4A3MI

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI02
4NBAA 4BBSI 4NBHA 4NBFA 1K83I 1USPA 3I07A 1RO4A 2J6AA 2JS4A 4Y7NI 4A3LI 3GTMS 2P3YA 1L1OC 4A3EI 3GTKI 2JNYA 4A3II 4A3MI 1X3WA 2JR6A 1I3QI 2NVQI 3GTQI 2HF1A 2K5RA 1Y1VS 5C4JI 4NBCA 2NVXI 2R7ZI 1I50I 1WW9A 5IP7I 4NBBA 4A3FI 3S1NI 4BXXI 1VLAA 3HOZI 1YUAA 1TWGI 2JA5I 1Y1WI 1WCMI 4MH4A 3GKQA 2PK7A 3PO3S 3RZOI 3VMIA 4QTTA 3PO2I 3S1RI 2AKLA 2YU9I 3GTPI 1SFOI 4NOZA 2B63I 4NB9A 3RZDI 2VUMI 2E2HI 4BY1I 3HOXI 1X3ZA 1LQLA 3H0GI 3S16I 2NVYI 3Q87A 1USPB 1TWAI 1DL6A 1R9TI 4A93I 2F4OA 3S17I 3VMGA 2JA8I 2R92I 5C4XI 3S15I 2JA7I 3GTGI 3K7AI 4QTUA 2NVTI 4BY7I 1TWCI 3S1MI 3M4OI 3HOUI 4A3BI 3HOVI 5CM2M 3M3YI 2R93I 2DE7A 3S2HI 3PO3I 4X6AI 3CQZI 2E2II 4Y52I 3LUSA 2KPIA 3I4MI 2DE5A 1I6HI 3S14I 3GTMI 3H3VJ 3ESWA 2DE6A 4A3GI 3HOWI 3HOYI 5C44I 1TWHI 4A3JI 5FLMI 4A3CI 3VB9A 3D6WA 1NUIA 4BBRI 1Y1VI 4NBGA 3S2DI 4NBEA 3VMHA 4XX2A 4A3DI 5C3EI 2RBLA 1ML8A 3U50C 2JA6I 1ZB8A 2BJOA 3GCFA 4A3KI 4NB8A 1ZB9A 4NBDA 1QYPA 1N2FA 2F4MA 3I4NI 2E2JI 1TWFI 5IP9I 1RLYA 3GTLI 1TFIA 3S1QI 3EERA 3FKII 3GTOI 3GTJI 1PFTA
chains in the Genus database with same CATH superfamily
1QVGY 5AN9F 1RO2A 1USPA 3J80b 1VQM1 3I07A 3CMEZ 1VQ41 3GTMS 2OTLZ 3GTKI 3CCR1 4A3II 1KD12 1X3WA 2HF1A 1Y1VS 4NBCA 2QRDB 5IP7I 4A3FI 1VQ6Z 1K731 2E9HA 3MZLB 2OOXB 1VLAA 3F3PC 4MH4A 3GKQA 3NDJA 4MD8A 3PO3S 3VMIA 3PO2I 1N8R2 1QVFY 1SFOI 1YJWZ 1Q7Y1 4BY1I 3HOXI 2PMZA 1LQLA 1ZH1A 3H0GI 4RV9A 3CCV1 2VPZA 3Q87A 2OZKA 1USPB 3HKZA 2Y0SA 2KI7B 2IZ3A 1DL6A 1Y8CA 1R9TI 1VQPZ 4RVGA 3J81f 3K7AI 4QTUA 5D1OA 3JAMb 1TWCI 3M4OI 1K8A1 5A2Qb 4A3BI 3J80f 2AYDA 3I55Z 3TDHB 3M3YI 2R93I 1QVGZ 4E2XA 3LUSA 3I4MI 4E31A 1VQNZ 2RIQA 3ESWA 2DE6A 5C44I 1Q822 4RS4A 4AYBA 3D6WA 1YUKA 1VQ91 4CL1A 1KD11 2V3VA 4HGZA 4A3DI 1KQSY 1VQ61 2QLVB 1YHQZ 1Z02A 2JA6I 4NB8A 3CCQZ 5T67A 1ZB9A 2VPXA 2G2KA 3I561 5D1OB 3I4NI 1YIT1 2E2JI 1RLYA 4E30A 1QVFZ 1YJW1 3S1QI 1PFTA 3CC4Z 1N8R1 2YADA 4BBSI 4NBHA 1KC82 1S721 1K83I 3CCSZ 2RPRA 4A3LI 1L1OC 1VQP1 3JAMf 3CCL1 4A3MI 5A2Qf 2GU2A 3CXCY 1VQOZ 2K5RA 1YJNZ 1QF8A 1WW9A 1Z01A 4NBBA 3G6EZ 3I551 2ZAEB 3KIHA 2V8KA 1W2BY 4QTTA 1VQ8Z 4RVFA 3GTPI 1VQN1 3CCJZ 2VUMI 2QREB 