4A3MI

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI02
2YU9I 2RBLA 4NBAA 4A93I 2VUMI 1Y1VI 4A3DI 1I50I 1ZB8A 4NB8A 3S1RI 3GTOI 3VMIA 3S1NI 2E2HI 1NUIA 2BJOA 1X3WA 2JNYA 4Y52I 1QYPA 3VMHA 3FKII 2PK7A 3CQZI 4NBHA 2JA6I 1L1OC 3I07A 1USPB 2R7ZI 1TWGI 2DE7A 2NVXI 3EERA 3U50C 4X6AI 1R9TI 1TFIA 4NBGA 3HOXI 4BXXI 5CM2M 3I4NI 2JA7I 2JS4A 3RZOI 3H0GI 1PFTA 1TWAI 3Q87A 4A3JI 3HOWI 2JA8I 4A3MI 3GCFA 3RZDI 3GTPI 4A3GI 1K83I 3GTQI 1ZB9A 3GTMS 4A3CI 3D6WA 4A3II 3H3VJ 1N2FA 5FLMI 3VB9A 2E2II 5IP9I 3GTGI 3I4MI 3PO3S 2KPIA 1LQLA 1TWHI 4NBCA 2J6AA 4XX2A 3S14I 4BBRI 2NVYI 2NVTI 3M4OI 4A3KI 3GKQA 3K7AI 1USPA 5C4JI 2B63I 3S16I 4A3EI 3S1QI 2JA5I 4NBEA 1WW9A 1WCMI 4NOZA 3HOUI 1RO4A 2R93I 3GTJI 1ML8A 4BBSI 2DE6A 3S2HI 2F4OA 3GTMI 3S1MI 3ESWA 4NBFA 1TWFI 1VLAA 3GTKI 1TWCI 3HOYI 2HF1A 4NBBA 4NB9A 1I6HI 1X3ZA 2AKLA 4BY7I 5IP7I 3PO2I 3PO3I 1Y1VS 3HOVI 2P3YA 1I3QI 1YUAA 3S17I 2R92I 4A3BI 2F4MA 2JR6A 5C3EI 2DE5A 4A3FI 3M3YI 2E2JI 4QTUA 3VMGA 1DL6A 3S2DI 4Y7NI 2K5RA 2NVQI 1RLYA 5C4XI 4BY1I 3S15I 4QTTA 4MH4A 5C44I 3LUSA 3HOZI 3GTLI 4NBDA 1Y1WI 4A3LI 1SFOI
chains in the Genus database with same CATH superfamily
5T6BA 1YJNZ 2YU9I 1FDIA 4NBAA 3BG1B 4MD8A 2KI7B 3GTOI 2GU2A 3CME1 3NDIA 1M1K2 3NH8A 4RVGA 1QYPA 1W2BY 3CPWZ 3CMAZ 1JJ2Y 3D9XA 2JIRA 3NH5A 3NH4A 1QVGY 2LIYA 5D1OA 1VQ51 2R6MA 3J7A4 4E2WA 3I56Z 1USPB 2R7ZI 2W04A 2QKDA 4X6AI 1VQ4Z 1VQ6Z 2K3RA 1Q7Y2 3G6E1 3HOXI 2V8JA 4BXXI 4NFRA 5CM2M 2JA7I 4E32A 3H0GI 1WZNA 2E9HA 1TWAI 3Q87A 3CC41 1VQP1 3CXCZ 5FLXf 1S72Z 1M901 1VQKZ 3GCFA 3CCS1 3CCMZ 1Q822 3GTGI 3J80f 1TWHI 3G4S1 3S14I 1VQ71 2HU9A 2QA4Z 1M1K1 1USPA 1VQMZ 2OTL1 2QR1B 1JWHC 2JA5I 3S1QI 1YIJZ 3HOUI 4BBSI 3S2HI 3S1MI 3ESWA 3MZLB 2OTJ1 3MZKB 3G711 1VQOZ 2WB1A 1X3ZA 4BY7I 1YUKA 3MONA 1RNIA 3HOVI 3S17I 2R92I 4RVHA 1P9NA 3M3YI 3S2DI 1RLYA 2OOXB 4BY1I 2RHBA 3S15I 3IR7A 3P5JB 1NP6A 3GTLI 1Q821 3CCV1 2VPXA 3CD6Z 3FQQA 1SFOI 1VQL1 1KD11 1VQ8Z 1YJWZ 1Q812 4A3DI 2VPYA 1I50I 4NB8A 5D1OB 4MD9A 3S1RI 1RO0A 1X3WA 1SIWA 2JNYA 1S7MA 3J81f 3CCL1 1K9M2 1Y8CA 3CCRZ 3VTNA 1YI2Z 2JA6I 1L1OC 3CCUZ 2GTHA 4RS4A 2JUBA 3U50C 2V8KA 1R9TI 1K8A2 3T4NB 1Z03A 2AYDA 3RZOI 1YJ9Z 3IF8A 3CPWY 3RZDI 