3P5JB

The structure of the human rnase h2 complex defines key interaction interfaces relevant to enzyme function and human disease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
221
structure length
171
Chain Sequence
AARQLVFLLPEHLKDASSLLFVKLANPHSGEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKPDCTLLLRFPELEKSLRHVTEKYYKYSSEKTLKWLEKKVNQTVVALKANNVNEDYVRYAHGLISDYIPKELSDDLSKFLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/replication
molecule keywords Ribonuclease H2 subunit A
publication title The Structure of the Human RNase H2 Complex Defines Key Interaction Interfaces Relevant to Enzyme Function and Human Disease.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 171
sequence length 221
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain
B PF17745 Ydr279_N Ydr279p protein triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.120 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3p5jB02
2.20.25.530 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3p5jB01
3P5JB
chains in the Genus database with same CATH superfamily
2ZY5A 5DNMD 1YJWZ 3CC4Z 1Y8CA 1P3BD 4LD9D 2E2JI 3AZEA 5BS7A 4YS3C 3CCMZ 3X1SB 3AV2D 3B6GC 1F66C 4WJ3C 1USPA 2JIPA 4UUZA 3LUSA 4EWCA 2OTJZ 3WTPA 5DNMB 5D1OA 1KQSY 1P3BB 1BFMA 5CPKC 4LD9B 3AZIA 3MGPD 3AZHA 3REIC 3REKD 1YHQ1 5BNXA 1U35D 1I3QI 3AYWA 2UWXA 3AV2B 3X1UD 5AV8A 3UTBD 4Y52I 5LL6f 3W99A 5GSUD 1QVFZ 4EO5C 3AFAB 1P3AA 4MONA 3AZFA 4E32A 3IP4C 3MGPB 3REKB 4XX2A 4AYBA 1U35B 3VH6W 3UT9A 2CV5D 1P3LA 3J80f 3UTBB 3X1SA 2JR6A 1YHQZ 5GSUB 2NVQI 5GT3B 1HQ3D 4E31A 4H9RB 2RVQC 4Z5TC 5DNMA 4E2ZA 2GTIA 4KUDD 1P3BA 2HF1A 1KX5D 1N8R2 4CSRB 1YIJ1 2KI7B 4TNUA 4Z2MH 4J8UA 3EPLA 2CV5B 5FLXb 3W98C 4XUJC 1S72Z 3S1MI 5FUGB 3AV2A 3I551 3VMHA 5B40B 3S15I 4NBHA 2DE6A 3F3FC 4KUDB 3LELD 3B0DC 1KX5B 2R6MA 2F8ND 3MGPA 3IR7A 3RZOI 1U35A 2OZKA 3AZGD 2ZY3A 4KHAB 5B1LC 1X3WA 3X1UA 1JWHC 3UTBA 1QF8A 3WA9C 3NFZA 4A3EI 4E30A 5GSUA 3AV1D 2VPZA 5JA4B 3I55Z 4H9RA 3LELB 4AWLC 2F8NB 1ZB9A 2Y2NA 2NVXI 4JJNC 4CSRA 3AZGB 4X23D 1QXFA 5B0ZC 2JIOA 3HOVI 3S14I 4YM6D 3AV1B 1HQ3A 3AZKC 3AZLD 4M6BA 3I561 1H3OB 4WU8D 3W97D 4WU9B 4KUDA 3B0CW 1KX5A 2NQBD 1BH8B 4X23B 3EEDA 1VLAA 4KHAA 4YM6B 4XZQD 3AZLB 3EERA 1ZH1A 1WIIA 5B33D 3FDDA 4WU8B 3TE5B 3W97B 5JA4A 3HOWI 3REHD 3I56Z 2M6NA 3F3PC 3LELA 2NQBB 1YIT1 2F8NA 5AVCC 5GT0D 3CXCZ 1Q7Y2 1P3FC 4QTTA 5AY8C 3AZGA 3VH6A 3FKII 4XZQB 3J80b 2HIOC 3EPHA 4H9OB 5B33B 3AV1A 1N1JB 2YFVB 3MVDD 1P34D 3MNNA 3REHB 1WW9A 2E7ZA 2AYDA 1H3OA 2LIYA 3OW2Z 3WKJC 1EQZC 3M3YI 4NE5A 4NBEA 5CPIB 4Z66C 3VMIA 4NBAA 3GTPI 4MD8A 3G711 5E5AC 3LZ1B 2WB1A 3AZNC 1P34B 3AZLA 3MVDB 2DF4C 5B1MD 4HGAB 3RELC 3HOYI 4J8VC 4MRIA 2FFFB 3A1IA 3W97A 3C1BD 2P3YA 1K731 3CPWY 3CD61 2NQBA 3KWQC 2YFWB 2I3CA 3X1VD 1P3IC 2PM9A 5JRGB 1K83I 4NOZA 4Y7NI 3V9RB 5B2JC 5B1MB 5CP6B 3AZJD 3T4NB 3G71Z 4H9OA 4E45A 5B33A 1N1JA 2YFVA 3C1BB 4J8WC 3S1QI 2E2HI 3KSYA 5GT0A 3REJC 4NBFA 3MGQB 3X1VB 5T6BA 5C4XI 1YI21 2G2KA 1YJ91 3A6NC 1KRLA 5A2Qf 3AZJB 4A3KI 2LY8A 2BG1A 1P34A 3MVDA 2PK7A 4H9NA 3LZ0D 4KGCD 3LJAC 4BBSI 1KU5A 3KFUG 3NQUB 3WAAD 1KC82 2YFWA 5C3IB 1ID3C 2QEXZ 2HU9A 3S16I 1Q862 3CQZI 1YI2Z 3V9RA 3MGSC 5B1MA 5AVBD 2QEX1 3M4OI 3LZ0B 2J6AA 5B24D 4KGCB 3S1NI 3C1BA 3WAAB 2FJ7C 3AN2C 1W2BZ 3X1VA 2Y2GA 4G92C 1VQ4Z 4Z2MG 3AZJA 5AVBB 5AV9C 1P3PC 1KX3A 1ZLAD 1ML8A 1N2FA 5B24B 2DE7A 1X0TA 2DE5A 1M19C 1P3KD 3AZID 3NQUA 1VQP1 5AV5D 4G91C 1S32A 2JIRA 3AYWD 1ZLAB 4NH1C 1AA6A 1YIJZ 1P3MD 3LZ0A 3WTPB 1QVGY 4KGCA 1P3KB 3AZFD 3CCVZ 2NVTI 3J81f 3AZIB 3WAAA 5AV5B 4RVGA 1VQ5Z 5B0YD 2EGTA 2LFUA 5B31G 2K3RA 4QLCC 2AROC 3AYWB 1P3LD 1M1AD 2PYOC 1Y1VI 1P3MB 1VQPZ 5AVBA 1KX4C 3C1CD 5B24A 3AZFB 5BS7C 2HUEC 3FQQA 5B0YB 1K732 1M1K2 4YS3D 1M18D 3CCL1 2L5AA 3UT9B 1P3LB 4J8UD 1M1AB 5A2Qb 1F66D 2VPXA 3W96C 1ZLAA 2K5RA 4DRBA 2YADA 3AZHC 3GTOI 1P3KA 1Q7Y1 1Y1VS 4YS3B 1M18B 1SIWA 3MGRA 5AV5A 5F99A 5AV8C 5CPJD 1F1EA 4J8UB 3W99C 1K8A2 3CCLZ 2OOXB 4ZBJC 1P3AC 1VQM1 4H9QA 1P3MA 4DGLA 1M902 3EPKA 5G49B 2JCHA 4MH4A 2Y2JA 3QWUA 5B0YA 5CPJB 3X1SC 1JJ2Y 1TZYC 1M1AA 3X1UB 5B32D 1Z2CB 3H0RC 4EO5B 1RO0A 3C1CA 2RVQD 5DNNC 3TU4C 1VQMZ 3GTLI 4LD9C 3CCSZ 2P28A 4YS3A 2IO5C 1M18A 3W98D 4XUJD 3AV2C 3U50C 1Y1WI 5B32B 1F66A 1HQ3B 3AFAC 4CL1A 5C44I 5IP7I 3CXCY 1VQ6Z 4A3BI 3MGPC 5CPKA 3REKC 4H9SC 5G49A 4A3GI 3REIA 2E2II 3J81b 3W98B 3MZLB 5B1LD 5CPJA 2JE5A 4NE3A 3WA9D 3H0LC 5GT3C 1I50I 2QREB 4WZSB 3I07A 4WV4B 3MNND 2B63I 3CME1 4E2YA 4JJND 2CV5C 1KC81 5FLMI 5B1LB 5B0ZD 1P3OC 3NDJA 3WA9B 1Q861 1WJ2A 5B32A 2ZAEB 5B40C 2GU2A 4A3FI 3FQMA 3JAMf 3MNNB 2Q51A 1KX5C 4ZUXC 1AOIC 4JJNB 3BG1B 4A3LI 3CMEZ 5B0ZB 3W98A 4XUJA 1NP6A 3GCFA 2JIMA 4MD9A 1PZRA 2NZDD 3B6FC 5B31D 1VQ9Z 2IZ3A 3LELC 3HOZI 5D1PA 2XD5A 5AVCD 3CCUZ 4RVFA 3AZGC 3VH5W 2Y2IA 1P3FD 1KQSZ 5B1LA 4A3MI 3O62C 3AV1C 3WA9A 2NZDB 5B31B 5B2IC 4WU9C 2QKDA 1RQFA 3WKJD 1EQZD 1P3FB 4X23C 4JJNA 5GT0B 3UTAD 4Z66D 5B0ZA 4YM6C 1S721 1LQLA 3WTPE 3AZND 