3CCQ1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccq100
2QA4Z 1VQM1 3CCM1 1KQSZ 1Q861 3OW2Z 1VQ9Z 1KD11 1VQ81 1VQMZ 3CCMZ 3G4S1 1KQSY 1M902 1QVGZ 3CCU1 3CME1 3CC21 2OTL1 1Q822 1VQ8Z 3CCS1 3G4SZ 1M901 1N8R2 3CCQ1 3CCUZ 3CMEZ 1YIJ1 1QVGY 3CC2Z 2OTLZ 3CCV1 1W2BY 3G711 3CCSZ 1JJ2Z 1VQ61 1YHQ1 1YIT1 1N8R1 3CCQZ 1YIJZ 3CC41 1K732 3CMA1 3CCVZ 1Q7Y2 1YJ91 1K8A2 3G71Z 1VQ6Z 1YHQZ 1YITZ 1JJ2Y 3CPWY 3CC4Z 1KC82 3CMAZ 3CD61 1Q7Y1 1K9M2 1VQN1 1K8A1 1YJ9Z 1W2BZ 3G6E1 1M1K2 1KC81 3CXCZ 3CD6Z 3CCR1 1K9M1 1Q821 1VQNZ 3G6EZ 1VQO1 1M1K1 3CPWZ 3CXCY 1VQK1 3CCRZ 1YJW1 1QVFZ 1VQOZ 3CCE1 1VQL1 2OTJ1 1VQKZ 3CCJ1 1YJWZ 1K731 3I551 1QVFY 1VQ51 1YJN1 3CCEZ 1VQLZ 1VQ41 2OTJZ 1S721 3CCJZ 1KD12 3I55Z 1YJNZ 1VQ5Z 3CCL1 1YI21 1VQ4Z 1VQP1 1S72Z 1Q812 3I561 3CCLZ 1NJI2 1YI2Z 3OW2Y 2QEX1 3CC71 1VQ71 1VQPZ 1Q811 2QA41 3I56Z 1NJI1 1Q862 2QEXZ 3CC7Z 1VQ7Z 1VQ91
chains in the Genus database with same CATH superfamily
3GTMS 2H85A 3S17I 1KQSZ 4RV9A 2VF1A 1VQ9Z 2LFUA 3GTGI 3G4S1 1M902 1RLYA 5IP7I 4BY7I 2I3CA 3NH8A 3G4SZ 1N8R2 3S2DI 3GTJI 3EERA 3CCV1 3U50C 1Z01A 2JA8I 4BBSI 4E33A 1YHQ1 4NBHA 4E2YA 4QTUA 3CCVZ 1K8A2 3D2LA 3KIFA 1YHQZ 3J81f 2IV2X 3GTKI 4MD8A 2J6AA 1RQFA 2YADA 3LUSA 3GTQI 4Y52I 3CXCZ 4NFRA 4MONA 2NVQI 3K7AI 2E7ZA 2E2HI 3FQQA 3H3VJ 3ESWA 3JAMb 1YJW1 1YUAA 3P5JB 1QVFZ 1VQL1 2OTJ1 1YJWZ 3FQMA 1QF8A 2Q51A 1YJN1 2QREB 1VQLZ 3IX0A 4E32A 1VQ41 2OTJZ 3PO2I 1YJNZ 2JA6I 1R9TI 2IZ3A 1I6HI 1VQ4Z 4NBDA 3HOZI 1FDIA 1FDOA 3CQZI 2IZ4A 2Y0SA 1VLAA 4BBRI 2VPXA 1NJI2 4NB9A 3M3YI 4A3JI 3CC71 2VPWA 1Y1VS 2NVYI 2W03A 4MD7A 1TWGI 3S14I 3IFUA 3CC7Z 3I4NI 3HOWI 2DE6A 2JIRA 4DQYB 3CCM1 5IT9f 5C44I 1ZH1A 3NFZA 4DGLA 1I3QI 1KD11 2GTHA 4BY1I 3CCMZ 5FLMI 1KQSY 2VPYA 1QVGZ 2OTL1 3I4MI 1WJ2A 1NP6A 2PM9A 1YIJ1 1TWHI 2OTLZ 3F3PC 4A3II 1JJ2Z 2V8JA 2NVXI 1YIT1 2AYDA 2JMOA 3GTOI 1YIJZ 4A93I 1NUIA 2RHBA 1ML8A 4NBAA 2JIQA 4RVDA 3VTNA 3S1MI 3NDIA 1YITZ 3CPWY 1N2FA 2NAPA 2B63I 4E30A 2HF1A 1Q7Y1 1K9M2 4MRIA 2K5RA 1M1K2 5LL6f 1WCMI 1KC81 2JA5I 4E2ZA 3CCR1 2QR1B 4MXUA 1VQO1 2AKLA 3HOVI 3CPWZ 2VUMI 3CXCY 1VQK1 3CCRZ 2V8KA 1WW9A 3TE5B 1VQOZ 2JIMA 