2JIQA 1VQNZ 3GTPI 4MXUA 2W03A 1ZB9A 5T67A 4CL1A 4E31A 3CC71 2IV2X 1KC82 3I4MI 3CC21 1Z01A 1WIIA 2KPIA 1LQLA 1Q811 2J6AA 3JAMf 1KQSY 4E33A 2NVTI 1VQ9Z 3CXCY 1YJN1 3K7AI 2RT9A 5C4JI 3F3FC 2NAPA 1W2BZ 3CCEZ 1K731 1WW9A 2H85A 1ML8A 3GTJI 3GTMI 1YHQZ 4NBFA 1TWFI 1VLAA 1VQN1 3GTKI 3J80b 3CMA1 3HOYI 4NB9A 2M6NA 2AKLA 2Y0SA 2PMZA 3PO3I 1K8A1 2P3YA 1YUAA 2QEXZ 2V45A 4A3BI 3I561 5C3EI 1VQ41 2O53A 2ZAEB 2VF1A 3VMGA 1VQ61 4Y7NI 2M48A 4MH4A 1QVFZ 3EEDA 1S721 3HKZA 1VQK1 2V8IA 1KRLA 4RVFA 2PM9A 1YHQ1 4MONA 1Q7Y1 1Y1VI 2VUMI 4A93I 3CCM1 2RPRA 3VMIA 2E2HI 2VPWA 4EWCA 1NUIA 1YITZ 4MRIA 4Y52I 3FKII 3D2LA 4NBHA 2QA41 1NJI2 2JIPA 2RIQA 1VQM1 2NVXI 3EERA 5IT9f 1YIJ1 1TFIA 3F3PC 3CCQZ 4DQYB 2QREB 1VQO1 4E2XA 2QRCB 2JA8I 4A3MI 2VPZA 4DK1A 4HGYA 3I55Z 1K83I 3GTMS 3D6WA 4A3II 3TDHB 3NFZA 2E2II 5IP9I 3PO3S 5A2Qf 4HH4A 4XX2A 4BBRI 4E30A 2NVYI 3CD61 3M4OI 4A3KI 4RV9A 1VQ5Z 1X0TA 1Q16A 3GKQA 1M902 1VQ81 1YJW1 4TNUA 4A3EI 2Q51A 3OW2Z 1WJ2A 1WCMI 1RO4A 3G6EZ 2HF1A 3BG0B 2WAQA 4NBBA 3CC4Z 1I6HI 2VUGA 1VQPZ 5IP7I 3CCR1 1Y1VS 1YI21 3JAMb 1RO2A 1N8R2 1I3QI 3KIHA 3CCSZ 3CCU1 2F4MA 3TE5B 2JR6A 4A3FI 5FLXb 1FDOA 1AA6A 2E7ZA 1JJ2Z 4E2ZA 5C44I 1YJ91 1K9M1 1RQFA 1QVGZ 3HOZI 1QF8A 3G4SZ 5D1PA 1VQ7Z 4A3LI 2YADA 3CCJZ 2QLVB 3KIFA 4RVDA 2RBLA 5LL6f 2OTLZ 4MD7A 2GTIA 2IZ4A 1ZB8A 4E2YA 1KQSZ 3S1NI 1QXFA 2EGTA 2G2KA 2BJOA 2QRDB 3VMHA 5AN9F 2OTJZ 2I3CA 3G71Z 3NDJA 2PK7A 3CQZI 1QVFY 1VQ91 2JIMA 3I07A 2V3VA 1TWGI 2DE7A 1KD12 1KC81 3CCE1 4NBGA 1N8R1 3I4NI 2JS4A 3CCJ1 1PFTA 4A3JI 3HOWI 3CCVZ 1Q862 3IFUA 4A3GI 1Z02A 1VQLZ 2QEX1 1ZH1A 2Q4ZA 3GTQI 4A3CI 3H3VJ 1N2FA 5FLMI 2OZKA 5IT9b 3VB9A 3QWUA 2OOYB 4NBCA 4AYBA 3CCLZ 2JIOA 2JMOA 3IX0A 2P28A 3S16I 2LEXA 2B63I 3J81b 4NBEA 4NOZA 2R93I 2DE6A 2F4OA 3FQMA 1YIT1 1TWCI 5A2Qb 3CMEZ 3PO2I 4S1TA 4NH1C 2DE5A 4DGLA 3CC7Z 2O4HA 5T64A 2LFUA 4QTUA 2E2JI 1DL6A 2K5RA 1Q861 3OW2Y 2NVQI 5C4XI 1K732 3CC2Z 4HGZA 4QTTA 3CCQ1 3LUSA 2IZ3A 4NBDA 1NJI1 1Y1WI 3I551
chains in the Genus database with same CATH topology
