3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
4NBHA 4A3GI 3GTMI 2YU9I 1VLAA 3RZOI 2R92I 1USPB 3GTQI 3M3YI 1Y1WI 3LUSA 4NBCA 4A3CI 4Y7NI 4NB8A 4NBBA 3VMGA 2B63I 3RZDI 3I4NI 5C4XI 3S17I 2J6AA 2JR6A 4A3JI 2E2JI 3GTPI 2VUMI 5FLMI 3S1QI 3VMHA 1ML8A 2JA7I 1QYPA 3HOZI 3K7AI 2JA8I 1I6HI 1Y1VI 1WW9A 3GTJI 5C44I 3I4MI 2DE6A 1RO4A 3PO3S 3GCFA 3S14I 1TWCI 3M4OI 3U50C 3GTKI 2P3YA 1R9TI 1TWFI 4NOZA 3VMIA 3HOUI 1DL6A 1I50I 2PK7A 4X6AI 3CQZI 1ZB8A 3HOXI 1Y1VS 3HOWI 4A3LI 4A3II 3GTLI 1X3ZA 1YUAA 1RLYA 5IP7I 2KPIA 4NBGA 3GTGI 4BBRI 1TWHI 4A3BI 3ESWA 4QTUA 4BBSI 2HF1A 4A3MI 3H3VJ 3S1RI 1K83I 1N2FA 1USPA 3GTOI 4NBEA 2DE7A 2AKLA 1WCMI 3EERA 3HOVI 3PO2I 4BY7I 2DE5A 3S1MI 4XX2A 2F4OA 3S2DI 4NBAA 1X3WA 2JA6I 4A3DI 1NUIA 3FKII 2JA5I 3H0GI 2NVXI 3D6WA 4A93I 3I07A 4A3KI 1I3QI 2R93I 4A3EI 3GTMS 2BJOA 2F4MA 4BXXI 5IP9I 1LQLA 4A3FI 3S1NI 2K5RA 3PO3I 2E2HI 4Y52I 1SFOI 3GKQA 4NBDA 2RBLA 2JS4A 1TWGI 2JNYA 3S2HI 4MH4A 1ZB9A 2NVYI 4NBFA 4QTTA 3VB9A 1TWAI 1L1OC 3Q87A 1PFTA 4NB9A 2NVQI 3HOYI 2R7ZI 1TFIA 3S15I 3S16I 2NVTI 5CM2M 5C4JI 2E2II 4BY1I 5C3EI
chains in the Genus database with same CATH superfamily
2IV2X 1SIWA 2R92I 1VQ61 1KC81 3GTQI 4NBCA 1M901 4A3CI 3J81b 4NB8A 2V8KA 3IX0A 3G6EZ 3S1QI 1ML8A 3NH8A 4RVFA 4E2ZA 5T6BA 1N8R1 4RVHA 5C44I 3CC2Z 2QKDA 1VQLZ 2JIRA 1TWCI 3CCEZ 3M4OI 3GTKI 2P3YA 1P9NA 1TWFI 4NOZA 3CCSZ 1VQMZ 1DL6A 4E2WA 2JUBA 1ZB8A 3GTLI 1X3ZA 1RLYA 4CL1A 3CCJZ 3EEDA 3GTGI 3MZLB 1YJN1 1TWHI 3ESWA 2OOXB 3H3VJ 2JIMA 1VQ6Z 2QA4Z 4DGLA 3P5JB 1K8A2 3CC4Z 4BY7I 3CCJ1 1S72Z 1X3WA 1Q812 1VQPZ 2Y0SA 3FKII 2JA5I 3H0GI 4E2XA 3D6WA 1JWHC 2V8IA 4E32A 3GTMS 4S1TA 1Z02A 2QR1B 1VQ4Z 1WZNA 4BXXI 3G71Z 4A3FI 2H85A 5D1PA 5A2Qf 1K8A1 1VQL1 1X0TA 3G4SZ 4NBDA 1TWGI 4AYBA 3FQQA 4MH4A 1Z01A 4QTTA 1YJNZ 2JMOA 2RPRA 1L1OC 3CPWY 1TFIA 2R7ZI 2NVTI 2QRCB 3CCRZ 2E2II 3CPWZ 3GTMI 4NH1C 4E2YA 2IZ3A 1VQM1 1Y1WI 5T67A 3TDHB 4NBBA 1K731 1QVFY 2B63I 2RIQA 5C4XI 3S17I 4A3JI 2R6MA 1N8R2 3HOZI 2VF1A 2JA8I 1I6HI 2VPYA 3CME1 2GTIA 2KI7B 3D2LA 3I4MI 2DE6A 3CD61 1VQ5Z 4E31A 3GCFA 3S14I 1YUKA 3CC41 3VMIA 1K732 3HOUI 2V3VA 1AA6A 3OW2Y 3I551 1M1K2 3CQZI 2YADA 1YIT1 3HOXI 4A3II 1Q822 2OOYB 4RVDA 2GTHA 