A;  5AV6 C;  1ID3 D;  4YM6 C;  3REK B;  1P3M A;  1X3Z A;  2QKD A;  2L5A A;  3W96 A;  4J8U D;  1SFO I;  1M18 A;  1BH9 A;  1S32 B;  3UTA C;  1K83 I;  5E5A C;  3MVD D;  3AV2 B;  5B31 A;  5BO0 B;  5B2I A;  5AV8 D;  3AYW B;  1WII A;  1K8A 2;  3RZO I;  1RQF A;  4CSR B;  4NB9 A;  3AZH B;  5AV9 B;  3AFA D;  3UT9 D;  2NZD C;  4J8W D;  2QLV B;  4G92 C;  1KD1 1;  4E44 A;  3WTP A;  3MON A;  1S32 A;  1Z03 A;  2HUE C;  3VMH A;  1F1E A;  3X1U B;  3I56 Z;  5FLM I;  1P3L B;  5B1M D;  3AZF C;  4KGC A;  1VQ9 Z;  5F99 C;  1R4V A;  5B1M C;  4NBC A;  3TDH B;  4DRA A;  2E2J I;  3LZ0 A;  2E9H A;  4G91 C;  5CP6 C;  2G5I C;  3B6F A;  4XZQ C;  4R8P B;  3TU4 C;  3UTB C;  2KPI A;  5B1L C;  4NBB A;  3CC2 Z;  1P3A D;  3CCE Z;  2RVQ C;  4WU9 C;  3AV2 D;  3WTP D;  1P3P B;  4Z66 C;  1P3A C;  2WAQ A;  3CCV 1;  5JA4 A;  1VQ7 1;  1QVF Y;  4J8V A;  1U35 A;  1JJ2 Y;  1TWC I;  3HOY I;  1YJN Z;  1P3P D;  5GSU C;  3C1B A;  1Q7Y 2;  3EG5 B;  1S72 1;  3S2H I;  3CME Z;  4NB8 A;  5JRG B;  4YS3 B;  1N8R 1;  3MVD A;  3T4N B;  4NBH A;  1HTA A;  1F66 B;  5B32 D;  1AOI A;  4H9R B;  4ZBJ B;  5E5A A;  5DNN B;  4JJN C;  2F8N H;  2RHB A;  4MD7 A;  2JA6 I;  2OTJ Z;  3AZG A;  4WU9 A;  5AVB B;  3I07 A;  4A3K I;  4H9P B;  3AZI D;  3AZL D;  3MGP A;  3CCM Z;  3G4S 1;  1B6W A;  3CC7 1;  5B0Y A;  1S72 Z;  3X1S C;  3B6G B;  5GT0 C;  2FFF B;  1KX5 A;  3S17 I;  5JRG A;  3AZJ B;  1JFI B;  3A6N B;  3REH B;  2LFU A;  5BNX A;  3MGS B;  3IF8 A;  5B33 A;  3CCR Z;  1F66 A;  2F8N K;  3S1M I;  2NVY I;  2W8S A;  1VQ9 1;  3B0D B;  3X1S B;  4J8X D;  3B6G C;  3CCS Z;  2ARO C;  4KUD B;  3AZF D;  4JJN A;  3KXB C;  1ML8 A;  2F4M A;  1P3P A;  2ARO D;  3AZG C;  3NH4 A;  3CC4 Z;  2Y2K A;  3R45 A;  1Y1V S;  5JA4 B;  5B32 G;  5T6B A;  3HOU I;  5GXQ B;  1P3G B;  4LD9 C;  1P3F D;  2F8N A;  1ZB9 A;  3AZN C;  3GTM S;  1P3O B;  5GT3 B;  5JRG C;  3AZM B;  1P3F C;  1KC8 2;  5B32 A;  3LJA D;  3CCL 1;  2HIO C;  1M18 B;  1YHQ 1;  5B40 B;  4Z66 B;  2Y2N A;  3UTA A;  