3CCQ1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccq100
1VQOZ 1VQKZ 1Q811 1KQSZ 1VQ41 1M901 3I55Z 3CMAZ 1YJWZ 1VQ9Z 3CCVZ 2OTJ1 1N8R1 3CXCZ 3CCR1 1VQ5Z 3CCS1 1W2BY 3CCQ1 1Q821 2QA41 3CD61 3CCEZ 1K8A1 1VQNZ 1VQ6Z 1QVGZ 1QVFY 3CPWZ 3CME1 1VQ7Z 3CC21 1YJNZ 1YIJ1 3CCU1 1Q861 1KC82 3CCJZ 3G711 1S721 1VQ81 1YHQ1 3I561 1VQL1 3G4S1 3CC71 1K9M1 1JJ2Y 3CCM1 1VQPZ 1M1K2 3OW2Z 1YJ91 3I551 3CCLZ 2QEXZ 1YI21 3CCRZ 3CCV1 1YITZ 1VQM1 3CC41 3G6E1 1Q7Y2 3CCQZ 1VQ51 2QA4Z 3CD6Z 1Q812 1KQSY 3CC2Z 3CXCY 1VQ71 2OTL1 1YJN1 1VQO1 1VQ4Z 1Q822 1VQ8Z 1S72Z 1VQK1 1YHQZ 1VQLZ 1NJI2 3G4SZ 3CC7Z 2OTJZ 1K8A2 3CMA1 1KD12 1YJW1 1VQ91 1K732 1Q7Y1 1QVGY 1K9M2 3CPWY 3CCSZ 1VQP1 1Q862 1YJ9Z 1KC81 1YI2Z 1M902 3CCE1 3CCL1 2QEX1 3G6EZ 1VQMZ 1JJ2Z 3CC4Z 1N8R2 1VQN1 3CMEZ 1VQ61 1YIT1 1W2BZ 1YIJZ 3CCUZ 1M1K1 1NJI1 3G71Z 3I56Z 1KD11 3CCJ1 3OW2Y 1QVFZ 1K731 2OTLZ 3CCMZ
chains in the Genus database with same CATH superfamily
1VQOZ 2RT9A 3NFZA 3HOVI 1USPA 4E33A 3RZOI 2R7ZI 2OTJ1 4NBGA 1Y1WI 3NH8A 1W2BY 3J81b 2QKDA 4NB8A 2QA41 4A3GI 4HGYA 1VQNZ 1QVFY 3PO3I 2V8JA 1RQFA 1VQ7Z 1Y8CA 4A3LI 3NDJA 3CC21 2OOYB 3GCFA 3GKQA 2LIYA 3CCJZ 2DE6A 1VQ81 3IFUA 3I561 1VQL1 3G4S1 3S2DI 2KI7B 5A2Qf 3FQMA 1USPB 1M1K2 1R9TI 4RVDA 1ZH1A 1TFIA 3EERA 3I551 2QEXZ 3CCV1 3S1QI 2JMOA 4E30A 3D9XA 4DGLA 3CD6Z 3I07A 5C4XI 1WCMI 2J6AA 1PFTA 3CQZI 2Q4ZA 3CXCY 2OTL1 2RBLA 1YJN1 5CM2M 3RZDI 1S72Z 2VUMI 3VMGA 2JA6I 3S14I 3GTJI 3GTGI 4HGZA 5IT9f 3CPWY 3FQQA 1VQP1 3PO3S 4RVHA 1LQLA 2K5RA 1TWFI 2M48A 2JNYA 2QLVB 3S2HI 1X3ZA 5C3EI 1DL6A 2JUBA 3NDIA 3CMEZ 2V45A 4RVFA 4NBDA 5IP9I 3CCUZ 4EWCA 1RO0A 4E2ZA 1Y1VI 2PK7A 2P28A 4NOZA 3K7AI 5T6BA 4QTUA 4BY1I 2Q51A 3M3YI 1JWHC 2JS4A 4E31A 2JA5I 2GU2A 4RVGA 1I3QI 2P3YA 1VQKZ 1KQSZ 2QRDB 1Z01A 4MONA 1VQ9Z 1VLAA 2I3CA 2V8KA 1VQ5Z 3CCQ1 3J81f 2F4OA 3CCEZ 2JA7I 2F4MA 2DE5A 2PMZA 4A3CI 1WJ2A 3HOYI 2JA8I 4E2WA 1Q861 2WAQA 1I6HI 3IF8A 2NVXI 2JIMA 4MD8A 5LL6f 1YHQ1 1I50I 1RO2A 3CCM1 3QWUA 2VUGA 3H3VJ 2GTHA 3BG0B 4BBRI 1K83I 4A3II 2DE7A 1Z03A 1YJ91 3CCLZ 1YI21 2W03A 1Y1VS 1VQM1 2QA4Z 1Q16A 3HOXI 1N2FA 3I4NI 4E32A 1X3WA 2WB1A 