3JAMf 2KPIA 4E33A 1YJ91 1QXFA 2JIQA 3TE5B 3CCU1 2E7ZA 4A3BI 3CXCZ 3CC7Z 4BBSI 3F3PC 2HF1A 1RO0A 3S1RI 1YITZ 4MRIA 2HU9A 4NBEA 2RT9A 1M1K1 2O4HA 2NAPA 3IF8A 3PO2I 2W03A 2DE5A 3S1MI 3CMA1 3JAMb 2LEXA 3QWUA 2NVXI 2WB1A 5FLXf 1KQSZ 4A3KI 1I3QI 1ZH1A 3CCQZ 4A3EI 2R93I 2QEX1 2LIYA 2Q4ZA 1LQLA 5A2Qb 1YI2Z 1Q16A 3PO3I 4MXUA 3MONA 4Y52I 1VQ8Z 3IR7A 1W2BY 3CCVZ 3BG1B 1NJI2 3NFZA 4EWCA 2RBLA 2VUGA 3IFUA 5LL6f 4MD7A 2JIPA 4RVGA 3VB9A 1TWAI 1Q7Y1 1QF8A 1PFTA 4NB9A 1Q811 3S16I 2PM9A 2QA41 4A3MI 1VQ71 3I561 4A3GI 2YU9I 3G4S1 2Q51A 3CCM1 5D1OA 2K3RA 2ZAEB 2OTLZ 3NH4A 2QRDB 1RQFA 3CCUZ 2J6AA 3CCLZ 3VMHA 2JA7I 1VQO1 4TNUA 3J80b 1Y1VI 3NH5A 1KD12 2O53A 1RO4A 3CCL1 3PO3S 2WAQA 3CXCY 3NDJA 1QVGY 2OTL1 1WIIA 1YIJ1 2PK7A 1JJ2Y 1Q821 3VTNA 4X6AI 3I56Z 2PMZA 1Y1VS 3CMEZ 3HOWI 4A3LI 3J7A4 1YUAA 1S7MA 2EGTA 4QTUA 2P28A 1WJ2A 1KRLA 1Z03A 1Q7Y2 2DE7A 2OTJZ 1WCMI 2JIOA 3EERA 3HOVI 3NDIA 3CCE1 4XX2A 2F4OA 4NBAA 3CCQ1 2E9HA 5IT9f 5FLXb 4A93I 1YHQ1 4E30A 1Y8CA 3I07A 1M902 2V45A 5IP9I 2M6NA 3S1NI 3G711 2E2HI 4HH4A 3GKQA 1Q861 1VQNZ 2W04A 5IT9b 3S2HI 3CC71 1ZB9A 3D9XA 4NBFA 1YJWZ 1KQSY 2VPXA 1YJW1 3HKZA 3Q87A 3MZKB 3HOYI 3KIFA 1VQ9Z 5CM2M 3CCMZ 4BY1I 1VQN1 5C3EI 4NBHA 3I55Z 1VLAA 3RZOI 1USPB 3CCR1 1Q862 3M3YI 3LUSA 1QVFZ 2AYDA 4Y7NI 3F3FC 1FDIA 5AN9F 3VMGA 3RZDI 3I4NI 4DK1A 2JR6A 3GTPI 2E2JI 2VUMI 5FLMI 2RHBA 1YHQZ 1QYPA 3K7AI 1NJI1 1WW9A 4DQYB 3GTJI 2V8JA 1VQOZ 4MD9A 1VQ81 4HGZA 3CCS1 3U50C 1YI21 1R9TI 2OTJ1 4RS4A 1I50I 2QEXZ 3CC21 5D1OB 5IP7I 1W2BZ 3G6E1 1S721 3CMAZ 4NBGA 3KIHA 4BBRI 1NP6A 5T64A 4MD8A 1FDOA 1K83I 1KD11 1N2FA 1USPA 4NFRA 3T4NB 3CCV1 3GTOI 2AKLA 1VQKZ 1YIJZ 1YJ9Z 3FQMA 1VQ41 3S2DI 2OZKA 2JA6I 4A3DI 1NUIA 4HGYA 4RV9A 3OW2Z 2GU2A 2G2KA 2VPZA 3BG0B 1VQP1 1RO2A 2VPWA 2LFUA 2BJOA 2QLVB 2F4MA 4MONA 3J80f 2K5RA 2QREB 1K9M1 1RNIA 1VQ51 3CD6Z 1SFOI 1KC82 1VQ7Z 2I3CA 3J81f 2JS4A 2M48A 2JNYA 1VQ91 2NVYI 1JJ2Z 1QVGZ 2IZ4A 2NVQI 3S15I 1VQK1 5C4JI 1K9M2
chains in the Genus database with same CATH topology