5T6BA 1YJNZ 2YU9I 4NBAA 3BG1B 4MD8A 2KI7B 3GTOI 2GU2A 3CME1 3NDIA 1M1K2 3NH8A 4RVGA 1QYPA 1W2BY 3CPWZ 3CMAZ 1JJ2Y 3D9XA 3NH4A 3NH5A 1QVGY 2LIYA 5D1OA 1VQ51 2R6MA 3J7A4 4E2WA 3I56Z 1USPB 2R7ZI 2W04A 2QKDA 4X6AI 1VQ4Z 1VQ6Z 2K3RA 1Q7Y2 3G6E1 3HOXI 2V8JA 4BXXI 4NFRA 5CM2M 2JA7I 4E32A 3H0GI 2E9HA 1TWAI 3Q87A 3CC41 1VQP1 3CXCZ 5FLXf 1S72Z 1M901 1VQKZ 3GCFA 3CCS1 3CCMZ 1Q822 3GTGI 3J80f 1TWHI 3G4S1 3S14I 1VQ71 2HU9A 2QA4Z 1M1K1 1USPA 1VQMZ 2OTL1 2QR1B 1JWHC 2JA5I 3S1QI 1YIJZ 3HOUI 4BBSI 3S2HI 3S1MI 3ESWA 3MZLB 2OTJ1 3MZKB 1VQOZ 3G711 2WB1A 1X3ZA 4BY7I 1YUKA 3MONA 1RNIA 3HOVI 3S17I 2R92I 4RVHA 1P9NA 3M3YI 3S2DI 1RLYA 2OOXB 4BY1I 2RHBA 3S15I 3P5JB 1NP6A 3GTLI 1Q821 3CCV1 3CD6Z 3FQQA 1SFOI 1VQL1 1KD11 1VQ8Z 1YJWZ 1Q812 4A3DI 1I50I 4NB8A 5D1OB 4MD9A 3S1RI 1RO0A 1X3WA 2JNYA 1S7MA 3J81f 3CCL1 1K9M2 3CCRZ 3VTNA 1YI2Z 2JA6I 1L1OC 3CCUZ 2GTHA 4RS4A 2JUBA 3U50C 2V8KA 1R9TI 1K8A2 3T4NB 1Z03A 3RZOI 1YJ9Z 3IF8A 3CPWY 3RZDI 1VQNZ 3GTPI 4MXUA 2W03A 1ZB9A 5T67A 4CL1A 4E31A 3CC71 1KC82 3I4MI 3CC21 1Z01A 1WIIA 2KPIA 1LQLA 1Q811 2J6AA 3JAMf 1KQSY 4E33A 2NVTI 1VQ9Z 3CXCY 1YJN1 3K7AI 2RT9A 5C4JI 3F3FC 1W2BZ 3CCEZ 1K731 1WW9A 2H85A 1ML8A 3GTJI 3GTMI 1YHQZ 4NBFA 1TWFI 1VLAA 1VQN1 3GTKI 3J80b 3CMA1 3HOYI 4NB9A 2M6NA 2AKLA 2Y0SA 2PMZA 3PO3I 1K8A1 2P3YA 1YUAA 2QEXZ 4A3BI 3I561 5C3EI 1VQ41 2O53A 2ZAEB 2VF1A 3VMGA 1VQ61 4Y7NI 2M48A 4MH4A 1QVFZ 3EEDA 1S721 3HKZA 1VQK1 2V8IA 1KRLA 4RVFA 2PM9A 1YHQ1 4MONA 1Q7Y1 1Y1VI 2VUMI 4A93I 3CCM1 2RPRA 3VMIA 2E2HI 4EWCA 1NUIA 1YITZ 4MRIA 4Y52I 3FKII 4NBHA 2QA41 1NJI2 2RIQA 1VQM1 2NVXI 3EERA 5IT9f 1YIJ1 1TFIA 3F3PC 3CCQZ 4DQYB 2QREB 1VQO1 4E2XA 2QRCB 2JA8I 4A3MI 4DK1A 4HGYA 3I55Z 1K83I 3GTMS 3D6WA 4A3II 3TDHB 3NFZA 2E2II 5IP9I 3PO3S 5A2Qf 4HH4A 4XX2A 4BBRI 4E30A 2NVYI 3CD61 3M4OI 4A3KI 4RV9A 1VQ5Z 1X0TA 3GKQA 1M902 1VQ81 1YJW1 4TNUA 4A3EI 2Q51A 3OW2Z 1WCMI 1RO4A 3G6EZ 2HF1A 3BG0B 2WAQA 4NBBA 3CC4Z 1I6HI 2VUGA 1VQPZ 5IP7I 3CCR1 1Y1VS 1YI21 3JAMb 1RO2A 1N8R2 1I3QI 3KIHA 3CCSZ 3CCU1 2F4MA 3TE5B 2JR6A 4A3FI 5FLXb 1JJ2Z 4E2ZA 5C44I 1YJ91 1K9M1 1RQFA 1QVGZ 3HOZI 1QF8A 3G4SZ 5D1PA 1VQ7Z 4A3LI 2YADA 3CCJZ 2QLVB 3KIFA 4RVDA 2RBLA 5LL6f 2OTLZ 4MD7A 2GTIA 2IZ4A 1ZB8A 4E2YA 1KQSZ 3S1NI 2EGTA 2G2KA 2BJOA 2QRDB 3VMHA 5AN9F 2OTJZ 2I3CA 3G71Z 3NDJA 2PK7A 3CQZI 1QVFY 1VQ91 3I07A 1TWGI 2DE7A 1KD12 1KC81 3CCE1 4NBGA 