3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
1USPA 2JA5I 2R92I 4X6AI 1I6HI 2JA6I 2JA8I 4A3CI 4A3KI 1I3QI 1NUIA 4A3DI 3VMHA 4BXXI 4A3II 4A3MI 3CQZI 3PO2I 4A93I 1N2FA 2E2JI 3I07A 3PO3I 1TWFI 2NVTI 2AKLA 4BBSI 3S1MI 2R93I 5IP7I 1VLAA 1Y1VI 4A3LI 4NBBA 3S2HI 5FLMI 2NVYI 3S1QI 1LQLA 3S17I 2BJOA 4A3FI 3GTOI 3VMGA 5C4JI 3GTJI 2E2II 1RO4A 2F4MA 3HOYI 2JNYA 4NBFA 3VB9A 3GTKI 5IP9I 3H0GI 3Q87A 3D6WA 2JA7I 3S2DI 1ZB8A 3RZOI 3GTPI 4NBDA 1TWCI 4QTUA 4Y7NI 5C3EI 1WW9A 2PK7A 4MH4A 4BBRI 3GTMS 3H3VJ 3K7AI 1X3ZA 1SFOI 5C44I 1Y1WI 4QTTA 3M4OI 1R9TI 2KPIA 4A3GI 1ML8A 3S1NI 3M3YI 3FKII 2K5RA 2J6AA 3HOZI 3ESWA 4BY7I 1USPB 3HOXI 4NB8A 2R7ZI 1K83I 4NBAA 2DE5A 5CM2M 4BY1I 3GKQA 1I50I 4A3EI 2F4OA 4NBEA 4NOZA 4NB9A 3PO3S 3GCFA 3RZDI 2DE6A 1TWAI 1ZB9A 4A3JI 3HOWI 3S16I 4XX2A 1L1OC 2VUMI 1WCMI 4Y52I 3U50C 2DE7A 2P3YA 1RLYA 2NVQI 1DL6A 5C4XI 3LUSA 4NBHA 1TFIA 2YU9I 1TWGI 3EERA 2JR6A 2NVXI 3S15I 1PFTA 3HOVI 3GTLI 3GTGI 3S14I 1YUAA 2E2HI 1X3WA 4NBGA 3GTMI 3S1RI 3HOUI 3I4NI 2JS4A 4A3BI 1TWHI 3VMIA 2RBLA 4NBCA 2B63I 2HF1A 1QYPA 1Y1VS 3GTQI 3I4MI
chains in the Genus database with same CATH superfamily
4NH1C 1YHQ1 2QRDB 2HU9A 4MONA 1M901 3VMHA 2GTIA 1X0TA 2E2JI 1KC81 3JAMf 5T6BA 4MXUA 5AN9F 2OTLZ 1Z03A 2Y0SA 4E30A 5IP7I 5FLMI 3CCVZ 1Q822 3VMGA 1QVGY 3GTJI 4RVFA 1VQLZ 2F4MA 1Q862 3HOYI 2JNYA 3VB9A 3KIHA 2JIQA 2OTL1 3GTKI 5FLXf 3H0GI 3Q87A 2YADA 2JA7I 3RZOI 3CCV1 1Q812 2V8IA 4Y7NI 2PM9A 1JJ2Z 2LFUA 1VQL1 1NP6A 4DQYB 3IFUA 3M4OI 1R9TI 1RQFA 2H85A 3J80b 3HOXI 4BY1I 1QVFZ 3FQMA 2R6MA 3IX0A 2F4OA 1YJWZ 3P5JB 1Q821 3RZDI 2QLVB 3FQQA 3S16I 2JUBA 1VQNZ 5LL6f 1QF8A 3I56Z 1RLYA 3QWUA 3D9XA 1YJW1 1Q811 1DL6A 3G6E1 2M48A 2PMZA 3G71Z 3EERA 2JR6A 3S15I 1PFTA 3CCEZ 1YUAA 1VQN1 3GTMI 3I561 3HKZA 3CXCZ 4A3BI 2RBLA 2RT9A 4NBCA 1VQ9Z 3G711 1AA6A 2B63I 2HF1A 1Y1VS 3CCE1 3CCQZ 3J7A4 3I4MI 2R92I 3BG0B 1I6HI 2JA6I 2JA8I 4A3KI 3BG1B 1I3QI 1NUIA 2JIOA 3NDIA 4E33A 1S72Z 3MZKB 1M1K2 4A3MI 1VQ91 3CQZI 3CCMZ 1N2FA 3CCQ1 5T67A 3CC2Z 1VQ5Z 2NVTI 2AKLA 1KD11 1Y1VI 1S721 2NVYI 2BJOA 3GTOI 1K9M2 3CCM1 3G4SZ 1RO2A 2QRCB 3TE5B 3CC21 1VQ51 5IT9b 4E32A 1Y8CA 2AYDA 4E2YA 1VQKZ 3D6WA 2I3CA 2GTHA 2W03A 2Q51A 