1I6HI 4WU8C 2M48A 4NBBA 3W97C 4H9NB 3MONA 2NQBC 2ZM5A 1EQZB 3WKJB 2VPYA 3GKQA 3KUYD 3KWQD 3UTAB 4NB8A 1M1K1 1K8A1 1P3ID 4H9PB 3VH6T 4XZQC 3AZNB 4X6AI 5B2JD 2CWEA 2NZDA 2DQNC 2W03A 3REHC 5B31A 1KX3D 4NFRA 2JA5I 4NBDA 3KUYB 3KWQB 2QRCB 5T64A 5AVCA 5BT1C 3REJD 1TWAI 5CPIC 3AZMC 1P3IB 1P3FA 5AY8A 1FDOA 5AV6D 1Z01A 3LZ1C 3NQJA 5B2JB 1Z03A 3B0BA 2NVYI 4E2XA 1P34C 3MVDC 4HGAC 1S32D 1KX3B 1M901 4E44A 2VUMI 3JAMb 3LJAD 3REJB 3WKJA 1EQZA 3UTAA 5AV6B 4Z66A 1ID3D 5JRGC 1TWHI 4H9PA 1VQ41 3AZNA 5CP6C 4NBGA 1S32B 3CCR1 3MGSD 3RELA 2QR1B 2Y2OA 3LJAB 2H85A 2KPIA 3KUYA 3KWQA 3X1VC 3MGQC 2FJ7D 1ID3B 1QYPA 3VH5A 1P3IA 3AZJC 5B2JA 3MGSB 1P3PD 1P3GD 3CCRZ 3I4MI 3J7A4 3CCV1 2FJ7B 3Q87A 3HOUI 3B0CT 3REJA 2G5IC 1VQ51 2LEXA 3CMA1 3KXBC 5AV6A 3GTMI 1QVFY 3MGRD 1P3PB 3G6E1 5F99D 3X1TC 1P3GB 3S17I 3LZ0C 2J8PA 4KGCC 2NAPA 3VB9A 1VQO1 3LJAA 3G4S1 5GXQD 3I4NI 3ESWA 3NH8A 1ID3A 3MGRB 5F99B 4QLCD 2AROD 2ZY4A 5AVBC 3CMAZ 3MGSA 1KX4D 1TFIA 5B24C 2Y0SA 3G6EZ 4H9QB 4R8PC 4J8XD 3GTGI 2RPRA 1KD11 3GTMS 5GXQB 2FJ7A 1VQOZ 3AZEC 3G4SZ 2RIQA 1Q16A 2Y2KA 2AROB 4QLCB 1TWCI 1FDIA 1P3PA 1KX4B 1ZLAC 3W96D 3B6GD 1P3GA 4J8XB 2VF1A 4RS4A 1ZB8A 3WTPC 3C1CB 1P3KC 2V3VA 3PO2I 2HUEB 3AZIC 4MXUA 5CPKD 2IZ4A 2JUBA 4A3II 2R92I 3REID 3AYWC 5IP9I 1P3MC 3B6GB 2Y2LA 1ULYA 1F66B 2BYMB 3PO3I 1TAFB 2Y2PA 3AZFC 3CCS1 5IT9f 3IF8A 5CPKB 2JNYA 5GXQA 4NE6A 1RO4A 3REIB 4RVHA 3UT9C 1P3LC 1M1AC 2IV2X 1TZYD 4QLCA 2AROA 4ZBJB 2JS4A 1WWSA 1KX4A 1VQ61 1VQN1 3F6TA 5DNND 4J8XA 3TU4D 5DNMC 2Q4ZA 4Z5TD 1P3BC 2BYKA 1M18C 4J8UC 2W04A 1TZYB 1RO2A 1L1OC 3HKZA 3PO3S 4MD7A 2VPWA 3A1KA 4DQYB 2F8NK 3W96A 3B6GA 3AFAD 5DNNB 3TU4B 2BYMA 2RBLA 4Z5TB 1TAFA 1R4VA 3CCQ1 3GTKI 1VQNZ 2IO5B 4CAYB 5CPJC 3AL0C 1U35C 2JA6I 5BNVB 4XUJB 3X1UC 5GT3D 3UTBC 2R93I 3S2HI 5GSUC 2Y2HA 4NBCA 3B0DB 1B67A 1K9M2 2JMOA 1QVGZ 3GTJI 3CCQZ 1P3OD 1JFIB 1TZYA 2Y2QA 5B32C 2F8NH 3P5JB 1P9NA 4WNNB 5B40D 1HQ3C 5AN9F 1VQ91 3AZKD 5DNNA 3TU4A 1WCMI 4LD9A 4AWLB 4Z5TA 4ZUXD 1AOID 4KUDC 3CCU1 3S1RI 1KD12 1B6WA 3D9XA 1P3OB 1HTAA 4CAYA 2RHBA 5BNVA 2F2AC 3AFAA 3AZKB 3B6FD 4RVDA 1NJI2 3OW2Y 4ZUXB 1AOIB 3REKA 2W8SA 4H9SA 3EG5B 1NUIA 2AKLA 3D6WA 3IFUA 2OOYB 4RV9A 2YU9I 5IT9b 3D2LA 5AY8D 3O62D 1JFIA 5GT3A 2QA41 1VQ81 3B6FB 2HIOD 4WNNA 1T3UA 5C4JI 3MNNC 5B2ID 4HH4A 2QLVB 1R9TI 4WU9D 3CCJ1 1VQ71 2E9HA 3IX0A 3VTNA 5CHLB 1DL6A 5AVCB 2CV5A 1Q821 1P3OA 5AY8B 5FUGA 3O62B 4HGZA 3HOXI 1A7WA 3NQJB 1JJ2Z 2HIOB 4UPKA 5E5AD 3R45B 5KDMB 5B40A 3AZLC 5B2IB 2GTHA 3AZKA 3RELD 3NDIA 3H0MC 5C3EI 2QA4Z 1VQ8Z 4J8VD 2O53A 1W2BY 4ZUXA 1AOIA 4BXXI 3CCJZ 1VQ7Z 4Z66B 1Q811 1Z02A 5E5AB 1S7MA 2NZDC 5B31C 4BBRI 4A93I 3RELB 5B33C 3B6FA 2O4HA 3BG0B 4J8VB 2JA8I 2BJOA 3S2DI 4E2WA 2RT9A 4J8WD 5BT1D 4A3JI 5GT0C 3AZMD 5CPID 4NB9A 1TWFI 2V8KA 3LZ1D 1YUAA 3O62A 4HGYA 2F4MA 3A6ND 3CCE1 2ZY2A 2HIOA 5KDMA 3K7AI 3R45A 1VQL1 5B2IA 1WWIA 4WU9A 2R7ZI 4J8WB 1BH8A 2XD1A 4X23A 3UTAC 3AZMB 4E33A 3NH5A 1YITZ 5JRGD 4YM6A 3A6NB 5CP6D 4BY1I 5E5AA 2V45A 4WU8A 3NH4A 5B1MC 2QRDB 2V8IA 4DK1A 3GTQI 3CCEZ 3KUYC 3C1BC 4J8VA 3RZDI 1BH9B 1VQLZ 1VQK1 3MGQD 1YUKA 4A3CI 3AN2D 4XZQA 4QTUA 4NFTA 1YJN1 1W2EA 1KX3C 5AV9D 3REHA 2JSSA 2JIQA 4A3DI 5B32G 4J8WA 3CD6Z 4S1TA 1M19D 3AZMA 5AV6C 3AN2B 5CPIA 2VUGA 3KXBD 2WAQA 1VQKZ 3LZ1A 4G92B 5C3IC 3KIHA 3X1TD 1S32C 3A6NA 5AV9B 1Q9CA 1YJNZ 2JA7I 2OTL1 3CC21 1M19B 1K9M1 3KIFA 1BH9A 3KXBB 3WAAC 3VH5T 1SFOI 5JRGA 3X1TB 2G5HC 1YJ9Z 4G91B 5CP6A 1Q822 2PYOD 3H0GI 2F8NG 4R8PD 1N8R1 2Y2MA 5BO0B 1RLYA 3MGQA 3AZED 2OTLZ 3H3VJ 3AN2A 3CC2Z 3CPWZ 2PYOB 1WZNA 1P3GC 3CC71 1Q812 3TDHB 1TWGI 4R8PB 5AV9A 1NJI1 4BY7I 1PFTA 3WTPD 4DRAA 1X3ZA 3EPJA 3AZEB 3AZHD 2BYKB 1M19A 3MZKB 5T67A 5FLXf 3KXBA 2VQRA 5AV5C 5F99C 3MGRC 2F4OA 5AV8D 3X1TA 1USPB 2PMZA 3W99D 4UUZB 5CM2M 3W96B 5D1OB 1P3AD 3CC41 1YJW1 3CC7Z 1RNIA 5GXQC 3AZHB 3CCM1 5BO0A 5BNXB 3UT9D 5B0YC 5AV8B 2OTJ1 3X1SD 3W99B 2V8JA 2PYOA 3VMGA 1P3AB 4J8XC 4R8PA 3C1CC
chains in the Genus database with same CATH topology
2ZY5A 5DNMD 1YJWZ 3CC4Z 1P3BD 4LD9D 2E2JI 3AZEA 5BS7A 4YS3C 3CCMZ 3X1SB 3AV2D 3B6GC 1F66C 4WJ3C 1USPA 3LUSA 4UUZA 4EWCA 2OTJZ 3WTPA 5DNMB 5D1OA 1KQSY 1P3BB 1BFMA 5CPKC 4LD9B 3AZIA 3MGPD 3AZHA 3REIC 3REKD 1YHQ1 5BNXA 1U35D 1I3QI 3AYWA 2UWXA 3AV2B 3X1UD 5AV8A 3UTBD 4Y52I 5LL6f 3W99A 5GSUD 1QVFZ 4EO5C 3AFAB 1P3AA 4MONA 3AZFA 4E32A 3IP4C 3MGPB 3REKB 4XX2A 4AYBA 1U35B 3VH6W 3UT9A 2CV5D 1P3LA 3J80f 3UTBB 3X1SA 2JR6A 1YHQZ 5GSUB 2NVQI 5GT3B 1HQ3D 4E31A 4H9RB 2RVQC 4Z5TC 5DNMA 4E2ZA 2GTIA 4KUDD 1P3BA 2HF1A 1KX5D 1N8R2 4CSRB 1YIJ1 2KI7B 4TNUA 4Z2MH 4J8UA 3EPLA 2CV5B 5FLXb 3W98C 4XUJC 1S72Z 3S1MI 5FUGB 3AV2A 3I551 3VMHA 5B40B 3S15I 4NBHA 2DE6A 3F3FC 4KUDB 3LELD 3B0DC 1KX5B 2R6MA 2F8ND 3MGPA 3RZOI 1U35A 2OZKA 3AZGD 2ZY3A 4KHAB 5B1LC 1X3WA 3X1UA 1JWHC 3UTBA 1QF8A 3WA9C 3NFZA 4A3EI 4E30A 5GSUA 3AV1D 5JA4B 3I55Z 4H9RA 3LELB 4AWLC 2F8NB 1ZB9A 2Y2NA 2NVXI 4JJNC 4CSRA 3AZGB 4X23D 5B0ZC 3HOVI 3S14I 4YM6D 3AV1B 1HQ3A 3AZKC 3AZLD 4M6BA 3I561 1H3OB 