2R92I 1VQ61 1KC81 3GTQI 4NBCA 1M901 4A3CI 3J81b 4NB8A 2V8KA 3IX0A 3G6EZ 3S1QI 1ML8A 3NH8A 4RVFA 4E2ZA 5T6BA 1N8R1 4RVHA 5C44I 3CC2Z 2QKDA 1VQLZ 1TWCI 3CCEZ 3M4OI 3GTKI 2P3YA 1P9NA 1TWFI 4NOZA 3CCSZ 1VQMZ 1DL6A 4E2WA 2JUBA 1ZB8A 3GTLI 1X3ZA 1RLYA 4CL1A 3CCJZ 3EEDA 3GTGI 3MZLB 1YJN1 1TWHI 3ESWA 2OOXB 3H3VJ 1VQ6Z 2QA4Z 4DGLA 3P5JB 1K8A2 3CC4Z 4BY7I 3CCJ1 1S72Z 1X3WA 1Q812 1VQPZ 2Y0SA 3FKII 2JA5I 3H0GI 4E2XA 3D6WA 1JWHC 2V8IA 4E32A 3GTMS 1Z02A 2QR1B 4S1TA 1VQ4Z 4BXXI 3G71Z 4A3FI 2H85A 5D1PA 5A2Qf 1K8A1 1VQL1 1X0TA 3G4SZ 4NBDA 1TWGI 4AYBA 3FQQA 4MH4A 1Z01A 4QTTA 1YJNZ 2JMOA 2RPRA 1L1OC 3CPWY 1TFIA 2R7ZI 2NVTI 2QRCB 3CCRZ 2E2II 3CPWZ 3GTMI 4NH1C 4E2YA 2IZ3A 1VQM1 1Y1WI 5T67A 3TDHB 4NBBA 1K731 1QVFY 2B63I 2RIQA 5C4XI 3S17I 4A3JI 2R6MA 1N8R2 3HOZI 2VF1A 2JA8I 1I6HI 3CME1 2GTIA 2KI7B 3I4MI 2DE6A 3CD61 1VQ5Z 4E31A 3GCFA 3S14I 1YUKA 3CC41 3VMIA 1K732 3HOUI 3OW2Y 3I551 1M1K2 3CQZI 2YADA 1YIT1 3HOXI 4A3II 1Q822 2OOYB 4RVDA 2GTHA 3JAMf 2KPIA 4E33A 1YJ91 3TE5B 3CCU1 4A3BI 3CXCZ 3CC7Z 4BBSI 3F3PC 2HF1A 1RO0A 3S1RI 1YITZ 4MRIA 2HU9A 4NBEA 2RT9A 1M1K1 2O4HA 3IF8A 3PO2I 2W03A 2DE5A 3S1MI 3CMA1 3JAMb 3QWUA 2NVXI 2WB1A 5FLXf 1KQSZ 4A3KI 1I3QI 1ZH1A 3CCQZ 4A3EI 2R93I 2LIYA 2QEX1 2Q4ZA 1LQLA 5A2Qb 1YI2Z 3PO3I 4MXUA 3MONA 4Y52I 1VQ8Z 1W2BY 3CCVZ 3BG1B 1NJI2 3NFZA 4EWCA 2RBLA 2VUGA 3IFUA 5LL6f 4MD7A 4RVGA 3VB9A 1TWAI 1Q7Y1 1QF8A 1PFTA 4NB9A 1Q811 3S16I 2PM9A 2QA41 4A3MI 1VQ71 3I561 4A3GI 2YU9I 3G4S1 2Q51A 3CCM1 5D1OA 2K3RA 2ZAEB 2OTLZ 3NH4A 2QRDB 1RQFA 3CCUZ 2J6AA 3CCLZ 3VMHA 2JA7I 1VQO1 4TNUA 3J80b 1Y1VI 3NH5A 1KD12 2O53A 1RO4A 3CCL1 3PO3S 2WAQA 3CXCY 3NDJA 1QVGY 2OTL1 1WIIA 1YIJ1 2PK7A 1JJ2Y 1Q821 3VTNA 4X6AI 3I56Z 2PMZA 1Y1VS 3CMEZ 3HOWI 4A3LI 3J7A4 1YUAA 1S7MA 2EGTA 4QTUA 2P28A 1KRLA 1Z03A 1Q7Y2 2DE7A 2OTJZ 1WCMI 3EERA 3HOVI 3NDIA 3CCE1 4XX2A 2F4OA 4NBAA 3CCQ1 2E9HA 5IT9f 5FLXb 4A93I 4E30A 1YHQ1 3I07A 1M902 5IP9I 2M6NA 3S1NI 3G711 2E2HI 4HH4A 3GKQA 1Q861 1VQNZ 2W04A 5IT9b 3S2HI 3CC71 1ZB9A 3D9XA 4NBFA 1YJWZ 1KQSY 1YJW1 3HKZA 3Q87A 3MZKB 3HOYI 3KIFA 1VQ9Z 5CM2M 3CCMZ 4BY1I 1VQN1 5C3EI 4NBHA 3I55Z 1VLAA 3RZOI 1USPB 3CCR1 1Q862 3M3YI 3LUSA 1QVFZ 4Y7NI 3F3FC 5AN9F 3VMGA 3RZDI 3I4NI 4DK1A 2JR6A 3GTPI 2E2JI 2VUMI 5FLMI 2RHBA 1YHQZ 1QYPA 3K7AI 1NJI1 1WW9A 4DQYB 3GTJI 2V8JA 1VQOZ 4MD9A 1VQ81 4HGZA 3CCS1 3U50C 1YI21 1R9TI 2OTJ1 4RS4A 