4A3MI

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3mI02
4A3EI 4NBFA 3S2HI 4A3LI 1X3WA 2DE7A 1YUAA 2NVTI 3H3VJ 1ZB9A 3VMGA 4NBAA 3Q87A 1Y1WI 2HF1A 4MH4A 1WCMI 1I6HI 2YU9I 2F4OA 3GTMS 3S2DI 2DE5A 1RO4A 1I50I 2K5RA 2NVYI 3HOVI 2JA5I 4BY7I 1K83I 3GTLI 1N2FA 2KPIA 3ESWA 3GTJI 3M4OI 4NBDA 4BBSI 1I3QI 4BXXI 1USPB 2R7ZI 4QTUA 5IP7I 1TWAI 1X3ZA 3LUSA 4NBBA 3S1RI 3PO2I 3GTKI 2BJOA 3H0GI 4Y52I 4NOZA 3RZOI 1QYPA 1NUIA 4A3FI 2F4MA 2JR6A 3HOZI 2PK7A 3GTMI 4XX2A 4A93I 3GKQA 3PO3S 4A3MI 2E2JI 4NBEA 4A3BI 5FLMI 2NVXI 1DL6A 3EERA 1Y1VS 4Y7NI 3HOXI 4BBRI 4A3II 3GTOI 3K7AI 2AKLA 1PFTA 3CQZI 1ZB8A 2RBLA 5CM2M 3M3YI 1ML8A 2NVQI 1RLYA 4NBCA 5IP9I 2JNYA 2E2II 3HOYI 4A3JI 2B63I 3GTQI 3S17I 5C44I 3RZDI 4NBGA 2E2HI 1TWFI 3PO3I 1TWHI 4A3CI 1VLAA 1L1OC 2J6AA 3FKII 1Y1VI 5C4XI 1R9TI 3S16I 3I4NI 3S15I 3I07A 2DE6A 4A3DI 1TFIA 3HOUI 1USPA 3U50C 3S1MI 3I4MI 2JA7I 1TWGI 1SFOI 4NBHA 3HOWI 2P3YA 3GCFA 1TWCI 3S14I 2JA8I 4NB8A 4BY1I 2R93I 1LQLA 3VMIA 4A3KI 2R92I 3GTGI 2JS4A 4QTTA 4X6AI 3VB9A 3VMHA 3GTPI 5C4JI 2JA6I 4NB9A 5C3EI 3S1NI 4A3GI 1WW9A 3S1QI 2VUMI 3D6WA
chains in the Genus database with same CATH superfamily
1YHQZ 3NDJA 3G4SZ 3S2HI 4A3LI 3JAMf 3CCRZ 2NVTI 3CMEZ 4NBAA 2QR1B 2VUGA 3CMA1 2R6MA 1M901 1KQSY 3S2DI 3KIFA 4E33A 2W04A 3J81f 2JA5I 4E2ZA 3FQQA 2IZ3A 4NBDA 1K8A2 4MD8A 4NH1C 4NFRA 2OTL1 3OW2Y 5IP7I 1TWAI 1X3ZA 3GTKI 3H0GI 1K8A1 2IZ4A 2VPYA 1Q862 1M1K2 4A3FI 4EWCA 3MONA 3QWUA 3CC21 2RIQA 2VF1A 4A3MI 1M1K1 1Q861 2NVXI 3EERA 5FLXf 2JIRA 3CC4Z 3CCS1 1K732 1Q822 2VPZA 3NDIA 1VQ5Z 4NBCA 1VQ7Z 3CCJ1 1WZNA 4MXUA 4A3JI 5C44I 2PM9A 1YIT1 2JIMA 2PMZA 1KRLA 1YJ91 2J6AA 3CPWZ 3S16I 3IR7A 3I4NI 3S15I 3I07A 1YIJZ 4A3DI 1USPA 5T6BA 4RVFA 1Z02A 1QVGY 2K3RA 5AN9F 1P9NA 2GTIA 3GCFA 1TWCI 1K9M1 3S14I 4BY1I 1LQLA 2V45A 1YI21 4QTTA 4X6AI 2QKDA 2V8KA 3VTNA 1KD12 1QVFY 5D1OA 4NB9A 1RO0A 3S1NI 4A3GI 3CCMZ 3S1QI 2VUMI 3CXCY 1VQL1 4DQYB 2LFUA 4A3EI 3TE5B 1Q812 1W2BZ 3H3VJ 3CCQZ 1KQSZ 3TDHB 2QEX1 1Y1WI 4MH4A 4DGLA 2AYDA 4MD9A 2F4OA 2K5RA 3G71Z 2NVYI 2ZAEB 3HOVI 4BY7I 1K83I 3CCLZ 2GTHA 2OOYB 1S721 3ESWA 3M4OI 3OW2Z 4BBSI 3IF8A 1YJW1 1USPB 2R7ZI 4MONA 1M902 2HU9A 3PO2I 2BJOA 1VQ9Z 