1TWCI 2RHBA 3TDHB 1WIIA 1WW9A 3G4S1 2OOYB 2ZAEB 4BBRI 2RIQA 1W2BZ 2WAQA 1VQK1 2G2KA 2KPIA 4A3GI 2LEXA 1Q16A 4RV9A 4RVHA 3J80f 2O4HA 5CM2M 4A3EI 4NBEA 2LIYA 4NOZA 3CCLZ 3KIFA 3PO3S 3GCFA 1K9M1 3OW2Z 4XX2A 2VPYA 4E2XA 1S7MA 2DE7A 3CCL1 2EGTA 1YITZ 1TFIA 4E2ZA 1TWGI 3HOVI 1KQSZ 3JAMb 3GTGI 4AYBA 3I4NI 1FDIA 3VMIA 1RNIA 1Q861 1VQMZ 1USPA 5FLXb 1WZNA 4A3CI 4E31A 2VPWA 2V45A 5A2Qf 4A3DI 2Q4ZA 4BXXI 1VQ8Z 3PO2I 2JIPA 3CC7Z 1VQM1 3I07A 3NFZA 2IV2X 4BBSI 2W04A 2R93I 2NAPA 1VLAA 3S2HI 2QA4Z 1QVGZ 3S1QI 1LQLA 3S17I 1VQ81 2OTJZ 4A3FI 3NH5A 4RVDA 5C4JI 1N8R2 3CC71 1RO4A 4NBFA 2QKDA 5IP9I 5D1PA 2VF1A 1ZB8A 3D2LA 2QA41 3GTPI 1M902 1ZH1A 4QTUA 2VPXA 5C3EI 4DGLA 1JJ2Y 3H3VJ 1SFOI 1Y1WI 1KC82 4CL1A 4QTTA 1WJ2A 1Q7Y2 1ML8A 3CD6Z 3S1NI 1VQOZ 1YJ9Z 3FKII 2J6AA 1Z02A 1K83I 4NBAA 4HH4A 4MD7A 3GKQA 3CCJZ 1I50I 1QVFY 3CD61 1VQO1 1YJ91 2QR1B 3CCSZ 2JIRA 2DE6A 4S1TA 1TWAI 1ZB9A 3HOWI 3NH8A 2VUMI 3CCJ1 1YUKA 4Y52I 3U50C 1M1K1 2QREB 5D1OB 3CCS1 1YIJZ 3LUSA 3IF8A 2YU9I 1VQ4Z 3NDJA 2NVXI 4NFRA 2KI7B 2V3VA 3VTNA 3S14I 2IZ4A 4NBGA 4RVGA 3HOUI 1Q7Y1 3J81b 1YIJ1 3CXCY 1VQ41 3CPWZ 2WB1A 3F3FC 2JA5I 4X6AI 5T64A 1JWHC 2QEXZ 1SIWA 3NH4A 4EWCA 2P28A 3CMAZ 4A3II 3IR7A 2RPRA 4A93I 2V8KA 4RS4A 3PO3I 4TNUA 1TWFI 3S1MI 2QEX1 1QXFA 2OOXB 1YI2Z 1VQ7Z 4HGZA 4A3LI 4NBBA 3CMA1 1YIT1 3F3PC 1NJI2 3MZLB 3CCUZ 1K732 4MD9A 2E2II 3T4NB 4MRIA 2JMOA 4HGYA 1KRLA 1YI21 1VQ71 3S2DI 4NBDA 1P9NA 3CCU1 3G6EZ 2O53A 2PK7A 4DK1A 4MH4A 3GTMS 3CCRZ 3K7AI 1X3ZA 1W2BY 5C44I 1KD12 1K8A2 3M3YI 2K5RA 3HOZI 3CC4Z 2V8JA 2M6NA 3ESWA 1USPB 4BY7I 4NB8A 3CCR1 2GU2A 2R7ZI 2DE5A 3CMEZ 5IT9f 1Z01A 2OTJ1 4NB9A 1NJI1 1YJNZ 1K731 3CC41 4A3JI 3I55Z 1VQPZ 3CME1 3OW2Y 1FDOA 1L1OC 3CPWY 1WCMI 5A2Qb 2E7ZA 1RO0A 2P3YA 2NVQI 1YJN1 5C4XI 4NBHA 1VQ6Z 3MONA 2E9HA 2K3RA 2JIMA 3I551 1VQP1 3GTLI 2E2HI 2OZKA 1X3WA 1KQSY 1YHQZ 3S1RI 2IZ3A 2VUGA 2JS4A 4E2WA 1K8A1 1TWHI 2VPZA 3J81f 1N8R1 1VQ61 3EEDA 4MD8A 5D1OA 1QYPA 3GTQI
chains in the Genus database with same CATH topology