5T67A 1TWAI 1VQKZ 3CCJ1 2JNYA 3J80f 1K731 3I551 5T64A 2OZKA 4DK1A 1X3ZA 1VQ51 1QVFY 3GCFA 2RPRA 3NH4A 3T4NB 4A3EI 1S721 3CCJZ 1KD12 2YU9I 3D9XA 3I55Z 1VQ5Z 3CCL1 2V8IA 5AN9F 1Z02A 1S72Z 3NDJA 3CCLZ 2BJOA 4BXXI 4RVGA 3RZDI 1LQLA 4E2WA 1Q811 2QA41 4A3DI 4XX2A 3MZKB 2K3RA 2DE7A 5IT9b 2QA4Z 1VQM1 1RO0A 2PMZA 1Q861 3D6WA 2O4HA 5A2Qf 4A3CI 1VQ81 1VQMZ 2EGTA 2R7ZI 3CC21 2VPZA 3S1QI 3MONA 1DL6A 1VQ8Z 3BG0B 1S7MA 3IR7A 1KRLA 1Y1WI 3S15I 1USPB 2QKDA 4NBEA 3TDHB 1M901 3CCQ1 2QRDB 3H0GI 4RVFA 1QVGY 2R92I 3CC2Z 1X0TA 3G711 1VQ61 2E2JI 1N8R1 3GTMI 3CCQZ 3CC41 1K732 2JUBA 2GU2A 3PO3I 3G71Z 1VQ6Z 5C4JI 1PFTA 1JJ2Y 3S2HI 3CC4Z 1X3WA 2E2II 1Q16A 3VMHA 1VQN1 1K8A1 3VMGA 4HGYA 2G2KA 1Q821 2Q4ZA 1VQNZ 2QLVB 4NBGA 2KPIA 1WZNA 4NB8A 4A3KI 3GTPI 1K83I 3J81b 3CCE1 1USPA 4CL1A 3CCEZ 1WIIA 3HOUI 2OOXB 2M6NA 5FLXf 1P9NA 2KI7B 2E9HA 2OOYB 2RT9A 4A3BI 4EWCA 1YI21 3PO3S 5C4XI 4NBCA 4MD9A 1VQP1 2LEXA 4A3MI 4NBBA 3I561 3QWUA 5CM2M 1YI2Z 3OW2Y 2LIYA 4S1TA 1VQ71 3NH5A 3VB9A 5IP9I 1VQPZ 4HH4A 2GTIA 3I56Z 1NJI1 1L1OC 1VQ7Z 2JA7I 5A2Qb 3OW2Z 3J7A4 2P3YA 2F4MA 4A3GI 1ZB9A 3CCU1 3CME1 5D1OB 1Q822 2M48A 2V3VA 4NBFA 1Y1VI 4AYBA 3CCS1 4QTTA 1Y8CA 3CMEZ 1YUKA 2F4OA 3CCUZ 1TWCI 2W04A 2JR6A 1TWFI 1W2BY 5D1PA 3CCSZ 1SIWA 3S1NI 2VUGA 1QYPA 1RO2A 3CMA1 1JWHC 2JIOA 2RBLA 1Q7Y2 2JS4A 1YJ91 3MZLB 2JIPA 2ZAEB 3Q87A 2P28A 1KC82 3CMAZ 3CD61 4E31A 2HU9A 2R6MA 1YJ9Z 1W2BZ 5C3EI 4RVHA 3G6E1 3RZOI 1I50I 3S1RI 3CD6Z 2NVTI 1K9M1 3BG1B 3F3FC 3S16I 1TFIA 2WAQA 3HOXI 3G6EZ 3GKQA 1M1K1 3IF8A 4A3LI 4HGZA 3JAMf 5D1OA 2RIQA 3HKZA 4MH4A 3FKII 2R93I 1RO4A 1AA6A 4NOZA 3VMIA 4NH1C 2WB1A 1ZB8A 5FLXb 1Z03A 4Y7NI 4X6AI 4E2XA 1SFOI 1RNIA 3KIHA 2V45A 5T6BA 3I07A 4TNUA 4A3FI 4RS4A 1Q812 3GTLI 2PK7A 3HOYI 1QXFA 2QEX1 3M4OI 3J80b 3EEDA 1Q862 2QEXZ 2QRCB 2O53A 2DE5A 1VQ91
chains in the Genus database with same CATH topology