1N8R1 3I4NI 2JS4A 3CCJ1 1PFTA 4A3JI 3HOWI 3CCVZ 1Q862 3IFUA 4A3GI 1Z02A 1VQLZ 2QEX1 1ZH1A 2Q4ZA 3GTQI 4A3CI 3H3VJ 1N2FA 5FLMI 2OZKA 5IT9b 3VB9A 3QWUA 2OOYB 4NBCA 4AYBA 3CCLZ 2JMOA 3IX0A 2P28A 3S16I 2B63I 3J81b 4NBEA 4NOZA 2R93I 2DE6A 2F4OA 3FQMA 1YIT1 1TWCI 5A2Qb 3CMEZ 3PO2I 4S1TA 4NH1C 2DE5A 4DGLA 3CC7Z 2O4HA 5T64A 2LFUA 4QTUA 2E2JI 1DL6A 2K5RA 1Q861 3OW2Y 2NVQI 5C4XI 1K732 3CC2Z 4HGZA 4QTTA 3CCQ1 3LUSA 2IZ3A 4NBDA 1NJI1 1Y1WI 3I551
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 I;  2RBL A;  4NBA A;  4A93 I;  2VUM I;  1Y1V I;  4A3D I;  1I50 I;  1ZB8 A;  4NB8 A;  3S1R I;  3GTO I;  3VMI A;  3S1N I;  2E2H I;  1NUI A;  2BJO A;  1X3W A;  2JNY A;  4Y52 I;  1QYP A;  3VMH A;  3FKI I;  2PK7 A;  3CQZ I;  4NBH A;  2JA6 I;  1L1O C;  3I07 A;  1USP B;  2R7Z I;  1TWG I;  2DE7 A;  2NVX I;  3EER A;  3U50 C;  4X6A I;  1R9T I;  1TFI A;  4NBG A;  3HOX I;  4BXX I;  5CM2 M;  3I4N I;  2JA7 I;  2JS4 A;  3RZO I;  3H0G I;  1PFT A;  1TWA I;  3Q87 A;  4A3J I;  3HOW I;  2JA8 I;  4A3M I;  3GCF A;  3RZD I;  3GTP I;  4A3G I;  1K83 I;  3GTQ I;  1ZB9 A;  3GTM S;  4A3C I;  3D6W A;  4A3I I;  3H3V J;  1N2F A;  5FLM I;  3VB9 A;  2E2I I;  5IP9 I;  3GTG I;  3I4M I;  3PO3 S;  2KPI A;  1LQL A;  1TWH I;  4NBC A;  2J6A A;  4XX2 A;  3S14 I;  4BBR I;  2NVY I;  2NVT I;  3M4O I;  4A3K I;  3GKQ A;  3K7A I;  1USP A;  5C4J I;  2B63 I;  3S16 I;  4A3E I;  3S1Q I;  2JA5 I;  4NBE A;  1WW9 A;  1WCM I;  4NOZ A;  3HOU I;  1RO4 A;  2R93 I;  3GTJ I;  1ML8 A;  4BBS I;  2DE6 A;  3S2H I;  2F4O A;  3GTM I;  3S1M I;  3ESW A;  4NBF A;  1TWF I;  1VLA A;  3GTK I;  1TWC I;  3HOY I;  2HF1 A;  4NBB A;  4NB9 A;  1I6H I;  1X3Z A;  2AKL A;  4BY7 I;  5IP7 I;  3PO2 I;  3PO3 I;  1Y1V S;  3HOV I;  2P3Y A;  1I3Q I;  1YUA A;  3S17 I;  2R92 I;  4A3B I;  2F4M A;  2JR6 A;  5C3E I;  2DE5 A;  4A3F I;  3M3Y I;  2E2J I;  4QTU A;  3VMG A;  1DL6 A;  3S2D I;  4Y7N I;  2K5R A;  2NVQ I;  1RLY A;  5C4X I;  4BY1 I;  3S15 I;  4QTT A;  4MH4 A;  5C44 I;  3LUS A;  3HOZ I;  3GTL I;  4NBD A;  1Y1W I;  4A3L I;  1SFO I; 
#chains in the Genus database with same CATH topology
