3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
3H3VJ 2PK7A 1RLYA 1I6HI 1TWCI 3RZDI 3GTOI 2VUMI 2NVTI 1X3WA 2E2II 2JA5I 3LUSA 1Y1WI 3D6WA 4QTUA 3GTJI 1WW9A 4NBHA 4NBCA 3GTKI 5C3EI 5C4JI 2E2JI 3HOWI 1TFIA 1I50I 2B63I 3S16I 4BBSI 1L1OC 4BBRI 4Y7NI 4NB8A 3PO3I 4A3CI 4QTTA 4A3GI 2RBLA 5C44I 1WCMI 3HOXI 1DL6A 3HOYI 2JR6A 3K7AI 1USPB 1QYPA 3EERA 4A93I 4BXXI 1LQLA 3PO3S 3VB9A 2JA6I 1Y1VI 2HF1A 4NB9A 3ESWA 2BJOA 4A3KI 1RO4A 3S1MI 1TWGI 3Q87A 3S2HI 4XX2A 3S17I 3GCFA 1ZB8A 2NVYI 4A3FI 3S1QI 1VLAA 3S1NI 5IP7I 1R9TI 1NUIA 3FKII 4NBFA 3GTGI 3I4MI 4A3JI 2DE7A 3GTMI 3CQZI 4NBAA 2NVXI 3HOUI 2KPIA 1TWAI 4NBEA 3VMGA 1X3ZA 2JS4A 5CM2M 3U50C 2P3YA 4NOZA 4A3II 1I3QI 5FLMI 3RZOI 2R92I 3S2DI 3HOVI 4A3EI 3S14I 1PFTA 2NVQI 4NBDA 2YU9I 3M3YI 4MH4A 2J6AA 3VMHA 1N2FA 4BY1I 3GTLI 2R7ZI 3S1RI 3GTMS 3HOZI 2F4OA 4A3MI 2DE5A 1TWHI 1SFOI 2JA8I 1K83I 2E2HI 4A3DI 1USPA 3H0GI 2F4MA 3VMIA 4X6AI 5IP9I 1Y1VS 1ZB9A 2JA7I 2AKLA 3GTQI 4A3BI 4BY7I 2JNYA 2R93I 4NBGA 1ML8A 3GKQA 3GTPI 2DE6A 4Y52I 3I4NI 3S15I 3I07A 5C4XI 3PO2I 1TWFI 2K5RA 4NBBA 4A3LI 1YUAA 3M4OI
chains in the Genus database with same CATH superfamily
5D1OB 3H3VJ 2H85A 2LIYA 5FLXb 3CMEZ 1N8R2 2VUMI 1X3WA 4HGYA 2RHBA 2E2II 2JA5I 1VQ81 4NFRA 1KRLA 4NBHA 5A2Qf 3HOWI 3I551 1Q861 1L1OC 3PO3I 4A3GI 4HGZA 3HKZA 3CMA1 3NDJA 1VQLZ 3HOXI 1DL6A 3HOYI 1M1K1 1YIJZ 1VQ7Z 2NAPA 3EERA 2LEXA 4BXXI 1LQLA 1Q822 1VQKZ 3J81b 1WJ2A 1K8A1 1VQO1 1YHQ1 2O53A 2OTJ1 2JA6I 2OTLZ 3CCMZ 3ESWA 2BJOA 2VPXA 1RO4A 4A3KI 4EWCA 2WAQA 2HU9A 3F3FC 1Z03A 3CC2Z 5D1OA 5T64A 3S1QI 1YIT1 3S1NI 4MD8A 1R9TI 3GTGI 1VQ8Z 1TWAI 4NBEA 3VMGA 1I3QI 3I55Z 3CC71 2OOYB 2V45A 4HH4A 2YU9I 1YJ9Z 1VQ4Z 1Q811 1SIWA 3GTLI 3J7A4 1Q7Y2 3GTMS 3CD6Z 3IFUA 4E33A 3CCJ1 2AYDA 3NH8A 2F4MA 5IP9I 2QR1B 4BY7I 2PM9A 4MD7A 1QVFZ 1VQOZ 2DE6A 1AA6A 1TWFI 2K5RA 4A3LI 1Q16A 1YUAA 1QVGY 1VQ9Z 4RVHA 1I6HI 1RQFA 1Q862 1YIJ1 2QREB 2VPWA 2NVTI 3MZKB 1Y8CA 2QA4Z 1X0TA 