1VQOZ 3RZOI 2QREB 4RVHA 1NUIA 2F4MA 3HOZI 4RVDA 2PK7A 3CCV1 2G2KA 4A93I 2OTJZ 5IT9b 4NBEA 5D1OB 1ZH1A 1RQFA 3J80f 1X0TA 1VQNZ 3IFUA 1YJNZ 2LIYA 3GTOI 1WJ2A 5T64A 1VQKZ 1AA6A 2AKLA 1PFTA 3CQZI 2QRCB 4AYBA 2RBLA 5CM2M 3M3YI 2QLVB 1ML8A 1RLYA 3NH8A 3CC71 2M48A 5A2Qb 1VQ8Z 1VQPZ 2OOXB 1YJWZ 2RT9A 2W03A 3D9XA 3FKII 4HGZA 4E30A 3CMAZ 3BG1B 3S1MI 1SFOI 4NBHA 4HGYA 2P3YA 2VPWA 2O53A 3CCU1 2R93I 1QVFZ 3VMIA 2Q4ZA 4A3KI 2R92I 1VQ61 4RS4A 3GTPI 2OTLZ 3I551 3CXCZ 1JWHC 3CCE1 1KC81 1WW9A 2OZKA 4HH4A 4NBFA 3NH5A 1X3WA 1K9M2 1YUAA 2KI7B 1ZB9A 3VMGA 3CC2Z 3CD61 1SIWA 1VQ41 2HF1A 1WCMI 1I6HI 2E9HA 2DE5A 3CCSZ 1RO4A 1I50I 2JUBA 1JJ2Y 3KIHA 1QF8A 3F3PC 4MD7A 2KPIA 1RNIA 3BG0B 3CCJZ 1FDOA 1I3QI 1Z01A 4TNUA 3CCUZ 4RV9A 2O4HA 1VQM1 1NJI1 2VPXA 4BXXI 1YITZ 3LUSA 3JAMb 2QA41 4RVGA 1YHQ1 4Y52I 3MZLB 1YJ9Z 2JR6A 3CCR1 2I3CA 3G6E1 3CME1 4XX2A 2E2JI 1DL6A 3J81b 3HOXI 4A3II 2EGTA 1ZB8A 2JIPA 1YI2Z 5IP9I 2RHBA 2GU2A 2E2II 3GTQI 3S17I 4E2WA 4E2YA 1VQLZ 1TWFI 3NH4A 1TWHI 4A3CI 1L1OC 1YUKA 5FLXb 4E31A 2QEXZ 1FDIA 3P5JB 2DE6A 3T4NB 4E2XA 3F3FC 3G6EZ 3CC41 3I4MI 2JA7I 1TWGI 2P28A 1W2BY 1Q7Y2 4S1TA 1VQ51 4NB8A 1S72Z 2Y0SA 2JS4A 1VQ71 3VMHA 5C4JI 1Q7Y1 2H85A 3HKZA 5C3EI 1RO2A 3D2LA 2LEXA 1QVGZ 2V8IA 2DE7A 3J7A4 3CCVZ 2JIOA 3Q87A 1NP6A 1JJ2Z 1YIJ1 2YU9I 3GTMS 5IT9f 1KC82 3GTLI 3I561 1N2FA 3CC7Z 3GTJI 5T67A 4QTUA 3S1RI 4NBBA 1K731 3NFZA 2JMOA 3CCM1 1Y8CA 5A2Qf 1Q821 4NOZA 1QYPA 4E32A 2M6NA 3GTMI 2NAPA 1Q16A 3CCQ1 1S7MA 3GKQA 3PO3S 2V3VA 4A3BI 5FLMI 4CL1A 1Y1VS 4Y7NI 1NJI2 4BBRI 2WB1A 3G711 3K7AI 2RPRA 1QXFA 3CCL1 2NVQI 1Z03A 3EEDA 1VQ6Z 2JNYA 2JIQA 3HOYI 2QRDB 2B63I 3I56Z 3I55Z 3RZDI 3G4S1 3CCEZ 4NBGA 2V8JA 2E2HI 1VQ91 1VQO1 3PO3I 3MZKB 1VLAA 4MRIA 5LL6f 1Y1VI 5C4XI 1R9TI 3J80b 3CD6Z 2OTJ1 1N8R2 1KD11 1VQ4Z 3CPWY 1TFIA 3HOUI 3U50C 1VQN1 1YJN1 2E7ZA 1VQK1 1N8R1 3HOWI 1Q811 2JA8I 4DK1A 2IV2X 2Q51A 2YADA 3GTGI 3VB9A 1VQMZ 3IX0A 2JA6I 1WIIA 1VQ81 2WAQA 3FQMA 1VQP1 2QA4Z 5D1PA 3D6WA
chains in the Genus database with same CATH topology