3CC2Z 3ESWA 2NVYI 1TWHI 1VQ71 1VQ4Z 3NH5A 2R93I 1VQ8Z 4S1TA 5D1OA 4NBBA 1VQLZ 1NJI2 3G4SZ 3HOZI 4BXXI 3CMA1 1KD12 1YJW1 2G2KA 3JAMb 1K732 3S17I 1Q7Y1 1FDOA 3CCSZ 2RIQA 3P5JB 1X0TA 1Q862 2M6NA 1YUAA 2QEX1 1JJ2Z 1VQ61 1YIJZ 3J80b 3J7A4 4MD9A 3G71Z 3EEDA 2K3RA 2RPRA 2OTLZ 1K9M1 3TDHB 1Q811 5D1OB 2LEXA 1M901 2VPWA 4XX2A 3VTNA 1WIIA 1N8R1 3F3FC 2JIQA 3CCR1 4A3KI 2OZKA 1Q821 1QYPA 4NBAA 1ML8A 5C44I 2O4HA 1QVGZ 4NBHA 3CME1 2E2II 2QRCB 1NUIA 3CCU1 4MH4A 3GTPI 4BY7I 3CC71 4NFRA 3F3PC 1P9NA 2JR6A 3NH4A 2O53A 4A3FI 3OW2Z 2HU9A 3GTMI 1S7MA 2E9HA 1WZNA 1KRLA 1YITZ 3G6E1 3CC41 2OOXB 3CCQZ 1VQ51 5IP7I 1Q812 1KQSY 3HKZA 3S16I 1NP6A 4E2XA 2JIRA 3H0GI 5T64A 1AA6A 2RHBA 1WW9A 3U50C 2E2HI 1VQO1 2R6MA 1Q822 1YHQZ 2OTJZ 1ZB9A 3JAMf 1Z02A 5FLMI 4Y7NI 1YJ9Z 3TE5B 1KC81 1RNIA 1YI2Z 2JIOA 1TWAI 3CCL1 2H85A 1VQMZ 2QR1B 1VQN1 2V8IA 3MZKB 3J80f 2E2JI 2V3VA 2B63I 3I56Z 3CCJ1 4RS4A 5C4JI 4MD7A 4A3BI 3GTMS 2VF1A 1VQ41 4Y52I 2BJOA 3I55Z 3CMAZ 2LFUA 1YJWZ 3S15I 3CCVZ 2AYDA 3KIHA 3CXCZ 2QREB 1YUKA 1QF8A 3GTQI 3CCS1 3D6WA 1SIWA 2NAPA 3CD61 1ZB8A 2ZAEB 2GTIA 1K8A1 1VQ6Z 3FKII 4NB9A 4E2YA 3CPWZ 5D1PA 1TWCI 1YJNZ 1YIJ1 2KPIA 2W04A 2R92I 3MZLB 1KC82 4X6AI 2E7ZA 5FLXf 4NBFA 4TNUA 3G711 1S721 3HOUI 1JJ2Y 1VQPZ 5A2Qb 2PM9A 2VPYA 2IV2X 3KIFA 4MXUA 3S1NI 2Y0SA 3VMHA 3CCRZ 3VB9A 4AYBA 4NH1C 1Q7Y2 4DQYB 2AKLA 4A3DI 2IZ3A 1L1OC 2YU9I 5T67A 3IX0A 3I4MI 5FLXb 1TWGI 4DK1A 2HF1A 3T4NB 4A3EI 3HOWI 4BBSI 1RO4A 3S1MI 3D2LA 4NBCA 3S1RI 3M4OI 1VQK1 3Q87A 3CC7Z 1K8A2 5AN9F 4RV9A 1VQ91 4NBEA 1QVGY 3GTOI 1K9M2 3IR7A 5IT9b 3PO2I 3MONA 3VMIA 4A3MI 1FDIA 2VPXA 1M902 4CL1A 4A93I 2NVQI 3CCE1 2IZ4A 4A3JI 4QTTA 3G6EZ 3CC4Z 1N8R2 3GTLI 1YIT1 3LUSA 1W2BZ 2JIPA 3GTKI 1SFOI 4HH4A 1QXFA 1RLYA 2EGTA 2NVTI 1M1K1 1NJI1 3BG1B 1KD11 2VPZA 3OW2Y 1QVFZ 1K731 4MRIA 3CCMZ 2YADA
chains in the Genus database with same CATH topology