3S14 I;  1K9M 1;  1ID3 B;  1YIT 1;  4WU9 B;  1P3P C;  1VQ6 1;  4XUJ B;  2H85 A;  2HU9 A;  3CD6 Z;  3WAA C;  2J8P A;  3WA9 D;  4J8U B;  4LD9 A;  2K5R A;  3AN2 A;  3AZE D;  1USP B;  1KQS Y;  3PO3 I;  3GTQ I;  3KWQ D;  3MGQ A;  3X1T C;  1HQ3 D;  4WU8 C;  4E2Z A;  4A3I I;  3KWQ C;  5C3E I;  3WTP E;  3PO2 I;  1TAF B;  4TNU A;  4H9Q A;  1VQL 1;  5GT0 D;  2YFV B;  5T64 A;  4YM6 D;  1Q86 1;  5B2I D;  3M4O I;  4E45 A;  5B1M A;  4KGC D;  3K7A I;  3I55 1;  5B33 C;  2PYO B;  3HOV I;  5B24 B;  1B67 A;  5C3I C;  3LZ1 C;  2OOY B;  3GTM I;  3AZH C;  3X1V C;  2W03 A;  4NFR A;  2DQN C;  4J8W B;  5BNV B;  4NBE A;  4A3M I;  3REL B;  1X0T A;  2QR1 B;  2K3R A;  2F4O A;  3AYW C;  5AN9 F;  4UUZ A;  4Z66 A;  3UTA B;  4AWL C;  1KQS Z;  4QTU A;  4J8V B;  1KX4 A;  2NZD A;  4XUJ A;  3AZM C;  2BG1 A;  5GSU A;  1P3O C;  2G2K A;  2Y2I A;  3VH5 T;  1QF8 A;  3GCF A;  4LD9 B;  1Z02 A;  1L1O C;  2QEX Z;  3MGQ B;  1P3B A;  5GXQ D;  3LZ0 B;  3W98 A;  4H9N B;  2J6A A;  2NQB D;  5DNM D;  2QRE B;  2QA4 Z;  2ARO B;  5B31 B;  3AYW A;  4KUD C;  1P3K B;  3B0D C;  2Y2H A;  3U50 C;  1PFT A;  3FDD A;  1P3M C;  3AZK B;  2B63 I;  3AZE A;  2QEX 1;  3X1T A;  2ZY5 A;  4X23 C;  4QLC C;  2M48 A;  5AV6 D;  1P34 D;  3KUY A;  1JJ2 Z;  2JA8 I;  4DRB A;  1I50 I;  1N2F A;  1M90 1;  2RIQ A;  3H0G I;  2KI7 B;  3GTP I;  1ZH1 A;  3B0B A;  4KHA A;  3KXB A;  4JJN B;  3VTN A;  4ZBJ C;  5DNN C;  5B2I C;  4WJ3 C;  3FQM A;  3R45 B;  5B0Z C;  2F2A C;  2NQB A;  5IP9 I;  3VH5 A;  4YS3 C;  5BO0 A;  1NJI 2;  4H9P A;  1VQK Z;  2EGT A;  3FKI I;  5E5A D;  3MVD C;  5GSU B;  3REJ A;  3AZH A;  1P3F A;  2F8N D;  5AVC B;  2RBL A;  2M6N A;  1TZY D;  4A3L I;  5BNX B;  3MGS A;  5G49 B;  2FJ7 D;  3I55 Z;  3RZD I;  2NZD D;  1YIT Z;  3A1K A;  4NE6 A;  1TZY C;  3W98 B;  2HF1 A;  2JR6 A;  3MZL B;  3VMI A;  5B0Y C;  3S16 I;  3AZF A;  3UTB B;  4R8P C;  3CC2 1;  1M1A A;  5CPJ A;  1YUK A;  5CP6 B;  1NJI 1;  2OTL Z;  4HGY A;  1KX3 C;  5CPK D;  5B31 G;  3NFZ A;  2UWX