4S1TA 2E2HI 5T64A 4E2ZA 5D1PA 1YI21 3CCUZ 2WB1A 1Q821 1TWAI 1KQSZ 4DQYB 5LL6f 4A93I 1YHQ1 2F4OA 3S17I 3VMGA 3D2LA 1P9NA 1VQLZ 3GTGI 3G711 2NVTI 3S1MI 2OOYB 3G4SZ 1WZNA 3CC41 3OW2Y 3CCMZ 2M48A 3PO3I 2QEX1 3CC7Z 4Y52I 1RO0A 2KPIA 2QR1B 1I6HI 2O53A 1KC81 2JUBA 4A3GI 3CD6Z 2QKDA 1VQKZ 4DGLA 3P5JB 3VB9A 3CXCZ 3FQMA 4BBRI 4NBGA 2JIRA 1YIJ1 5C3EI 5FLXb 3G6E1 2RBLA 1ML8A 3U50C 1WJ2A 1ZB8A 4A3KI 1VQ71 1QYPA 1W2BZ 2VPWA 2QA4Z 2F4MA 3CME1 3CCJ1 2OTJZ 2OTL1 2GTIA 3EERA 3FKII 2W03A 3IFUA 4NBFA 1RNIA 2J6AA 2JS4A 2K3RA 4A3EI 2GTHA 3CCEZ 2HU9A 2JR6A 2NVQI 1VQL1 3FQQA 2JIQA 1Q812 2NVXI 3NFZA 4BXXI 2V8IA 3OW2Z 1Y1WI 3RZOI 3F3FC 3CC71 3BG1B 2AKLA 2YU9I 4E32A 1YJ9Z 3J7A4 3KIFA 4NOZA 4NB9A 1X3ZA 1VQK1 5FLXf 3S16I 4MONA 2O4HA 4MXUA 1M1K2 1WIIA 4NFRA 4RVDA 2R92I 4TNUA 3CCVZ 1SIWA 3MZKB 2QA41 4BY7I 3MONA 3HOUI 3EEDA 3NDIA 3CC2Z 5CM2M 2V8JA 2DE7A 5T6BA 3CMAZ 2H85A 3J81b 3GTMI 3H3VJ 3IX0A 2W04A 3NH8A 2IV2X 2P28A 1TWHI 1VQ5Z 3CCQ1 3IR7A 1NUIA 1Y1VI 4NBEA 2IZ4A 4MD7A 2VF1A 2BJOA 1Q811 3T4NB 2Q4ZA 2LFUA 2QRCB 1VQ9Z 1N2FA 1M902 1YJ91 3CCS1 1TFIA 3GTJI 4NBAA 3VTNA 3I56Z 3NH5A 3BG0B 1VQO1 1YITZ 1RO4A 4Y7NI 2NAPA 2P3YA 1YJN1 4EWCA 2JNYA 1M1K1 1I3QI 2JIOA 1S72Z 3GTQI 3IF8A 5C4JI 1NP6A 4DK1A 1I50I 1VQ81 2R7ZI 3CC21 3S1NI 1NJI2 3CCLZ 2I3CA 3HOZI 1YUAA 1TWGI 3NH4A 2JA5I 1WCMI 1X0TA 1Q862 2PK7A 1FDIA 3S1RI 3CMA1 3CCU1 1K9M2 1RQFA 1JJ2Y 3CPWY 2B63I 3RZDI 2JIPA 2LEXA 5IT9b 1VQ51 4NH1C 2JIMA 2NVYI 1VQMZ 1VQ4Z 4HGYA 3G4S1 3CCRZ 3TE5B 2V45A 2JA8I 4RVHA 1Q16A 5C4XI 3CCM1 2JA7I 3S15I 2LIYA 1YI2Z 2R6MA 1K732 1QXFA 3HOVI 1Z03A 1M901 3S2HI 4X6AI 3CD61 4E2YA 3CQZI 2E2II 2VPYA 3G71Z 3D9XA 4MD9A 1Q7Y2 2E7ZA 2DE5A 2Q51A 1FDOA 4E33A 3S14I 2VUGA 4HH4A 2WAQA 3HOWI 3HOYI 2QEXZ 4A3JI 5FLMI 4A3CI 2PM9A 2RHBA 1S7MA 2EGTA 3S2DI 3VMHA 4XX2A 1KRLA 2OTJ1 3GCFA 4NBDA 3QWUA 1K8A2 2JMOA 1NJI1 4MRIA 1YIJZ 2RT9A 2M6NA 5IT9f 1Q861 1TWFI 5IP9I 1JWHC 1AA6A 3GTLI 4E2WA 1JJ2Z 3CPWZ 1K9M1 3GTOI 1VQ7Z 3CCE1
chains in the Genus database with same CATH topology