3GTMS 2H85A 3S17I 1KQSZ 4RV9A 2VF1A 1VQ9Z 2LFUA 3GTGI 3G4S1 1M902 1RLYA 5IP7I 4BY7I 2I3CA 3NH8A 3G4SZ 1N8R2 3S2DI 3GTJI 3EERA 3CCV1 3U50C 1Z01A 2JA8I 4BBSI 4E33A 1YHQ1 4NBHA 4E2YA 4QTUA 3CCVZ 1K8A2 3KIFA 1YHQZ 3J81f 3GTKI 4MD8A 2J6AA 1RQFA 2YADA 3LUSA 3GTQI 4Y52I 3CXCZ 4NFRA 4MONA 2NVQI 3K7AI 2E2HI 3FQQA 3H3VJ 3ESWA 3JAMb 1YJW1 1YUAA 3P5JB 1QVFZ 1VQL1 2OTJ1 1YJWZ 3FQMA 1QF8A 2Q51A 1YJN1 2QREB 1VQLZ 3IX0A 4E32A 1VQ41 2OTJZ 3PO2I 1YJNZ 2JA6I 1R9TI 2IZ3A 1I6HI 1VQ4Z 4NBDA 3HOZI 3CQZI 2IZ4A 2Y0SA 1VLAA 4BBRI 1NJI2 4NB9A 3M3YI 4A3JI 3CC71 1Y1VS 2NVYI 2W03A 4MD7A 1TWGI 3S14I 3IFUA 3CC7Z 3I4NI 3HOWI 2DE6A 4DQYB 3CCM1 5IT9f 5C44I 1ZH1A 3NFZA 4DGLA 1I3QI 1KD11 2GTHA 4BY1I 3CCMZ 5FLMI 1KQSY 1QVGZ 2OTL1 3I4MI 1NP6A 2PM9A 1YIJ1 1TWHI 2OTLZ 3F3PC 4A3II 1JJ2Z 2V8JA 2NVXI 1YIT1 2JMOA 3GTOI 1YIJZ 4A93I 1NUIA 2RHBA 1ML8A 4NBAA 4RVDA 3VTNA 3S1MI 3NDIA 1YITZ 3CPWY 1N2FA 2B63I 4E30A 2HF1A 1Q7Y1 1K9M2 4MRIA 2K5RA 1M1K2 5LL6f 1WCMI 1KC81 2JA5I 4E2ZA 3CCR1 2QR1B 4MXUA 1VQO1 2AKLA 3HOVI 3CPWZ 2VUMI 3CXCY 1VQK1 3CCRZ 2V8KA 1WW9A 3TE5B 1VQOZ 5T67A 1TWAI 1VQKZ 3CCJ1 2JNYA 3J80f 1K731 3I551 5T64A 2OZKA 4DK1A 1X3ZA 1VQ51 1QVFY 4A3EI 2RPRA 3GCFA 3NH4A 3T4NB 1S721 3CCJZ 1KD12 2YU9I 3D9XA 3I55Z 1VQ5Z 3CCL1 2V8IA 5AN9F 1Z02A 1S72Z 3NDJA 3CCLZ 2BJOA 4BXXI 4RVGA 3RZDI 1LQLA 4E2WA 1Q811 2QA41 4A3DI 4XX2A 3MZKB 2K3RA 2DE7A 5IT9b 2QA4Z 1VQM1 1RO0A 2PMZA 1Q861 3D6WA 2O4HA 5A2Qf 4A3CI 1VQ81 1VQMZ 2EGTA 2R7ZI 3CC21 3S1QI 3MONA 1DL6A 1VQ8Z 3BG0B 1S7MA 1KRLA 1Y1WI 3S15I 1USPB 2QKDA 4NBEA 3TDHB 1M901 3CCQ1 2QRDB 3H0GI 4RVFA 1QVGY 2R92I 3CC2Z 1X0TA 3G711 1VQ61 2E2JI 1N8R1 3GTMI 3CCQZ 3CC41 1K732 2JUBA 2GU2A 3PO3I 3G71Z 1VQ6Z 5C4JI 1PFTA 1JJ2Y 3S2HI 3CC4Z 1X3WA 2E2II 3VMHA 1VQN1 1K8A1 3VMGA 4HGYA 2G2KA 1Q821 2Q4ZA 1VQNZ 2QLVB 4NBGA 2KPIA 4NB8A 4A3KI 3GTPI 1K83I 3J81b 3CCE1 1USPA 4CL1A 3CCEZ 1WIIA 3HOUI 2OOXB 2M6NA 5FLXf 1P9NA 2KI7B 2E9HA 2OOYB 2RT9A 4A3BI 4EWCA 1YI21 3PO3S 5C4XI 4NBCA 4MD9A 1VQP1 4A3MI 4NBBA 3I561 3QWUA 5CM2M 1YI2Z 3OW2Y 2LIYA 4S1TA 1VQ71 3NH5A 3VB9A 5IP9I 1VQPZ 4HH4A 2GTIA 3I56Z 1NJI1 1L1OC 1VQ7Z 2JA7I 5A2Qb 3OW2Z 3J7A4 2P3YA 2F4MA 4A3GI 1ZB9A 3CCU1 3CME1 5D1OB 1Q822 2M48A 4NBFA 1Y1VI 4AYBA 3CCS1 4QTTA 3CCUZ 3CMEZ 1YUKA 2F4OA 1TWCI 2W04A 2JR6A 1TWFI 1W2BY 5D1PA 3CCSZ 3S1NI 2VUGA 1QYPA 1RO2A 3CMA1 1JWHC 2RBLA 1Q7Y2 2JS4A 1YJ91 3MZLB 3Q87A 