A;  1KU5 A;  3HKZ A;  2IO5 C;  2P3Y A;  4S1T A;  3BG0 B;  2JA5 I;  4A3B I;  3TE5 B;  1K9M 2;  3HOX I;  3GTJ I;  3KXB D;  4NOZ A;  1Q7Y 1;  4KHA B;  1M1A B;  3I56 1;  1P3K C;  2QA4 1;  4XZQ D;  3TU4 D;  1Q82 2;  4ZUX D;  3W97 C;  3NDJ A;  3AZN D;  4RV9 A;  4G92 B;  5T67 A;  4DGL A;  3WTP C;  2I3C A;  1YHQ Z;  1W2B Y;  3W97 D;  3S1R I;  3IP4 C;  1EQZ D;  1QVF Z;  2LIY A;  3C1B D;  5C4J I;  1VQN 1;  3REJ B;  5B2J B;  3AN2 D;  3W96 B;  1VQO 1;  3I4M I;  3AV2 C;  5BNV A;  3H0M C;  2RPR A;  3V9R A;  1P3I D;  4NH1 C;  1A7W A;  1QVG Z;  3LEL A;  1PZR A;  4AWL B;  2OZK A;  4A93 I;  2OTJ 1;  1VQ8 1;  1VQK 1;  1RO4 A;  3KSY A;  3W96 C;  3REJ C;  4J8W C;  1P3O A;  3VH6 T;  4XZQ A;  5B24 D;  3TU4 A;  3C1C D;  5LL6 f;  4MD9 A;  3LZ1 B;  3REI A;  1KX5 B;  1I3Q I;  2Y2Q A;  2ZY3 A;  3MNN B;  3CCR 1;  5B24 C;  5AV5 D;  5B33 B;  3V9R B;  2PYO C;  3S1N I;  3EED A;  2BJO A;  1TWA I;  2VUM I;  1M1A C;  4KUD A;  1ID3 A;  5CHL B;  1EQZ A;  4HGZ A;  2OOX B;  5CPK A;  4RVD A;  4A3J I;  3AZN A;  1JWH C;  3KWQ B;  3LZ1 A;  2ZY4 A;  3X1T B;  3WKJ A;  4X23 A;  1T3U A;  2V8K A;  4Z5T C;  5GT3 A;  1QVG Y;  4E31 A;  1KX3 B;  2JSS A;  2RVQ D;  4Z5T D;  5B31 D;  5AV8 A;  3IX0 A;  3CD6 1;  4H9Q B;  1DL6 A;  2V8J A;  3MGP D;  4XUJ C;  1TZY B;  2YFV A;  1ID3 C;  1M18 D;  3MGR C;  5B40 C;  3CCL Z;  1M90 2;  3AV1 D;  5A2Q f;  3AN2 C;  2HIO B;  4Z2M G;  1M18 C;  1ZLA D;  2JE5 A;  4E32 A;  5AY8 B;  3AZK A;  1P3F B;  1H3O B;  3WKJ C;  5BT1 C;  1P3I C;  2NVQ I;  5GT3 C;  4JJN D;  5B0Z B;  3UTA D;  3WKJ D;  3KUY D;  3LEL C;  1U35 D;  1TZY A;  4WV4 B;  1P3G C;  1AOI B;  4MRI A;  4UUZ B;  2YAD A;  4RS4 A;  5D1O A;  1Z2C B;  3X1T D;  4E2Y A;  3REJ D;  2Y2O A;  3AZG B;  3CPW Y;  2R92 I;  3KXB B;  2IZ3 A;  2G5H C;  3A1I A;  3B6F D;  4HGA C;  4QLC B;  3D9X A;  3GKQ A;  3P5J B;  4QLC D;  2YFW B;  5FLX b;  2PYO A;  4A3G I;  1Q9C A;  3AZK C;  1P3M B;  3A6N C;  3REH C;  3AZJ C;  1M19 B;  2DF4 C;  4KGC C;  1TWG I;  1VQ6 Z;  