4NH1C 1YHQ1 2QRDB 2HU9A 4MONA 1M901 3VMHA 2GTIA 1X0TA 2E2JI 1KC81 3JAMf 5T6BA 4MXUA 5AN9F 2OTLZ 1Z03A 2Y0SA 4E30A 5IP7I 5FLMI 3CCVZ 1Q822 3VMGA 1QVGY 3GTJI 4RVFA 1VQLZ 2F4MA 1Q862 3HOYI 2JNYA 3VB9A 3KIHA 2OTL1 3GTKI 5FLXf 3H0GI 3Q87A 2YADA 2JA7I 3RZOI 3CCV1 1Q812 2V8IA 4Y7NI 2PM9A 1JJ2Z 2LFUA 1VQL1 1NP6A 4DQYB 3IFUA 3M4OI 1R9TI 1RQFA 2H85A 3J80b 3HOXI 4BY1I 1QVFZ 3FQMA 2R6MA 3IX0A 2F4OA 1YJWZ 3P5JB 1Q821 3RZDI 2QLVB 3FQQA 3S16I 2JUBA 1VQNZ 5LL6f 1QF8A 3I56Z 1RLYA 3QWUA 3D9XA 1YJW1 1Q811 1DL6A 3G6E1 2M48A 2PMZA 3G71Z 3EERA 2JR6A 3S15I 1PFTA 3CCEZ 1YUAA 1VQN1 3GTMI 3I561 3HKZA 3CXCZ 4A3BI 2RBLA 2RT9A 4NBCA 1VQ9Z 3G711 2B63I 2HF1A 1Y1VS 3CCE1 3CCQZ 3J7A4 3I4MI 2R92I 3BG0B 1I6HI 2JA6I 2JA8I 4A3KI 3BG1B 1I3QI 1NUIA 3NDIA 4E33A 1S72Z 3MZKB 1M1K2 4A3MI 1VQ91 3CQZI 3CCMZ 1N2FA 3CCQ1 5T67A 3CC2Z 1VQ5Z 2NVTI 2AKLA 1KD11 1Y1VI 1S721 2NVYI 2BJOA 3GTOI 1K9M2 3CCM1 3G4SZ 1RO2A 2QRCB 3TE5B 3CC21 1VQ51 5IT9b 4E32A 4E2YA 1VQKZ 3D6WA 2I3CA 2GTHA 2W03A 2Q51A 1TWCI 2RHBA 3TDHB 1WIIA 1WW9A 3G4S1 2OOYB 2ZAEB 4BBRI 2RIQA 1W2BZ 2WAQA 1VQK1 2G2KA 2KPIA 4A3GI 4RV9A 4RVHA 3J80f 2O4HA 5CM2M 4A3EI 4NBEA 2LIYA 4NOZA 3CCLZ 3KIFA 3PO3S 3GCFA 1K9M1 3OW2Z 4XX2A 4E2XA 1S7MA 2DE7A 3CCL1 2EGTA 1YITZ 1TFIA 4E2ZA 1TWGI 3HOVI 1KQSZ 3JAMb 3GTGI 4AYBA 3I4NI 3VMIA 1RNIA 1Q861 1VQMZ 1USPA 5FLXb 4A3CI 4E31A 5A2Qf 4A3DI 2Q4ZA 4BXXI 1VQ8Z 3PO2I 3CC7Z 1VQM1 3I07A 3NFZA 4BBSI 2W04A 2R93I 1VLAA 3S2HI 2QA4Z 1QVGZ 3S1QI 1LQLA 3S17I 1VQ81 2OTJZ 4A3FI 3NH5A 4RVDA 5C4JI 1N8R2 3CC71 1RO4A 4NBFA 2QKDA 5IP9I 5D1PA 2VF1A 1ZB8A 2QA41 3GTPI 1M902 1ZH1A 4QTUA 5C3EI 4DGLA 1JJ2Y 3H3VJ 1SFOI 1Y1WI 1KC82 4CL1A 4QTTA 1Q7Y2 1ML8A 3CD6Z 3S1NI 1VQOZ 1YJ9Z 3FKII 2J6AA 1Z02A 1K83I 4NBAA 4HH4A 4MD7A 3GKQA 3CCJZ 1I50I 1QVFY 3CD61 1VQO1 1YJ91 2QR1B 3CCSZ 2DE6A 4S1TA 1TWAI 1ZB9A 3HOWI 3NH8A 2VUMI 3CCJ1 1YUKA 4Y52I 3U50C 1M1K1 2QREB 5D1OB 3CCS1 1YIJZ 3LUSA 3IF8A 2YU9I 1VQ4Z 3NDJA 2NVXI 4NFRA 2KI7B 3VTNA 3S14I 2IZ4A 4NBGA 4RVGA 3HOUI 1Q7Y1 3J81b 1YIJ1 3CXCY 1VQ41 3CPWZ 2WB1A 3F3FC 2JA5I 4X6AI 5T64A 1JWHC 2QEXZ 3NH4A 4EWCA 2P28A 3CMAZ 4A3II 2RPRA 4A93I 2V8KA 4RS4A 3PO3I 4TNUA 1TWFI 3S1MI 2QEX1 2OOXB 1YI2Z 1VQ7Z 4HGZA 4A3LI 4NBBA 3CMA1 1YIT1 3F3PC 1NJI2 3MZLB 3CCUZ 1K732 4MD9A 2E2II 3T4NB 4MRIA 2JMOA 4HGYA 1KRLA 1YI21 1VQ71 3S2DI 4NBDA 1P9NA 3CCU1 3G6EZ 2O53A 2PK7A 4DK1A 4MH4A 3GTMS 