1YHQZ 3NDJA 3G4SZ 3S2HI 4A3LI 3JAMf 3CCRZ 2NVTI 3CMEZ 4NBAA 2QR1B 2VUGA 3CMA1 2R6MA 1M901 1KQSY 3S2DI 3KIFA 4E33A 2W04A 3J81f 2JA5I 4E2ZA 3FQQA 2IZ3A 4NBDA 1K8A2 4MD8A 4NH1C 4NFRA 2OTL1 3OW2Y 5IP7I 1TWAI 1X3ZA 3GTKI 3H0GI 1K8A1 2IZ4A 1Q862 1M1K2 4A3FI 4EWCA 3MONA 3QWUA 3CC21 2RIQA 2VF1A 4A3MI 1M1K1 1Q861 2NVXI 3EERA 5FLXf 3CC4Z 3CCS1 1K732 1Q822 3NDIA 1VQ5Z 4NBCA 1VQ7Z 3CCJ1 4MXUA 4A3JI 5C44I 2PM9A 1YIT1 2PMZA 1KRLA 1YJ91 2J6AA 3CPWZ 3S16I 3I4NI 3S15I 3I07A 1YIJZ 4A3DI 1USPA 5T6BA 4RVFA 1Z02A 1QVGY 2K3RA 5AN9F 1P9NA 2GTIA 3GCFA 1TWCI 1K9M1 3S14I 4BY1I 1LQLA 1YI21 4QTTA 4X6AI 2QKDA 2V8KA 3VTNA 1KD12 1QVFY 5D1OA 4NB9A 1RO0A 3S1NI 4A3GI 3CCMZ 3S1QI 2VUMI 3CXCY 1VQL1 4DQYB 2LFUA 4A3EI 3TE5B 1Q812 1W2BZ 3H3VJ 3CCQZ 1KQSZ 3TDHB 2QEX1 1Y1WI 4MH4A 4DGLA 4MD9A 2F4OA 2K5RA 3G71Z 2NVYI 2ZAEB 3HOVI 4BY7I 1K83I 3CCLZ 2GTHA 2OOYB 1S721 3ESWA 3M4OI 3OW2Z 4BBSI 3IF8A 1YJW1 1USPB 2R7ZI 4MONA 1M902 2HU9A 3PO2I 2BJOA 1VQ9Z 1VQOZ 3RZOI 2QREB 4RVHA 1NUIA 2F4MA 3HOZI 4RVDA 2PK7A 3CCV1 2G2KA 4A93I 2OTJZ 5IT9b 4NBEA 5D1OB 1ZH1A 1RQFA 3J80f 1X0TA 1VQNZ 3IFUA 1YJNZ 2LIYA 3GTOI 5T64A 1VQKZ 2AKLA 1PFTA 3CQZI 2QRCB 4AYBA 2RBLA 5CM2M 3M3YI 2QLVB 1ML8A 1RLYA 3NH8A 3CC71 2M48A 5A2Qb 1VQ8Z 1VQPZ 2OOXB 1YJWZ 2RT9A 2W03A 3D9XA 3FKII 4HGZA 4E30A 3CMAZ 3BG1B 3S1MI 1SFOI 4NBHA 4HGYA 2P3YA 2O53A 3CCU1 2R93I 1QVFZ 3VMIA 2Q4ZA 4A3KI 2R92I 1VQ61 4RS4A 3GTPI 2OTLZ 3I551 3CXCZ 1JWHC 3CCE1 1KC81 1WW9A 2OZKA 4HH4A 4NBFA 3NH5A 1X3WA 1K9M2 1YUAA 2KI7B 1ZB9A 3VMGA 3CC2Z 3CD61 1VQ41 2HF1A 1WCMI 1I6HI 2E9HA 2DE5A 3CCSZ 1RO4A 1I50I 2JUBA 1JJ2Y 3KIHA 1QF8A 3F3PC 4MD7A 2KPIA 1RNIA 3BG0B 3CCJZ 1I3QI 1Z01A 4TNUA 3CCUZ 4RV9A 2O4HA 1VQM1 1NJI1 4BXXI 1YITZ 3LUSA 3JAMb 2QA41 4RVGA 1YHQ1 4Y52I 3MZLB 1YJ9Z 2JR6A 3CCR1 2I3CA 3G6E1 3CME1 4XX2A 2E2JI 1DL6A 3J81b 3HOXI 4A3II 2EGTA 1ZB8A 1YI2Z 5IP9I 2RHBA 2GU2A 2E2II 3GTQI 3S17I 4E2WA 4E2YA 1VQLZ 1TWFI 3NH4A 1TWHI 4A3CI 1L1OC 1YUKA 5FLXb 4E31A 2QEXZ 3P5JB 2DE6A 3T4NB 4E2XA 3F3FC 3G6EZ 3CC41 3I4MI 2JA7I 1TWGI 2P28A 1W2BY 1Q7Y2 4S1TA 1VQ51 4NB8A 1S72Z 2Y0SA 2JS4A 1VQ71 3VMHA 5C4JI 1Q7Y1 2H85A 3HKZA 5C3EI 1RO2A 1QVGZ 2V8IA 2DE7A 3J7A4 3CCVZ 3Q87A 1NP6A 1JJ2Z 1YIJ1 2YU9I 3GTMS 5IT9f 1KC82 3GTLI 3I561 1N2FA 3CC7Z 3GTJI 5T67A 4QTUA 3S1RI 4NBBA 1K731 3NFZA 2JMOA 3CCM1 5A2Qf 1Q821 4NOZA 1QYPA 4E32A 2M6NA 3GTMI 