1VQOZ 2RT9A 3NFZA 3HOVI 1USPA 4E33A 3RZOI 2R7ZI 2OTJ1 4NBGA 1Y1WI 3NH8A 1W2BY 3J81b 2QKDA 4NB8A 2QA41 4A3GI 4HGYA 1VQNZ 1QVFY 3PO3I 2V8JA 1RQFA 1VQ7Z 4A3LI 3NDJA 3CC21 2OOYB 3GCFA 3GKQA 2LIYA 3CCJZ 2DE6A 1VQ81 3IFUA 3I561 1VQL1 3G4S1 3S2DI 2KI7B 5A2Qf 3FQMA 1USPB 1M1K2 1R9TI 4RVDA 1ZH1A 1TFIA 3EERA 3I551 2QEXZ 3CCV1 3S1QI 2JMOA 4E30A 3D9XA 4DGLA 3CD6Z 3I07A 5C4XI 1WCMI 2J6AA 1PFTA 3CQZI 2Q4ZA 3CXCY 2OTL1 2RBLA 1YJN1 5CM2M 3RZDI 1S72Z 2VUMI 3VMGA 2JA6I 3S14I 3GTJI 3GTGI 4HGZA 5IT9f 3CPWY 3FQQA 1VQP1 3PO3S 4RVHA 1LQLA 2K5RA 1TWFI 2M48A 2JNYA 2QLVB 3S2HI 1X3ZA 5C3EI 1DL6A 2JUBA 3NDIA 3CMEZ 4RVFA 4NBDA 5IP9I 3CCUZ 4EWCA 1RO0A 4E2ZA 1Y1VI 2PK7A 2P28A 4NOZA 3K7AI 5T6BA 4QTUA 4BY1I 2Q51A 3M3YI 1JWHC 2JS4A 4E31A 2JA5I 2GU2A 4RVGA 1I3QI 2P3YA 1VQKZ 1KQSZ 2QRDB 1Z01A 4MONA 1VQ9Z 1VLAA 2I3CA 2V8KA 1VQ5Z 3CCQ1 3J81f 2F4OA 3CCEZ 2JA7I 2F4MA 2DE5A 2PMZA 4A3CI 3HOYI 2JA8I 4E2WA 1Q861 2WAQA 1I6HI 3IF8A 2NVXI 4MD8A 1YHQ1 5LL6f 1I50I 1RO2A 3CCM1 3QWUA 2VUGA 3H3VJ 2GTHA 3BG0B 4BBRI 1K83I 4A3II 2DE7A 1Z03A 1YJ91 3CCLZ 1YI21 2W03A 1Y1VS 1VQM1 2QA4Z 3HOXI 1N2FA 3I4NI 4E32A 1X3WA 2WB1A 3CC2Z 3ESWA 2NVYI 1TWHI 1VQ71 1VQ4Z 3NH5A 2R93I 1VQ8Z 4S1TA 5D1OA 4NBBA 1VQLZ 1NJI2 3G4SZ 3HOZI 4BXXI 3CMA1 1KD12 1YJW1 2G2KA 3JAMb 1K732 3S17I 1Q7Y1 3CCSZ 2RIQA 3P5JB 1X0TA 1Q862 2M6NA 1YUAA 2QEX1 1JJ2Z 1VQ61 1YIJZ 3J80b 3J7A4 4MD9A 3G71Z 3EEDA 2K3RA 2RPRA 2OTLZ 1K9M1 3TDHB 1Q811 5D1OB 1M901 4XX2A 3VTNA 1WIIA 1N8R1 3F3FC 3CCR1 4A3KI 2OZKA 1Q821 1QYPA 4NBAA 1ML8A 5C44I 2O4HA 1QVGZ 4NBHA 3CME1 2E2II 2QRCB 1NUIA 3CCU1 4MH4A 3GTPI 4BY7I 3CC71 4NFRA 3F3PC 1P9NA 2JR6A 3NH4A 2O53A 4A3FI 3OW2Z 2HU9A 3GTMI 1S7MA 2E9HA 1KRLA 1YITZ 3G6E1 3CC41 2OOXB 3CCQZ 1VQ51 5IP7I 1Q812 1KQSY 3HKZA 3S16I 1NP6A 4E2XA 3H0GI 5T64A 2RHBA 1WW9A 3U50C 2E2HI 1VQO1 2R6MA 1Q822 1YHQZ 2OTJZ 1ZB9A 3JAMf 1Z02A 5FLMI 4Y7NI 1YJ9Z 3TE5B 1KC81 1RNIA 1YI2Z 1TWAI 3CCL1 2H85A 1VQMZ 2QR1B 1VQN1 2V8IA 3MZKB 3J80f 2E2JI 2B63I 3I56Z 3CCJ1 4RS4A 5C4JI 4MD7A 4A3BI 3GTMS 2VF1A 1VQ41 4Y52I 2BJOA 3I55Z 3CMAZ 2LFUA 1YJWZ 3S15I 3CCVZ 3KIHA 3CXCZ 2QREB 1YUKA 1QF8A 3GTQI 3CCS1 3D6WA 3CD61 1ZB8A 2ZAEB 2GTIA 1K8A1 1VQ6Z 3FKII 4NB9A 4E2YA 3CPWZ 5D1PA 1TWCI 1YJNZ 1YIJ1 2KPIA 2W04A 2R92I 3MZLB 1KC82 4X6AI 5FLXf 4NBFA 4TNUA 3G711 1S721 3HOUI 1JJ2Y 1VQPZ 5A2Qb 2PM9A 3KIFA 4MXUA 3S1NI 2Y0SA 3VMHA 3CCRZ 3VB9A 4AYBA 