3CCRZ 3K7AI 1X3ZA 1W2BY 5C44I 1KD12 1K8A2 3M3YI 2K5RA 3HOZI 3CC4Z 2V8JA 2M6NA 3ESWA 1USPB 4BY7I 4NB8A 3CCR1 2GU2A 2R7ZI 2DE5A 3CMEZ 5IT9f 1Z01A 2OTJ1 4NB9A 1NJI1 1YJNZ 1K731 3CC41 4A3JI 3I55Z 1VQPZ 3CME1 3OW2Y 3CPWY 1L1OC 1WCMI 5A2Qb 1RO0A 2P3YA 2NVQI 1YJN1 5C4XI 4NBHA 1VQ6Z 3MONA 2E9HA 2K3RA 3I551 1VQP1 3GTLI 2E2HI 2OZKA 1X3WA 1KQSY 1YHQZ 3S1RI 2IZ3A 2VUGA 2JS4A 4E2WA 1K8A1 1TWHI 1N8R1 3J81f 1VQ61 3EEDA 4MD8A 5D1OA 1QYPA 3GTQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  2JA5 I;  2R92 I;  4X6A I;  1I6H I;  2JA6 I;  2JA8 I;  4A3C I;  4A3K I;  1I3Q I;  1NUI A;  4A3D I;  3VMH A;  4BXX I;  4A3I I;  4A3M I;  3CQZ I;  3PO2 I;  4A93 I;  1N2F A;  2E2J I;  3I07 A;  3PO3 I;  1TWF I;  2NVT I;  2AKL A;  4BBS I;  3S1M I;  2R93 I;  5IP7 I;  1VLA A;  1Y1V I;  4A3L I;  4NBB A;  3S2H I;  5FLM I;  2NVY I;  3S1Q I;  1LQL A;  3S17 I;  2BJO A;  4A3F I;  3GTO I;  3VMG A;  5C4J I;  3GTJ I;  2E2I I;  1RO4 A;  2F4M A;  3HOY I;  2JNY A;  4NBF A;  3VB9 A;  3GTK I;  5IP9 I;  3H0G I;  3Q87 A;  3D6W A;  2JA7 I;  3S2D I;  1ZB8 A;  3RZO I;  3GTP I;  4NBD A;  1TWC I;  4QTU A;  4Y7N I;  5C3E I;  1WW9 A;  2PK7 A;  4MH4 A;  4BBR I;  3GTM S;  3H3V J;  3K7A I;  1X3Z A;  1SFO I;  5C44 I;  1Y1W I;  4QTT A;  3M4O I;  1R9T I;  2KPI A;  4A3G I;  1ML8 A;  3S1N I;  3M3Y I;  3FKI I;  2K5R A;  2J6A A;  3HOZ I;  3ESW A;  4BY7 I;  1USP B;  3HOX I;  4NB8 A;  2R7Z I;  1K83 I;  4NBA A;  2DE5 A;  5CM2 M;  4BY1 I;  3GKQ A;  1I50 I;  4A3E I;  2F4O A;  4NBE A;  4NOZ A;  4NB9 A;  3PO3 S;  3GCF A;  3RZD I;  2DE6 A;  1TWA I;  1ZB9 A;  4A3J I;  3HOW I;  3S16 I;  4XX2 A;  1L1O C;  2VUM I;  1WCM I;  4Y52 I;  3U50 C;  2DE7 A;  2P3Y A;  1RLY A;  2NVQ I;  1DL6 A;  5C4X I;  3LUS A;  4NBH A;  1TFI A;  2YU9 I;  1TWG I;  3EER A;  2JR6 A;  2NVX I;  3S15 I;  1PFT A;  3HOV I;  3GTL I;  3GTG I;  3S14 I;  1YUA A;  2E2H I;  1X3W A;  4NBG A;  3GTM I;  3S1R I;  3HOU I;  3I4N I;  2JS4 A;  4A3B I;  1TWH I;  3VMI A;  2RBL A;  4NBC A;  2B63 I;  2HF1 A;  1QYP A;  1Y1V S;  3GTQ I;  3I4M I; 
#chains in the Genus database with same CATH topology