3CCQ1 1S7MA 3GKQA 3PO3S 4A3BI 5FLMI 4CL1A 1Y1VS 4Y7NI 1NJI2 4BBRI 2WB1A 3G711 3K7AI 2RPRA 3CCL1 2NVQI 1Z03A 3EEDA 1VQ6Z 2JNYA 3HOYI 2QRDB 2B63I 3I56Z 3I55Z 3RZDI 3G4S1 3CCEZ 4NBGA 2V8JA 2E2HI 1VQ91 1VQO1 3PO3I 3MZKB 1VLAA 4MRIA 5LL6f 1Y1VI 5C4XI 1R9TI 3J80b 3CD6Z 2OTJ1 1N8R2 1KD11 1VQ4Z 3CPWY 1TFIA 3HOUI 3U50C 1VQN1 1YJN1 1VQK1 1N8R1 3HOWI 1Q811 2JA8I 4DK1A 2Q51A 2YADA 3GTGI 3VB9A 1VQMZ 3IX0A 2JA6I 1WIIA 1VQ81 2WAQA 3FQMA 1VQP1 2QA4Z 5D1PA 3D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  4NBF A;  3S2H I;  4A3L I;  1X3W A;  2DE7 A;  1YUA A;  2NVT I;  3H3V J;  1ZB9 A;  3VMG A;  4NBA A;  3Q87 A;  1Y1W I;  2HF1 A;  4MH4 A;  1WCM I;  1I6H I;  2YU9 I;  2F4O A;  3GTM S;  3S2D I;  2DE5 A;  1RO4 A;  1I50 I;  2K5R A;  2NVY I;  3HOV I;  2JA5 I;  4BY7 I;  1K83 I;  3GTL I;  1N2F A;  2KPI A;  3ESW A;  3GTJ I;  3M4O I;  4NBD A;  4BBS I;  1I3Q I;  4BXX I;  1USP B;  2R7Z I;  4QTU A;  5IP7 I;  1TWA I;  1X3Z A;  3LUS A;  4NBB A;  3S1R I;  3PO2 I;  3GTK I;  2BJO A;  3H0G I;  4Y52 I;  4NOZ A;  3RZO I;  1QYP A;  1NUI A;  4A3F I;  2F4M A;  2JR6 A;  3HOZ I;  2PK7 A;  3GTM I;  4XX2 A;  4A93 I;  3GKQ A;  3PO3 S;  4A3M I;  2E2J I;  4NBE A;  4A3B I;  5FLM I;  2NVX I;  1DL6 A;  3EER A;  1Y1V S;  4Y7N I;  3HOX I;  4BBR I;  4A3I I;  3GTO I;  3K7A I;  2AKL A;  1PFT A;  3CQZ I;  1ZB8 A;  2RBL A;  5CM2 M;  3M3Y I;  1ML8 A;  2NVQ I;  1RLY A;  4NBC A;  5IP9 I;  2JNY A;  2E2I I;  3HOY I;  4A3J I;  2B63 I;  3GTQ I;  3S17 I;  5C44 I;  3RZD I;  4NBG A;  2E2H I;  1TWF I;  3PO3 I;  1TWH I;  4A3C I;  1VLA A;  1L1O C;  2J6A A;  3FKI I;  1Y1V I;  5C4X I;  1R9T I;  3S16 I;  3I4N I;  3S15 I;  3I07 A;  2DE6 A;  4A3D I;  1TFI A;  3HOU I;  1USP A;  3U50 C;  3S1M I;  3I4M I;  2JA7 I;  1TWG I;  1SFO I;  4NBH A;  3HOW I;  2P3Y A;  3GCF A;  1TWC I;  3S14 I;  2JA8 I;  4NB8 A;  4BY1 I;  2R93 I;  1LQL A;  3VMI A;  4A3K I;  2R92 I;  3GTG I;  2JS4 A;  4QTT A;  4X6A I;  3VB9 A;  3VMH A;  3GTP I;  5C4J I;  2JA6 I;  4NB9 A;  5C3E I;  3S1N I;  4A3G I;  1WW9 A;  3S1Q I;  2VUM I;  3D6W A; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  3NDJ A;  3G4S Z;  3S2H I;  4A3L I;  3JAM f;  3CCR Z;  