4NH1C 1Q7Y2 4DQYB 2AKLA 4A3DI 2IZ3A 1L1OC 2YU9I 5T67A 3IX0A 3I4MI 5FLXb 1TWGI 4DK1A 2HF1A 3T4NB 4A3EI 3HOWI 4BBSI 1RO4A 3S1MI 4NBCA 3S1RI 3M4OI 1VQK1 3Q87A 3CC7Z 1K8A2 5AN9F 4RV9A 1VQ91 4NBEA 1QVGY 3GTOI 1K9M2 5IT9b 3PO2I 3MONA 3VMIA 4A3MI 4A93I 1M902 4CL1A 2NVQI 3CCE1 2IZ4A 4A3JI 4QTTA 3G6EZ 3CC4Z 1N8R2 3GTLI 1YIT1 3LUSA 1W2BZ 3GTKI 1SFOI 4HH4A 2EGTA 1RLYA 2NVTI 1M1K1 1NJI1 3BG1B 1KD11 3OW2Y 1QVFZ 1K731 4MRIA 3CCMZ 2YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  1VQK Z;  1Q81 1;  1KQS Z;  1VQ4 1;  1M90 1;  3I55 Z;  3CMA Z;  1YJW Z;  1VQ9 Z;  3CCV Z;  2OTJ 1;  1N8R 1;  3CXC Z;  3CCR 1;  1VQ5 Z;  3CCS 1;  1W2B Y;  3CCQ 1;  1Q82 1;  2QA4 1;  3CD6 1;  3CCE Z;  1K8A 1;  1VQN Z;  1VQ6 Z;  1QVG Z;  1QVF Y;  3CPW Z;  3CME 1;  1VQ7 Z;  3CC2 1;  1YJN Z;  1YIJ 1;  3CCU 1;  1Q86 1;  1KC8 2;  3CCJ Z;  3G71 1;  1S72 1;  1VQ8 1;  1YHQ 1;  3I56 1;  1VQL 1;  3G4S 1;  3CC7 1;  1K9M 1;  1JJ2 Y;  3CCM 1;  1VQP Z;  1M1K 2;  3OW2 Z;  1YJ9 1;  3I55 1;  3CCL Z;  2QEX Z;  1YI2 1;  3CCR Z;  3CCV 1;  1YIT Z;  1VQM 1;  3CC4 1;  3G6E 1;  1Q7Y 2;  3CCQ Z;  1VQ5 1;  2QA4 Z;  3CD6 Z;  1Q81 2;  1KQS Y;  3CC2 Z;  3CXC Y;  1VQ7 1;  2OTL 1;  1YJN 1;  1VQO 1;  1VQ4 Z;  1Q82 2;  1VQ8 Z;  1S72 Z;  1VQK 1;  1YHQ Z;  1VQL Z;  1NJI 2;  3G4S Z;  3CC7 Z;  2OTJ Z;  1K8A 2;  3CMA 1;  1KD1 2;  1YJW 1;  1VQ9 1;  1K73 2;  1Q7Y 1;  1QVG Y;  1K9M 2;  3CPW Y;  3CCS Z;  1VQP 1;  1Q86 2;  1YJ9 Z;  1KC8 1;  1YI2 Z;  1M90 2;  3CCE 1;  3CCL 1;  2QEX 1;  3G6E Z;  1VQM Z;  1JJ2 Z;  3CC4 Z;  1N8R 2;  1VQN 1;  3CME Z;  1VQ6 1;  1YIT 1;  1W2B Z;  1YIJ Z;  3CCU Z;  1M1K 1;  1NJI 1;  3G71 Z;  3I56 Z;  1KD1 1;  3CCJ 1;  3OW2 Y;  1QVF Z;  1K73 1;  2OTL Z;  3CCM Z; 
#chains in the Genus database with same CATH topology
 1VQO Z;  2RT9 A;  3NFZ A;  3HOV I;  1USP A;  4E33 A;  3RZO I;  2R7Z I;  2OTJ 1;  4NBG A;  1Y1W I;  3NH8 A;  1W2B Y;  3J81 b;  2QKD A;  4NB8 A;  2QA4 1;  4A3G I;  4HGY A;  1VQN Z;  1QVF Y;  3PO3 I;  2V8J A;  1RQF A;  1VQ7 Z;  1Y8C A;  4A3L I;  3NDJ A;  3CC2 1;  2OOY B;  3GCF A;  3GKQ A;  2LIY A;  3CCJ Z;  2DE6 A;  1VQ8 