 4NH1 C;  1YHQ 1;  2QRD B;  2HU9 A;  4MON A;  1M90 1;  3VMH A;  2GTI A;  1X0T A;  2E2J I;  1KC8 1;  3JAM f;  5T6B A;  4MXU A;  5AN9 F;  2OTL Z;  1Z03 A;  2Y0S A;  4E30 A;  5IP7 I;  5FLM I;  3CCV Z;  1Q82 2;  3VMG A;  1QVG Y;  3GTJ I;  4RVF A;  1VQL Z;  2F4M A;  1Q86 2;  3HOY I;  2JNY A;  3VB9 A;  3KIH A;  2JIQ A;  2OTL 1;  3GTK I;  5FLX f;  3H0G I;  3Q87 A;  2YAD A;  2JA7 I;  3RZO I;  3CCV 1;  1Q81 2;  2V8I A;  4Y7N I;  2PM9 A;  1JJ2 Z;  2LFU A;  1VQL 1;  1NP6 A;  4DQY B;  3IFU A;  3M4O I;  1R9T I;  1RQF A;  2H85 A;  3J80 b;  3HOX I;  4BY1 I;  1QVF Z;  3FQM A;  2R6M A;  3IX0 A;  2F4O A;  1YJW Z;  3P5J B;  1Q82 1;  3RZD I;  2QLV B;  3FQQ A;  3S16 I;  2JUB A;  1VQN Z;  5LL6 f;  1QF8 A;  3I56 Z;  1RLY A;  3QWU A;  3D9X A;  1YJW 1;  1Q81 1;  1DL6 A;  3G6E 1;  2M48 A;  2PMZ A;  3G71 Z;  3EER A;  2JR6 A;  3S15 I;  1PFT A;  3CCE Z;  1YUA A;  1VQN 1;  3GTM I;  3I56 1;  3HKZ A;  3CXC Z;  4A3B I;  2RBL A;  2RT9 A;  4NBC A;  1VQ9 Z;  3G71 1;  1AA6 A;  2B63 I;  2HF1 A;  1Y1V S;  3CCE 1;  3CCQ Z;  3J7A 4;  3I4M I;  2R92 I;  3BG0 B;  1I6H I;  2JA6 I;  2JA8 I;  4A3K I;  3BG1 B;  1I3Q I;  1NUI A;  2JIO A;  3NDI A;  4E33 A;  1S72 Z;  3MZK B;  1M1K 2;  4A3M I;  1VQ9 1;  3CQZ I;  3CCM Z;  1N2F A;  3CCQ 1;  5T67 A;  3CC2 Z;  1VQ5 Z;  2NVT I;  2AKL A;  1KD1 1;  1Y1V I;  1S72 1;  2NVY I;  2BJO A;  3GTO I;  1K9M 2;  3CCM 1;  3G4S Z;  1RO2 A;  2QRC B;  3TE5 B;  3CC2 1;  1VQ5 1;  5IT9 b;  4E32 A;  1Y8C A;  2AYD A;  4E2Y A;  1VQK Z;  3D6W A;  2I3C A;  2GTH A;  2W03 A;  2Q51 A;  1TWC I;  2RHB A;  3TDH B;  1WII A;  1WW9 A;  3G4S 1;  2OOY B;  2ZAE B;  4BBR I;  2RIQ A;  1W2B Z;  2WAQ A;  1VQK 1;  2G2K A;  2KPI A;  4A3G I;  2LEX A;  1Q16 A;  4RV9 A;  4RVH A;  3J80 f;  2O4H A;  5CM2 M;  4A3E I;  4NBE A;  2LIY A;  4NOZ A;  3CCL Z;  3KIF A;  3PO3 S;  3GCF A;  1K9M 1;  3OW2 Z;  4XX2 A;  2VPY A;  4E2X A;  1S7M A;  2DE7 A;  3CCL 1;  2EGT A;  1YIT Z;  1TFI A;  4E2Z A;  1TWG I;  3HOV I;  1KQS Z;  3JAM b;  3GTG I;  4AYB A;  3I4N I;  1FDI A;  3VMI A;  1RNI A;  1Q86 1;  1VQM Z;  1USP A;  5FLX b;  1WZN A;  4A3C I;  4E31 A;  2VPW A;  2V45 A;  5A2Q f;  4A3D I;  2Q4Z A;  4BXX I;  1VQ8 Z;  3PO2 I;  2JIP A;  3CC7 Z;  1VQM 1;  3I07 A;  3NFZ A;  2IV2 X;  4BBS