 5T6B A;  1YJN Z;  2YU9 I;  1FDI A;  4NBA A;  3BG1 B;  4MD8 A;  2KI7 B;  3GTO I;  2GU2 A;  3CME 1;  3NDI A;  1M1K 2;  3NH8 A;  4RVG A;  1QYP A;  1W2B Y;  3CPW Z;  3CMA Z;  1JJ2 Y;  3D9X A;  2JIR A;  3NH5 A;  3NH4 A;  1QVG Y;  2LIY A;  5D1O A;  1VQ5 1;  2R6M A;  3J7A 4;  4E2W A;  3I56 Z;  1USP B;  2R7Z I;  2W04 A;  2QKD A;  4X6A I;  1VQ4 Z;  1VQ6 Z;  2K3R A;  1Q7Y 2;  3G6E 1;  3HOX I;  2V8J A;  4BXX I;  4NFR A;  5CM2 M;  2JA7 I;  4E32 A;  3H0G I;  1WZN A;  2E9H A;  1TWA I;  3Q87 A;  3CC4 1;  1VQP 1;  3CXC Z;  5FLX f;  1S72 Z;  1M90 1;  1VQK Z;  3GCF A;  3CCS 1;  3CCM Z;  1Q82 2;  3GTG I;  3J80 f;  1TWH I;  3G4S 1;  3S14 I;  1VQ7 1;  2HU9 A;  2QA4 Z;  1M1K 1;  1USP A;  1VQM Z;  2OTL 1;  2QR1 B;  1JWH C;  2JA5 I;  3S1Q I;  1YIJ Z;  3HOU I;  4BBS I;  3S2H I;  3S1M I;  3ESW A;  3MZL B;  2OTJ 1;  3MZK B;  3G71 1;  1VQO Z;  2WB1 A;  1X3Z A;  4BY7 I;  1YUK A;  3MON A;  1RNI A;  3HOV I;  3S17 I;  2R92 I;  4RVH A;  1P9N A;  3M3Y I;  3S2D I;  1RLY A;  2OOX B;  4BY1 I;  2RHB A;  3S15 I;  3IR7 A;  3P5J B;  1NP6 A;  3GTL I;  1Q82 1;  3CCV 1;  2VPX A;  3CD6 Z;  3FQQ A;  1SFO I;  1VQL 1;  1KD1 1;  1VQ8 Z;  1YJW Z;  1Q81 2;  4A3D I;  2VPY A;  1I50 I;  4NB8 A;  5D1O B;  4MD9 A;  3S1R I;  1RO0 A;  1X3W A;  1SIW A;  2JNY A;  1S7M A;  3J81 f;  3CCL 1;  1K9M 2;  1Y8C A;  3CCR Z;  3VTN A;  1YI2 Z;  2JA6 I;  1L1O C;  3CCU Z;  2GTH A;  4RS4 A;  2JUB A;  3U50 C;  2V8K A;  1R9T I;  1K8A 2;  3T4N B;  1Z03 A;  2AYD A;  3RZO I;  1YJ9 Z;  3IF8 A;  3CPW Y;  3RZD I;  2JIQ A;  1VQN Z;  3GTP I;  4MXU A;  2W03 A;  1ZB9 A;  5T67 A;  4CL1 A;  4E31 A;  3CC7 1;  2IV2 X;  1KC8 2;  3I4M I;  3CC2 1;  1Z01 A;  1WII A;  2KPI A;  1LQL A;  1Q81 1;  2J6A A;  3JAM f;  1KQS Y;  4E33 A;  2NVT I;  1VQ9 Z;  3CXC Y;  1YJN 1;  3K7A I;  2RT9 A;  5C4J I;  3F3F C;  2NAP A;  1W2B Z;  3CCE Z;  1K73 1;  1WW9 A;  2H85 A;  1ML8 A;  3GTJ I;  3GTM I;  1YHQ Z;  4NBF A;  1TWF I;  1VLA A;  1VQN 1;  3GTK I;  3J80 b;  3CMA 1;  3HOY I;  4NB9 A;  2M6N A;  2AKL A;  2Y0S A;  2PMZ A;  3PO3 I;  1K8A 1;  2P3Y A;  1YUA A;  2QEX Z;  2V45 A;  4A3B I;  3I56 1;  5C3E I;  1VQ4 1;  2O53 A;  2ZAE B;  2VF1 A;  3VMG A;  1VQ6 1;  4Y7N I;  2M48 A;  4MH4 A;  1QVF Z;  3EED A;  1S72 1;  3HKZ A;  