4WU8D 3W97D 4WU9B 4KUDA 3B0CW 1KX5A 2NQBD 1BH8B 4X23B 3EEDA 1VLAA 4KHAA 4YM6B 4XZQD 3AZLB 3EERA 1ZH1A 1WIIA 5B33D 3FDDA 4WU8B 3TE5B 3W97B 5JA4A 3HOWI 3REHD 3I56Z 2M6NA 3F3PC 3LELA 2NQBB 1YIT1 2F8NA 5AVCC 5GT0D 3CXCZ 1Q7Y2 1P3FC 4QTTA 5AY8C 3AZGA 3VH6A 3FKII 4XZQB 3J80b 2HIOC 3EPHA 4H9OB 5B33B 3AV1A 1N1JB 2YFVB 3MVDD 1P34D 3MNNA 3REHB 1WW9A 2F4OA 2LIYA 1H3OA 3WKJC 1EQZC 3M3YI 4NE5A 4NBEA 5CPIB 4Z66C 3VMIA 4NBAA 3GTPI 4MD8A 3G711 5E5AC 3LZ1B 2WB1A 3AZNC 1P34B 3AZLA 3MVDB 2DF4C 5B1MD 4HGAB 3RELC 3HOYI 4J8VC 4MRIA 2FFFB 3A1IA 3W97A 3C1BD 2P3YA 1K731 3CPWY 3CD61 2NQBA 3KWQC 2YFWB 2I3CA 3X1VD 1P3IC 2PM9A 5JRGB 1K83I 4NOZA 4Y7NI 3V9RB 5B2JC 5B1MB 5CP6B 3AZJD 3T4NB 3G71Z 4H9OA 4E45A 5B33A 1N1JA 2YFVA 3C1BB 4J8WC 3S1QI 2E2HI 3KSYA 5GT0A 3REJC 4NBFA 3MGQB 3X1VB 5T6BA 5C4XI 1YI21 2G2KA 1YJ91 3A6NC 1KRLA 5A2Qf 3AZJB 4A3KI 2LY8A 2BG1A 1P34A 3MVDA 2PK7A 4H9NA 3LZ0D 4KGCD 3LJAC 4BBSI 1KU5A 3KFUG 3NQUB 3WAAD 1KC82 2YFWA 5C3IB 1ID3C 2QEXZ 2HU9A 3S16I 1Q862 3CQZI 1YI2Z 3V9RA 3MGSC 5B1MA 5AVBD 2QEX1 3M4OI 3LZ0B 2J6AA 5B24D 4KGCB 3S1NI 3C1BA 3WAAB 2FJ7C 3AN2C 1W2BZ 3X1VA 2Y2GA 4G92C 1VQ4Z 4Z2MG 3AZJA 5AVBB 5AV9C 1P3PC 1KX3A 1ZLAD 1ML8A 1N2FA 5B24B 2DE7A 1X0TA 2DE5A 1M19C 1P3KD 3AZID 3NQUA 1VQP1 5AV5D 4G91C 1S32A 3AYWD 1ZLAB 4NH1C 1YIJZ 1P3MD 3LZ0A 3WTPB 1QVGY 4KGCA 1P3KB 3AZFD 3CCVZ 2NVTI 3J81f 3AZIB 3WAAA 5AV5B 4RVGA 1VQ5Z 5B0YD 2EGTA 2LFUA 5B31G 2K3RA 4QLCC 2AROC 3AYWB 1P3LD 1M1AD 2PYOC 1Y1VI 1P3MB 1VQPZ 5AVBA 1KX4C 3C1CD 5B24A 3AZFB 5BS7C 2HUEC 3FQQA 5B0YB 1K732 1M1K2 4YS3D 1M18D 3CCL1 2L5AA 3UT9B 1P3LB 4J8UD 1M1AB 5A2Qb 1F66D 3W96C 1ZLAA 2K5RA 4DRBA 2YADA 3AZHC 3GTOI 1P3KA 1Q7Y1 1Y1VS 4YS3B 1M18B 3MGRA 5AV5A 5F99A 5AV8C 5CPJD 1F1EA 4J8UB 3W99C 1K8A2 3CCLZ 2OOXB 4ZBJC 1P3AC 1VQM1 4H9QA 1P3MA 4DGLA 1M902 3EPKA 5G49B 2JCHA 4MH4A 2Y2JA 3QWUA 5B0YA 5CPJB 3X1SC 1JJ2Y 1TZYC 1M1AA 3X1UB 5B32D 1Z2CB 3H0RC 4EO5B 1RO0A 3C1CA 2RVQD 5DNNC 3TU4C 1VQMZ 3GTLI 4LD9C 3CCSZ 2P28A 4YS3A 2IO5C 1M18A 3W98D 4XUJD 3AV2C 3U50C 1Y1WI 5B32B 1F66A 1HQ3B 3AFAC 4CL1A 5C44I 5IP7I 3CXCY 1VQ6Z 4A3BI 3MGPC 5CPKA 3REKC 4H9SC 5G49A 4A3GI 3REIA 2E2II 3J81b 3W98B 3MZLB 5B1LD 5CPJA 2JE5A 4NE3A 3WA9D 3H0LC 5GT3C 1I50I 2QREB 4WZSB 3I07A 4WV4B 3MNND 2B63I 3CME1 4E2YA 4JJND 2CV5C 1KC81 5FLMI 5B1LB 5B0ZD 1P3OC 3NDJA 3WA9B 1Q861 2ZAEB 5B32A 4A3FI 5B40C 2GU2A 3FQMA 3JAMf 3MNNB 2Q51A 1KX5C 4ZUXC 1AOIC 4JJNB 3BG1B 4A3LI 3CMEZ 5B0ZB 3W98A 4XUJA 1NP6A 3GCFA 4MD9A 1PZRA 2NZDD 3B6FC 5B31D 1VQ9Z 2IZ3A 3LELC 3HOZI 5D1PA 2XD5A 5AVCD 3CCUZ 4RVFA 3AZGC 3VH5W 2Y2IA 1P3FD 1KQSZ 5B1LA 4A3MI 3O62C 3AV1C 3WA9A 2NZDB 5B31B 5B2IC 4WU9C 2QKDA 1RQFA 3WKJD 1EQZD 1P3FB 4X23C 4JJNA 5GT0B 3UTAD 4Z66D 5B0ZA 4YM6C 1S721 1LQLA 3WTPE 3AZND 1I6HI 4WU8C 2M48A 4NBBA 3W97C 4H9NB 3MONA 2NQBC 2ZM5A 1EQZB 3WKJB 3GKQA 4NB8A 3KUYD 3KWQD 3UTAB 1M1K1 1K8A1 1P3ID 4H9PB 3VH6T 4XZQC 3AZNB 4X6AI 5B2JD 2CWEA 2NZDA 2DQNC 2W03A 3REHC 5B31A 1KX3D 4NFRA 2JA5I 4NBDA 3KUYB 3KWQB 2QRCB 5T64A 5AVCA 5BT1C 3REJD 1TWAI 5CPIC 3AZMC 1P3IB 1P3FA 5AY8A 1Z01A 5AV6D 2NVYI 3LZ1C 3NQJA 5B2JB 1Z03A 3B0BA 4E2XA 3OW2Z 1P34C 3MVDC 4HGAC 1S32D 1KX3B 1M901 4E44A 2VUMI 3JAMb 3LJAD 3REJB 3WKJA 1EQZA 3UTAA 5AV6B 4Z66A 1ID3D 5JRGC 1TWHI 4H9PA 1VQ41 3AZNA 5CP6C 4NBGA 1S32B 3CCR1 3MGSD 3RELA 2QR1B 2Y2OA 3LJAB 2H85A 2KPIA 3KUYA 3KWQA 3X1VC 3MGQC 2FJ7D 1ID3B 1QYPA 3VH5A 1P3IA 3AZJC 5B2JA 3MGSB 1P3PD 1P3GD 3CCRZ 3I4MI 3J7A4 3CCV1 2FJ7B 3Q87A 3HOUI 3B0CT 3REJA 2G5IC 1VQ51 3CMA1 3KXBC 5AV6A 3GTMI 1QVFY 3MGRD 1P3PB 3G6E1 5F99D 3X1TC 1P3GB 3S17I 3LZ0C 2J8PA 4KGCC 3VB9A 1VQO1 3LJAA 3G4S1 5GXQD 3I4NI 3ESWA 3NH8A 1ID3A 3MGRB 5F99B 4QLCD 2AROD 2ZY4A 5AVBC 3CMAZ 3MGSA 1KX4D 1TFIA 5B24C 2Y0SA 3G6EZ 4H9QB 4R8PC 4J8XD 3GTGI 2RPRA 1KD11 3GTMS 5GXQB 2FJ7A 1VQOZ 3AZEC 3G4SZ 2RIQA 2Y2KA 2AROB 4QLCB 1TWCI 1P3PA 1KX4B 1ZLAC 3W96D 3B6GD 1P3GA 4J8XB 2VF1A 4RS4A 1ZB8A 3WTPC 3C1CB 1P3KC 3PO2I 2HUEB 3AZIC 4MXUA 5CPKD 2IZ4A 2JUBA 4A3II 2R92I 3REID 3AYWC 5IP9I 1P3MC 3B6GB 2Y2LA 1ULYA 1F66B 2BYMB 3PO3I 1TAFB 2Y2PA 3AZFC 3CCS1 5IT9f 3IF8A 5CPKB 2JNYA 5GXQA 4NE6A 1RO4A 3REIB 4RVHA 3UT9C 1P3LC 1M1AC 1TZYD 4QLCA 2AROA 4ZBJB 2JS4A 1WWSA 1KX4A 1VQ61 1VQN1 3F6TA 5DNND 4J8XA 3TU4D 5DNMC 2Q4ZA 4Z5TD 1P3BC 2BYKA 1M18C 4J8UC 2W04A 1TZYB 1RO2A 1L1OC 3HKZA 3PO3S 4MD7A 3A1KA 4DQYB 2F8NK 3W96A 3B6GA 3AFAD 5DNNB 3TU4B 2BYMA 2RBLA 4Z5TB 1TAFA 1R4VA 3CCQ1 3GTKI 1VQNZ 2IO5B 4CAYB 5CPJC 3AL0C 1U35C 2JA6I 5BNVB 4XUJB 3X1UC 5GT3D 3UTBC 2R93I 3S2HI 5GSUC 2Y2HA 4NBCA 3B0DB 1B67A 1K9M2 2JMOA 1QVGZ 3GTJI 3CCQZ 1P3OD 1JFIB 1TZYA 2Y2QA 5B32C 2F8NH 3P5JB 1P9NA 4WNNB 5B40D 1HQ3C 5AN9F 1VQ91 3AZKD 5DNNA 3TU4A 1WCMI 4LD9A 4AWLB 4Z5TA 4ZUXD 1AOID 4KUDC 3CCU1 3S1RI 1KD12 1B6WA 3D9XA 1P3OB 1HTAA 4CAYA 2RHBA 5BNVA 2F2AC 3AFAA 3AZKB 3B6FD 4RVDA 1NJI2 3OW2Y 4ZUXB 1AOIB 3REKA 2W8SA 4H9SA 3EG5B 1NUIA 2AKLA 3D6WA 3IFUA 2OOYB 4RV9A 2YU9I 5IT9b 5AY8D 3O62D 1JFIA 5GT3A 2QA41 1VQ81 3B6FB 2HIOD 4WNNA 1T3UA 5C4JI 