4RVDA 3LUSA 3I56Z 1YITZ 3D6WA 4QTUA 1WW9A 2LFUA 1KD11 1VQK1 3GTKI 2IV2X 5C4JI 2E2JI 5IT9b 1TFIA 1I50I 3G6EZ 4BBSI 2O4HA 3OW2Y 4Y7NI 2ZAEB 3CCM1 4QTTA 1K732 3TE5B 3QWUA 2RT9A 1K9M2 3BG1B 3K7AI 3CC21 1USPB 4DGLA 4A93I 3CCJZ 3CCS1 4TNUA 4MXUA 1M901 5AN9F 3VB9A 2GTHA 3IX0A 3CC4Z 3CXCZ 1Z02A 4E30A 3G4SZ 3CPWZ 3S1MI 1YJ91 1NJI1 3Q87A 1VQ41 1YJNZ 3EEDA 2JUBA 2JIRA 2IZ4A 3CD61 2EGTA 2NVYI 2OZKA 4A3FI 1VLAA 1NUIA 4A3JI 1W2BZ 4E2ZA 2VUGA 5CM2M 3U50C 4A3II 5FLMI 3S2DI 2R92I 3HOVI 4A3EI 3KIFA 1VQ91 3M3YI 1VQ5Z 1WIIA 2QLVB 2R7ZI 2F4OA 3CCEZ 4A3MI 1SFOI 2QA41 5LL6f 3D2LA 4AYBA 3I561 1USPA 3CCSZ 1KC81 4X6AI 5T6BA 1JJ2Y 2JIPA 3JAMf 2KI7B 3GTQI 4A3BI 4RVGA 3GKQA 4S1TA 3G6E1 3GTPI 2IZ3A 1S7MA 1N8R1 3S15I 3I07A 3PO2I 3D9XA 3M4OI 2PK7A 1RLYA 2YADA 4RVFA 1TWCI 2GTIA 2VPYA 3GTOI 2V3VA 1Y1WI 2R6MA 3T4NB 3GTJI 3CCU1 4DQYB 3J80f 2RPRA 4MD9A 5C3EI 3CCV1 2B63I 3S16I 3CCL1 2P28A 4BBRI 4A3CI 3CC41 2RIQA 3G4S1 1Q821 1QXFA 1YJN1 5IT9f 1QYPA 2W03A 2QEXZ 4RS4A 1KQSZ 3PO3S 1M1K2 3F3PC 5FLXf 4NB9A 1Z01A 5T67A 4MRIA 2M48A 1K8A2 1VQ51 3P5JB 3CCE1 3S17I 1FDOA 3GCFA 1QVFY 1ZB8A 1VQP1 5IP7I 3FKII 4NBFA 3TDHB 2DE7A 2E7ZA 2OOXB 3CQZI 3GTMI 3HOUI 3CCUZ 3CCQZ 4NOZA 4CL1A 3CCVZ 1Q7Y1 3RZOI 3CCLZ 1VQM1 4E2YA 3S14I 4MONA 2NVQI 3J81f 4MH4A 2J6AA 3VMHA 3VTNA 3HOZI 3G711 3NH4A 2DE5A 1TWHI 1K83I 2E2HI 4A3DI 3H0GI 3VMIA 4E2XA 1Q812 1Y1VS 2AKLA 3NH5A 2K3RA 1S72Z 4E32A 2R93I 1RNIA 1ML8A 4NBGA 3NFZA 4Y52I 3MZLB 3I4NI 1JJ2Z 1JWHC 4NBBA 1YJWZ 1VQ61 3RZDI 5A2Qb 1YI2Z 4NH1C 4RV9A 2QEX1 2QRCB 3IR7A 3CXCY 2Q4ZA 1VQPZ 1K731 3CPWY 1VQNZ 4NBCA 1K9M1 4NB8A 2M6NA 3CCRZ 1NP6A 2RBLA 1KD12 1VQMZ 5C44I 2W04A 1WCMI 1W2BY 2PMZA 2E9HA 2JR6A 1QF8A 2G2KA 3G71Z 4DK1A 2JIOA 1RO2A 3NDIA 1QVGZ 1RO0A 3CCQ1 3IF8A 2JIQA 1Y1VI 2HF1A 1M902 2QKDA 3JAMb 3CMAZ 1TWGI 3CME1 2VPZA 3S2HI 2VF1A 1FDIA 1VQ6Z 1WZNA 4XX2A 3BG0B 3OW2Z 2V8KA 3I4MI 1NJI2 3FQMA 2GU2A 4NBAA 2NVXI 2Y0SA 2KPIA 4E2WA 1S721 3FQQA 1X3ZA 2JS4A 3MONA 4E31A 1YHQZ 2P3YA 2OTJZ 2I3CA 2Q51A 1PFTA 4NBDA 3J80b 1VQL1 1YJW1 1YUKA 1N2FA 1VQ71 4BY1I 3S1RI 3KIHA 1YI21 2JMOA 2JA8I 1P9NA 2V8IA 2V8JA 5D1PA 2WB1A 1VQN1 1ZB9A 2JA7I 2JNYA 2OTL1 1ZH1A 3CC7Z 1KC82 3CCR1 5C4XI 2QRDB 2JIMA 1KQSY