1VQK 1;  2V8I A;  1KRL A;  4RVF A;  2PM9 A;  1YHQ 1;  4MON A;  1Q7Y 1;  1Y1V I;  2VUM I;  4A93 I;  3CCM 1;  2RPR A;  3VMI A;  2E2H I;  2VPW A;  4EWC A;  1NUI A;  1YIT Z;  4MRI A;  4Y52 I;  3FKI I;  3D2L A;  4NBH A;  2QA4 1;  1NJI 2;  2JIP A;  2RIQ A;  1VQM 1;  2NVX I;  3EER A;  5IT9 f;  1YIJ 1;  1TFI A;  3F3P C;  3CCQ Z;  4DQY B;  2QRE B;  1VQO 1;  4E2X A;  2QRC B;  2JA8 I;  4A3M I;  2VPZ A;  4DK1 A;  4HGY A;  3I55 Z;  1K83 I;  3GTM S;  3D6W A;  4A3I I;  3TDH B;  3NFZ A;  2E2I I;  5IP9 I;  3PO3 S;  5A2Q f;  4HH4 A;  4XX2 A;  4BBR I;  4E30 A;  2NVY I;  3CD6 1;  3M4O I;  4A3K I;  4RV9 A;  1VQ5 Z;  1X0T A;  1Q16 A;  3GKQ A;  1M90 2;  1VQ8 1;  1YJW 1;  4TNU A;  4A3E I;  2Q51 A;  3OW2 Z;  1WJ2 A;  1WCM I;  1RO4 A;  3G6E Z;  2HF1 A;  3BG0 B;  2WAQ A;  4NBB A;  3CC4 Z;  1I6H I;  2VUG A;  1VQP Z;  5IP7 I;  3CCR 1;  1Y1V S;  1YI2 1;  3JAM b;  1RO2 A;  1N8R 2;  1I3Q I;  3KIH A;  3CCS Z;  3CCU 1;  2F4M A;  3TE5 B;  2JR6 A;  4A3F I;  5FLX b;  1FDO A;  1AA6 A;  2E7Z A;  1JJ2 Z;  4E2Z A;  5C44 I;  1YJ9 1;  1K9M 1;  1RQF A;  1QVG Z;  3HOZ I;  1QF8 A;  3G4S Z;  5D1P A;  1VQ7 Z;  4A3L I;  2YAD A;  3CCJ Z;  2QLV B;  3KIF A;  4RVD A;  2RBL A;  5LL6 f;  2OTL Z;  4MD7 A;  2GTI A;  2IZ4 A;  1ZB8 A;  4E2Y A;  1KQS Z;  3S1N I;  1QXF A;  2EGT A;  2G2K A;  2BJO A;  2QRD B;  3VMH A;  5AN9 F;  2OTJ Z;  2I3C A;  3G71 Z;  3NDJ A;  2PK7 A;  3CQZ I;  1QVF Y;  1VQ9 1;  2JIM A;  3I07 A;  2V3V A;  1TWG I;  2DE7 A;  1KD1 2;  1KC8 1;  3CCE 1;  4NBG A;  1N8R 1;  3I4N I;  2JS4 A;  3CCJ 1;  1PFT A;  4A3J I;  3HOW I;  3CCV Z;  1Q86 2;  3IFU A;  4A3G I;  1Z02 A;  1VQL Z;  2QEX 1;  1ZH1 A;  2Q4Z A;  3GTQ I;  4A3C I;  3H3V J;  1N2F A;  5FLM I;  2OZK A;  5IT9 b;  3VB9 A;  3QWU A;  2OOY B;  4NBC A;  4AYB A;  3CCL Z;  2JIO A;  2JMO A;  3IX0 A;  2P28 A;  3S16 I;  2LEX A;  2B63 I;  3J81 b;  4NBE A;  4NOZ A;  2R93 I;  2DE6 A;  2F4O A;  3FQM A;  1YIT 1;  1TWC I;  5A2Q b;  3CME Z;  3PO2 I;  4S1T A;  4NH1 C;  2DE5 A;  4DGL A;  3CC7 Z;  2O4H A;  5T64 A;  2LFU A;  4QTU A;  2E2J I;  1DL6 A;  2K5R A;  1Q86 1;  3OW2 Y;  2NVQ I;  5C4X I;  1K73 2;  3CC2 Z;  4HGZ A;  4QTT A;  3CCQ 1;  3LUS A;  2IZ3 A;  4NBD A;  1NJI 1;  1Y1W I;  3I55 1; 