1QVGY 5AN9F 1RO2A 1USPA 3J80b 1VQM1 3I07A 3CMEZ 1VQ41 3GTMS 2OTLZ 3GTKI 3CCR1 4A3II 1KD12 1X3WA 2HF1A 1Y1VS 4NBCA 2QRDB 5IP7I 4A3FI 1VQ6Z 1K731 2E9HA 3MZLB 2OOXB 1VLAA 3F3PC 4MH4A 3GKQA 3NDJA 4MD8A 3PO3S 3VMIA 3PO2I 1N8R2 1QVFY 1SFOI 1YJWZ 1Q7Y1 4BY1I 3HOXI 2PMZA 1LQLA 1ZH1A 3H0GI 4RV9A 3CCV1 3Q87A 2OZKA 1USPB 3HKZA 2Y0SA 2KI7B 2IZ3A 1DL6A 1R9TI 1VQPZ 4RVGA 3J81f 3K7AI 4QTUA 5D1OA 3JAMb 1TWCI 3M4OI 1K8A1 5A2Qb 4A3BI 3J80f 3I55Z 3M3YI 3TDHB 2R93I 1QVGZ 4E2XA 3LUSA 3I4MI 4E31A 1VQNZ 2RIQA 3ESWA 2DE6A 5C44I 1Q822 4RS4A 4AYBA 3D6WA 1YUKA 1VQ91 4CL1A 1KD11 4HGZA 4A3DI 1KQSY 1VQ61 2QLVB 1YHQZ 1Z02A 2JA6I 4NB8A 3CCQZ 5T67A 1ZB9A 2G2KA 3I561 5D1OB 3I4NI 1YIT1 2E2JI 1RLYA 4E30A 1QVFZ 1YJW1 3S1QI 1PFTA 3CC4Z 1N8R1 2YADA 4BBSI 4NBHA 1KC82 1S721 1K83I 3CCSZ 2RPRA 4A3LI 1L1OC 1VQP1 3JAMf 3CCL1 4A3MI 5A2Qf 2GU2A 3CXCY 1VQOZ 2K5RA 1YJNZ 1QF8A 1WW9A 1Z01A 4NBBA 3G6EZ 3I551 2ZAEB 3KIHA 2V8KA 1W2BY 4QTTA 1VQ8Z 4RVFA 3GTPI 1VQN1 3CCJZ 2VUMI 2QREB 4S1TA 2E2HI 5T64A 4E2ZA 5D1PA 1YI21 3CCUZ 2WB1A 1Q821 1TWAI 1KQSZ 4DQYB 5LL6f 4A93I 1YHQ1 2F4OA 3S17I 3VMGA 1P9NA 1VQLZ 3GTGI 3G711 2NVTI 3S1MI 2OOYB 3G4SZ 3CC41 3OW2Y 3CCMZ 2M48A 3PO3I 2QEX1 3CC7Z 4Y52I 1RO0A 2KPIA 2QR1B 1I6HI 2O53A 1KC81 2JUBA 4A3GI 3CD6Z 2QKDA 1VQKZ 4DGLA 3P5JB 3VB9A 3CXCZ 3FQMA 4BBRI 4NBGA 1YIJ1 5C3EI 5FLXb 3G6E1 2RBLA 1ML8A 3U50C 1ZB8A 4A3KI 1VQ71 1QYPA 1W2BZ 2QA4Z 2F4MA 3CME1 3CCJ1 2OTJZ 2OTL1 2GTIA 3EERA 3FKII 2W03A 3IFUA 4NBFA 1RNIA 2J6AA 2JS4A 2K3RA 4A3EI 2GTHA 3CCEZ 2HU9A 2JR6A 2NVQI 1VQL1 3FQQA 1Q812 2NVXI 3NFZA 4BXXI 2V8IA 3OW2Z 1Y1WI 3RZOI 3F3FC 3CC71 3BG1B 2AKLA 2YU9I 4E32A 1YJ9Z 3J7A4 3KIFA 4NOZA 4NB9A 1X3ZA 1VQK1 5FLXf 3S16I 4MONA 2O4HA 4MXUA 1M1K2 1WIIA 4NFRA 4RVDA 2R92I 4TNUA 3CCVZ 3MZKB 2QA41 4BY7I 3MONA 3HOUI 3EEDA 3NDIA 3CC2Z 5CM2M 2V8JA 2DE7A 5T6BA 3CMAZ 2H85A 3J81b 3GTMI 3H3VJ 3IX0A 2W04A 3NH8A 2P28A 1TWHI 1VQ5Z 3CCQ1 1NUIA 1Y1VI 4NBEA 2IZ4A 4MD7A 2VF1A 2BJOA 1Q811 3T4NB 2Q4ZA 2LFUA 2QRCB 1VQ9Z 1N2FA 1M902 1YJ91 3CCS1 1TFIA 3GTJI 4NBAA 3VTNA 3I56Z 3NH5A 3BG0B 1VQO1 1YITZ 1RO4A 4Y7NI 2P3YA 1YJN1 4EWCA 2JNYA 1M1K1 1I3QI 1S72Z 3GTQI 3IF8A 5C4JI 1NP6A 4DK1A 1I50I 1VQ81 2R7ZI 3CC21 3S1NI 1NJI2 3CCLZ 2I3CA 3HOZI 1YUAA 1TWGI 3NH4A 2JA5I 1WCMI 1X0TA 1Q862 2PK7A 3S1RI 3CMA1 3CCU1 1K9M2 1RQFA 1JJ2Y 3CPWY 2B63I 3RZDI 5IT9b 1VQ51 4NH1C 2NVYI 1VQMZ 1VQ4Z 4HGYA 3G4S1 3CCRZ 3TE5B 2JA8I 3S15I 4RVHA 5C4XI 3CCM1 2JA7I 2LIYA 1YI2Z 2R6MA 1K732 3HOVI 1Z03A 1M901 3S2HI 4X6AI 3CD61 4E2YA 3CQZI 2E2II 3G71Z 3D9XA 4MD9A 1Q7Y2 2DE5A 2Q51A 4E33A 3S14I 2VUGA 4HH4A 2WAQA 3HOWI 3HOYI 2QEXZ 4A3JI 5FLMI 4A3CI 2PM9A 2RHBA 1S7MA 2EGTA 3S2DI 3VMHA 4XX2A 1KRLA 2OTJ1 3GCFA 4NBDA 3QWUA 1K8A2 2JMOA 1NJI1 4MRIA 1YIJZ 2RT9A 2M6NA 5IT9f 1Q861 1TWFI 5IP9I 1JWHC 3GTLI 4E2WA 1JJ2Z 3CPWZ 1K9M1 3GTOI 1VQ7Z 3CCE1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBA A;  4BBS I;  4NBH A;  4NBF A;  1K83 I;  1USP A;  3I07 A;  1RO4 A;  2J6A A;  2JS4 A;  4Y7N I;  4A3L I;  3GTM S;  2P3Y A;  1L1O C;  4A3E I;  3GTK I;  2JNY A;  4A3I I;  4A3M I;  1X3W A;  2JR6 A;  1I3Q I;  2NVQ I;  3GTQ I;  2HF1 A;  2K5R A;  1Y1V S;  5C4J I;  4NBC A;  2NVX I;  2R7Z I;  1I50 I;  1WW9 A;  5IP7 I;  4NBB A;  4A3F I;  3S1N I;  4BXX I;  1VLA A;  3HOZ I;  1YUA A;  1TWG I;  2JA5 I;  1Y1W I;  1WCM I;  4MH4 A;  3GKQ A;  2PK7 A;  3PO3 S;  3RZO I;  3VMI A;  4QTT A;  3PO2 I;  3S1R I;  2AKL A;  2YU9 I;  3GTP I;  1SFO I;  4NOZ A;  2B63 I;  4NB9 A;  3RZD I;  2VUM I;  2E2H I;  4BY1 I;  3HOX I;  1X3Z A;  1LQL A;  3H0G I;  3S16 I;  2NVY I;  3Q87 A;  1USP B;  1TWA I;  1DL6 A;  1R9T I;  4A93 I;  2F4O A;  3S17 I;  3VMG A;  2JA8 I;  2R92 I;  5C4X I;  3S15 I;  2JA7 I;  3GTG I;  3K7A I;  4QTU A;  2NVT I;  4BY7 I;  1TWC I;  3S1M I;  3M4O I;  3HOU I;  4A3B I;  3HOV I;  5CM2 M;  3M3Y I;  2R93 I;  2DE7 A;  3S2H I;  3PO3 I;  4X6A I;  3CQZ I;  2E2I I;  4Y52 I;  3LUS A;  2KPI A;  3I4M I;  2DE5 A;  1I6H I;  3S14 I;  3GTM I;  3H3V J;  3ESW A;  2DE6 A;  4A3G I;  3HOW I;  3HOY I;  5C44 I;  1TWH I;  4A3J I;  5FLM I;  4A3C I;  3VB9 A;  3D6W A;  1NUI A;  4BBR I;  1Y1V I;  4NBG A;  3S2D I;  4NBE A;  3VMH A;  4XX2 A;  4A3D I;  5C3E I;  2RBL A;  1ML8 A;  3U50 C;  2JA6 I;  1ZB8 A;  2BJO A;  3GCF A;  4A3K I;  4NB8 A;  1ZB9 A;  4NBD A;  1QYP A;  1N2F A;  2F4M A;  3I4N I;  2E2J I;  1TWF I;  5IP9 I;  1RLY A;  3GTL I;  1TFI A;  3S1Q I;  3EER A;  3FKI I;  3GTO I;  3GTJ I;  1PFT A; 
#chains in the Genus database with same CATH topology