1;  3IFU A;  3I56 1;  1VQL 1;  3G4S 1;  3S2D I;  2KI7 B;  5A2Q f;  3FQM A;  1USP B;  1M1K 2;  1R9T I;  4RVD A;  1ZH1 A;  1TFI A;  3EER A;  3I55 1;  2QEX Z;  3CCV 1;  3S1Q I;  2JMO A;  4E30 A;  3D9X A;  4DGL A;  3CD6 Z;  3I07 A;  5C4X I;  1WCM I;  2J6A A;  1PFT A;  3CQZ I;  2Q4Z A;  3CXC Y;  2OTL 1;  2RBL A;  1YJN 1;  5CM2 M;  3RZD I;  1S72 Z;  2VUM I;  3VMG A;  2JA6 I;  3S14 I;  3GTJ I;  3GTG I;  4HGZ A;  5IT9 f;  3CPW Y;  3FQQ A;  1VQP 1;  3PO3 S;  4RVH A;  1LQL A;  2K5R A;  1TWF I;  2M48 A;  2JNY A;  2QLV B;  3S2H I;  1X3Z A;  5C3E I;  1DL6 A;  2JUB A;  3NDI A;  3CME Z;  2V45 A;  4RVF A;  4NBD A;  5IP9 I;  3CCU Z;  4EWC A;  1RO0 A;  4E2Z A;  1Y1V I;  2PK7 A;  2P28 A;  4NOZ A;  3K7A I;  5T6B A;  4QTU A;  4BY1 I;  2Q51 A;  3M3Y I;  1JWH C;  2JS4 A;  4E31 A;  2JA5 I;  2GU2 A;  4RVG A;  1I3Q I;  2P3Y A;  1VQK Z;  1KQS Z;  2QRD B;  1Z01 A;  4MON A;  1VQ9 Z;  1VLA A;  2I3C A;  2V8K A;  1VQ5 Z;  3CCQ 1;  3J81 f;  2F4O A;  3CCE Z;  2JA7 I;  2F4M A;  2DE5 A;  2PMZ A;  4A3C I;  1WJ2 A;  3HOY I;  2JA8 I;  4E2W A;  1Q86 1;  2WAQ A;  1I6H I;  3IF8 A;  2NVX I;  2JIM A;  4MD8 A;  5LL6 f;  1YHQ 1;  1I50 I;  1RO2 A;  3CCM 1;  3QWU A;  2VUG A;  3H3V J;  2GTH A;  3BG0 B;  4BBR I;  1K83 I;  4A3I I;  2DE7 A;  1Z03 A;  1YJ9 1;  3CCL Z;  1YI2 1;  2W03 A;  1Y1V S;  1VQM 1;  2QA4 Z;  1Q16 A;  3HOX I;  1N2F A;  3I4N I;  4E32 A;  1X3W A;  2WB1 A;  3CC2 Z;  3ESW A;  2NVY I;  1TWH I;  1VQ7 1;  1VQ4 Z;  3NH5 A;  2R93 I;  1VQ8 Z;  4S1T A;  5D1O A;  4NBB A;  1VQL Z;  1NJI 2;  3G4S Z;  3HOZ I;  4BXX I;  3CMA 1;  1KD1 2;  1YJW 1;  2G2K A;  3JAM b;  1K73 2;  3S17 I;  1Q7Y 1;  1FDO A;  3CCS Z;  2RIQ A;  3P5J B;  1X0T A;  1Q86 2;  2M6N A;  1YUA A;  2QEX 1;  1JJ2 Z;  1VQ6 1;  1YIJ Z;  3J80 b;  3J7A 4;  4MD9 A;  3G71 Z;  3EED A;  2K3R A;  2RPR A;  2OTL Z;  1K9M 1;  3TDH B;  1Q81 1;  5D1O B;  2LEX A;  1M90 1;  2VPW A;  4XX2 A;  3VTN A;  1WII A;  1N8R 1;  3F3F C;  2JIQ A;  3CCR 1;  4A3K I;  2OZK A;  1Q82 1;  1QYP A;  4NBA A;  1ML8 A;  5C44 I;  2O4H A;  1QVG Z;  4NBH A;  3CME 1;  2E2I I;  2QRC B;  1NUI A;  3CCU 1;  4MH4 