chains in the Genus database with same CATH topology
5D1OB 3H3VJ 2H85A 2LIYA 5FLXb 3CMEZ 1N8R2 2VUMI 1X3WA 4HGYA 2RHBA 2E2II 2JA5I 1VQ81 4NFRA 1KRLA 4NBHA 5A2Qf 3HOWI 3I551 1Q861 1L1OC 3PO3I 4A3GI 4HGZA 3HKZA 3CMA1 3NDJA 1VQLZ 3HOXI 1DL6A 3HOYI 1M1K1 1YIJZ 1VQ7Z 3EERA 4BXXI 1LQLA 1Q822 1VQKZ 3J81b 1K8A1 1VQO1 1YHQ1 2O53A 2OTJ1 2JA6I 2OTLZ 3CCMZ 3ESWA 2BJOA 4A3KI 1RO4A 4EWCA 2WAQA 2HU9A 3F3FC 1Z03A 3CC2Z 5D1OA 5T64A 3S1QI 1YIT1 3S1NI 4MD8A 1R9TI 3GTGI 1VQ8Z 1TWAI 4NBEA 3VMGA 1I3QI 3I55Z 3CC71 2OOYB 4HH4A 2YU9I 1YJ9Z 1VQ4Z 1Q811 3J7A4 3GTLI 1Q7Y2 3GTMS 3CD6Z 3IFUA 4E33A 3CCJ1 3NH8A 2F4MA 5IP9I 2QR1B 4BY7I 2PM9A 4MD7A 1QVFZ 1VQOZ 2DE6A 1TWFI 2K5RA 4A3LI 1YUAA 1QVGY 1VQ9Z 4RVHA 1I6HI 1RQFA 1Q862 1YIJ1 2QREB 2NVTI 3MZKB 2QA4Z 1X0TA 4RVDA 3LUSA 3I56Z 1YITZ 3D6WA 4QTUA 1WW9A 2LFUA 1KD11 1VQK1 3GTKI 5C4JI 2E2JI 5IT9b 1TFIA 1I50I 3G6EZ 4BBSI 2O4HA 3OW2Y 4Y7NI 2ZAEB 3CCM1 4QTTA 1K732 3TE5B 3QWUA 2RT9A 1K9M2 3BG1B 3K7AI 3CC21 1USPB 4DGLA 4A93I 3CCJZ 3CCS1 4TNUA 4MXUA 1M901 5AN9F 3VB9A 2GTHA 3IX0A 3CC4Z 3CXCZ 1Z02A 4E30A 3G4SZ 3CPWZ 3S1MI 1YJ91 1NJI1 3Q87A 1VQ41 1YJNZ 3EEDA 2JUBA 2IZ4A 3CD61 2EGTA 2NVYI 2OZKA 4A3FI 1VLAA 1NUIA 4A3JI 1W2BZ 4E2ZA 2VUGA 5CM2M 3U50C 4A3II 5FLMI 3S2DI 2R92I 3HOVI 4A3EI 3KIFA 1VQ91 3M3YI 1VQ5Z 1WIIA 2QLVB 2R7ZI 2F4OA 3CCEZ 4A3MI 1SFOI 2QA41 5LL6f 4AYBA 3I561 1USPA 3CCSZ 1KC81 4X6AI 5T6BA 1JJ2Y 3JAMf 2KI7B 3GTQI 4A3BI 4RVGA 3GKQA 4S1TA 3G6E1 3GTPI 2IZ3A 1S7MA 1N8R1 3S15I 3I07A 3PO2I 3D9XA 3M4OI 2PK7A 1RLYA 2YADA 4RVFA 1TWCI 2GTIA 3GTOI 1Y1WI 2R6MA 3T4NB 3GTJI 3CCU1 4DQYB 3J80f 2RPRA 4MD9A 5C3EI 3CCV1 2B63I 3S16I 3CCL1 2P28A 4BBRI 4A3CI 3CC41 2RIQA 3G4S1 1Q821 