2ZAEB 2P28A 1KC82 3CMAZ 3CD61 4E31A 2HU9A 2R6MA 1YJ9Z 1W2BZ 5C3EI 4RVHA 3G6E1 3RZOI 1I50I 3S1RI 3CD6Z 2NVTI 1K9M1 3BG1B 3F3FC 3S16I 1TFIA 2WAQA 3HOXI 3G6EZ 3GKQA 1M1K1 3IF8A 4A3LI 4HGZA 3JAMf 5D1OA 2RIQA 3HKZA 4MH4A 3FKII 2R93I 1RO4A 4NOZA 3VMIA 4NH1C 2WB1A 1ZB8A 5FLXb 1Z03A 4Y7NI 4X6AI 4E2XA 1SFOI 1RNIA 3KIHA 5T6BA 3I07A 4TNUA 4A3FI 4RS4A 1Q812 3GTLI 2PK7A 3HOYI 2QEX1 3M4OI 3J80b 3EEDA 1Q862 2QEXZ 2QRCB 2O53A 2DE5A 1VQ91
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1VQM 1;  3CCM 1;  1KQS Z;  1Q86 1;  3OW2 Z;  1VQ9 Z;  1KD1 1;  1VQ8 1;  1VQM Z;  3CCM Z;  3G4S 1;  1KQS Y;  1M90 2;  1QVG Z;  3CCU 1;  3CME 1;  3CC2 1;  2OTL 1;  1Q82 2;  1VQ8 Z;  3CCS 1;  3G4S Z;  1M90 1;  1N8R 2;  3CCQ 1;  3CCU Z;  3CME Z;  1YIJ 1;  1QVG Y;  3CC2 Z;  2OTL Z;  3CCV 1;  1W2B Y;  3G71 1;  3CCS Z;  1JJ2 Z;  1VQ6 1;  1YHQ 1;  1YIT 1;  1N8R 1;  3CCQ Z;  1YIJ Z;  3CC4 1;  1K73 2;  3CMA 1;  3CCV Z;  1Q7Y 2;  1YJ9 1;  1K8A 2;  3G71 Z;  1VQ6 Z;  1YHQ Z;  1YIT Z;  1JJ2 Y;  3CPW Y;  3CC4 Z;  1KC8 2;  3CMA Z;  3CD6 1;  1Q7Y 1;  1K9M 2;  1VQN 1;  1K8A 1;  1YJ9 Z;  1W2B Z;  3G6E 1;  1M1K 2;  1KC8 1;  3CXC Z;  3CD6 Z;  3CCR 1;  1K9M 1;  1Q82 1;  1VQN Z;  3G6E Z;  1VQO 1;  1M1K 1;  3CPW Z;  3CXC Y;  1VQK 1;  3CCR Z;  1YJW 1;  1QVF Z;  1VQO Z;  3CCE 1;  1VQL 1;  2OTJ 1;  1VQK Z;  3CCJ 1;  1YJW Z;  1K73 1;  3I55 1;  1QVF Y;  1VQ5 1;  1YJN 1;  3CCE Z;  1VQL Z;  1VQ4 1;  2OTJ Z;  1S72 1;  3CCJ Z;  1KD1 2;  3I55 Z;  1YJN Z;  1VQ5 Z;  3CCL 1;  1YI2 1;  1VQ4 Z;  1VQP 1;  1S72 Z;  1Q81 2;  3I56 1;  3CCL Z;  1NJI 2;  1YI2 Z;  3OW2 Y;  2QEX 1;  3CC7 1;  1VQ7 1;  1VQP Z;  1Q81 1;  2QA4 1;  3I56 Z;  1NJI 1;  1Q86 2;  2QEX Z;  3CC7 Z;  1VQ7 Z;  1VQ9 1; 
#chains in the Genus database with same CATH topology
 3GTM S;  2H85 A;  3S17 I;  1KQS Z;  4RV9 A;  2VF1 A;  1VQ9 Z;  2LFU A;  3GTG I;  3G4S 1;  1M90 2;  1RLY A;  5IP7 I;  4BY7 I;  2I3C A;  3NH8 A;  3G4S Z;  1N8R 2;  3S2D I;  3GTJ I;  3EER A;  3CCV 1;  3U50 C;  1Z01 A;  2JA8 I;  4BBS I;  4E33 A;  1YHQ 1;  4NBH A;  4E2Y A;  4QTU A;  3CCV Z;  1K8A 2;  3D2L A;  3KIF A;  1YHQ Z;  3J81 f;  2IV2 X;  3GTK I;  4MD8 A;  2J6A A;  1RQF A;  2YAD A;  3LUS A;  3GTQ I;  4Y52 I;  3CXC Z;  4NFR A;  4MON A;  2NVQ I;  3K7A I;  2E7Z A;  2E2H I;  3FQQ A;  3H3V J;  3ESW A;  3JAM b;  1YJW 1;  1YUA A;  3P5J B;  1QVF Z;  1VQL 1;  2OTJ 1;  1YJW Z;  3FQM A;  1QF8 A;  2Q51 A;  1YJN 1;  2QRE B;  1VQL Z;  3IX0 A;  4E32 A;  1VQ4 1;  2OTJ Z;  3PO2 I;  1YJN Z;  2JA6 I;  1R9T I;  2IZ3 A;  1I6H I;  1VQ4 Z;  4NBD A;  3HOZ I;  1FDI A;  1FDO A;  3CQZ I;  2IZ4 A;  2Y0S A;  1VLA A;  4BBR I;  2VPX A;  1NJI 2;  4NB9 A;  3M3Y I;  4A3J I;  3CC7 1;  2VPW A;  1Y1V S;  2NVY I;  2W03 A;  4MD7 A;  1TWG I;  3S14 I;  3IFU A;  3CC7 Z;  3I4N I;  3HOW I;  2DE6 A;  2JIR A;  4DQY B;  3CCM 1;  5IT9 f;  5C44 I;  1ZH1 A;  3NFZ A;  4DGL A;  1I3Q I;  1KD1 1;  2GTH A;  4BY1 I;  3CCM Z;  5FLM I;  1KQS Y;  2VPY A;  1QVG Z;  2OTL 1;  3I4M I;  1WJ2 A;  1NP6 A;  2PM9 A;  1YIJ 1;  1TWH I;  2OTL Z;  3F3P C;  4A3I I;  1JJ2 Z;  2V8J A;  2NVX I;  1YIT 1;  2AYD A;  2JMO A;  3GTO I;  1YIJ Z;  4A93 I;  1NUI A;  2RHB A;  1ML8 A;  4NBA A;  2JIQ A;  4RVD A;  3VTN A;  3S1M I;  3NDI A;  1YIT Z;  3CPW Y;  1N2F A;  2NAP A;  2B63 I;  4E30 A;  2HF1 A;  1Q7Y 1;  1K9M 2;  4MRI A;  2K5R A;  1M1K 2;  5LL6 f;  1WCM I;  1KC8 1;  2JA5 I;  4E2Z A;  3CCR 1;  2QR1 B;  4MXU A;  1VQO 1;  2AKL A;  3HOV I;  3CPW Z;  2VUM I;  3CXC Y;  1VQK 1;  3CCR Z;  2V8K A;  1WW9 A;  3TE5 B;  1VQO Z;  2JIM A;  5T67 A;  1TWA I;  1VQK Z;  3CCJ 1;  2JNY A;  3J80 f;  1K73 1;  3I55 1;  5T64 A;  2OZK A;  4DK1 A;  1X3Z A;  1VQ5 1;  1QVF Y;  3GCF A;  2RPR A;  3NH4 A;  3T4N B;  4A3E I;  1S72 1;  3CCJ Z;  1KD1 2;  2YU9 I;  3D9X A;  3I55 Z;  1VQ5 Z;  3CCL 1;  2V8I A;  5AN9 F;  1Z02 A;  1S72 Z;  3NDJ A;  3CCL Z;  2BJO A;  4BXX I;  4RVG A;  3RZD I;  1LQL A;  4E2W A;  1Q81 1;  2QA4 1;  4A3D I;  4XX2 A;  3MZK B;  2K3R A;  2DE7 A;  5IT9 b;  2QA4 Z;  1VQM 1;  1RO0 A;  2PMZ A;  1Q86 1;  3D6W A;  2O4H A;  5A2Q f;  4A3C I;  1VQ8 1;  1VQM Z;  2EGT A;  2R7Z I;  3CC2 1;  2VPZ A;  3S1Q I;  3MON A;  1DL6 A;  1VQ8 Z;  3BG0 B;  1S7M A;  3IR7 A;  1KRL A;  1Y1W I;  3S15 I;  1USP B;  2QKD