2NVT I;  3CME Z;  4NBA A;  2QR1 B;  2VUG A;  3CMA 1;  2R6M A;  1M90 1;  1KQS Y;  3S2D I;  3KIF A;  4E33 A;  2W04 A;  3J81 f;  2JA5 I;  4E2Z A;  3FQQ A;  2IZ3 A;  4NBD A;  1K8A 2;  4MD8 A;  4NH1 C;  4NFR A;  2OTL 1;  3OW2 Y;  5IP7 I;  1TWA I;  1X3Z A;  3GTK I;  3H0G I;  1K8A 1;  2IZ4 A;  2VPY A;  1Q86 2;  1M1K 2;  4A3F I;  4EWC A;  3MON A;  3QWU A;  3CC2 1;  2RIQ A;  2VF1 A;  4A3M I;  1M1K 1;  1Q86 1;  2NVX I;  3EER A;  5FLX f;  2JIR A;  3CC4 Z;  3CCS 1;  1K73 2;  1Q82 2;  2VPZ A;  3NDI A;  1VQ5 Z;  4NBC A;  1VQ7 Z;  3CCJ 1;  1WZN A;  4MXU A;  4A3J I;  5C44 I;  2PM9 A;  1YIT 1;  2JIM A;  2PMZ A;  1KRL A;  1YJ9 1;  2J6A A;  3CPW Z;  3S16 I;  3IR7 A;  3I4N I;  3S15 I;  3I07 A;  1YIJ Z;  4A3D I;  1USP A;  5T6B A;  4RVF A;  1Z02 A;  1QVG Y;  2K3R A;  5AN9 F;  1P9N A;  2GTI A;  3GCF A;  1TWC I;  1K9M 1;  3S14 I;  4BY1 I;  1LQL A;  2V45 A;  1YI2 1;  4QTT A;  4X6A I;  2QKD A;  2V8K A;  3VTN A;  1KD1 2;  1QVF Y;  5D1O A;  4NB9 A;  1RO0 A;  3S1N I;  4A3G I;  3CCM Z;  3S1Q I;  2VUM I;  3CXC Y;  1VQL 1;  4DQY B;  2LFU A;  4A3E I;  3TE5 B;  1Q81 2;  1W2B Z;  3H3V J;  3CCQ Z;  1KQS Z;  3TDH B;  2QEX 1;  1Y1W I;  4MH4 A;  4DGL A;  2AYD A;  4MD9 A;  2F4O A;  2K5R A;  3G71 Z;  2NVY I;  2ZAE B;  3HOV I;  4BY7 I;  1K83 I;  3CCL Z;  2GTH A;  2OOY B;  1S72 1;  3ESW A;  3M4O I;  3OW2 Z;  4BBS I;  3IF8 A;  1YJW 1;  1USP B;  2R7Z I;  4MON A;  1M90 2;  2HU9 A;  3PO2 I;  2BJO A;  1VQ9 Z;  1VQO Z;  3RZO I;  2QRE B;  4RVH A;  1NUI A;  2F4M A;  3HOZ I;  4RVD A;  2PK7 A;  3CCV 1;  2G2K A;  4A93 I;  2OTJ Z;  5IT9 b;  4NBE A;  5D1O B;  1ZH1 A;  1RQF A;  3J80 f;  1X0T A;  1VQN Z;  3IFU A;  1YJN Z;  2LIY A;  3GTO I;  1WJ2 A;  5T64 A;  1VQK Z;  1AA6 A;  2AKL A;  1PFT A;  3CQZ I;  2QRC B;  4AYB A;  2RBL A;  5CM2 M;  3M3Y I;  2QLV B;  1ML8 A;  1RLY A;  3NH8 A;  3CC7 1;  2M48 A;  5A2Q b;  1VQ8 Z;  1VQP Z;  2OOX B;  1YJW Z;  2RT9 A;  2W03 A;  3D9X A;  3FKI I;  4HGZ A;  4E30 A;  3CMA Z;  3BG1 B;  3S1M I;  1SFO I;  4NBH A;  4HGY A;  2P3Y A;  2VPW A;  2O53 A;  3CCU 1;  2R93 I;  1QVF Z;  3VMI A;  2Q4Z A;  4A3K I;  2R92 I;  1VQ6 1;  4RS4 A;  3GTP I;  2OTL Z;  3I55 1;  3CXC Z;  1JWH