1YJN1 5IT9f 1QYPA 2W03A 2QEXZ 4RS4A 1KQSZ 3PO3S 1M1K2 3F3PC 5FLXf 4NB9A 1Z01A 5T67A 4MRIA 2M48A 1K8A2 1VQ51 3P5JB 3CCE1 3S17I 3GCFA 1QVFY 1ZB8A 1VQP1 5IP7I 3FKII 4NBFA 3TDHB 2DE7A 2OOXB 3GTMI 3CQZI 3HOUI 3CCUZ 3CCQZ 4NOZA 4CL1A 3CCVZ 1Q7Y1 3RZOI 3CCLZ 1VQM1 4E2YA 3S14I 4MONA 2NVQI 3J81f 4MH4A 2J6AA 3VMHA 3VTNA 3HOZI 3G711 3NH4A 2DE5A 1TWHI 1K83I 2E2HI 4A3DI 3H0GI 3VMIA 4E2XA 1Q812 1Y1VS 2AKLA 3NH5A 2K3RA 1S72Z 4E32A 2R93I 1RNIA 1ML8A 4NBGA 3NFZA 4Y52I 3MZLB 3I4NI 1JJ2Z 1JWHC 4NBBA 1YJWZ 1VQ61 3RZDI 5A2Qb 1YI2Z 4NH1C 4RV9A 2QEX1 2QRCB 3CXCY 2Q4ZA 1VQPZ 1K731 3CPWY 1VQNZ 4NBCA 1K9M1 4NB8A 2M6NA 3CCRZ 1NP6A 2RBLA 1KD12 1VQMZ 5C44I 2W04A 1WCMI 1W2BY 2PMZA 2E9HA 2JR6A 1QF8A 2G2KA 3G71Z 4DK1A 1RO2A 3NDIA 1QVGZ 1RO0A 3CCQ1 3IF8A 1Y1VI 2HF1A 1M902 2QKDA 3JAMb 3CMAZ 1TWGI 3CME1 3S2HI 2VF1A 1VQ6Z 4XX2A 3BG0B 3OW2Z 2V8KA 3I4MI 1NJI2 3FQMA 2GU2A 4NBAA 2NVXI 2Y0SA 2KPIA 4E2WA 1S721 3FQQA 1X3ZA 2JS4A 3MONA 4E31A 1YHQZ 2P3YA 2OTJZ 2I3CA 2Q51A 1PFTA 4NBDA 3J80b 1VQL1 1YJW1 1YUKA 1N2FA 1VQ71 4BY1I 3S1RI 3KIHA 1YI21 2JMOA 2JA8I 1P9NA 2V8IA 2V8JA 5D1PA 2WB1A 1VQN1 1ZB9A 2JA7I 2JNYA 2OTL1 1ZH1A 3CC7Z 1KC82 3CCR1 5C4XI 2QRDB 1KQSY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V J;  2PK7 A;  1RLY A;  1I6H I;  1TWC I;  3RZD I;  3GTO I;  2VUM I;  2NVT I;  1X3W A;  2E2I I;  2JA5 I;  3LUS A;  1Y1W I;  3D6W A;  4QTU A;  3GTJ I;  1WW9 A;  4NBH A;  4NBC A;  3GTK I;  5C3E I;  5C4J I;  2E2J I;  3HOW I;  1TFI A;  1I50 I;  2B63 I;  3S16 I;  4BBS I;  1L1O C;  4BBR I;  4Y7N I;  4NB8 A;  3PO3 I;  4A3C I;  4QTT A;  4A3G I;  2RBL A;  5C44 I;  1WCM I;  3HOX I;  1DL6 A;  3HOY I;  2JR6 A;  3K7A I;  1USP B;  1QYP A;  3EER A;  4A93 I;  4BXX I;  1LQL A;  3PO3 S;  3VB9 A;  2JA6 I;  1Y1V I;  2HF1 A;  4NB9 A;  3ESW A;  2BJO A;  4A3K I;  1RO4 A;  3S1M I;  1TWG I;  3Q87 A;  3S2H I;  4XX2 A;  3S17 I;  3GCF A;  1ZB8 A;  2NVY I;  4A3F I;  3S1Q I;  1VLA A;  