1I50I 2QEXZ 3CC21 5D1OB 5IP7I 1W2BZ 3G6E1 1S721 3CMAZ 4NBGA 3KIHA 4BBRI 1NP6A 5T64A 4MD8A 1K83I 1KD11 1N2FA 1USPA 4NFRA 3T4NB 3CCV1 3GTOI 2AKLA 1VQKZ 1YIJZ 1YJ9Z 3FQMA 1VQ41 3S2DI 2OZKA 2JA6I 4A3DI 1NUIA 4HGYA 4RV9A 3OW2Z 2GU2A 2G2KA 3BG0B 1VQP1 1RO2A 2LFUA 2BJOA 2QLVB 2F4MA 4MONA 3J80f 2K5RA 2QREB 1K9M1 1RNIA 1VQ51 3CD6Z 1SFOI 1KC82 1VQ7Z 2I3CA 3J81f 2JS4A 2M48A 2JNYA 1VQ91 2NVYI 1JJ2Z 1QVGZ 2IZ4A 2NVQI 3S15I 1VQK1 5C4JI 1K9M2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBH A;  4A3G I;  3GTM I;  2YU9 I;  1VLA A;  3RZO I;  2R92 I;  1USP B;  3GTQ I;  3M3Y I;  1Y1W I;  3LUS A;  4NBC A;  4A3C I;  4Y7N I;  4NB8 A;  4NBB A;  3VMG A;  2B63 I;  3RZD I;  3I4N I;  5C4X I;  3S17 I;  2J6A A;  2JR6 A;  4A3J I;  2E2J I;  3GTP I;  2VUM I;  5FLM I;  3S1Q I;  3VMH A;  1ML8 A;  2JA7 I;  1QYP A;  3HOZ I;  3K7A I;  2JA8 I;  1I6H I;  1Y1V I;  1WW9 A;  3GTJ I;  5C44 I;  3I4M I;  2DE6 A;  1RO4 A;  3PO3 S;  3GCF A;  3S14 I;  1TWC I;  3M4O I;  3U50 C;  3GTK I;  2P3Y A;  1R9T I;  1TWF I;  4NOZ A;  3VMI A;  3HOU I;  1DL6 A;  1I50 I;  2PK7 A;  4X6A I;  3CQZ I;  1ZB8 A;  3HOX I;  1Y1V S;  3HOW I;  4A3L I;  4A3I I;  3GTL I;  1X3Z A;  1YUA A;  1RLY A;  5IP7 I;  2KPI A;  4NBG A;  3GTG I;  4BBR I;  1TWH I;  4A3B I;  3ESW A;  4QTU A;  4BBS I;  2HF1 A;  4A3M I;  3H3V J;  3S1R I;  1K83 I;  1N2F A;  1USP A;  3GTO I;  4NBE A;  2DE7 A;  2AKL A;  1WCM I;  3EER A;  3HOV I;  3PO2 I;  4BY7 I;  2DE5 A;  3S1M I;  4XX2 A;  2F4O A;  3S2D I;  4NBA A;  1X3W A;  2JA6 I;  4A3D I;  1NUI A;  3FKI I;  2JA5 I;  3H0G I;  2NVX I;  3D6W A;  4A93 I;  3I07 A;  4A3K I;  1I3Q I;  2R93 I;  4A3E I;  3GTM S;  2BJO A;  2F4M A;  4BXX I;  5IP9 I;  1LQL A;  4A3F I;  3S1N I;  2K5R A;  3PO3 I;  2E2H I;  4Y52 I;  1SFO I;  3GKQ A;  4NBD A;  2RBL A;  2JS4 A;  1TWG I;  2JNY A;  3S2H I;  4MH4 A;  1ZB9 A;  2NVY I;  4NBF A;  4QTT A;  3VB9 A;  1TWA I;  1L1O C;  3Q87 A;  1PFT A;  4NB9 A;  2NVQ I;  3HOY I;  2R7Z I;  1TFI A;  3S15 I;  3S16 I;  2NVT I;  5CM2 M;  5C4J I;  2E2I I;  4BY1 I;  5C3E I; 
#chains in the Genus database with same CATH topology