#chains in the Genus database with same CATH homology
 5T6B A;  1YJN Z;  2YU9 I;  4NBA A;  3BG1 B;  4MD8 A;  2KI7 B;  3GTO I;  2GU2 A;  3CME 1;  3NDI A;  1M1K 2;  3NH8 A;  4RVG A;  1QYP A;  1W2B Y;  3CPW Z;  3CMA Z;  1JJ2 Y;  3D9X A;  3NH4 A;  3NH5 A;  1QVG Y;  2LIY A;  5D1O A;  1VQ5 1;  2R6M A;  3J7A 4;  4E2W A;  3I56 Z;  1USP B;  2R7Z I;  2W04 A;  2QKD A;  4X6A I;  1VQ4 Z;  1VQ6 Z;  2K3R A;  1Q7Y 2;  3G6E 1;  3HOX I;  2V8J A;  4BXX I;  4NFR A;  5CM2 M;  2JA7 I;  4E32 A;  3H0G I;  2E9H A;  1TWA I;  3Q87 A;  3CC4 1;  1VQP 1;  3CXC Z;  5FLX f;  1S72 Z;  1M90 1;  1VQK Z;  3GCF A;  3CCS 1;  3CCM Z;  1Q82 2;  3GTG I;  3J80 f;  1TWH I;  3G4S 1;  3S14 I;  1VQ7 1;  2HU9 A;  2QA4 Z;  1M1K 1;  1USP A;  1VQM Z;  2OTL 1;  2QR1 B;  1JWH C;  2JA5 I;  3S1Q I;  1YIJ Z;  3HOU I;  4BBS I;  3S2H I;  3S1M I;  3ESW A;  3MZL B;  2OTJ 1;  3MZK B;  1VQO Z;  3G71 1;  2WB1 A;  1X3Z A;  4BY7 I;  1YUK A;  3MON A;  1RNI A;  3HOV I;  3S17 I;  2R92 I;  4RVH A;  1P9N A;  3M3Y I;  3S2D I;  1RLY A;  2OOX B;  4BY1 I;  2RHB A;  3S15 I;  3P5J B;  1NP6 A;  3GTL I;  1Q82 1;  3CCV 1;  3CD6 Z;  3FQQ A;  1SFO I;  1VQL 1;  1KD1 1;  1VQ8 Z;  1YJW Z;  1Q81 2;  4A3D I;  1I50 I;  4NB8 A;  5D1O B;  4MD9 A;  3S1R I;  1RO0 A;  1X3W A;  2JNY A;  1S7M A;  3J81 f;  3CCL 1;  1K9M 2;  3CCR Z;  3VTN A;  1YI2 Z;  2JA6 I;  1L1O C;  3CCU Z;  2GTH A;  4RS4 A;  2JUB A;  3U50 C;  2V8K A;  1R9T I;  1K8A 2;  3T4N B;  1Z03 A;  3RZO I;  1YJ9 Z;  3IF8 A;  3CPW Y;  3RZD I;  1VQN Z;  3GTP I;  4MXU A;  2W03 A;  1ZB9 A;  5T67 A;  4CL1 A;  4E31 A;  3CC7 1;  1KC8 2;  3I4M I;  3CC2 1;  1Z01 A;  1WII A;  2KPI A;  1LQL A;  1Q81 1;  2J6A A;  3JAM f;  1KQS Y;  4E33 A;  2NVT I;  1VQ9 Z;  3CXC Y;  1YJN 1;  3K7A I;  2RT9 A;  5C4J I;  3F3F C;  1W2B Z;  3CCE Z;  1K73 1;  1WW9 A;  2H85 A;  1ML8 A;  3GTJ I;  3GTM I;  1YHQ Z;  4NBF A;  1TWF I;  1VLA A;  1VQN 1;  3GTK I;  3J80 b;  3CMA 1;  3HOY I;  4NB9 A;  2M6N A;  2AKL A;  2Y0S A;  2PMZ A;  3PO3 I;  1K8A 1;  2P3Y A;  1YUA A;  2QEX Z;  4A3B I;  3I56 1;  5C3E I;  1VQ4 1;  2O53 A;  2ZAE B;  2VF1 A;  3VMG A;  1VQ6 1;  4Y7N I;  2M48 A;  4MH4 A;  