I;  2W04 A;  2R93 I;  2NAP A;  1VLA A;  3S2H I;  2QA4 Z;  1QVG Z;  3S1Q I;  1LQL A;  3S17 I;  1VQ8 1;  2OTJ Z;  4A3F I;  3NH5 A;  4RVD A;  5C4J I;  1N8R 2;  3CC7 1;  1RO4 A;  4NBF A;  2QKD A;  5IP9 I;  5D1P A;  2VF1 A;  1ZB8 A;  3D2L A;  2QA4 1;  3GTP I;  1M90 2;  1ZH1 A;  4QTU A;  2VPX A;  5C3E I;  4DGL A;  1JJ2 Y;  3H3V J;  1SFO I;  1Y1W I;  1KC8 2;  4CL1 A;  4QTT A;  1WJ2 A;  1Q7Y 2;  1ML8 A;  3CD6 Z;  3S1N I;  1VQO Z;  1YJ9 Z;  3FKI I;  2J6A A;  1Z02 A;  1K83 I;  4NBA A;  4HH4 A;  4MD7 A;  3GKQ A;  3CCJ Z;  1I50 I;  1QVF Y;  3CD6 1;  1VQO 1;  1YJ9 1;  2QR1 B;  3CCS Z;  2JIR A;  2DE6 A;  4S1T A;  1TWA I;  1ZB9 A;  3HOW I;  3NH8 A;  2VUM I;  3CCJ 1;  1YUK A;  4Y52 I;  3U50 C;  1M1K 1;  2QRE B;  5D1O B;  3CCS 1;  1YIJ Z;  3LUS A;  3IF8 A;  2YU9 I;  1VQ4 Z;  3NDJ A;  2NVX I;  4NFR A;  2KI7 B;  2V3V A;  3VTN A;  3S14 I;  2IZ4 A;  4NBG A;  4RVG A;  3HOU I;  1Q7Y 1;  3J81 b;  1YIJ 1;  3CXC Y;  1VQ4 1;  3CPW Z;  2WB1 A;  3F3F C;  2JA5 I;  4X6A I;  5T64 A;  1JWH C;  2QEX Z;  1SIW A;  3NH4 A;  4EWC A;  2P28 A;  3CMA Z;  4A3I I;  3IR7 A;  2RPR A;  4A93 I;  2V8K A;  4RS4 A;  3PO3 I;  4TNU A;  1TWF I;  3S1M I;  2QEX 1;  1QXF A;  2OOX B;  1YI2 Z;  1VQ7 Z;  4HGZ A;  4A3L I;  4NBB A;  3CMA 1;  1YIT 1;  3F3P C;  1NJI 2;  3MZL B;  3CCU Z;  1K73 2;  4MD9 A;  2E2I I;  3T4N B;  4MRI A;  2JMO A;  4HGY A;  1KRL A;  1YI2 1;  1VQ7 1;  3S2D I;  4NBD A;  1P9N A;  3CCU 1;  3G6E Z;  2O53 A;  2PK7 A;  4DK1 A;  4MH4 A;  3GTM S;  3CCR Z;  3K7A I;  1X3Z A;  1W2B Y;  5C44 I;  1KD1 2;  1K8A 2;  3M3Y I;  2K5R A;  3HOZ I;  3CC4 Z;  2V8J A;  2M6N A;  3ESW A;  1USP B;  4BY7 I;  4NB8 A;  3CCR 1;  2GU2 A;  2R7Z I;  2DE5 A;  3CME Z;  5IT9 f;  1Z01 A;  2OTJ 1;  4NB9 A;  1NJI 1;  1YJN Z;  1K73 1;  3CC4 1;  4A3J I;  3I55 Z;  1VQP Z;  3CME 1;  3OW2 Y;  1FDO A;  1L1O C;  3CPW Y;  1WCM I;  5A2Q b;  2E7Z A;  1RO0 A;  2P3Y A;  2NVQ I;  1YJN 1;  5C4X I;  4NBH A;  1VQ6 Z;  3MON A;  2E9H A;  2K3R A;  2JIM A;  3I55 1;  1VQP 1;  3GTL I;  2E2H I;  2OZK A;  1X3W A;  1KQS Y;  1YHQ Z;  3S1R I;  2IZ3 A;  2VUG A;  2JS4 A;  4E2W A;  1K8A 1;  1TWH I;  2VPZ A;  3J81 f;  1N8R 1;  1VQ6 1;  3EED A;  4MD8 A;  5D1O A;  1QYP A;  3GTQ I; 