 2IV2 X;  1SIW A;  2R92 I;  1VQ6 1;  1KC8 1;  3GTQ I;  4NBC A;  1M90 1;  4A3C I;  3J81 b;  4NB8 A;  2V8K A;  3IX0 A;  3G6E Z;  3S1Q I;  1ML8 A;  3NH8 A;  4RVF A;  4E2Z A;  5T6B A;  1N8R 1;  4RVH A;  5C44 I;  3CC2 Z;  2QKD A;  1VQL Z;  2JIR A;  1TWC I;  3CCE Z;  3M4O I;  3GTK I;  2P3Y A;  1P9N A;  1TWF I;  4NOZ A;  3CCS Z;  1VQM Z;  1DL6 A;  4E2W A;  2JUB A;  1ZB8 A;  3GTL I;  1X3Z A;  1RLY A;  4CL1 A;  3CCJ Z;  3EED A;  3GTG I;  3MZL B;  1YJN 1;  1TWH I;  3ESW A;  2OOX B;  3H3V J;  2JIM A;  1VQ6 Z;  2QA4 Z;  4DGL A;  3P5J B;  1K8A 2;  3CC4 Z;  4BY7 I;  3CCJ 1;  1S72 Z;  1X3W A;  1Q81 2;  1VQP Z;  2Y0S A;  3FKI I;  2JA5 I;  3H0G I;  4E2X A;  3D6W A;  1JWH C;  2V8I A;  4E32 A;  3GTM S;  4S1T A;  1Z02 A;  2QR1 B;  1VQ4 Z;  1WZN A;  4BXX I;  3G71 Z;  4A3F I;  2H85 A;  5D1P A;  5A2Q f;  1K8A 1;  1VQL 1;  1X0T A;  3G4S Z;  4NBD A;  1TWG I;  4AYB A;  3FQQ A;  4MH4 A;  1Z01 A;  4QTT A;  1YJN Z;  2JMO A;  2RPR A;  1L1O C;  3CPW Y;  1TFI A;  2R7Z I;  2NVT I;  2QRC B;  3CCR Z;  2E2I I;  3CPW Z;  3GTM I;  4NH1 C;  4E2Y A;  2IZ3 A;  1VQM 1;  1Y1W I;  5T67 A;  3TDH B;  4NBB A;  1K73 1;  1QVF Y;  2B63 I;  2RIQ A;  5C4X I;  3S17 I;  4A3J I;  2R6M A;  1N8R 2;  3HOZ I;  2VF1 A;  2JA8 I;  1I6H I;  2VPY A;  3CME 1;  2GTI A;  2KI7 B;  3D2L A;  3I4M I;  2DE6 A;  3CD6 1;  1VQ5 Z;  4E31 A;  3GCF A;  3S14 I;  1YUK A;  3CC4 1;  3VMI A;  1K73 2;  3HOU I;  2V3V A;  1AA6 A;  3OW2 Y;  3I55 1;  1M1K 2;  3CQZ I;  2YAD A;  1YIT 1;  3HOX I;  4A3I I;  1Q82 2;  2OOY B;  4RVD A;  2GTH A;  3JAM f;  2KPI A;  4E33 A;  1YJ9 1;  1QXF A;  2JIQ A;  3TE5 B;  3CCU 1;  2E7Z A;  4A3B I;  3CXC Z;  3CC7 Z;  4BBS I;  3F3P C;  2HF1 A;  1RO0 A;  3S1R I;  1YIT Z;  4MRI A;  2HU9 A;  4NBE A;  2RT9 A;  1M1K 1;  2O4H A;  2NAP A;  3IF8 A;  3PO2 I;  2W03 A;  2DE5 A;  3S1M I;  3CMA 1;  3JAM b;  2LEX A;  3QWU A;  2NVX I;  2WB1 A;  5FLX f;  1KQS Z;  4A3K I;  1I3Q I;  1ZH1 A;  3CCQ Z;  4A3E I;  2R93 I;  2QEX 1;  2LIY A;  2Q4Z A;  1LQL A;  5A2Q b;  1YI2 Z;  1Q16 A;  3PO3 I;  4MXU A;  3MON A;  4Y52 I;  1VQ8 Z;  3IR7 A;  1W2B Y;  3CCV Z;  3BG1 B;  1NJI 2;  3NFZ A;  4EWC A;  2RBL A;  2VUG A;  3IFU A;  5LL6 f;  4MD7 A;  2JIP A;  4RVG A;  3VB9 A;  1TWA I;  1Q7Y 1;  1QF8 A;  1PFT