A;  3GTP I;  4BY7 I;  3CC7 1;  4NFR A;  3F3P C;  1P9N A;  2JR6 A;  3NH4 A;  2O53 A;  4A3F I;  3OW2 Z;  2HU9 A;  3GTM I;  1S7M A;  2E9H A;  1WZN A;  1KRL A;  1YIT Z;  3G6E 1;  3CC4 1;  2OOX B;  3CCQ Z;  1VQ5 1;  5IP7 I;  1Q81 2;  1KQS Y;  3HKZ A;  3S16 I;  1NP6 A;  4E2X A;  2JIR A;  3H0G I;  5T64 A;  1AA6 A;  2RHB A;  1WW9 A;  3U50 C;  2E2H I;  1VQO 1;  2R6M A;  1Q82 2;  1YHQ Z;  2OTJ Z;  1ZB9 A;  3JAM f;  1Z02 A;  5FLM I;  4Y7N I;  1YJ9 Z;  3TE5 B;  1KC8 1;  1RNI A;  1YI2 Z;  2JIO A;  1TWA I;  3CCL 1;  2H85 A;  1VQM Z;  2QR1 B;  1VQN 1;  2V8I A;  3MZK B;  3J80 f;  2E2J I;  2V3V A;  2B63 I;  3I56 Z;  3CCJ 1;  4RS4 A;  5C4J I;  4MD7 A;  4A3B I;  3GTM S;  2VF1 A;  1VQ4 1;  4Y52 I;  2BJO A;  3I55 Z;  3CMA Z;  2LFU A;  1YJW Z;  3S15 I;  3CCV Z;  2AYD A;  3KIH A;  3CXC Z;  2QRE B;  1YUK A;  1QF8 A;  3GTQ I;  3CCS 1;  3D6W A;  1SIW A;  2NAP A;  3CD6 1;  1ZB8 A;  2ZAE B;  2GTI A;  1K8A 1;  1VQ6 Z;  3FKI I;  4NB9 A;  4E2Y A;  3CPW Z;  5D1P A;  1TWC I;  1YJN Z;  1YIJ 1;  2KPI A;  2W04 A;  2R92 I;  3MZL B;  1KC8 2;  4X6A I;  2E7Z A;  5FLX f;  4NBF A;  4TNU A;  3G71 1;  1S72 1;  3HOU I;  1JJ2 Y;  1VQP Z;  5A2Q b;  2PM9 A;  2VPY A;  2IV2 X;  3KIF A;  4MXU A;  3S1N I;  2Y0S A;  3VMH A;  3CCR Z;  3VB9 A;  4AYB A;  4NH1 C;  1Q7Y 2;  4DQY B;  2AKL A;  4A3D I;  2IZ3 A;  1L1O C;  2YU9 I;  5T67 A;  3IX0 A;  3I4M I;  5FLX b;  1TWG I;  4DK1 A;  2HF1 A;  3T4N B;  4A3E I;  3HOW I;  4BBS I;  1RO4 A;  3S1M I;  3D2L A;  4NBC A;  3S1R I;  3M4O I;  1VQK 1;  3Q87 A;  3CC7 Z;  1K8A 2;  5AN9 F;  4RV9 A;  1VQ9 1;  4NBE A;  1QVG Y;  3GTO I;  1K9M 2;  3IR7 A;  5IT9 b;  3PO2 I;  3MON A;  3VMI A;  4A3M I;  1FDI A;  2VPX A;  1M90 2;  4CL1 A;  4A93 I;  2NVQ I;  3CCE 1;  2IZ4 A;  4A3J I;  4QTT A;  3G6E Z;  3CC4 Z;  1N8R 2;  3GTL I;  1YIT 1;  3LUS A;  1W2B Z;  2JIP A;  3GTK I;  1SFO I;  4HH4 A;  1QXF A;  1RLY A;  2EGT A;  2NVT I;  1M1K 1;  1NJI 1;  3BG1 B;  1KD1 1;  2VPZ A;  3OW2 Y;  1QVF Z;  1K73 1;  4MRI A;  3CCM Z;  2YAD A; 
#chains in the Genus database with same CATH homology