 1QVG Y;  5AN9 F;  1RO2 A;  1USP A;  3J80 b;  1VQM 1;  3I07 A;  3CME Z;  1VQ4 1;  3GTM S;  2OTL Z;  3GTK I;  3CCR 1;  4A3I I;  1KD1 2;  1X3W A;  2HF1 A;  1Y1V S;  4NBC A;  2QRD B;  5IP7 I;  4A3F I;  1VQ6 Z;  1K73 1;  2E9H A;  3MZL B;  2OOX B;  1VLA A;  3F3P C;  4MH4 A;  3GKQ A;  3NDJ A;  4MD8 A;  3PO3 S;  3VMI A;  3PO2 I;  1N8R 2;  1QVF Y;  1SFO I;  1YJW Z;  1Q7Y 1;  4BY1 I;  3HOX I;  2PMZ A;  1LQL A;  1ZH1 A;  3H0G I;  4RV9 A;  3CCV 1;  2VPZ A;  3Q87 A;  2OZK A;  1USP B;  3HKZ A;  2Y0S A;  2KI7 B;  2IZ3 A;  1DL6 A;  1Y8C A;  1R9T I;  1VQP Z;  4RVG A;  3J81 f;  3K7A I;  4QTU A;  5D1O A;  3JAM b;  1TWC I;  3M4O I;  1K8A 1;  5A2Q b;  4A3B I;  3J80 f;  2AYD A;  3I55 Z;  3TDH B;  3M3Y I;  2R93 I;  1QVG Z;  4E2X A;  3LUS A;  3I4M I;  4E31 A;  1VQN Z;  2RIQ A;  3ESW A;  2DE6 A;  5C44 I;  1Q82 2;  4RS4 A;  4AYB A;  3D6W A;  1YUK A;  1VQ9 1;  4CL1 A;  1KD1 1;  2V3V A;  4HGZ A;  4A3D I;  1KQS Y;  1VQ6 1;  2QLV B;  1YHQ Z;  1Z02 A;  2JA6 I;  4NB8 A;  3CCQ Z;  5T67 A;  1ZB9 A;  2VPX A;  2G2K A;  3I56 1;  5D1O B;  3I4N I;  1YIT 1;  2E2J I;  1RLY A;  4E30 A;  1QVF Z;  1YJW 1;  3S1Q I;  1PFT A;  3CC4 Z;  1N8R 1;  2YAD A;  4BBS I;  4NBH A;  1KC8 2;  1S72 1;  1K83 I;  3CCS Z;  2RPR A;  4A3L I;  1L1O C;  1VQP 1;  3JAM f;  3CCL 1;  4A3M I;  5A2Q f;  2GU2 A;  3CXC Y;  1VQO Z;  2K5R A;  1YJN Z;  1QF8 A;  1WW9 A;  1Z01 A;  4NBB A;  3G6E Z;  3I55 1;  2ZAE B;  3KIH A;  2V8K A;  1W2B Y;  4QTT A;  1VQ8 Z;  4RVF A;  3GTP I;  1VQN 1;  3CCJ Z;  2VUM I;  2QRE B;  4S1T A;  2E2H I;  5T64 A;  4E2Z A;  5D1P A;  1YI2 1;  3CCU Z;  2WB1 A;  1Q82 1;  1TWA I;  1KQS Z;  4DQY B;  5LL6 f;  4A93 I;  1YHQ 1;  2F4O A;  3S17 I;  3VMG A;  3D2L A;  1P9N A;  1VQL Z;  3GTG I;  3G71 1;  2NVT I;  3S1M I;  2OOY B;  3G4S Z;  1WZN A;  3CC4 1;  3OW2 Y;  3CCM Z;  2M48 A;  3PO3 I;  2QEX 1;  3CC7 Z;  4Y52 I;  1RO0 A;  2KPI A;  2QR1 B;  1I6H I;  2O53 A;  1KC8 1;  2JUB A;  4A3G I;  3CD6 Z;  2QKD A;  1VQK Z;  4DGL A;  3P5J B;  3VB9 A;  3CXC Z;  3FQM A;  4BBR I;  4NBG A;  2JIR A;  1YIJ 1;  5C3E I;  5FLX b;  3G6E 1;  2RBL A;  1ML8 A;  3U50 C;  1WJ2 A;  1ZB8 A;  4A3K I;  1VQ7 1;  1QYP A;  1W2B Z;  2VPW A;  2QA4 Z;  2F4M A;  3CME 1;  3CCJ 1;  2OTJ Z;  2OTL 1;  2GTI A;  