C;  3CCE 1;  1KC8 1;  1WW9 A;  2OZK A;  4HH4 A;  4NBF A;  3NH5 A;  1X3W A;  1K9M 2;  1YUA A;  2KI7 B;  1ZB9 A;  3VMG A;  3CC2 Z;  3CD6 1;  1SIW A;  1VQ4 1;  2HF1 A;  1WCM I;  1I6H I;  2E9H A;  2DE5 A;  3CCS Z;  1RO4 A;  1I50 I;  2JUB A;  1JJ2 Y;  3KIH A;  1QF8 A;  3F3P C;  4MD7 A;  2KPI A;  1RNI A;  3BG0 B;  3CCJ Z;  1FDO A;  1I3Q I;  1Z01 A;  4TNU A;  3CCU Z;  4RV9 A;  2O4H A;  1VQM 1;  1NJI 1;  2VPX A;  4BXX I;  1YIT Z;  3LUS A;  3JAM b;  2QA4 1;  4RVG A;  1YHQ 1;  4Y52 I;  3MZL B;  1YJ9 Z;  2JR6 A;  3CCR 1;  2I3C A;  3G6E 1;  3CME 1;  4XX2 A;  2E2J I;  1DL6 A;  3J81 b;  3HOX I;  4A3I I;  2EGT A;  1ZB8 A;  2JIP A;  1YI2 Z;  5IP9 I;  2RHB A;  2GU2 A;  2E2I I;  3GTQ I;  3S17 I;  4E2W A;  4E2Y A;  1VQL Z;  1TWF I;  3NH4 A;  1TWH I;  4A3C I;  1L1O C;  1YUK A;  5FLX b;  4E31 A;  2QEX Z;  1FDI A;  3P5J B;  2DE6 A;  3T4N B;  4E2X A;  3F3F C;  3G6E Z;  3CC4 1;  3I4M I;  2JA7 I;  1TWG I;  2P28 A;  1W2B Y;  1Q7Y 2;  4S1T A;  1VQ5 1;  4NB8 A;  1S72 Z;  2Y0S A;  2JS4 A;  1VQ7 1;  3VMH A;  5C4J I;  1Q7Y 1;  2H85 A;  3HKZ A;  5C3E I;  1RO2 A;  3D2L A;  2LEX A;  1QVG Z;  2V8I A;  2DE7 A;  3J7A 4;  3CCV Z;  2JIO A;  3Q87 A;  1NP6 A;  1JJ2 Z;  1YIJ 1;  2YU9 I;  3GTM S;  5IT9 f;  1KC8 2;  3GTL I;  3I56 1;  1N2F A;  3CC7 Z;  3GTJ I;  5T67 A;  4QTU A;  3S1R I;  4NBB A;  1K73 1;  3NFZ A;  2JMO A;  3CCM 1;  1Y8C A;  5A2Q f;  1Q82 1;  4NOZ A;  1QYP A;  4E32 A;  2M6N A;  3GTM I;  2NAP A;  1Q16 A;  3CCQ 1;  1S7M A;  3GKQ A;  3PO3 S;  2V3V A;  4A3B I;  5FLM I;  4CL1 A;  1Y1V S;  4Y7N I;  1NJI 2;  4BBR I;  2WB1 A;  3G71 1;  3K7A I;  2RPR A;  1QXF A;  3CCL 1;  2NVQ I;  1Z03 A;  3EED A;  1VQ6 Z;  2JNY A;  2JIQ A;  3HOY I;  2QRD B;  2B63 I;  3I56 Z;  3I55 Z;  3RZD I;  3G4S 1;  3CCE Z;  4NBG A;  2V8J A;  2E2H I;  1VQ9 1;  1VQO 1;  3PO3 I;  3MZK B;  1VLA A;  4MRI A;  5LL6 f;  1Y1V I;  5C4X I;  1R9T I;  3J80 b;  3CD6 Z;  2OTJ 1;  1N8R 2;  1KD1 1;  1VQ4 Z;  3CPW Y;  1TFI A;  3HOU I;  3U50 C;  1VQN 1;  1YJN 1;  2E7Z A;  1VQK 1;  1N8R 1;  3HOW I;  1Q81 1;  2JA8 I;  4DK1 A;  2IV2 X;  2Q51 A;  2YAD A;  3GTG I;  3VB9 A;  1VQM Z;  3IX0 A;  2JA6 I;  1WII A;  1VQ8 1;  2WAQ A;  