4CAY B;  2BYK A;  4WNN B;  5GT0 B;  4H9S A;  3O62 A;  5DNM B;  1TWF I;  2AKL A;  1WWS A;  4E2W A;  1YI2 1;  1VQ5 Z;  3LZ1 D;  3REL A;  1P3K A;  3GTK I;  1KX4 C;  1P3L A;  3LZ0 C;  2LY8 A;  5B33 D;  3MGQ C;  1KX4 D;  1ULY A;  1KX5 D;  1F66 C;  4NE3 A;  5CP6 D;  2XD1 A;  3VB9 A;  4J8V D;  3HOZ I;  3WA9 B;  4H9O A;  2BYK B;  5DNM A;  3O62 B;  3AZI A;  3AZL A;  3EPJ A;  4J8V C;  4WU9 D;  1YJN 1;  4XX2 A;  1Q81 2;  1P3B D;  4MH4 A;  1P3B B;  5D1O B;  3AV1 C;  2Q51 A;  1NP6 A;  3O62 D;  3REL C;  4ZUX A;  3NQJ A;  2JUB A;  5GSU D;  3X1V B;  1LQL A;  4RVG A;  1YI2 Z;  5C3I B;  3IFU A;  5IP7 I;  4XZQ B;  3TU4 B;  3C1B B;  4QLC A;  1P3I A;  4J8U A;  3B0C T;  4G91 B;  4MON A;  3CCU 1;  3KUY C;  1P3G D;  3NH5 A;  1K8A 1;  3GTL I;  5KDM B;  1P3M D;  1M19 A;  3W99 D;  5B2J A;  5DNN A;  2Y2G A;  4WNN A;  1P3K D;  2R6M A;  3W97 A;  3AZF B;  5AVB A;  5AV5 B;  2VUG A;  1Q81 1;  5CPI A;  4WU8 B;  1N8R 2;  5B1L D;  2XD5 A;  3AFA A;  3UT9 A;  2HUE B;  3B6G A;  3CCQ Z;  3B0C W;  3A6N A;  3REH A;  4J8U C;  2Y2J A;  3CQZ I;  3WAA B;  5AV9 C;  3LJA A;  3AZI B;  2CWE A;  3AZL B;  5AY8 D;  1RLY A;  3CMA Z;  3MNN D;  2OTL 1;  4BXX I;  3MGQ D;  5CPJ C;  1S32 D;  5CPI B;  2NVT I;  2NVX I;  2RT9 A;  5E5A B;  3GTG I;  3MGR A;  4LD9 D;  3NQJ B;  5CPJ D;  5B32 C;  5CPI C;  1S32 C;  5CPJ B;  2DE7 A;  5AVC D;  3C1C C;  2HIO A;  3MGP B;  1EQZ B;  2F8N B;  3NDI A;  5C44 I;  1P34 A;  3CXC Y;  5CPI D;  3CME 1;  3S2D I;  3AZN B;  1WWI A;  3AZL C;  3AZI C;  2FJ7 A;  1KX3 D;  5GXQ C;  5B0Z A;  4YM6 B;  1NUI A;  5B2J D;  3AV1 A;  2O53 A;  4KUD D;  3G71 Z;  3Q87 A;  4A3C I;  1M19 D;  3X1S A;  1P9N A;  4A3F I;  1W2E A;  3CCM 1;  4HH4 A;  3CCE 1;  3X1U A;  2JMO A;  3J7A 4;  4M6B A;  3QWU A;  2P28 A;  1N1J B;  4WU8 A;  1P34 B;  1VQO Z;  4Z5T A;  3EPK A;  2JNY A;  3MGS C;  4X23 D;  3AZG D;  2ZY2 A;  1YJW Z;  1VQN Z;  1VQP Z;  3CCQ 1;  1M1K 1;  5AVB D;  1AOI D;  5F99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...