#chains in the Genus database with same CATH homology
 4NH1 C;  1YHQ 1;  2QRD B;  2HU9 A;  4MON A;  1M90 1;  3VMH A;  2GTI A;  1X0T A;  2E2J I;  1KC8 1;  3JAM f;  5T6B A;  4MXU A;  5AN9 F;  2OTL Z;  1Z03 A;  2Y0S A;  4E30 A;  5IP7 I;  5FLM I;  3CCV Z;  1Q82 2;  3VMG A;  1QVG Y;  3GTJ I;  4RVF A;  1VQL Z;  2F4M A;  1Q86 2;  3HOY I;  2JNY A;  3VB9 A;  3KIH A;  2OTL 1;  3GTK I;  5FLX f;  3H0G I;  3Q87 A;  2YAD A;  2JA7 I;  3RZO I;  3CCV 1;  1Q81 2;  2V8I A;  4Y7N I;  2PM9 A;  1JJ2 Z;  2LFU A;  1VQL 1;  1NP6 A;  4DQY B;  3IFU A;  3M4O I;  1R9T I;  1RQF A;  2H85 A;  3J80 b;  3HOX I;  4BY1 I;  1QVF Z;  3FQM A;  2R6M A;  3IX0 A;  2F4O A;  1YJW Z;  3P5J B;  1Q82 1;  3RZD I;  2QLV B;  3FQQ A;  3S16 I;  2JUB A;  1VQN Z;  5LL6 f;  1QF8 A;  3I56 Z;  1RLY A;  3QWU A;  3D9X A;  1YJW 1;  1Q81 1;  1DL6 A;  3G6E 1;  2M48 A;  2PMZ A;  3G71 Z;  3EER A;  2JR6 A;  3S15 I;  1PFT A;  3CCE Z;  1YUA A;  1VQN 1;  3GTM I;  3I56 1;  3HKZ A;  3CXC Z;  4A3B I;  2RBL A;  2RT9 A;  4NBC A;  1VQ9 Z;  3G71 1;  2B63 I;  2HF1 A;  1Y1V S;  3CCE 1;  3CCQ Z;  3J7A 4;  3I4M I;  2R92 I;  3BG0 B;  1I6H I;  2JA6 I;  2JA8 I;  4A3K I;  3BG1 B;  1I3Q I;  1NUI A;  3NDI A;  4E33 A;  1S72 Z;  3MZK B;  1M1K 2;  4A3M I;  1VQ9 1;  3CQZ I;  3CCM Z;  1N2F A;  3CCQ 1;  5T67 A;  3CC2 Z;  1VQ5 Z;  2NVT I;  2AKL A;  1KD1 1;  1Y1V I;  1S72 1;  2NVY I;  2BJO A;  3GTO I;  1K9M 2;  3CCM 1;  3G4S Z;  1RO2 A;  2QRC B;  3TE5 B;  3CC2 1;  1VQ5 1;  5IT9 b;  4E32 A;  4E2Y A;  1VQK Z;  3D6W A;  2I3C A;  2GTH A;  2W03 A;  2Q51 A;  1TWC I;  2RHB A;  3TDH B;  1WII A;  1WW9 A;  3G4S 1;  2OOY B;  2ZAE B;  4BBR I;  2RIQ A;  1W2B Z;  2WAQ A;  1VQK 1;  2G2K A;  2KPI A;  4A3G I;  4RV9 A;  4RVH A;  3J80 f;  2O4H A;  5CM2 M;  4A3E I;  4NBE A;  2LIY A;  4NOZ A;  3CCL Z;  3KIF A;  3PO3 S;  3GCF A;  1K9M 1;  3OW2 Z;  4XX2 A;  4E2X A;  1S7M A;  2DE7 A;  3CCL 1;  2EGT A;  1YIT Z;  1TFI A;  4E2Z A;  1TWG I;  3HOV I;  1KQS Z;  3JAM b;  3GTG I;  4AYB A;  3I4N I;  3VMI A;  1RNI A;  1Q86 1;  1VQM Z;  1USP A;  5FLX b;  4A3C I;  4E31 A;  5A2Q f;  4A3D I;  2Q4Z A;  4BXX I;  1VQ8 Z;  3PO2 I;  3CC7 Z;  