3MNNC 5B2ID 4HH4A 2QLVB 1R9TI 4WU9D 3CCJ1 1VQ71 2E9HA 3IX0A 3VTNA 5CHLB 1DL6A 5AVCB 2CV5A 1Q821 1P3OA 5AY8B 5FUGA 3O62B 4HGZA 3HOXI 1A7WA 3NQJB 1JJ2Z 2HIOB 4UPKA 5E5AD 3R45B 5KDMB 5B40A 3AZLC 5B2IB 2GTHA 3AZKA 3RELD 3NDIA 3H0MC 5C3EI 2QA4Z 1VQ8Z 4J8VD 2O53A 1W2BY 4ZUXA 1AOIA 4BXXI 3CCJZ 1VQ7Z 4Z66B 1Q811 1Z02A 5E5AB 1S7MA 2NZDC 5B31C 4BBRI 4A93I 3RELB 5B33C 3B6FA 2O4HA 3BG0B 4J8VB 2JA8I 2BJOA 3S2DI 4E2WA 2RT9A 4J8WD 5BT1D 4A3JI 5GT0C 3AZMD 5CPID 4NB9A 1TWFI 2V8KA 3LZ1D 1YUAA 3O62A 4HGYA 2F4MA 3A6ND 3CCE1 2ZY2A 2HIOA 5KDMA 3K7AI 3R45A 1VQL1 5B2IA 1WWIA 4WU9A 2R7ZI 4J8WB 1BH8A 2XD1A 4X23A 3UTAC 3AZMB 4E33A 3NH5A 1YITZ 5JRGD 4YM6A 3A6NB 5CP6D 4BY1I 5E5AA 4WU8A 3NH4A 5B1MC 2QRDB 2V8IA 4DK1A 3GTQI 3CCEZ 3KUYC 3C1BC 4J8VA 3RZDI 1BH9B 1VQLZ 1VQK1 3MGQD 1YUKA 4A3CI 3AN2D 4XZQA 4QTUA 4NFTA 1YJN1 1W2EA 1KX3C 5AV9D 3REHA 2JSSA 4A3DI 5B32G 4J8WA 3CD6Z 4S1TA 1M19D 3AZMA 5AV6C 3AN2B 5CPIA 2VUGA 3KXBD 2WAQA 1VQKZ 3LZ1A 4G92B 5C3IC 3KIHA 3X1TD 1S32C 3A6NA 5AV9B 1Q9CA 1YJNZ 2JA7I 2OTL1 3CC21 1M19B 1K9M1 3KIFA 1BH9A 3KXBB 3WAAC 3VH5T 1SFOI 5JRGA 3X1TB 2G5HC 1YJ9Z 4G91B 5CP6A 1Q822 2PYOD 3H0GI 2F8NG 4R8PD 1N8R1 2Y2MA 5BO0B 1RLYA 3MGQA 3AZED 2OTLZ 3H3VJ 3AN2A 3CC2Z 3CPWZ 2PYOB 1P3GC 3CC71 1Q812 3TDHB 1TWGI 4R8PB 5AV9A 1NJI1 4BY7I 1PFTA 3WTPD 4DRAA 1X3ZA 3EPJA 3AZEB 3AZHD 2BYKB 1M19A 3MZKB 5T67A 5FLXf 3KXBA 2VQRA 5AV5C 5F99C 3MGRC 5AV8D 3X1TA 1USPB 2PMZA 3W99D 4UUZB 5CM2M 3W96B 5D1OB 1P3AD 3CC41 1YJW1 3CC7Z 1RNIA 5GXQC 3AZHB 3CCM1 5BO0A 5BNXB 3UT9D 5B0YC 5AV8B 2OTJ1 3X1SD 3W99B 2V8JA 2PYOA 3VMGA 1P3AB 4J8XC 4R8PA 3C1CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J B; 
#chains in the Genus database with same CATH topology
 2ZY5 A;  5DNM D;  1YJW Z;  3CC4 Z;  1Y8C A;  1P3B D;  4LD9 D;  2E2J I;  3AZE A;  5BS7 A;  4YS3 C;  3CCM Z;  3X1S B;  3AV2 D;  3B6G C;  1F66 C;  4WJ3 C;  1USP A;  2JIP A;  4UUZ A;  3LUS A;  4EWC A;  2OTJ Z;  3WTP A;  5DNM B;  5D1O A;  1KQS Y;  1P3B B;  1BFM A;  5CPK C;  4LD9 B;  3AZI A;  3MGP D;  3AZH A;  3REI C;  3REK D;  1YHQ 1;  5BNX A;  1U35 D;  1I3Q I;  3AYW A;  2UWX A;  3AV2 B;  3X1U D;  5AV8 A;  3UTB D;  4Y52 I;  5LL6 f;  3W99 A;  5GSU D;  1QVF Z;  4EO5 C;  3AFA B;  1P3A A;  4MON A;  3AZF A;  4E32 A;  3IP4 C;  3MGP B;  3REK B;  4XX2 A;  4AYB A;  1U35 B;  3VH6 W;  3UT9 A;  2CV5 D;  1P3L A;  3J80 f;  3UTB B;  3X1S A;  2JR6 A;  1YHQ Z;  5GSU B;  2NVQ I;  5GT3 B;  1HQ3 D;  4E31 A;  4H9R B;  2RVQ C;  4Z5T C;  5DNM A;  4E2Z A;  2GTI A;  4KUD D;  1P3B A;  2HF1 A;  1KX5 D;  1N8R 2;  4CSR B;  1YIJ 1;  2KI7 B;  4TNU A;  4Z2M H;  4J8U A;  3EPL A;  2CV5 B;  5FLX b;  3W98 C;  4XUJ C;  1S72 Z;  3S1M I;  5FUG B;  3AV2 A;  3I55 1;  3VMH A;  5B40 B;  3S15 I;  4NBH A;  2DE6 A;  3F3F C;  4KUD B;  3LEL D;  3B0D C;  1KX5 B;  2R6M A;  2F8N D;  3MGP A;  3IR7 A;  3RZO I;  1U35 A;  2OZK A;  3AZG D;  2ZY3 A;  4KHA B;  5B1L C;  1X3W A;  3X1U A;  1JWH C;  3UTB A;  1QF8 A;  3WA9 C;  3NFZ A;  4A3E I;  4E30 A;  5GSU A;  3AV1 D;  2VPZ A;  5JA4 B;  3I55 Z;  4H9R A;  3LEL B;  4AWL C;  2F8N B;  1ZB9 A;  2Y2N A;  2NVX I;  4JJN C;  4CSR A;  3AZG B;  4X23 D;  1QXF A;  5B0Z C;  2JIO A;  3HOV I;  3S14 I;  4YM6 D;  3AV1 B;  1HQ3 A;  3AZK C;  3AZL D;  4M6B A;  3I56 1;  1H3O B;  4WU8 D;  3W97 D;  4WU9 B;  4KUD A;  3B0C W;  1KX5 A;  2NQB D;  1BH8 B;  4X23 B;  3EED A;  1VLA A;  4KHA A;  4YM6 B;  4XZQ D;  3AZL B;  3EER A;  1ZH1 A;  1WII A;  5B33 D;  3FDD A;  4WU8 B;  3TE5 B;  3W97 B;  5JA4 A;  3HOW I;  3REH D;  3I56 Z;  2M6N A;  3F3P C;  3LEL A;  2NQB B;  1YIT 1;  2F8N A;  5AVC C;  5GT0 D;  3CXC Z;  1Q7Y 2;  1P3F C;  4QTT A;  5AY8 C;  3AZG A;  3VH6 A;  3FKI I;  4XZQ B;  3J80 b;  2HIO C;  3EPH A;  4H9O B;  5B33 B;  3AV1 A;  1N1J B;  2YFV B;  3MVD D;  1P34 D;  3MNN A;  3REH B;  1WW9 A;  2E7Z A;  2AYD A;  1H3O A;  2LIY A;  3OW2 Z;  3WKJ C;  1EQZ C;  3M3Y I;  4NE5 A;  4NBE A;  5CPI B;  4Z66 C;  3VMI A;  4NBA A;  3GTP I;  4MD8 A;  3G71 1;  5E5A C;  3LZ1 B;  2WB1 A;  3AZN C;  1P34 B;  3AZL A;  3MVD B;  2DF4 C;  5B1M D;  4HGA B;  3REL C;  3HOY I;  4J8V C;  4MRI A;  2FFF B;  3A1I A;  3W97 A;  3C1B D;  2P3Y A;  1K73 1;  3CPW Y;  3CD6 1;  2NQB A;  3KWQ C;  2YFW B;  2I3C A;  3X1V D;  1P3I C;  2PM9 A;  5JRG B;  1K83 I;  4NOZ A;  4Y7N I;  3V9R B;  5B2J C;  5B1M B;  5CP6 B;  3AZJ D;  3T4N B;  3G71 Z;  4H9O A;  4E45 A;  5B33 A;  1N1J A;  2YFV A;  3C1B B;  4J8W C;  3S1Q I;  2E2H I;  3KSY A;  5GT0 A;  3REJ C;  4NBF A;  3MGQ B;  3X1V B;  5T6B A;  5C4X I;  1YI2 1;  2G2K A;  1YJ9 1;  3A6N C;  1KRL A;  5A2Q f;  3AZJ B;  4A3K I;  2LY8 A;  2BG1 A;  1P34 A;  3MVD A;  2PK7 A;  4H9N A;  3LZ0 D;  4KGC D;  3LJA C;  4BBS I;  1KU5 A;  3KFU G;  3NQU B;  3WAA D;  1KC8 2;  2YFW A;  5C3I B;  1ID3 C;  2QEX Z;  2HU9 A;  3S16 I;  1Q86 2;  3CQZ I;  1YI2 Z;  3V9R A;  3MGS C;  5B1M A;  5AVB D;  2QEX 1;  3M4O I;  3LZ0 B;  2J6A A;  5B24 D;  4KGC B;  3S1N I;  3C1B A;  3WAA B;  2FJ7 