A;  4NB9 A;  1Q81 1;  3S16 I;  2PM9 A;  2QA4 1;  4A3M I;  1VQ7 1;  3I56 1;  4A3G I;  2YU9 I;  3G4S 1;  2Q51 A;  3CCM 1;  5D1O A;  2K3R A;  2ZAE B;  2OTL Z;  3NH4 A;  2QRD B;  1RQF A;  3CCU Z;  2J6A A;  3CCL Z;  3VMH A;  2JA7 I;  1VQO 1;  4TNU A;  3J80 b;  1Y1V I;  3NH5 A;  1KD1 2;  2O53 A;  1RO4 A;  3CCL 1;  3PO3 S;  2WAQ A;  3CXC Y;  3NDJ A;  1QVG Y;  2OTL 1;  1WII A;  1YIJ 1;  2PK7 A;  1JJ2 Y;  1Q82 1;  3VTN A;  4X6A I;  3I56 Z;  2PMZ A;  1Y1V S;  3CME Z;  3HOW I;  4A3L I;  3J7A 4;  1YUA A;  1S7M A;  2EGT A;  4QTU A;  2P28 A;  1WJ2 A;  1KRL A;  1Z03 A;  1Q7Y 2;  2DE7 A;  2OTJ Z;  1WCM I;  2JIO A;  3EER A;  3HOV I;  3NDI A;  3CCE 1;  4XX2 A;  2F4O A;  4NBA A;  3CCQ 1;  2E9H A;  5IT9 f;  5FLX b;  4A93 I;  1YHQ 1;  4E30 A;  1Y8C A;  3I07 A;  1M90 2;  2V45 A;  5IP9 I;  2M6N A;  3S1N I;  3G71 1;  2E2H I;  4HH4 A;  3GKQ A;  1Q86 1;  1VQN Z;  2W04 A;  5IT9 b;  3S2H I;  3CC7 1;  1ZB9 A;  3D9X A;  4NBF A;  1YJW Z;  1KQS Y;  2VPX A;  1YJW 1;  3HKZ A;  3Q87 A;  3MZK B;  3HOY I;  3KIF A;  1VQ9 Z;  5CM2 M;  3CCM Z;  4BY1 I;  1VQN 1;  5C3E I;  4NBH A;  3I55 Z;  1VLA A;  3RZO I;  1USP B;  3CCR 1;  1Q86 2;  3M3Y I;  3LUS A;  1QVF Z;  2AYD A;  4Y7N I;  3F3F C;  1FDI A;  5AN9 F;  3VMG A;  3RZD I;  3I4N I;  4DK1 A;  2JR6 A;  3GTP I;  2E2J I;  2VUM I;  5FLM I;  2RHB A;  1YHQ Z;  1QYP A;  3K7A I;  1NJI 1;  1WW9 A;  4DQY B;  3GTJ I;  2V8J A;  1VQO Z;  4MD9 A;  1VQ8 1;  4HGZ A;  3CCS 1;  3U50 C;  1YI2 1;  1R9T I;  2OTJ 1;  4RS4 A;  1I50 I;  2QEX Z;  3CC2 1;  5D1O B;  5IP7 I;  1W2B Z;  3G6E 1;  1S72 1;  3CMA Z;  4NBG A;  3KIH A;  4BBR I;  1NP6 A;  5T64 A;  4MD8 A;  1FDO A;  1K83 I;  1KD1 1;  1N2F A;  1USP A;  4NFR A;  3T4N B;  3CCV 1;  3GTO I;  2AKL A;  1VQK Z;  1YIJ Z;  1YJ9 Z;  3FQM A;  1VQ4 1;  3S2D I;  2OZK A;  2JA6 I;  4A3D I;  1NUI A;  4HGY A;  4RV9 A;  3OW2 Z;  2GU2 A;  2G2K A;  2VPZ A;  3BG0 B;  1VQP 1;  1RO2 A;  2VPW A;  2LFU A;  2BJO A;  2QLV B;  2F4M A;  4MON A;  3J80 f;  2K5R A;  2QRE B;  1K9M 1;  1RNI A;  1VQ5 1;  3CD6 Z;  1SFO I;  1KC8 2;  1VQ7 Z;  2I3C A;  3J81 f;  2JS4 A;  2M48 A;  2JNY A;  1VQ9 1;  2NVY I;  1JJ2 Z;  1QVG Z;  2IZ4 A;  2NVQ I;  3S15 I;  1VQK 1;  5C4J I;  1K9M 2; 