A;  4NBE A;  3TDH B;  1M90 1;  3CCQ 1;  2QRD B;  3H0G I;  4RVF A;  1QVG Y;  2R92 I;  3CC2 Z;  1X0T A;  3G71 1;  1VQ6 1;  2E2J I;  1N8R 1;  3GTM I;  3CCQ Z;  3CC4 1;  1K73 2;  2JUB A;  2GU2 A;  3PO3 I;  3G71 Z;  1VQ6 Z;  5C4J I;  1PFT A;  1JJ2 Y;  3S2H I;  3CC4 Z;  1X3W A;  2E2I I;  1Q16 A;  3VMH A;  1VQN 1;  1K8A 1;  3VMG A;  4HGY A;  2G2K A;  1Q82 1;  2Q4Z A;  1VQN Z;  2QLV B;  4NBG A;  2KPI A;  1WZN A;  4NB8 A;  4A3K I;  3GTP I;  1K83 I;  3J81 b;  3CCE 1;  1USP A;  4CL1 A;  3CCE Z;  1WII A;  3HOU I;  2OOX B;  2M6N A;  5FLX f;  1P9N A;  2KI7 B;  2E9H A;  2OOY B;  2RT9 A;  4A3B I;  4EWC A;  1YI2 1;  3PO3 S;  5C4X I;  4NBC A;  4MD9 A;  1VQP 1;  2LEX A;  4A3M I;  4NBB A;  3I56 1;  3QWU A;  5CM2 M;  1YI2 Z;  3OW2 Y;  2LIY A;  4S1T A;  1VQ7 1;  3NH5 A;  3VB9 A;  5IP9 I;  1VQP Z;  4HH4 A;  2GTI A;  3I56 Z;  1NJI 1;  1L1O C;  1VQ7 Z;  2JA7 I;  5A2Q b;  3OW2 Z;  3J7A 4;  2P3Y A;  2F4M A;  4A3G I;  1ZB9 A;  3CCU 1;  3CME 1;  5D1O B;  1Q82 2;  2M48 A;  2V3V A;  4NBF A;  1Y1V I;  4AYB A;  3CCS 1;  4QTT A;  1Y8C A;  3CME Z;  1YUK A;  2F4O A;  3CCU Z;  1TWC I;  2W04 A;  2JR6 A;  1TWF I;  1W2B Y;  5D1P A;  3CCS Z;  1SIW A;  3S1N I;  2VUG A;  1QYP A;  1RO2 A;  3CMA 1;  1JWH C;  2JIO A;  2RBL A;  1Q7Y 2;  2JS4 A;  1YJ9 1;  3MZL B;  2JIP A;  2ZAE B;  3Q87 A;  2P28 A;  1KC8 2;  3CMA Z;  3CD6 1;  4E31 A;  2HU9 A;  2R6M A;  1YJ9 Z;  1W2B Z;  5C3E I;  4RVH A;  3G6E 1;  3RZO I;  1I50 I;  3S1R I;  3CD6 Z;  2NVT I;  1K9M 1;  3BG1 B;  3F3F C;  3S16 I;  1TFI A;  2WAQ A;  3HOX I;  3G6E Z;  3GKQ A;  1M1K 1;  3IF8 A;  4A3L I;  4HGZ A;  3JAM f;  5D1O A;  2RIQ A;  3HKZ A;  4MH4 A;  3FKI I;  2R93 I;  1RO4 A;  1AA6 A;  4NOZ A;  3VMI A;  4NH1 C;  2WB1 A;  1ZB8 A;  5FLX b;  1Z03 A;  4Y7N I;  4X6A I;  4E2X A;  1SFO I;  1RNI A;  3KIH A;  2V45 A;  5T6B A;  3I07 A;  4TNU A;  4A3F I;  4RS4 A;  1Q81 2;  3GTL I;  2PK7 A;  3HOY I;  1QXF A;  2QEX 1;  3M4O I;  3J80 b;  3EED A;  1Q86 2;  2QEX Z;  2QRC B;  2O53 A;  2DE5 A;  1VQ9 1; 
#chains in the Genus database with same CATH homology