3S1N I;  5IP7 I;  1R9T I;  1NUI A;  3FKI I;  4NBF A;  3GTG I;  3I4M I;  4A3J I;  2DE7 A;  3GTM I;  3CQZ I;  4NBA A;  2NVX I;  3HOU I;  2KPI A;  1TWA I;  4NBE A;  3VMG A;  1X3Z A;  2JS4 A;  5CM2 M;  3U50 C;  2P3Y A;  4NOZ A;  4A3I I;  1I3Q I;  5FLM I;  3RZO I;  2R92 I;  3S2D I;  3HOV I;  4A3E I;  3S14 I;  1PFT A;  2NVQ I;  4NBD A;  2YU9 I;  3M3Y I;  4MH4 A;  2J6A A;  3VMH A;  1N2F A;  4BY1 I;  3GTL I;  2R7Z I;  3S1R I;  3GTM S;  3HOZ I;  2F4O A;  4A3M I;  2DE5 A;  1TWH I;  1SFO I;  2JA8 I;  1K83 I;  2E2H I;  4A3D I;  1USP A;  3H0G I;  2F4M A;  3VMI A;  4X6A I;  5IP9 I;  1Y1V S;  1ZB9 A;  2JA7 I;  2AKL A;  3GTQ I;  4A3B I;  4BY7 I;  2JNY A;  2R93 I;  4NBG A;  1ML8 A;  3GKQ A;  3GTP I;  2DE6 A;  4Y52 I;  3I4N I;  3S15 I;  3I07 A;  5C4X I;  3PO2 I;  1TWF I;  2K5R A;  4NBB A;  4A3L I;  1YUA A;  3M4O I; 
#chains in the Genus database with same CATH topology
 5D1O B;  3H3V J;  2H85 A;  2LIY A;  5FLX b;  3CME Z;  1N8R 2;  2VUM I;  1X3W A;  4HGY A;  2RHB A;  2E2I I;  2JA5 I;  1VQ8 1;  4NFR A;  1KRL A;  4NBH A;  5A2Q f;  3HOW I;  3I55 1;  1Q86 1;  1L1O C;  3PO3 I;  4A3G I;  4HGZ A;  3HKZ A;  3CMA 1;  3NDJ A;  1VQL Z;  3HOX I;  1DL6 A;  3HOY I;  1M1K 1;  1YIJ Z;  1VQ7 Z;  2NAP A;  3EER A;  2LEX A;  4BXX I;  1LQL A;  1Q82 2;  1VQK Z;  3J81 b;  1WJ2 A;  1K8A 1;  1VQO 1;  1YHQ 1;  2O53 A;  2OTJ 1;  2JA6 I;  2OTL Z;  3CCM Z;  3ESW A;  2BJO A;  2VPX A;  1RO4 A;  4A3K I;  4EWC A;  2WAQ A;  2HU9 A;  3F3F C;  1Z03 A;  3CC2 Z;  5D1O A;  5T64 A;  3S1Q I;  1YIT 1;  3S1N I;  4MD8 A;  1R9T I;  3GTG I;  1VQ8 Z;  1TWA I;  4NBE A;  3VMG A;  1I3Q I;  3I55 Z;  3CC7 1;  2OOY B;  2V45 A;  4HH4 A;  2YU9 I;  1YJ9 Z;  1VQ4 Z;  1Q81 1;  1SIW A;  3GTL I;  3J7A 4;  1Q7Y 2;  3GTM S;  3CD6 Z;  3IFU A;  4E33 A;  3CCJ 1;  2AYD A;  3NH8 A;  2F4M A;  5IP9 I;  2QR1 B;  4BY7 I;  2PM9 A;  4MD7 A;  1QVF Z;  1VQO Z;  2DE6 A;  1AA6 A;  1TWF I;  2K5R A;  4A3L I;  