#chains in the Genus database with same CATH homology
 2R92 I;  1VQ6 1;  1KC8 1;  3GTQ I;  4NBC A;  1M90 1;  4A3C I;  3J81 b;  4NB8 A;  2V8K A;  3IX0 A;  3G6E Z;  3S1Q I;  1ML8 A;  3NH8 A;  4RVF A;  4E2Z A;  5T6B A;  1N8R 1;  4RVH A;  5C44 I;  3CC2 Z;  2QKD A;  1VQL Z;  1TWC I;  3CCE Z;  3M4O I;  3GTK I;  2P3Y A;  1P9N A;  1TWF I;  4NOZ A;  3CCS Z;  1VQM Z;  1DL6 A;  4E2W A;  2JUB A;  1ZB8 A;  3GTL I;  1X3Z A;  1RLY A;  4CL1 A;  3CCJ Z;  3EED A;  3GTG I;  3MZL B;  1YJN 1;  1TWH I;  3ESW A;  2OOX B;  3H3V J;  1VQ6 Z;  2QA4 Z;  4DGL A;  3P5J B;  1K8A 2;  3CC4 Z;  4BY7 I;  3CCJ 1;  1S72 Z;  1X3W A;  1Q81 2;  1VQP Z;  2Y0S A;  3FKI I;  2JA5 I;  3H0G I;  4E2X A;  3D6W A;  1JWH C;  2V8I A;  4E32 A;  3GTM S;  1Z02 A;  2QR1 B;  4S1T A;  1VQ4 Z;  4BXX I;  3G71 Z;  4A3F I;  2H85 A;  5D1P A;  5A2Q f;  1K8A 1;  1VQL 1;  1X0T A;  3G4S Z;  4NBD A;  1TWG I;  4AYB A;  3FQQ A;  4MH4 A;  1Z01 A;  4QTT A;  1YJN Z;  2JMO A;  2RPR A;  1L1O C;  3CPW Y;  1TFI A;  2R7Z I;  2NVT I;  2QRC B;  3CCR Z;  2E2I I;  3CPW Z;  3GTM I;  4NH1 C;  4E2Y A;  2IZ3 A;  1VQM 1;  1Y1W I;  5T67 A;  3TDH B;  4NBB A;  1K73 1;  1QVF Y;  2B63 I;  2RIQ A;  5C4X I;  3S17 I;  4A3J I;  2R6M A;  1N8R 2;  3HOZ I;  2VF1 A;  2JA8 I;  1I6H I;  3CME 1;  2GTI A;  2KI7 B;  3I4M I;  2DE6 A;  3CD6 1;  1VQ5 Z;  4E31 A;  3GCF A;  3S14 I;  1YUK A;  3CC4 1;  3VMI A;  1K73 2;  3HOU I;  3OW2 Y;  3I55 1;  1M1K 2;  3CQZ I;  2YAD A;  1YIT 1;  3HOX I;  4A3I I;  1Q82 2;  2OOY B;  4RVD A;  2GTH A;  3JAM f;  2KPI A;  4E33 A;  1YJ9 1;  3TE5 B;  3CCU 1;  4A3B I;  3CXC Z;  3CC7 Z;  4BBS I;  3F3P C;  2HF1 A;  1RO0 A;  3S1R I;  1YIT Z;  4MRI A;  2HU9 A;  4NBE A;  2RT9 A;  1M1K 1;  2O4H A;  3IF8 A;  3PO2 I;  2W03 A;  2DE5 A;  3S1M I;  3CMA 1;  3JAM b;  3QWU A;  2NVX I;  2WB1 A;  5FLX f;  1KQS Z;  4A3K I;  1I3Q I;  1ZH1 A;  3CCQ Z;  4A3E I;  2R93 I;  2LIY A;  2QEX 1;  2Q4Z A;  1LQL A;  5A2Q b;  1YI2 Z;  3PO3 I;  4MXU A;  3MON A;  4Y52 I;  1VQ8 Z;  1W2B Y;  3CCV Z;  3BG1 B;  1NJI 2;  3NFZ A;  4EWC A;  2RBL A;  2VUG A;  3IFU A;  5LL6 f;  4MD7 A;  4RVG A;  3VB9 A;  1TWA I;  1Q7Y 1;  1QF8 A;  