C;  3AN2 C;  1W2B Z;  3X1V A;  2Y2G A;  4G92 C;  1VQ4 Z;  4Z2M G;  3AZJ A;  5AVB B;  5AV9 C;  1P3P C;  1KX3 A;  1ZLA D;  1ML8 A;  1N2F A;  5B24 B;  2DE7 A;  1X0T A;  2DE5 A;  1M19 C;  1P3K D;  3AZI D;  3NQU A;  1VQP 1;  5AV5 D;  4G91 C;  1S32 A;  2JIR A;  3AYW D;  1ZLA B;  4NH1 C;  1AA6 A;  1YIJ Z;  1P3M D;  3LZ0 A;  3WTP B;  1QVG Y;  4KGC A;  1P3K B;  3AZF D;  3CCV Z;  2NVT I;  3J81 f;  3AZI B;  3WAA A;  5AV5 B;  4RVG A;  1VQ5 Z;  5B0Y D;  2EGT A;  2LFU A;  5B31 G;  2K3R A;  4QLC C;  2ARO C;  3AYW B;  1P3L D;  1M1A D;  2PYO C;  1Y1V I;  1P3M B;  1VQP Z;  5AVB A;  1KX4 C;  3C1C D;  5B24 A;  3AZF B;  5BS7 C;  2HUE C;  3FQQ A;  5B0Y B;  1K73 2;  1M1K 2;  4YS3 D;  1M18 D;  3CCL 1;  2L5A A;  3UT9 B;  1P3L B;  4J8U D;  1M1A B;  5A2Q b;  1F66 D;  2VPX A;  3W96 C;  1ZLA A;  2K5R A;  4DRB A;  2YAD A;  3AZH C;  3GTO I;  1P3K A;  1Q7Y 1;  1Y1V S;  4YS3 B;  1M18 B;  1SIW A;  3MGR A;  5AV5 A;  5F99 A;  5AV8 C;  5CPJ D;  1F1E A;  4J8U B;  3W99 C;  1K8A 2;  3CCL Z;  2OOX B;  4ZBJ C;  1P3A C;  1VQM 1;  4H9Q A;  1P3M A;  4DGL A;  1M90 2;  3EPK A;  5G49 B;  2JCH A;  4MH4 A;  2Y2J A;  3QWU A;  5B0Y A;  5CPJ B;  3X1S C;  1JJ2 Y;  1TZY C;  1M1A A;  3X1U B;  5B32 D;  1Z2C B;  3H0R C;  4EO5 B;  1RO0 A;  3C1C A;  2RVQ D;  5DNN C;  3TU4 C;  1VQM Z;  3GTL I;  4LD9 C;  3CCS Z;  2P28 A;  4YS3 A;  2IO5 C;  1M18 A;  3W98 D;  4XUJ D;  3AV2 C;  3U50 C;  1Y1W I;  5B32 B;  1F66 A;  1HQ3 B;  3AFA C;  4CL1 A;  5C44 I;  5IP7 I;  3CXC Y;  1VQ6 Z;  4A3B I;  3MGP C;  5CPK A;  3REK C;  4H9S C;  5G49 A;  4A3G I;  3REI A;  2E2I I;  3J81 b;  3W98 B;  3MZL B;  5B1L D;  5CPJ A;  2JE5 A;  4NE3 A;  3WA9 D;  3H0L C;  5GT3 C;  1I50 I;  2QRE B;  4WZS B;  3I07 A;  4WV4 B;  3MNN D;  2B63 I;  3CME 1;  4E2Y A;  4JJN D;  2CV5 C;  1KC8 1;  5FLM I;  5B1L B;  5B0Z D;  1P3O C;  3NDJ A;  3WA9 B;  1Q86 1;  1WJ2 A;  5B32 A;  2ZAE B;  5B40 C;  2GU2 A;  4A3F I;  3FQM A;  3JAM f;  3MNN B;  2Q51 A;  1KX5 C;  4ZUX C;  1AOI C;  4JJN B;  3BG1 B;  4A3L I;  3CME Z;  5B0Z B;  3W98 A;  4XUJ A;  1NP6 A;  3GCF A;  2JIM A;  4MD9 A;  1PZR A;  2NZD D;  3B6F C;  5B31 D;  1VQ9 Z;  2IZ3 A;  3LEL C;  3HOZ I;  5D1P A;  2XD5 A;  5AVC D;  3CCU Z;  4RVF A;  3AZG C;  3VH5 W;  2Y2I A;  1P3F D;  1KQS Z;  5B1L A;  4A3M I;  3O62 C;  3AV1 C;  3WA9 A;  2NZD B;  5B31 B;  5B2I C;  4WU9 C;  2QKD A;  1RQF A;  3WKJ D;  1EQZ D;  1P3F B;  4X23 C;  4JJN A;  5GT0 B;  3UTA D;  4Z66 D;  5B0Z A;  4YM6 C;  1S72 1;  1LQL A;  3WTP E;  3AZN D;  1I6H I;  4WU8 C;  2M48 A;  4NBB A;  3W97 C;  4H9N B;  3MON A;  2NQB C;  2ZM5 A;  1EQZ B;  3WKJ B;  2VPY A;  3GKQ A;  3KUY D;  3KWQ D;  3UTA B;  4NB8 A;  1M1K 1;  1K8A 1;  1P3I D;  4H9P B;  3VH6 T;  4XZQ C;  3AZN B;  4X6A I;  5B2J D;  2CWE A;  2NZD A;  2DQN C;  2W03 A;  3REH C;  5B31 A;  1KX3 D;  4NFR A;  2JA5 I;  4NBD A;  3KUY B;  3KWQ B;  2QRC B;  5T64 A;  5AVC A;  5BT1 C;  3REJ D;  1TWA I;  5CPI C;  3AZM C;  1P3I B;  1P3F A;  5AY8 A;  1FDO A;  5AV6 D;  1Z01 A;  3LZ1 C;  3NQJ A;  5B2J B;  1Z03 A;  3B0B A;  2NVY I;  4E2X A;  1P34 C;  3MVD C;  4HGA C;  1S32 D;  1KX3 B;  1M90 1;  4E44 A;  2VUM I;  3JAM b;  3LJA D;  3REJ B;  3WKJ A;  1EQZ A;  3UTA A;  5AV6 B;  4Z66 A;  1ID3 D;  5JRG C;  1TWH I;  4H9P A;  1VQ4 1;  3AZN A;  5CP6 C;  4NBG A;  1S32 B;  3CCR 1;  3MGS D;  3REL A;  2QR1 B;  2Y2O A;  3LJA B;  2H85 A;  2KPI A;  3KUY A;  3KWQ A;  3X1V C;  3MGQ C;  2FJ7 D;  1ID3 B;  1QYP A;  3VH5 A;  1P3I A;  3AZJ C;  5B2J A;  3MGS B;  1P3P D;  1P3G D;  3CCR Z;  3I4M I;  3J7A 4;  3CCV 1;  2FJ7 B;  3Q87 A;  3HOU I;  3B0C T;  3REJ A;  2G5I C;  1VQ5 1;  2LEX A;  3CMA 1;  3KXB C;  5AV6 A;  3GTM I;  1QVF Y;  3MGR D;  1P3P B;  3G6E 1;  5F99 D;  3X1T C;  1P3G B;  3S17 I;  3LZ0 C;  2J8P A;  4KGC C;  2NAP A;  3VB9 A;  1VQO 1;  3LJA A;  3G4S 1;  5GXQ D;  3I4N I;  3ESW A;  3NH8 A;  1ID3 A;  3MGR B;  5F99 B;  4QLC D;  2ARO D;  2ZY4 A;  5AVB C;  3CMA Z;  3MGS A;  1KX4 D;  1TFI A;  5B24 C;  2Y0S A;  3G6E Z;  4H9Q B;  4R8P C;  4J8X D;  3GTG I;  2RPR A;  1KD1 1;  3GTM S;  5GXQ B;  2FJ7 A;  1VQO Z;  3AZE C;  3G4S Z;  2RIQ A;  1Q16 A;  2Y2K A;  2ARO B;  4QLC B;  1TWC I;  1FDI A;  1P3P A;  1KX4 B;  1ZLA C;  3W96 D;  3B6G D;  1P3G A;  4J8X B;  2VF1 A;  4RS4 A;  1ZB8 A;  3WTP C;  3C1C B;  1P3K C;  2V3V A;  3PO2 I;  2HUE B;  3AZI C;  4MXU A;  5CPK D;  2IZ4 A;  2JUB A;  4A3I I;  2R92 I;  3REI D;  3AYW C;  5IP9 I;  1P3M C;  3B6G B;  2Y2L A;  1ULY A;  1F66 B;  2BYM B;  3PO3 I;  1TAF B;  2Y2P A;  3AZF C;  3CCS 1;  5IT9 f;  3IF8 A;  5CPK B;  2JNY A;  5GXQ A;  4NE6 A;  1RO4 A;  3REI B;  4RVH A;  3UT9 C;  1P3L C;  1M1A C;  2IV2 X;  1TZY D;  4QLC A;  2ARO A;  4ZBJ B;  2JS4 A;  1WWS A;  1KX4 A;  1VQ6 1;  1VQN 1;  3F6T A;  5DNN D;  4J8X A;  3TU4 D;  5DNM C;  2Q4Z A;  4Z5T D;  1P3B C;  2BYK A;  1M18 C;  4J8U C;  2W04 A;  1TZY B;  1RO2 A;  1L1O C;  3HKZ A;  3PO3 S;  4MD7 A;  2VPW A;  3A1K A;  4DQY B;  2F8N K;  3W96 A;  