3FQM A;  1VQP 1;  2QA4 Z;  5D1P A;  3D6W A; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  3NDJ A;  3G4S Z;  3S2H I;  4A3L I;  3JAM f;  3CCR Z;  2NVT I;  3CME Z;  4NBA A;  2QR1 B;  2VUG A;  3CMA 1;  2R6M A;  1M90 1;  1KQS Y;  3S2D I;  3KIF A;  4E33 A;  2W04 A;  3J81 f;  2JA5 I;  4E2Z A;  3FQQ A;  2IZ3 A;  4NBD A;  1K8A 2;  4MD8 A;  4NH1 C;  4NFR A;  2OTL 1;  3OW2 Y;  5IP7 I;  1TWA I;  1X3Z A;  3GTK I;  3H0G I;  1K8A 1;  2IZ4 A;  1Q86 2;  1M1K 2;  4A3F I;  4EWC A;  3MON A;  3QWU A;  3CC2 1;  2RIQ A;  2VF1 A;  4A3M I;  1M1K 1;  1Q86 1;  2NVX I;  3EER A;  5FLX f;  3CC4 Z;  3CCS 1;  1K73 2;  1Q82 2;  3NDI A;  1VQ5 Z;  4NBC A;  1VQ7 Z;  3CCJ 1;  4MXU A;  4A3J I;  5C44 I;  2PM9 A;  1YIT 1;  2PMZ A;  1KRL A;  1YJ9 1;  2J6A A;  3CPW Z;  3S16 I;  3I4N I;  3S15 I;  3I07 A;  1YIJ Z;  4A3D I;  1USP A;  5T6B A;  4RVF A;  1Z02 A;  1QVG Y;  2K3R A;  5AN9 F;  1P9N A;  2GTI A;  3GCF A;  1TWC I;  1K9M 1;  3S14 I;  4BY1 I;  1LQL A;  1YI2 1;  4QTT A;  4X6A I;  2QKD A;  2V8K A;  3VTN A;  1KD1 2;  1QVF Y;  5D1O A;  4NB9 A;  1RO0 A;  3S1N I;  4A3G I;  3CCM Z;  3S1Q I;  2VUM I;  3CXC Y;  1VQL 1;  4DQY B;  2LFU A;  4A3E I;  3TE5 B;  1Q81 2;  1W2B Z;  3H3V J;  3CCQ Z;  1KQS Z;  3TDH B;  2QEX 1;  1Y1W I;  4MH4 A;  4DGL A;  4MD9 A;  2F4O A;  2K5R A;  3G71 Z;  2NVY I;  2ZAE B;  3HOV I;  4BY7 I;  1K83 I;  3CCL Z;  2GTH A;  2OOY B;  1S72 1;  3ESW A;  3M4O I;  3OW2 Z;  4BBS I;  3IF8 A;  1YJW 1;  1USP B;  2R7Z I;  4MON A;  1M90 2;  2HU9 A;  3PO2 I;  2BJO A;  1VQ9 Z;  1VQO Z;  3RZO I;  2QRE B;  4RVH A;  1NUI A;  2F4M A;  3HOZ I;  4RVD A;  2PK7 A;  3CCV 1;  2G2K A;  4A93 I;  2OTJ Z;  5IT9 b;  4NBE A;  5D1O B;  1ZH1 A;  1RQF A;  3J80 f;  1X0T A;  1VQN Z;  3IFU A;  1YJN Z;  2LIY A;  3GTO I;  5T64 A;  1VQK Z;  2AKL A;  1PFT A;  3CQZ I;  2QRC B;  4AYB A;  2RBL A;  5CM2 M;  3M3Y I;  2QLV B;  1ML8 A;  1RLY A;  3NH8 A;  3CC7 1;  2M48 A;  5A2Q b;  1VQ8 Z;  1VQP Z;  2OOX B;  1YJW Z;  2RT9 A;  2W03 A;  3D9X A;  3FKI I;  4HGZ A;  4E30 A;  3CMA Z;  3BG1 B;  3S1M I;  1SFO I;  4NBH A;  4HGY A;  2P3Y A;  2O53 A;  3CCU 1;  2R93 I;  1QVF Z;  3VMI A;  2Q4Z A;  4A3K I;  2R92 I;  1VQ6 1;  