3EER A;  3FKI I;  2W03 A;  3IFU A;  4NBF A;  1RNI A;  2J6A A;  2JS4 A;  2K3R A;  4A3E I;  2GTH A;  3CCE Z;  2HU9 A;  2JR6 A;  2NVQ I;  1VQL 1;  3FQQ A;  2JIQ A;  1Q81 2;  2NVX I;  3NFZ A;  4BXX I;  2V8I A;  3OW2 Z;  1Y1W I;  3RZO I;  3F3F C;  3CC7 1;  3BG1 B;  2AKL A;  2YU9 I;  4E32 A;  1YJ9 Z;  3J7A 4;  3KIF A;  4NOZ A;  4NB9 A;  1X3Z A;  1VQK 1;  5FLX f;  3S16 I;  4MON A;  2O4H A;  4MXU A;  1M1K 2;  1WII A;  4NFR A;  4RVD A;  2R92 I;  4TNU A;  3CCV Z;  1SIW A;  3MZK B;  2QA4 1;  4BY7 I;  3MON A;  3HOU I;  3EED A;  3NDI A;  3CC2 Z;  5CM2 M;  2V8J A;  2DE7 A;  5T6B A;  3CMA Z;  2H85 A;  3J81 b;  3GTM I;  3H3V J;  3IX0 A;  2W04 A;  3NH8 A;  2IV2 X;  2P28 A;  1TWH I;  1VQ5 Z;  3CCQ 1;  3IR7 A;  1NUI A;  1Y1V I;  4NBE A;  2IZ4 A;  4MD7 A;  2VF1 A;  2BJO A;  1Q81 1;  3T4N B;  2Q4Z A;  2LFU A;  2QRC B;  1VQ9 Z;  1N2F A;  1M90 2;  1YJ9 1;  3CCS 1;  1TFI A;  3GTJ I;  4NBA A;  3VTN A;  3I56 Z;  3NH5 A;  3BG0 B;  1VQO 1;  1YIT Z;  1RO4 A;  4Y7N I;  2NAP A;  2P3Y A;  1YJN 1;  4EWC A;  2JNY A;  1M1K 1;  1I3Q I;  2JIO A;  1S72 Z;  3GTQ I;  3IF8 A;  5C4J I;  1NP6 A;  4DK1 A;  1I50 I;  1VQ8 1;  2R7Z I;  3CC2 1;  3S1N I;  1NJI 2;  3CCL Z;  2I3C A;  3HOZ I;  1YUA A;  1TWG I;  3NH4 A;  2JA5 I;  1WCM I;  1X0T A;  1Q86 2;  2PK7 A;  1FDI A;  3S1R I;  3CMA 1;  3CCU 1;  1K9M 2;  1RQF A;  1JJ2 Y;  3CPW Y;  2B63 I;  3RZD I;  2JIP A;  2LEX A;  5IT9 b;  1VQ5 1;  4NH1 C;  2JIM A;  2NVY I;  1VQM Z;  1VQ4 Z;  4HGY A;  3G4S 1;  3CCR Z;  3TE5 B;  2V45 A;  2JA8 I;  4RVH A;  1Q16 A;  5C4X I;  3CCM 1;  2JA7 I;  3S15 I;  2LIY A;  1YI2 Z;  2R6M A;  1K73 2;  1QXF A;  3HOV I;  1Z03 A;  1M90 1;  3S2H I;  4X6A I;  3CD6 1;  4E2Y A;  3CQZ I;  2E2I I;  2VPY A;  3G71 Z;  3D9X A;  4MD9 A;  1Q7Y 2;  2E7Z A;  2DE5 A;  2Q51 A;  1FDO A;  4E33 A;  3S14 I;  2VUG A;  4HH4 A;  2WAQ A;  3HOW I;  3HOY I;  2QEX Z;  4A3J I;  5FLM I;  4A3C I;  2PM9 A;  2RHB A;  1S7M A;  2EGT A;  3S2D I;  3VMH A;  4XX2 A;  1KRL A;  2OTJ 1;  3GCF A;  4NBD A;  3QWU A;  1K8A 2;  2JMO A;  1NJI 1;  4MRI A;  1YIJ Z;  2RT9 A;  2M6N A;  5IT9 f;  1Q86 1;  1TWF I;  5IP9 I;  1JWH C;  1AA6 A;  3GTL I;  4E2W A;  1JJ2 Z;  3CPW Z;  1K9M 1;  3GTO I;  1VQ7 Z;  3CCE 1; 