3B6G A;  3AFA D;  5DNN B;  3TU4 B;  2BYM A;  2RBL A;  4Z5T B;  1TAF A;  1R4V A;  3CCQ 1;  3GTK I;  1VQN Z;  2IO5 B;  4CAY B;  5CPJ C;  3AL0 C;  1U35 C;  2JA6 I;  5BNV B;  4XUJ B;  3X1U C;  5GT3 D;  3UTB C;  2R93 I;  3S2H I;  5GSU C;  2Y2H A;  4NBC A;  3B0D B;  1B67 A;  1K9M 2;  2JMO A;  1QVG Z;  3GTJ I;  3CCQ Z;  1P3O D;  1JFI B;  1TZY A;  2Y2Q A;  5B32 C;  2F8N H;  3P5J B;  1P9N A;  4WNN B;  5B40 D;  1HQ3 C;  5AN9 F;  1VQ9 1;  3AZK D;  5DNN A;  3TU4 A;  1WCM I;  4LD9 A;  4AWL B;  4Z5T A;  4ZUX D;  1AOI D;  4KUD C;  3CCU 1;  3S1R I;  1KD1 2;  1B6W A;  3D9X A;  1P3O B;  1HTA A;  4CAY A;  2RHB A;  5BNV A;  2F2A C;  3AFA A;  3AZK B;  3B6F D;  4RVD A;  1NJI 2;  3OW2 Y;  4ZUX B;  1AOI B;  3REK A;  2W8S A;  4H9S A;  3EG5 B;  1NUI A;  2AKL A;  3D6W A;  3IFU A;  2OOY B;  4RV9 A;  2YU9 I;  5IT9 b;  3D2L A;  5AY8 D;  3O62 D;  1JFI A;  5GT3 A;  2QA4 1;  1VQ8 1;  3B6F B;  2HIO D;  4WNN A;  1T3U A;  5C4J I;  3MNN C;  5B2I D;  4HH4 A;  2QLV B;  1R9T I;  4WU9 D;  3CCJ 1;  1VQ7 1;  2E9H A;  3IX0 A;  3VTN A;  5CHL B;  1DL6 A;  5AVC B;  2CV5 A;  1Q82 1;  1P3O A;  5AY8 B;  5FUG A;  3O62 B;  4HGZ A;  3HOX I;  1A7W A;  3NQJ B;  1JJ2 Z;  2HIO B;  4UPK A;  5E5A D;  3R45 B;  5KDM B;  5B40 A;  3AZL C;  5B2I B;  2GTH A;  3AZK A;  3REL D;  3NDI A;  3H0M C;  5C3E I;  2QA4 Z;  1VQ8 Z;  4J8V D;  2O53 A;  1W2B Y;  4ZUX A;  1AOI A;  4BXX I;  3CCJ Z;  1VQ7 Z;  4Z66 B;  1Q81 1;  1Z02 A;  5E5A B;  1S7M A;  2NZD C;  5B31 C;  4BBR I;  4A93 I;  3REL B;  5B33 C;  3B6F A;  2O4H A;  3BG0 B;  4J8V B;  2JA8 I;  2BJO A;  3S2D I;  4E2W A;  2RT9 A;  4J8W D;  5BT1 D;  4A3J I;  5GT0 C;  3AZM D;  5CPI D;  4NB9 A;  1TWF I;  2V8K A;  3LZ1 D;  1YUA A;  3O62 A;  4HGY A;  2F4M A;  3A6N D;  3CCE 1;  2ZY2 A;  2HIO A;  5KDM A;  3K7A I;  3R45 A;  1VQL 1;  5B2I A;  1WWI A;  4WU9 A;  2R7Z I;  4J8W B;  1BH8 A;  2XD1 A;  4X23 A;  3UTA C;  3AZM B;  4E33 A;  3NH5 A;  1YIT Z;  5JRG D;  4YM6 A;  3A6N B;  5CP6 D;  4BY1 I;  5E5A A;  2V45 A;  4WU8 A;  3NH4 A;  5B1M C;  2QRD B;  2V8I A;  4DK1 A;  3GTQ I;  3CCE Z;  3KUY C;  3C1B C;  4J8V A;  3RZD I;  1BH9 B;  1VQL Z;  1VQK 1;  3MGQ D;  1YUK A;  4A3C I;  3AN2 D;  4XZQ A;  4QTU A;  4NFT A;  1YJN 1;  1W2E A;  1KX3 C;  5AV9 D;  3REH A;  2JSS A;  2JIQ A;  4A3D I;  5B32 G;  4J8W A;  3CD6 Z;  4S1T A;  1M19 D;  3AZM A;  5AV6 C;  3AN2 B;  5CPI A;  2VUG A;  3KXB D;  2WAQ A;  1VQK Z;  3LZ1 A;  4G92 B;  5C3I C;  3KIH A;  3X1T D;  1S32 C;  3A6N A;  5AV9 B;  1Q9C A;  1YJN Z;  2JA7 I;  2OTL 1;  3CC2 1;  1M19 B;  1K9M 1;  3KIF A;  1BH9 A;  3KXB B;  3WAA C;  3VH5 T;  1SFO I;  5JRG A;  3X1T B;  2G5H C;  1YJ9 Z;  4G91 B;  5CP6 A;  1Q82 2;  2PYO D;  3H0G I;  2F8N G;  4R8P D;  1N8R 1;  2Y2M A;  5BO0 B;  1RLY A;  3MGQ A;  3AZE D;  2OTL Z;  3H3V J;  3AN2 A;  3CC2 Z;  3CPW Z;  2PYO B;  1WZN A;  1P3G C;  3CC7 1;  1Q81 2;  3TDH B;  1TWG I;  4R8P B;  5AV9 A;  1NJI 1;  4BY7 I;  1PFT A;  3WTP D;  4DRA A;  1X3Z A;  3EPJ A;  3AZE B;  3AZH D;  2BYK B;  1M19 A;  3MZK B;  5T67 A;  5FLX f;  3KXB A;  2VQR A;  5AV5 C;  5F99 C;  3MGR C;  2F4O A;  5AV8 D;  3X1T A;  1USP B;  2PMZ A;  3W99 D;  4UUZ B;  5CM2 M;  3W96 B;  5D1O B;  1P3A D;  3CC4 1;  1YJW 1;  3CC7 Z;  1RNI A;  5GXQ C;  3AZH B;  3CCM 1;  5BO0 A;  5BNX B;  3UT9 D;  5B0Y C;  5AV8 B;  2OTJ 1;  3X1S D;  3W99 B;  2V8J A;  2PYO A;  3VMG A;  1P3A B;  4J8X C;  4R8P A;  3C1C C; 
#chains in the Genus database with same CATH homology
 2ZY5 A;  5DNM D;  1YJW Z;  3CC4 Z;  1P3B D;  4LD9 D;  2E2J I;  3AZE A;  5BS7 A;  4YS3 C;  3CCM Z;  3X1S B;  3AV2 D;  3B6G C;  1F66 C;  4WJ3 C;  1USP A;  3LUS A;  4UUZ A;  4EWC A;  2OTJ Z;  3WTP A;  5DNM B;  5D1O A;  1KQS Y;  1P3B B;  1BFM A;  5CPK C;  4LD9 B;  3AZI A;  3MGP D;  3AZH A;  3REI C;  3REK D;  1YHQ 1;  5BNX A;  1U35 D;  1I3Q I;  3AYW A;  2UWX A;  3AV2 B;  3X1U D;  5AV8 A;  3UTB D;  4Y52 I;  5LL6 f;  3W99 A;  5GSU D;  1QVF Z;  4EO5 C;  3AFA B;  1P3A A;  4MON A;  3AZF A;  4E32 A;  3IP4 C;  3MGP B;  3REK B;  4XX2 A;  4AYB A;  1U35 B;  3VH6 W;  3UT9 A;  2CV5 D;  1P3L A;  3J80 f;  3UTB B;  3X1S A;  2JR6 A;  1YHQ Z;  5GSU B;  2NVQ I;  5GT3 B;  1HQ3 D;  4E31 A;  4H9R B;  2RVQ C;  4Z5T C;  5DNM A;  4E2Z A;  2GTI A;  4KUD D;  1P3B A;  2HF1 A;  1KX5 D;  1N8R 2;  4CSR B;  1YIJ 1;  2KI7 B;  4TNU A;  4Z2M H;  4J8U A;  3EPL A;  2CV5 B;  5FLX b;  3W98 C;  4XUJ C;  1S72 Z;  3S1M I;  5FUG B;  3AV2 A;  3I55 1;  3VMH A;  5B40 B;  3S15 I;  4NBH A;  2DE6 A;  3F3F C;  4KUD B;  3LEL D;  3B0D C;  1KX5 B;  2R6M A;  2F8N D;  3MGP A;  3RZO I;  1U35 A;  2OZK A;  3AZG D;  2ZY3 A;  4KHA B;  5B1L C;  1X3W A;  3X1U A;  1JWH C;  3UTB A;  1QF8 A;  3WA9 C;  3NFZ A;  4A3E I;  4E30 A;  5GSU A;  3AV1 D;  5JA4 B;  3I55 Z;  4H9R A;  3LEL B;  4AWL C;  2F8N B;  1ZB9 A;  2Y2N A;  2NVX I;  4JJN C;  4CSR A;  3AZG B;  4X23 D;  5B0Z C;  3HOV I;  3S14 I;  4YM6 D;  3AV1 B;  1HQ3 A;  3AZK C;  3AZL D;  4M6B A;  3I56 1;  