1VQM 1;  3I07 A;  3NFZ A;  4BBS I;  2W04 A;  2R93 I;  1VLA A;  3S2H I;  2QA4 Z;  1QVG Z;  3S1Q I;  1LQL A;  3S17 I;  1VQ8 1;  2OTJ Z;  4A3F I;  3NH5 A;  4RVD A;  5C4J I;  1N8R 2;  3CC7 1;  1RO4 A;  4NBF A;  2QKD A;  5IP9 I;  5D1P A;  2VF1 A;  1ZB8 A;  2QA4 1;  3GTP I;  1M90 2;  1ZH1 A;  4QTU A;  5C3E I;  4DGL A;  1JJ2 Y;  3H3V J;  1SFO I;  1Y1W I;  1KC8 2;  4CL1 A;  4QTT A;  1Q7Y 2;  1ML8 A;  3CD6 Z;  3S1N I;  1VQO Z;  1YJ9 Z;  3FKI I;  2J6A A;  1Z02 A;  1K83 I;  4NBA A;  4HH4 A;  4MD7 A;  3GKQ A;  3CCJ Z;  1I50 I;  1QVF Y;  3CD6 1;  1VQO 1;  1YJ9 1;  2QR1 B;  3CCS Z;  2DE6 A;  4S1T A;  1TWA I;  1ZB9 A;  3HOW I;  3NH8 A;  2VUM I;  3CCJ 1;  1YUK A;  4Y52 I;  3U50 C;  1M1K 1;  2QRE B;  5D1O B;  3CCS 1;  1YIJ Z;  3LUS A;  3IF8 A;  2YU9 I;  1VQ4 Z;  3NDJ A;  2NVX I;  4NFR A;  2KI7 B;  3VTN A;  3S14 I;  2IZ4 A;  4NBG A;  4RVG A;  3HOU I;  1Q7Y 1;  3J81 b;  1YIJ 1;  3CXC Y;  1VQ4 1;  3CPW Z;  2WB1 A;  3F3F C;  2JA5 I;  4X6A I;  5T64 A;  1JWH C;  2QEX Z;  3NH4 A;  4EWC A;  2P28 A;  3CMA Z;  4A3I I;  2RPR A;  4A93 I;  2V8K A;  4RS4 A;  3PO3 I;  4TNU A;  1TWF I;  3S1M I;  2QEX 1;  2OOX B;  1YI2 Z;  1VQ7 Z;  4HGZ A;  4A3L I;  4NBB A;  3CMA 1;  1YIT 1;  3F3P C;  1NJI 2;  3MZL B;  3CCU Z;  1K73 2;  4MD9 A;  2E2I I;  3T4N B;  4MRI A;  2JMO A;  4HGY A;  1KRL A;  1YI2 1;  1VQ7 1;  3S2D I;  4NBD A;  1P9N A;  3CCU 1;  3G6E Z;  2O53 A;  2PK7 A;  4DK1 A;  4MH4 A;  3GTM S;  3CCR Z;  3K7A I;  1X3Z A;  1W2B Y;  5C44 I;  1KD1 2;  1K8A 2;  3M3Y I;  2K5R A;  3HOZ I;  3CC4 Z;  2V8J A;  2M6N A;  3ESW A;  1USP B;  4BY7 I;  4NB8 A;  3CCR 1;  2GU2 A;  2R7Z I;  2DE5 A;  3CME Z;  5IT9 f;  1Z01 A;  2OTJ 1;  4NB9 A;  1NJI 1;  1YJN Z;  1K73 1;  3CC4 1;  4A3J I;  3I55 Z;  1VQP Z;  3CME 1;  3OW2 Y;  3CPW Y;  1L1O C;  1WCM I;  5A2Q b;  1RO0 A;  2P3Y A;  2NVQ I;  1YJN 1;  5C4X I;  4NBH A;  1VQ6 Z;  3MON A;  2E9H A;  2K3R A;  3I55 1;  1VQP 1;  3GTL I;  2E2H I;  2OZK A;  1X3W A;  1KQS Y;  1YHQ Z;  3S1R I;  2IZ3 A;  2VUG A;  2JS4 A;  4E2W A;  1K8A 1;  1TWH I;  1N8R 1;  3J81 f;  1VQ6 1;  3EED A;  4MD8 A;  5D1O A;  1QYP A;  3GTQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...