#chains in the Genus database with same CATH homology
 1QVG Y;  5AN9 F;  1RO2 A;  1USP A;  3J80 b;  1VQM 1;  3I07 A;  3CME Z;  1VQ4 1;  3GTM S;  2OTL Z;  3GTK I;  3CCR 1;  4A3I I;  1KD1 2;  1X3W A;  2HF1 A;  1Y1V S;  4NBC A;  2QRD B;  5IP7 I;  4A3F I;  1VQ6 Z;  1K73 1;  2E9H A;  3MZL B;  2OOX B;  1VLA A;  3F3P C;  4MH4 A;  3GKQ A;  3NDJ A;  4MD8 A;  3PO3 S;  3VMI A;  3PO2 I;  1N8R 2;  1QVF Y;  1SFO I;  1YJW Z;  1Q7Y 1;  4BY1 I;  3HOX I;  2PMZ A;  1LQL A;  1ZH1 A;  3H0G I;  4RV9 A;  3CCV 1;  3Q87 A;  2OZK A;  1USP B;  3HKZ A;  2Y0S A;  2KI7 B;  2IZ3 A;  1DL6 A;  1R9T I;  1VQP Z;  4RVG A;  3J81 f;  3K7A I;  4QTU A;  5D1O A;  3JAM b;  1TWC I;  3M4O I;  1K8A 1;  5A2Q b;  4A3B I;  3J80 f;  3I55 Z;  3M3Y I;  3TDH B;  2R93 I;  1QVG Z;  4E2X A;  3LUS A;  3I4M I;  4E31 A;  1VQN Z;  2RIQ A;  3ESW A;  2DE6 A;  5C44 I;  1Q82 2;  4RS4 A;  4AYB A;  3D6W A;  1YUK A;  1VQ9 1;  4CL1 A;  1KD1 1;  4HGZ A;  4A3D I;  1KQS Y;  1VQ6 1;  2QLV B;  1YHQ Z;  1Z02 A;  2JA6 I;  4NB8 A;  3CCQ Z;  5T67 A;  1ZB9 A;  2G2K A;  3I56 1;  5D1O B;  3I4N I;  1YIT 1;  2E2J I;  1RLY A;  4E30 A;  1QVF Z;  1YJW 1;  3S1Q I;  1PFT A;  3CC4 Z;  1N8R 1;  2YAD A;  4BBS I;  4NBH A;  1KC8 2;  1S72 1;  1K83 I;  3CCS Z;  2RPR A;  4A3L I;  1L1O C;  1VQP 1;  3JAM f;  3CCL 1;  4A3M I;  5A2Q f;  2GU2 A;  3CXC Y;  1VQO Z;  2K5R A;  1YJN Z;  1QF8 A;  1WW9 A;  1Z01 A;  4NBB A;  3G6E Z;  3I55 1;  2ZAE B;  3KIH A;  2V8K A;  1W2B Y;  4QTT A;  1VQ8 Z;  4RVF A;  3GTP I;  1VQN 1;  3CCJ Z;  2VUM I;  2QRE B;  4S1T A;  2E2H I;  5T64 A;  4E2Z A;  5D1P A;  1YI2 1;  3CCU Z;  2WB1 A;  1Q82 1;  1TWA I;  1KQS Z;  4DQY B;  5LL6 f;  4A93 I;  1YHQ 1;  2F4O A;  3S17 I;  3VMG A;  1P9N A;  1VQL Z;  3GTG I;  3G71 1;  2NVT I;  3S1M I;  2OOY B;  3G4S Z;  3CC4 1;  3OW2 Y;  3CCM Z;  2M48 A;  3PO3 I;  2QEX 1;  3CC7 Z;  4Y52 I;  1RO0 A;  2KPI A;  2QR1 B;  1I6H I;  2O53 A;  1KC8 1;  2JUB A;  4A3G I;  3CD6 Z;  2QKD A;  1VQK Z;  4DGL A;  3P5J B;  3VB9 A;  3CXC Z;  3FQM A;  4BBR I;  4NBG A;  1YIJ 1;  5C3E I;  5FLX b;  3G6E 1;  2RBL A;  1ML8 A;  3U50 C;  1ZB8 A;  4A3K I;  1VQ7 1;  1QYP A;  1W2B Z;  