 3GTM S;  2H85 A;  3S17 I;  1KQS Z;  4RV9 A;  2VF1 A;  1VQ9 Z;  2LFU A;  3GTG I;  3G4S 1;  1M90 2;  1RLY A;  5IP7 I;  4BY7 I;  2I3C A;  3NH8 A;  3G4S Z;  1N8R 2;  3S2D I;  3GTJ I;  3EER A;  3CCV 1;  3U50 C;  1Z01 A;  2JA8 I;  4BBS I;  4E33 A;  1YHQ 1;  4NBH A;  4E2Y A;  4QTU A;  3CCV Z;  1K8A 2;  3KIF A;  1YHQ Z;  3J81 f;  3GTK I;  4MD8 A;  2J6A A;  1RQF A;  2YAD A;  3LUS A;  3GTQ I;  4Y52 I;  3CXC Z;  4NFR A;  4MON A;  2NVQ I;  3K7A I;  2E2H I;  3FQQ A;  3H3V J;  3ESW A;  3JAM b;  1YJW 1;  1YUA A;  3P5J B;  1QVF Z;  1VQL 1;  2OTJ 1;  1YJW Z;  3FQM A;  1QF8 A;  2Q51 A;  1YJN 1;  2QRE B;  1VQL Z;  3IX0 A;  4E32 A;  1VQ4 1;  2OTJ Z;  3PO2 I;  1YJN Z;  2JA6 I;  1R9T I;  2IZ3 A;  1I6H I;  1VQ4 Z;  4NBD A;  3HOZ I;  3CQZ I;  2IZ4 A;  2Y0S A;  1VLA A;  4BBR I;  1NJI 2;  4NB9 A;  3M3Y I;  4A3J I;  3CC7 1;  1Y1V S;  2NVY I;  2W03 A;  4MD7 A;  1TWG I;  3S14 I;  3IFU A;  3CC7 Z;  3I4N I;  3HOW I;  2DE6 A;  4DQY B;  3CCM 1;  5IT9 f;  5C44 I;  1ZH1 A;  3NFZ A;  4DGL A;  1I3Q I;  1KD1 1;  2GTH A;  4BY1 I;  3CCM Z;  5FLM I;  1KQS Y;  1QVG Z;  2OTL 1;  3I4M I;  1NP6 A;  2PM9 A;  1YIJ 1;  1TWH I;  2OTL Z;  3F3P C;  4A3I I;  1JJ2 Z;  2V8J A;  2NVX I;  1YIT 1;  2JMO A;  3GTO I;  1YIJ Z;  4A93 I;  1NUI A;  2RHB A;  1ML8 A;  4NBA A;  4RVD A;  3VTN A;  3S1M I;  3NDI A;  1YIT Z;  3CPW Y;  1N2F A;  2B63 I;  4E30 A;  2HF1 A;  1Q7Y 1;  1K9M 2;  4MRI A;  2K5R A;  1M1K 2;  5LL6 f;  1WCM I;  1KC8 1;  2JA5 I;  4E2Z A;  3CCR 1;  2QR1 B;  4MXU A;  1VQO 1;  2AKL A;  3HOV I;  3CPW Z;  2VUM I;  3CXC Y;  1VQK 1;  3CCR Z;  2V8K A;  1WW9 A;  3TE5 B;  1VQO Z;  5T67 A;  1TWA I;  1VQK Z;  3CCJ 1;  2JNY A;  3J80 f;  1K73 1;  3I55 1;  5T64 A;  2OZK A;  4DK1 A;  1X3Z A;  1VQ5 1;  1QVF Y;  4A3E I;  2RPR A;  3GCF A;  3NH4 A;  3T4N B;  1S72 1;  3CCJ Z;  1KD1 2;  2YU9 I;  3D9X A;  3I55 Z;  1VQ5 Z;  3CCL 1;  2V8I A;  5AN9 F;  1Z02 A;  1S72 Z;  3NDJ A;  3CCL Z;  2BJO A;  4BXX I;  4RVG A;  3RZD I;  1LQL A;  4E2W A;  1Q81 1;  2QA4 1;  4A3D I;  4XX2 A;  3MZK B;  2K3R A;  2DE7 A;  5IT9 b;  2QA4 Z;  1VQM 1;  1RO0 A;  2PMZ A;  1Q86 1;  3D6W A;  2O4H A;  5A2Q f;  4A3C I;  