1Q16 A;  1YUA A;  1QVG Y;  1VQ9 Z;  4RVH A;  1I6H I;  1RQF A;  1Q86 2;  1YIJ 1;  2QRE B;  2VPW A;  2NVT I;  3MZK B;  1Y8C A;  2QA4 Z;  1X0T A;  4RVD A;  3LUS A;  3I56 Z;  1YIT Z;  3D6W A;  4QTU A;  1WW9 A;  2LFU A;  1KD1 1;  1VQK 1;  3GTK I;  2IV2 X;  5C4J I;  2E2J I;  5IT9 b;  1TFI A;  1I50 I;  3G6E Z;  4BBS I;  2O4H A;  3OW2 Y;  4Y7N I;  2ZAE B;  3CCM 1;  4QTT A;  1K73 2;  3TE5 B;  3QWU A;  2RT9 A;  1K9M 2;  3BG1 B;  3K7A I;  3CC2 1;  1USP B;  4DGL A;  4A93 I;  3CCJ Z;  3CCS 1;  4TNU A;  4MXU A;  1M90 1;  5AN9 F;  3VB9 A;  2GTH A;  3IX0 A;  3CC4 Z;  3CXC Z;  1Z02 A;  4E30 A;  3G4S Z;  3CPW Z;  3S1M I;  1YJ9 1;  1NJI 1;  3Q87 A;  1VQ4 1;  1YJN Z;  3EED A;  2JUB A;  2JIR A;  2IZ4 A;  3CD6 1;  2EGT A;  2NVY I;  2OZK A;  4A3F I;  1VLA A;  1NUI A;  4A3J I;  1W2B Z;  4E2Z A;  2VUG A;  5CM2 M;  3U50 C;  4A3I I;  5FLM I;  3S2D I;  2R92 I;  3HOV I;  4A3E I;  3KIF A;  1VQ9 1;  3M3Y I;  1VQ5 Z;  1WII A;  2QLV B;  2R7Z I;  2F4O A;  3CCE Z;  4A3M I;  1SFO I;  2QA4 1;  5LL6 f;  3D2L A;  4AYB A;  3I56 1;  1USP A;  3CCS Z;  1KC8 1;  4X6A I;  5T6B A;  1JJ2 Y;  2JIP A;  3JAM f;  2KI7 B;  3GTQ I;  4A3B I;  4RVG A;  3GKQ A;  4S1T A;  3G6E 1;  3GTP I;  2IZ3 A;  1S7M A;  1N8R 1;  3S15 I;  3I07 A;  3PO2 I;  3D9X A;  3M4O I;  2PK7 A;  1RLY A;  2YAD A;  4RVF A;  1TWC I;  2GTI A;  2VPY A;  3GTO I;  2V3V A;  1Y1W I;  2R6M A;  3T4N B;  3GTJ I;  3CCU 1;  4DQY B;  3J80 f;  2RPR A;  4MD9 A;  5C3E I;  3CCV 1;  2B63 I;  3S16 I;  3CCL 1;  2P28 A;  4BBR I;  4A3C I;  3CC4 1;  2RIQ A;  3G4S 1;  1Q82 1;  1QXF A;  1YJN 1;  5IT9 f;  1QYP A;  2W03 A;  2QEX Z;  4RS4 A;  1KQS Z;  3PO3 S;  1M1K 2;  3F3P C;  5FLX f;  4NB9 A;  1Z01 A;  5T67 A;  4MRI A;  2M48 A;  1K8A 2;  1VQ5 1;  3P5J B;  3CCE 1;  3S17 I;  1FDO A;  3GCF A;  1QVF Y;  1ZB8 A;  1VQP 1;  5IP7 I;  3FKI I;  4NBF A;  3TDH B;  2DE7 A;  2E7Z A;  2OOX B;  3CQZ I;  3GTM I;  3HOU I;  3CCU Z;  3CCQ Z;  