1H3O B;  4WU8 D;  3W97 D;  4WU9 B;  4KUD A;  3B0C W;  1KX5 A;  2NQB D;  1BH8 B;  4X23 B;  3EED A;  1VLA A;  4KHA A;  4YM6 B;  4XZQ D;  3AZL B;  3EER A;  1ZH1 A;  1WII A;  5B33 D;  3FDD A;  4WU8 B;  3TE5 B;  3W97 B;  5JA4 A;  3HOW I;  3REH D;  3I56 Z;  2M6N A;  3F3P C;  3LEL A;  2NQB B;  1YIT 1;  2F8N A;  5AVC C;  5GT0 D;  3CXC Z;  1Q7Y 2;  1P3F C;  4QTT A;  5AY8 C;  3AZG A;  3VH6 A;  3FKI I;  4XZQ B;  3J80 b;  2HIO C;  3EPH A;  4H9O B;  5B33 B;  3AV1 A;  1N1J B;  2YFV B;  3MVD D;  1P34 D;  3MNN A;  3REH B;  1WW9 A;  2F4O A;  2LIY A;  1H3O A;  3WKJ C;  1EQZ C;  3M3Y I;  4NE5 A;  4NBE A;  5CPI B;  4Z66 C;  3VMI A;  4NBA A;  3GTP I;  4MD8 A;  3G71 1;  5E5A C;  3LZ1 B;  2WB1 A;  3AZN C;  1P34 B;  3AZL A;  3MVD B;  2DF4 C;  5B1M D;  4HGA B;  3REL C;  3HOY I;  4J8V C;  4MRI A;  2FFF B;  3A1I A;  3W97 A;  3C1B D;  2P3Y A;  1K73 1;  3CPW Y;  3CD6 1;  2NQB A;  3KWQ C;  2YFW B;  2I3C A;  3X1V D;  1P3I C;  2PM9 A;  5JRG B;  1K83 I;  4NOZ A;  4Y7N I;  3V9R B;  5B2J C;  5B1M B;  5CP6 B;  3AZJ D;  3T4N B;  3G71 Z;  4H9O A;  4E45 A;  5B33 A;  1N1J A;  2YFV A;  3C1B B;  4J8W C;  3S1Q I;  2E2H I;  3KSY A;  5GT0 A;  3REJ C;  4NBF A;  3MGQ B;  3X1V B;  5T6B A;  5C4X I;  1YI2 1;  2G2K A;  1YJ9 1;  3A6N C;  1KRL A;  5A2Q f;  3AZJ B;  4A3K I;  2LY8 A;  2BG1 A;  1P34 A;  3MVD A;  2PK7 A;  4H9N A;  3LZ0 D;  4KGC D;  3LJA C;  4BBS I;  1KU5 A;  3KFU G;  3NQU B;  3WAA D;  1KC8 2;  2YFW A;  5C3I B;  1ID3 C;  2QEX Z;  2HU9 A;  3S16 I;  1Q86 2;  3CQZ I;  1YI2 Z;  3V9R A;  3MGS C;  5B1M A;  5AVB D;  2QEX 1;  3M4O I;  3LZ0 B;  2J6A A;  5B24 D;  4KGC B;  3S1N I;  3C1B A;  3WAA B;  2FJ7 C;  3AN2 C;  1W2B Z;  3X1V A;  2Y2G A;  4G92 C;  1VQ4 Z;  4Z2M G;  3AZJ A;  5AVB B;  5AV9 C;  1P3P C;  1KX3 A;  1ZLA D;  1ML8 A;  1N2F A;  5B24 B;  2DE7 A;  1X0T A;  2DE5 A;  1M19 C;  1P3K D;  3AZI D;  3NQU A;  1VQP 1;  5AV5 D;  4G91 C;  1S32 A;  3AYW D;  1ZLA B;  4NH1 C;  1YIJ Z;  1P3M D;  3LZ0 A;  3WTP B;  1QVG Y;  4KGC A;  1P3K B;  3AZF D;  3CCV Z;  2NVT I;  3J81 f;  3AZI B;  3WAA A;  5AV5 B;  4RVG A;  1VQ5 Z;  5B0Y D;  2EGT A;  2LFU A;  5B31 G;  2K3R A;  4QLC C;  2ARO C;  3AYW B;  1P3L D;  1M1A D;  2PYO C;  1Y1V I;  1P3M B;  1VQP Z;  5AVB A;  1KX4 C;  3C1C D;  5B24 A;  3AZF B;  5BS7 C;  2HUE C;  3FQQ A;  5B0Y B;  1K73 2;  1M1K 2;  4YS3 D;  1M18 D;  3CCL 1;  2L5A A;  3UT9 B;  1P3L B;  4J8U D;  1M1A B;  5A2Q b;  1F66 D;  3W96 C;  1ZLA A;  2K5R A;  4DRB A;  2YAD A;  3AZH C;  3GTO I;  1P3K A;  1Q7Y 1;  1Y1V S;  4YS3 B;  1M18 B;  3MGR A;  5AV5 A;  5F99 A;  5AV8 C;  5CPJ D;  1F1E A;  4J8U B;  3W99 C;  1K8A 2;  3CCL Z;  2OOX B;  4ZBJ C;  1P3A C;  1VQM 1;  4H9Q A;  1P3M A;  4DGL A;  1M90 2;  3EPK A;  5G49 B;  2JCH A;  4MH4 A;  2Y2J A;  3QWU A;  5B0Y A;  5CPJ B;  3X1S C;  1JJ2 Y;  1TZY C;  1M1A A;  3X1U B;  5B32 D;  1Z2C B;  3H0R C;  4EO5 B;  1RO0 A;  3C1C A;  2RVQ D;  5DNN C;  3TU4 C;  1VQM Z;  3GTL I;  4LD9 C;  3CCS Z;  2P28 A;  4YS3 A;  2IO5 C;  1M18 A;  3W98 D;  4XUJ D;  3AV2 C;  3U50 C;  1Y1W I;  5B32 B;  1F66 A;  1HQ3 B;  3AFA C;  4CL1 A;  5C44 I;  5IP7 I;  3CXC Y;  1VQ6 Z;  4A3B I;  3MGP C;  5CPK A;  3REK C;  4H9S C;  5G49 A;  4A3G I;  3REI A;  2E2I I;  3J81 b;  3W98 B;  3MZL B;  5B1L D;  5CPJ A;  2JE5 A;  4NE3 A;  3WA9 D;  3H0L C;  5GT3 C;  1I50 I;  2QRE B;  4WZS B;  3I07 A;  4WV4 B;  3MNN D;  2B63 I;  3CME 1;  4E2Y A;  4JJN D;  2CV5 C;  1KC8 1;  5FLM I;  5B1L B;  5B0Z D;  1P3O C;  3NDJ A;  3WA9 B;  1Q86 1;  2ZAE B;  5B32 A;  4A3F I;  5B40 C;  2GU2 A;  3FQM A;  3JAM f;  3MNN B;  2Q51 A;  1KX5 C;  4ZUX C;  1AOI C;  4JJN B;  3BG1 B;  4A3L I;  3CME Z;  5B0Z B;  3W98 A;  4XUJ A;  1NP6 A;  3GCF A;  4MD9 A;  1PZR A;  2NZD D;  3B6F C;  5B31 D;  1VQ9 Z;  2IZ3 A;  3LEL C;  3HOZ I;  5D1P A;  2XD5 A;  5AVC D;  3CCU Z;  4RVF A;  3AZG C;  3VH5 W;  2Y2I A;  1P3F D;  1KQS Z;  5B1L A;  4A3M I;  3O62 C;  3AV1 C;  3WA9 A;  2NZD B;  5B31 B;  5B2I C;  4WU9 C;  2QKD A;  1RQF A;  3WKJ D;  1EQZ D;  1P3F B;  4X23 C;  4JJN A;  5GT0 B;  3UTA D;  4Z66 D;  5B0Z A;  4YM6 C;  1S72 1;  1LQL A;  3WTP E;  3AZN D;  1I6H I;  4WU8 C;  2M48 A;  4NBB A;  3W97 C;  4H9N B;  3MON A;  2NQB C;  2ZM5 A;  1EQZ B;  3WKJ B;  3GKQ A;  4NB8 A;  3KUY D;  3KWQ D;  3UTA B;  1M1K 1;  1K8A 1;  1P3I D;  4H9P B;  3VH6 T;  4XZQ C;  3AZN B;  4X6A I;  5B2J D;  2CWE A;  2NZD A;  2DQN C;  2W03 A;  3REH C;  5B31 A;  1KX3 D;  4NFR A;  2JA5 I;  4NBD A;  3KUY B;  3KWQ B;  2QRC B;  5T64 A;  5AVC A;  5BT1 C;  3REJ D;  1TWA I;  5CPI C;  3AZM C;  1P3I B;  1P3F A;  5AY8 A;  1Z01 A;  5AV6 D;  2NVY I;  3LZ1 C;  3NQJ A;  5B2J B;  1Z03 A;  3B0B A;  4E2X A;  3OW2 Z;  1P34 C;  3MVD C;  4HGA C;  1S32 D;  1KX3 B;  1M90 1;  4E44 A;  2VUM I;  3JAM b;  3LJA D;  3REJ B;  3WKJ A;  1EQZ A;  3UTA A;  5AV6 B;  4Z66 A;  1ID3 D;  5JRG C;  1TWH I;  4H9P A;  1VQ4 1;  3AZN A;  5CP6 C;  4NBG A;  1S32 B;  3CCR 1;  3MGS D;  3REL A;  2QR1 B;  2Y2O