 1VQO Z;  2RT9 A;  3NFZ A;  3HOV I;  1USP A;  4E33 A;  3RZO I;  2R7Z I;  2OTJ 1;  4NBG A;  1Y1W I;  3NH8 A;  1W2B Y;  3J81 b;  2QKD A;  4NB8 A;  2QA4 1;  4A3G I;  4HGY A;  1VQN Z;  1QVF Y;  3PO3 I;  2V8J A;  1RQF A;  1VQ7 Z;  4A3L I;  3NDJ A;  3CC2 1;  2OOY B;  3GCF A;  3GKQ A;  2LIY A;  3CCJ Z;  2DE6 A;  1VQ8 1;  3IFU A;  3I56 1;  1VQL 1;  3G4S 1;  3S2D I;  2KI7 B;  5A2Q f;  3FQM A;  1USP B;  1M1K 2;  1R9T I;  4RVD A;  1ZH1 A;  1TFI A;  3EER A;  3I55 1;  2QEX Z;  3CCV 1;  3S1Q I;  2JMO A;  4E30 A;  3D9X A;  4DGL A;  3CD6 Z;  3I07 A;  5C4X I;  1WCM I;  2J6A A;  1PFT A;  3CQZ I;  2Q4Z A;  3CXC Y;  2OTL 1;  2RBL A;  1YJN 1;  5CM2 M;  3RZD I;  1S72 Z;  2VUM I;  3VMG A;  2JA6 I;  3S14 I;  3GTJ I;  3GTG I;  4HGZ A;  5IT9 f;  3CPW Y;  3FQQ A;  1VQP 1;  3PO3 S;  4RVH A;  1LQL A;  2K5R A;  1TWF I;  2M48 A;  2JNY A;  2QLV B;  3S2H I;  1X3Z A;  5C3E I;  1DL6 A;  2JUB A;  3NDI A;  3CME Z;  4RVF A;  4NBD A;  5IP9 I;  3CCU Z;  4EWC A;  1RO0 A;  4E2Z A;  1Y1V I;  2PK7 A;  2P28 A;  4NOZ A;  3K7A I;  5T6B A;  4QTU A;  4BY1 I;  2Q51 A;  3M3Y I;  1JWH C;  2JS4 A;  4E31 A;  2JA5 I;  2GU2 A;  4RVG A;  1I3Q I;  2P3Y A;  1VQK Z;  1KQS Z;  2QRD B;  1Z01 A;  4MON A;  1VQ9 Z;  1VLA A;  2I3C A;  2V8K A;  1VQ5 Z;  3CCQ 1;  3J81 f;  2F4O A;  3CCE Z;  2JA7 I;  2F4M A;  2DE5 A;  2PMZ A;  4A3C I;  3HOY I;  2JA8 I;  4E2W A;  1Q86 1;  2WAQ A;  1I6H I;  3IF8 A;  2NVX I;  4MD8 A;  1YHQ 1;  5LL6 f;  1I50 I;  1RO2 A;  3CCM 1;  3QWU A;  2VUG A;  3H3V J;  2GTH A;  3BG0 B;  4BBR I;  1K83 I;  4A3I I;  2DE7 A;  1Z03 A;  1YJ9 1;  3CCL Z;  1YI2 1;  2W03 A;  1Y1V S;  1VQM 1;  2QA4 Z;  3HOX I;  1N2F A;  3I4N I;  4E32 A;  1X3W A;  2WB1 A;  3CC2 Z;  3ESW A;  2NVY I;  1TWH I;  1VQ7 1;  1VQ4 Z;  3NH5 A;  2R93 I;  1VQ8 Z;  4S1T A;  5D1O A;  4NBB A;  1VQL Z;  1NJI 2;  3G4S Z;  3HOZ I;  4BXX I;  3CMA 1;  1KD1 2;  1YJW 1;  2G2K A;  3JAM b;  1K73 2;  3S17 I;  1Q7Y 1;  3CCS Z;  2RIQ A;  3P5J B;  1X0T A;  1Q86 2;  2M6N A;  1YUA A;  2QEX 1;  1JJ2 Z;  1VQ6 1;  1YIJ Z;  3J80 b;  3J7A 4;  4MD9 A;  3G71 Z;  3EED A;  2K3R A;  2RPR A;  2OTL Z;  1K9M 1;  3TDH B;  1Q81 1;  5D1O