1QVF Z;  3EED A;  1S72 1;  3HKZ A;  1VQK 1;  2V8I A;  1KRL A;  4RVF A;  2PM9 A;  1YHQ 1;  4MON A;  1Q7Y 1;  1Y1V I;  2VUM I;  4A93 I;  3CCM 1;  2RPR A;  3VMI A;  2E2H I;  4EWC A;  1NUI A;  1YIT Z;  4MRI A;  4Y52 I;  3FKI I;  4NBH A;  2QA4 1;  1NJI 2;  2RIQ A;  1VQM 1;  2NVX I;  3EER A;  5IT9 f;  1YIJ 1;  1TFI A;  3F3P C;  3CCQ Z;  4DQY B;  2QRE B;  1VQO 1;  4E2X A;  2QRC B;  2JA8 I;  4A3M I;  4DK1 A;  4HGY A;  3I55 Z;  1K83 I;  3GTM S;  3D6W A;  4A3I I;  3TDH B;  3NFZ A;  2E2I I;  5IP9 I;  3PO3 S;  5A2Q f;  4HH4 A;  4XX2 A;  4BBR I;  4E30 A;  2NVY I;  3CD6 1;  3M4O I;  4A3K I;  4RV9 A;  1VQ5 Z;  1X0T A;  3GKQ A;  1M90 2;  1VQ8 1;  1YJW 1;  4TNU A;  4A3E I;  2Q51 A;  3OW2 Z;  1WCM I;  1RO4 A;  3G6E Z;  2HF1 A;  3BG0 B;  2WAQ A;  4NBB A;  3CC4 Z;  1I6H I;  2VUG A;  1VQP Z;  5IP7 I;  3CCR 1;  1Y1V S;  1YI2 1;  3JAM b;  1RO2 A;  1N8R 2;  1I3Q I;  3KIH A;  3CCS Z;  3CCU 1;  2F4M A;  3TE5 B;  2JR6 A;  4A3F I;  5FLX b;  1JJ2 Z;  4E2Z A;  5C44 I;  1YJ9 1;  1K9M 1;  1RQF A;  1QVG Z;  3HOZ I;  1QF8 A;  3G4S Z;  5D1P A;  1VQ7 Z;  4A3L I;  2YAD A;  3CCJ Z;  2QLV B;  3KIF A;  4RVD A;  2RBL A;  5LL6 f;  2OTL Z;  4MD7 A;  2GTI A;  2IZ4 A;  1ZB8 A;  4E2Y A;  1KQS Z;  3S1N I;  2EGT A;  2G2K A;  2BJO A;  2QRD B;  3VMH A;  5AN9 F;  2OTJ Z;  2I3C A;  3G71 Z;  3NDJ A;  2PK7 A;  3CQZ I;  1QVF Y;  1VQ9 1;  3I07 A;  1TWG I;  2DE7 A;  1KD1 2;  1KC8 1;  3CCE 1;  4NBG A;  1N8R 1;  3I4N I;  2JS4 A;  3CCJ 1;  1PFT A;  4A3J I;  3HOW I;  3CCV Z;  1Q86 2;  3IFU A;  4A3G I;  1Z02 A;  1VQL Z;  2QEX 1;  1ZH1 A;  2Q4Z A;  3GTQ I;  4A3C I;  3H3V J;  1N2F A;  5FLM I;  2OZK A;  5IT9 b;  3VB9 A;  3QWU A;  2OOY B;  4NBC A;  4AYB A;  3CCL Z;  2JMO A;  3IX0 A;  2P28 A;  3S16 I;  2B63 I;  3J81 b;  4NBE A;  4NOZ A;  2R93 I;  2DE6 A;  2F4O A;  3FQM A;  1YIT 1;  1TWC I;  5A2Q b;  3CME Z;  3PO2 I;  4S1T A;  4NH1 C;  2DE5 A;  4DGL A;  3CC7 Z;  2O4H A;  5T64 A;  2LFU A;  4QTU A;  2E2J I;  1DL6 A;  2K5R A;  1Q86 1;  3OW2 Y;  2NVQ I;  5C4X I;  1K73 2;  3CC2 Z;  4HGZ A;  4QTT A;  3CCQ 1;  3LUS A;  2IZ3 A;  4NBD A;  1NJI 1;  1Y1W I;  3I55 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...