1PFT A;  4NB9 A;  1Q81 1;  3S16 I;  2PM9 A;  2QA4 1;  4A3M I;  1VQ7 1;  3I56 1;  4A3G I;  2YU9 I;  3G4S 1;  2Q51 A;  3CCM 1;  5D1O A;  2K3R A;  2ZAE B;  2OTL Z;  3NH4 A;  2QRD B;  1RQF A;  3CCU Z;  2J6A A;  3CCL Z;  3VMH A;  2JA7 I;  1VQO 1;  4TNU A;  3J80 b;  1Y1V I;  3NH5 A;  1KD1 2;  2O53 A;  1RO4 A;  3CCL 1;  3PO3 S;  2WAQ A;  3CXC Y;  3NDJ A;  1QVG Y;  2OTL 1;  1WII A;  1YIJ 1;  2PK7 A;  1JJ2 Y;  1Q82 1;  3VTN A;  4X6A I;  3I56 Z;  2PMZ A;  1Y1V S;  3CME Z;  3HOW I;  4A3L I;  3J7A 4;  1YUA A;  1S7M A;  2EGT A;  4QTU A;  2P28 A;  1KRL A;  1Z03 A;  1Q7Y 2;  2DE7 A;  2OTJ Z;  1WCM I;  3EER A;  3HOV I;  3NDI A;  3CCE 1;  4XX2 A;  2F4O A;  4NBA A;  3CCQ 1;  2E9H A;  5IT9 f;  5FLX b;  4A93 I;  4E30 A;  1YHQ 1;  3I07 A;  1M90 2;  5IP9 I;  2M6N A;  3S1N I;  3G71 1;  2E2H I;  4HH4 A;  3GKQ A;  1Q86 1;  1VQN Z;  2W04 A;  5IT9 b;  3S2H I;  3CC7 1;  1ZB9 A;  3D9X A;  4NBF A;  1YJW Z;  1KQS Y;  1YJW 1;  3HKZ A;  3Q87 A;  3MZK B;  3HOY I;  3KIF A;  1VQ9 Z;  5CM2 M;  3CCM Z;  4BY1 I;  1VQN 1;  5C3E I;  4NBH A;  3I55 Z;  1VLA A;  3RZO I;  1USP B;  3CCR 1;  1Q86 2;  3M3Y I;  3LUS A;  1QVF Z;  4Y7N I;  3F3F C;  5AN9 F;  3VMG A;  3RZD I;  3I4N I;  4DK1 A;  2JR6 A;  3GTP I;  2E2J I;  2VUM I;  5FLM I;  2RHB A;  1YHQ Z;  1QYP A;  3K7A I;  1NJI 1;  1WW9 A;  4DQY B;  3GTJ I;  2V8J A;  1VQO Z;  4MD9 A;  1VQ8 1;  4HGZ A;  3CCS 1;  3U50 C;  1YI2 1;  1R9T I;  2OTJ 1;  4RS4 A;  1I50 I;  2QEX Z;  3CC2 1;  5D1O B;  5IP7 I;  1W2B Z;  3G6E 1;  1S72 1;  3CMA Z;  4NBG A;  3KIH A;  4BBR I;  1NP6 A;  5T64 A;  4MD8 A;  1K83 I;  1KD1 1;  1N2F A;  1USP A;  4NFR A;  3T4N B;  3CCV 1;  3GTO I;  2AKL A;  1VQK Z;  1YIJ Z;  1YJ9 Z;  3FQM A;  1VQ4 1;  3S2D I;  2OZK A;  2JA6 I;  4A3D I;  1NUI A;  4HGY A;  4RV9 A;  3OW2 Z;  2GU2 A;  2G2K A;  3BG0 B;  1VQP 1;  1RO2 A;  2LFU A;  2BJO A;  2QLV B;  2F4M A;  4MON A;  3J80 f;  2K5R A;  2QRE B;  1K9M 1;  1RNI A;  1VQ5 1;  3CD6 Z;  1SFO I;  1KC8 2;  1VQ7 Z;  2I3C A;  3J81 f;  2JS4 A;  2M48 A;  2JNY A;  1VQ9 1;  2NVY I;  1JJ2 Z;  1QVG Z;  2IZ4 A;  2NVQ I;  3S15 I;  1VQK 1;  5C4J I;  1K9M 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...