B;  1M90 1;  4XX2 A;  3VTN A;  1WII A;  1N8R 1;  3F3F C;  3CCR 1;  4A3K I;  2OZK A;  1Q82 1;  1QYP A;  4NBA A;  1ML8 A;  5C44 I;  2O4H A;  1QVG Z;  4NBH A;  3CME 1;  2E2I I;  2QRC B;  1NUI A;  3CCU 1;  4MH4 A;  3GTP I;  4BY7 I;  3CC7 1;  4NFR A;  3F3P C;  1P9N A;  2JR6 A;  3NH4 A;  2O53 A;  4A3F I;  3OW2 Z;  2HU9 A;  3GTM I;  1S7M A;  2E9H A;  1KRL A;  1YIT Z;  3G6E 1;  3CC4 1;  2OOX B;  3CCQ Z;  1VQ5 1;  5IP7 I;  1Q81 2;  1KQS Y;  3HKZ A;  3S16 I;  1NP6 A;  4E2X A;  3H0G I;  5T64 A;  2RHB A;  1WW9 A;  3U50 C;  2E2H I;  1VQO 1;  2R6M A;  1Q82 2;  1YHQ Z;  2OTJ Z;  1ZB9 A;  3JAM f;  1Z02 A;  5FLM I;  4Y7N I;  1YJ9 Z;  3TE5 B;  1KC8 1;  1RNI A;  1YI2 Z;  1TWA I;  3CCL 1;  2H85 A;  1VQM Z;  2QR1 B;  1VQN 1;  2V8I A;  3MZK B;  3J80 f;  2E2J I;  2B63 I;  3I56 Z;  3CCJ 1;  4RS4 A;  5C4J I;  4MD7 A;  4A3B I;  3GTM S;  2VF1 A;  1VQ4 1;  4Y52 I;  2BJO A;  3I55 Z;  3CMA Z;  2LFU A;  1YJW Z;  3S15 I;  3CCV Z;  3KIH A;  3CXC Z;  2QRE B;  1YUK A;  1QF8 A;  3GTQ I;  3CCS 1;  3D6W A;  3CD6 1;  1ZB8 A;  2ZAE B;  2GTI A;  1K8A 1;  1VQ6 Z;  3FKI I;  4NB9 A;  4E2Y A;  3CPW Z;  5D1P A;  1TWC I;  1YJN Z;  1YIJ 1;  2KPI A;  2W04 A;  2R92 I;  3MZL B;  1KC8 2;  4X6A I;  5FLX f;  4NBF A;  4TNU A;  3G71 1;  1S72 1;  3HOU I;  1JJ2 Y;  1VQP Z;  5A2Q b;  2PM9 A;  3KIF A;  4MXU A;  3S1N I;  2Y0S A;  3VMH A;  3CCR Z;  3VB9 A;  4AYB A;  4NH1 C;  1Q7Y 2;  4DQY B;  2AKL A;  4A3D I;  2IZ3 A;  1L1O C;  2YU9 I;  5T67 A;  3IX0 A;  3I4M I;  5FLX b;  1TWG I;  4DK1 A;  2HF1 A;  3T4N B;  4A3E I;  3HOW I;  4BBS I;  1RO4 A;  3S1M I;  4NBC A;  3S1R I;  3M4O I;  1VQK 1;  3Q87 A;  3CC7 Z;  1K8A 2;  5AN9 F;  4RV9 A;  1VQ9 1;  4NBE A;  1QVG Y;  3GTO I;  1K9M 2;  5IT9 b;  3PO2 I;  3MON A;  3VMI A;  4A3M I;  4A93 I;  1M90 2;  4CL1 A;  2NVQ I;  3CCE 1;  2IZ4 A;  4A3J I;  4QTT A;  3G6E Z;  3CC4 Z;  1N8R 2;  3GTL I;  1YIT 1;  3LUS A;  1W2B Z;  3GTK I;  1SFO I;  4HH4 A;  2EGT A;  1RLY A;  2NVT I;  1M1K 1;  1NJI 1;  3BG1 B;  1KD1 1;  3OW2 Y;  1QVF Z;  1K73 1;  4MRI A;  3CCM Z;  2YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...