4RS4 A;  3GTP I;  2OTL Z;  3I55 1;  3CXC Z;  1JWH C;  3CCE 1;  1KC8 1;  1WW9 A;  2OZK A;  4HH4 A;  4NBF A;  3NH5 A;  1X3W A;  1K9M 2;  1YUA A;  2KI7 B;  1ZB9 A;  3VMG A;  3CC2 Z;  3CD6 1;  1VQ4 1;  2HF1 A;  1WCM I;  1I6H I;  2E9H A;  2DE5 A;  3CCS Z;  1RO4 A;  1I50 I;  2JUB A;  1JJ2 Y;  3KIH A;  1QF8 A;  3F3P C;  4MD7 A;  2KPI A;  1RNI A;  3BG0 B;  3CCJ Z;  1I3Q I;  1Z01 A;  4TNU A;  3CCU Z;  4RV9 A;  2O4H A;  1VQM 1;  1NJI 1;  4BXX I;  1YIT Z;  3LUS A;  3JAM b;  2QA4 1;  4RVG A;  1YHQ 1;  4Y52 I;  3MZL B;  1YJ9 Z;  2JR6 A;  3CCR 1;  2I3C A;  3G6E 1;  3CME 1;  4XX2 A;  2E2J I;  1DL6 A;  3J81 b;  3HOX I;  4A3I I;  2EGT A;  1ZB8 A;  1YI2 Z;  5IP9 I;  2RHB A;  2GU2 A;  2E2I I;  3GTQ I;  3S17 I;  4E2W A;  4E2Y A;  1VQL Z;  1TWF I;  3NH4 A;  1TWH I;  4A3C I;  1L1O C;  1YUK A;  5FLX b;  4E31 A;  2QEX Z;  3P5J B;  2DE6 A;  3T4N B;  4E2X A;  3F3F C;  3G6E Z;  3CC4 1;  3I4M I;  2JA7 I;  1TWG I;  2P28 A;  1W2B Y;  1Q7Y 2;  4S1T A;  1VQ5 1;  4NB8 A;  1S72 Z;  2Y0S A;  2JS4 A;  1VQ7 1;  3VMH A;  5C4J I;  1Q7Y 1;  2H85 A;  3HKZ A;  5C3E I;  1RO2 A;  1QVG Z;  2V8I A;  2DE7 A;  3J7A 4;  3CCV Z;  3Q87 A;  1NP6 A;  1JJ2 Z;  1YIJ 1;  2YU9 I;  3GTM S;  5IT9 f;  1KC8 2;  3GTL I;  3I56 1;  1N2F A;  3CC7 Z;  3GTJ I;  5T67 A;  4QTU A;  3S1R I;  4NBB A;  1K73 1;  3NFZ A;  2JMO A;  3CCM 1;  5A2Q f;  1Q82 1;  4NOZ A;  1QYP A;  4E32 A;  2M6N A;  3GTM I;  3CCQ 1;  1S7M A;  3GKQ A;  3PO3 S;  4A3B I;  5FLM I;  4CL1 A;  1Y1V S;  4Y7N I;  1NJI 2;  4BBR I;  2WB1 A;  3G71 1;  3K7A I;  2RPR A;  3CCL 1;  2NVQ I;  1Z03 A;  3EED A;  1VQ6 Z;  2JNY A;  3HOY I;  2QRD B;  2B63 I;  3I56 Z;  3I55 Z;  3RZD I;  3G4S 1;  3CCE Z;  4NBG A;  2V8J A;  2E2H I;  1VQ9 1;  1VQO 1;  3PO3 I;  3MZK B;  1VLA A;  4MRI A;  5LL6 f;  1Y1V I;  5C4X I;  1R9T I;  3J80 b;  3CD6 Z;  2OTJ 1;  1N8R 2;  1KD1 1;  1VQ4 Z;  3CPW Y;  1TFI A;  3HOU I;  3U50 C;  1VQN 1;  1YJN 1;  1VQK 1;  1N8R 1;  3HOW I;  1Q81 1;  2JA8 I;  4DK1 A;  2Q51 A;  2YAD A;  3GTG I;  3VB9 A;  1VQM Z;  3IX0 A;  2JA6 I;  1WII A;  1VQ8 1;  2WAQ A;  3FQM A;  1VQP 1;  2QA4 Z;  5D1P A;  3D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...