1VQ8 1;  1VQM Z;  2EGT A;  2R7Z I;  3CC2 1;  3S1Q I;  3MON A;  1DL6 A;  1VQ8 Z;  3BG0 B;  1S7M A;  1KRL A;  1Y1W I;  3S15 I;  1USP B;  2QKD A;  4NBE A;  3TDH B;  1M90 1;  3CCQ 1;  2QRD B;  3H0G I;  4RVF A;  1QVG Y;  2R92 I;  3CC2 Z;  1X0T A;  3G71 1;  1VQ6 1;  2E2J I;  1N8R 1;  3GTM I;  3CCQ Z;  3CC4 1;  1K73 2;  2JUB A;  2GU2 A;  3PO3 I;  3G71 Z;  1VQ6 Z;  5C4J I;  1PFT A;  1JJ2 Y;  3S2H I;  3CC4 Z;  1X3W A;  2E2I I;  3VMH A;  1VQN 1;  1K8A 1;  3VMG A;  4HGY A;  2G2K A;  1Q82 1;  2Q4Z A;  1VQN Z;  2QLV B;  4NBG A;  2KPI A;  4NB8 A;  4A3K I;  3GTP I;  1K83 I;  3J81 b;  3CCE 1;  1USP A;  4CL1 A;  3CCE Z;  1WII A;  3HOU I;  2OOX B;  2M6N A;  5FLX f;  1P9N A;  2KI7 B;  2E9H A;  2OOY B;  2RT9 A;  4A3B I;  4EWC A;  1YI2 1;  3PO3 S;  5C4X I;  4NBC A;  4MD9 A;  1VQP 1;  4A3M I;  4NBB A;  3I56 1;  3QWU A;  5CM2 M;  1YI2 Z;  3OW2 Y;  2LIY A;  4S1T A;  1VQ7 1;  3NH5 A;  3VB9 A;  5IP9 I;  1VQP Z;  4HH4 A;  2GTI A;  3I56 Z;  1NJI 1;  1L1O C;  1VQ7 Z;  2JA7 I;  5A2Q b;  3OW2 Z;  3J7A 4;  2P3Y A;  2F4M A;  4A3G I;  1ZB9 A;  3CCU 1;  3CME 1;  5D1O B;  1Q82 2;  2M48 A;  4NBF A;  1Y1V I;  4AYB A;  3CCS 1;  4QTT A;  3CCU Z;  3CME Z;  1YUK A;  2F4O A;  1TWC I;  2W04 A;  2JR6 A;  1TWF I;  1W2B Y;  5D1P A;  3CCS Z;  3S1N I;  2VUG A;  1QYP A;  1RO2 A;  3CMA 1;  1JWH C;  2RBL A;  1Q7Y 2;  2JS4 A;  1YJ9 1;  3MZL B;  3Q87 A;  2ZAE B;  2P28 A;  1KC8 2;  3CMA Z;  3CD6 1;  4E31 A;  2HU9 A;  2R6M A;  1YJ9 Z;  1W2B Z;  5C3E I;  4RVH A;  3G6E 1;  3RZO I;  1I50 I;  3S1R I;  3CD6 Z;  2NVT I;  1K9M 1;  3BG1 B;  3F3F C;  3S16 I;  1TFI A;  2WAQ A;  3HOX I;  3G6E Z;  3GKQ A;  1M1K 1;  3IF8 A;  4A3L I;  4HGZ A;  3JAM f;  5D1O A;  2RIQ A;  3HKZ A;  4MH4 A;  3FKI I;  2R93 I;  1RO4 A;  4NOZ A;  3VMI A;  4NH1 C;  2WB1 A;  1ZB8 A;  5FLX b;  1Z03 A;  4Y7N I;  4X6A I;  4E2X A;  1SFO I;  1RNI A;  3KIH A;  5T6B A;  3I07 A;  4TNU A;  4A3F I;  4RS4 A;  1Q81 2;  3GTL I;  2PK7 A;  3HOY I;  2QEX 1;  3M4O I;  3J80 b;  3EED A;  1Q86 2;  2QEX Z;  2QRC B;  2O53 A;  2DE5 A;  1VQ9 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...