A;  3LJA B;  2H85 A;  2KPI A;  3KUY A;  3KWQ A;  3X1V C;  3MGQ C;  2FJ7 D;  1ID3 B;  1QYP A;  3VH5 A;  1P3I A;  3AZJ C;  5B2J A;  3MGS B;  1P3P D;  1P3G D;  3CCR Z;  3I4M I;  3J7A 4;  3CCV 1;  2FJ7 B;  3Q87 A;  3HOU I;  3B0C T;  3REJ A;  2G5I C;  1VQ5 1;  3CMA 1;  3KXB C;  5AV6 A;  3GTM I;  1QVF Y;  3MGR D;  1P3P B;  3G6E 1;  5F99 D;  3X1T C;  1P3G B;  3S17 I;  3LZ0 C;  2J8P A;  4KGC C;  3VB9 A;  1VQO 1;  3LJA A;  3G4S 1;  5GXQ D;  3I4N I;  3ESW A;  3NH8 A;  1ID3 A;  3MGR B;  5F99 B;  4QLC D;  2ARO D;  2ZY4 A;  5AVB C;  3CMA Z;  3MGS A;  1KX4 D;  1TFI A;  5B24 C;  2Y0S A;  3G6E Z;  4H9Q B;  4R8P C;  4J8X D;  3GTG I;  2RPR A;  1KD1 1;  3GTM S;  5GXQ B;  2FJ7 A;  1VQO Z;  3AZE C;  3G4S Z;  2RIQ A;  2Y2K A;  2ARO B;  4QLC B;  1TWC I;  1P3P A;  1KX4 B;  1ZLA C;  3W96 D;  3B6G D;  1P3G A;  4J8X B;  2VF1 A;  4RS4 A;  1ZB8 A;  3WTP C;  3C1C B;  1P3K C;  3PO2 I;  2HUE B;  3AZI C;  4MXU A;  5CPK D;  2IZ4 A;  2JUB A;  4A3I I;  2R92 I;  3REI D;  3AYW C;  5IP9 I;  1P3M C;  3B6G B;  2Y2L A;  1ULY A;  1F66 B;  2BYM B;  3PO3 I;  1TAF B;  2Y2P A;  3AZF C;  3CCS 1;  5IT9 f;  3IF8 A;  5CPK B;  2JNY A;  5GXQ A;  4NE6 A;  1RO4 A;  3REI B;  4RVH A;  3UT9 C;  1P3L C;  1M1A C;  1TZY D;  4QLC A;  2ARO A;  4ZBJ B;  2JS4 A;  1WWS A;  1KX4 A;  1VQ6 1;  1VQN 1;  3F6T A;  5DNN D;  4J8X A;  3TU4 D;  5DNM C;  2Q4Z A;  4Z5T D;  1P3B C;  2BYK A;  1M18 C;  4J8U C;  2W04 A;  1TZY B;  1RO2 A;  1L1O C;  3HKZ A;  3PO3 S;  4MD7 A;  3A1K A;  4DQY B;  2F8N K;  3W96 A;  3B6G A;  3AFA D;  5DNN B;  3TU4 B;  2BYM A;  2RBL A;  4Z5T B;  1TAF A;  1R4V A;  3CCQ 1;  3GTK I;  1VQN Z;  2IO5 B;  4CAY B;  5CPJ C;  3AL0 C;  1U35 C;  2JA6 I;  5BNV B;  4XUJ B;  3X1U C;  5GT3 D;  3UTB C;  2R93 I;  3S2H I;  5GSU C;  2Y2H A;  4NBC A;  3B0D B;  1B67 A;  1K9M 2;  2JMO A;  1QVG Z;  3GTJ I;  3CCQ Z;  1P3O D;  1JFI B;  1TZY A;  2Y2Q A;  5B32 C;  2F8N H;  3P5J B;  1P9N A;  4WNN B;  5B40 D;  1HQ3 C;  5AN9 F;  1VQ9 1;  3AZK D;  5DNN A;  3TU4 A;  1WCM I;  4LD9 A;  4AWL B;  4Z5T A;  4ZUX D;  1AOI D;  4KUD C;  3CCU 1;  3S1R I;  1KD1 2;  1B6W A;  3D9X A;  1P3O B;  1HTA A;  4CAY A;  2RHB A;  5BNV A;  2F2A C;  3AFA A;  3AZK B;  3B6F D;  4RVD A;  1NJI 2;  3OW2 Y;  4ZUX B;  1AOI B;  3REK A;  2W8S A;  4H9S A;  3EG5 B;  1NUI A;  2AKL A;  3D6W A;  3IFU A;  2OOY B;  4RV9 A;  2YU9 I;  5IT9 b;  5AY8 D;  3O62 D;  1JFI A;  5GT3 A;  2QA4 1;  1VQ8 1;  3B6F B;  2HIO D;  4WNN A;  1T3U A;  5C4J I;  3MNN C;  5B2I D;  4HH4 A;  2QLV B;  1R9T I;  4WU9 D;  3CCJ 1;  1VQ7 1;  2E9H A;  3IX0 A;  3VTN A;  5CHL B;  1DL6 A;  5AVC B;  2CV5 A;  1Q82 1;  1P3O A;  5AY8 B;  5FUG A;  3O62 B;  4HGZ A;  3HOX I;  1A7W A;  3NQJ B;  1JJ2 Z;  2HIO B;  4UPK A;  5E5A D;  3R45 B;  5KDM B;  5B40 A;  3AZL C;  5B2I B;  2GTH A;  3AZK A;  3REL D;  3NDI A;  3H0M C;  5C3E I;  2QA4 Z;  1VQ8 Z;  4J8V D;  2O53 A;  1W2B Y;  4ZUX A;  1AOI A;  4BXX I;  3CCJ Z;  1VQ7 Z;  4Z66 B;  1Q81 1;  1Z02 A;  5E5A B;  1S7M A;  2NZD C;  5B31 C;  4BBR I;  4A93 I;  3REL B;  5B33 C;  3B6F A;  2O4H A;  3BG0 B;  4J8V B;  2JA8 I;  2BJO A;  3S2D I;  4E2W A;  2RT9 A;  4J8W D;  5BT1 D;  4A3J I;  5GT0 C;  3AZM D;  5CPI D;  4NB9 A;  1TWF I;  2V8K A;  3LZ1 D;  1YUA A;  3O62 A;  4HGY A;  2F4M A;  3A6N D;  3CCE 1;  2ZY2 A;  2HIO A;  5KDM A;  3K7A I;  3R45 A;  1VQL 1;  5B2I A;  1WWI A;  4WU9 A;  2R7Z I;  4J8W B;  1BH8 A;  2XD1 A;  4X23 A;  3UTA C;  3AZM B;  4E33 A;  3NH5 A;  1YIT Z;  5JRG D;  4YM6 A;  3A6N B;  5CP6 D;  4BY1 I;  5E5A A;  4WU8 A;  3NH4 A;  5B1M C;  2QRD B;  2V8I A;  4DK1 A;  3GTQ I;  3CCE Z;  3KUY C;  3C1B C;  4J8V A;  3RZD I;  1BH9 B;  1VQL Z;  1VQK 1;  3MGQ D;  1YUK A;  4A3C I;  3AN2 D;  4XZQ A;  4QTU A;  4NFT A;  1YJN 1;  1W2E A;  1KX3 C;  5AV9 D;  3REH A;  2JSS A;  4A3D I;  5B32 G;  4J8W A;  3CD6 Z;  4S1T A;  1M19 D;  3AZM A;  5AV6 C;  3AN2 B;  5CPI A;  2VUG A;  3KXB D;  2WAQ A;  1VQK Z;  3LZ1 A;  4G92 B;  5C3I C;  3KIH A;  3X1T D;  1S32 C;  3A6N A;  5AV9 B;  1Q9C A;  1YJN Z;  2JA7 I;  2OTL 1;  3CC2 1;  1M19 B;  1K9M 1;  3KIF A;  1BH9 A;  3KXB B;  3WAA C;  3VH5 T;  1SFO I;  5JRG A;  3X1T B;  2G5H C;  1YJ9 Z;  4G91 B;  5CP6 A;  1Q82 2;  2PYO D;  3H0G I;  2F8N G;  4R8P D;  1N8R 1;  2Y2M A;  5BO0 B;  1RLY A;  3MGQ A;  3AZE D;  2OTL Z;  3H3V J;  3AN2 A;  3CC2 Z;  3CPW Z;  2PYO B;  1P3G C;  3CC7 1;  1Q81 2;  3TDH B;  1TWG I;  4R8P B;  5AV9 A;  1NJI 1;  4BY7 I;  1PFT A;  3WTP D;  4DRA A;  1X3Z A;  3EPJ A;  3AZE B;  3AZH D;  2BYK B;  1M19 A;  3MZK B;  5T67 A;  5FLX f;  3KXB A;  2VQR A;  5AV5 C;  5F99 C;  3MGR C;  5AV8 D;  3X1T A;  1USP B;  2PMZ A;  3W99 D;  4UUZ B;  5CM2 M;  3W96 B;  5D1O B;  1P3A D;  3CC4 1;  1YJW 1;  3CC7 Z;  1RNI A;  5GXQ C;  3AZH B;  3CCM 1;  5BO0 A;  5BNX B;  3UT9 D;  5B0Y C;  5AV8 B;  2OTJ 1;  3X1S D;  3W99 B;  2V8J A;  2PYO A;  3VMG A;  1P3A B;  4J8X C;  4R8P A;  3C1C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...