2QA4 Z;  2F4M A;  3CME 1;  3CCJ 1;  2OTJ Z;  2OTL 1;  2GTI A;  3EER A;  3FKI I;  2W03 A;  3IFU A;  4NBF A;  1RNI A;  2J6A A;  2JS4 A;  2K3R A;  4A3E I;  2GTH A;  3CCE Z;  2HU9 A;  2JR6 A;  2NVQ I;  1VQL 1;  3FQQ A;  1Q81 2;  2NVX I;  3NFZ A;  4BXX I;  2V8I A;  3OW2 Z;  1Y1W I;  3RZO I;  3F3F C;  3CC7 1;  3BG1 B;  2AKL A;  2YU9 I;  4E32 A;  1YJ9 Z;  3J7A 4;  3KIF A;  4NOZ A;  4NB9 A;  1X3Z A;  1VQK 1;  5FLX f;  3S16 I;  4MON A;  2O4H A;  4MXU A;  1M1K 2;  1WII A;  4NFR A;  4RVD A;  2R92 I;  4TNU A;  3CCV Z;  3MZK B;  2QA4 1;  4BY7 I;  3MON A;  3HOU I;  3EED A;  3NDI A;  3CC2 Z;  5CM2 M;  2V8J A;  2DE7 A;  5T6B A;  3CMA Z;  2H85 A;  3J81 b;  3GTM I;  3H3V J;  3IX0 A;  2W04 A;  3NH8 A;  2P28 A;  1TWH I;  1VQ5 Z;  3CCQ 1;  1NUI A;  1Y1V I;  4NBE A;  2IZ4 A;  4MD7 A;  2VF1 A;  2BJO A;  1Q81 1;  3T4N B;  2Q4Z A;  2LFU A;  2QRC B;  1VQ9 Z;  1N2F A;  1M90 2;  1YJ9 1;  3CCS 1;  1TFI A;  3GTJ I;  4NBA A;  3VTN A;  3I56 Z;  3NH5 A;  3BG0 B;  1VQO 1;  1YIT Z;  1RO4 A;  4Y7N I;  2P3Y A;  1YJN 1;  4EWC A;  2JNY A;  1M1K 1;  1I3Q I;  1S72 Z;  3GTQ I;  3IF8 A;  5C4J I;  1NP6 A;  4DK1 A;  1I50 I;  1VQ8 1;  2R7Z I;  3CC2 1;  3S1N I;  1NJI 2;  3CCL Z;  2I3C A;  3HOZ I;  1YUA A;  1TWG I;  3NH4 A;  2JA5 I;  1WCM I;  1X0T A;  1Q86 2;  2PK7 A;  3S1R I;  3CMA 1;  3CCU 1;  1K9M 2;  1RQF A;  1JJ2 Y;  3CPW Y;  2B63 I;  3RZD I;  5IT9 b;  1VQ5 1;  4NH1 C;  2NVY I;  1VQM Z;  1VQ4 Z;  4HGY A;  3G4S 1;  3CCR Z;  3TE5 B;  2JA8 I;  3S15 I;  4RVH A;  5C4X I;  3CCM 1;  2JA7 I;  2LIY A;  1YI2 Z;  2R6M A;  1K73 2;  3HOV I;  1Z03 A;  1M90 1;  3S2H I;  4X6A I;  3CD6 1;  4E2Y A;  3CQZ I;  2E2I I;  3G71 Z;  3D9X A;  4MD9 A;  1Q7Y 2;  2DE5 A;  2Q51 A;  4E33 A;  3S14 I;  2VUG A;  4HH4 A;  2WAQ A;  3HOW I;  3HOY I;  2QEX Z;  4A3J I;  5FLM I;  4A3C I;  2PM9 A;  2RHB A;  1S7M A;  2EGT A;  3S2D I;  3VMH A;  4XX2 A;  1KRL A;  2OTJ 1;  3GCF A;  4NBD A;  3QWU A;  1K8A 2;  2JMO A;  1NJI 1;  4MRI A;  1YIJ Z;  2RT9 A;  2M6N A;  5IT9 f;  1Q86 1;  1TWF I;  5IP9 I;  1JWH C;  3GTL I;  4E2W A;  1JJ2 Z;  3CPW Z;  1K9M 1;  3GTO I;  1VQ7 Z;  3CCE 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...