4NOZ A;  4CL1 A;  3CCV Z;  1Q7Y 1;  3RZO I;  3CCL Z;  1VQM 1;  4E2Y A;  3S14 I;  4MON A;  2NVQ I;  3J81 f;  4MH4 A;  2J6A A;  3VMH A;  3VTN A;  3HOZ I;  3G71 1;  3NH4 A;  2DE5 A;  1TWH I;  1K83 I;  2E2H I;  4A3D I;  3H0G I;  3VMI A;  4E2X A;  1Q81 2;  1Y1V S;  2AKL A;  3NH5 A;  2K3R A;  1S72 Z;  4E32 A;  2R93 I;  1RNI A;  1ML8 A;  4NBG A;  3NFZ A;  4Y52 I;  3MZL B;  3I4N I;  1JJ2 Z;  1JWH C;  4NBB A;  1YJW Z;  1VQ6 1;  3RZD I;  5A2Q b;  1YI2 Z;  4NH1 C;  4RV9 A;  2QEX 1;  2QRC B;  3IR7 A;  3CXC Y;  2Q4Z A;  1VQP Z;  1K73 1;  3CPW Y;  1VQN Z;  4NBC A;  1K9M 1;  4NB8 A;  2M6N A;  3CCR Z;  1NP6 A;  2RBL A;  1KD1 2;  1VQM Z;  5C44 I;  2W04 A;  1WCM I;  1W2B Y;  2PMZ A;  2E9H A;  2JR6 A;  1QF8 A;  2G2K A;  3G71 Z;  4DK1 A;  2JIO A;  1RO2 A;  3NDI A;  1QVG Z;  1RO0 A;  3CCQ 1;  3IF8 A;  2JIQ A;  1Y1V I;  2HF1 A;  1M90 2;  2QKD A;  3JAM b;  3CMA Z;  1TWG I;  3CME 1;  2VPZ A;  3S2H I;  2VF1 A;  1FDI A;  1VQ6 Z;  1WZN A;  4XX2 A;  3BG0 B;  3OW2 Z;  2V8K A;  3I4M I;  1NJI 2;  3FQM A;  2GU2 A;  4NBA A;  2NVX I;  2Y0S A;  2KPI A;  4E2W A;  1S72 1;  3FQQ A;  1X3Z A;  2JS4 A;  3MON A;  4E31 A;  1YHQ Z;  2P3Y A;  2OTJ Z;  2I3C A;  2Q51 A;  1PFT A;  4NBD A;  3J80 b;  1VQL 1;  1YJW 1;  1YUK A;  1N2F A;  1VQ7 1;  4BY1 I;  3S1R I;  3KIH A;  1YI2 1;  2JMO A;  2JA8 I;  1P9N A;  2V8I A;  2V8J A;  5D1P A;  2WB1 A;  1VQN 1;  1ZB9 A;  2JA7 I;  2JNY A;  2OTL 1;  1ZH1 A;  3CC7 Z;  1KC8 2;  3CCR 1;  5C4X I;  2QRD B;  2JIM A;  1KQS Y; 
#chains in the Genus database with same CATH homology
 5D1O B;  3H3V J;  2H85 A;  2LIY A;  5FLX b;  3CME Z;  1N8R 2;  2VUM I;  1X3W A;  4HGY A;  2RHB A;  2E2I I;  2JA5 I;  1VQ8 1;  4NFR A;  1KRL A;  4NBH A;  5A2Q f;  3HOW I;  3I55 1;  1Q86 1;  1L1O C;  3PO3 I;  4A3G I;  4HGZ A;  3HKZ A;  3CMA 1;  3NDJ A;  1VQL Z;  3HOX I;  1DL6 A;  3HOY I;  1M1K 1;  1YIJ Z;  1VQ7 Z;  3EER A;  4BXX I;  1LQL A;  1Q82 2;  1VQK Z;  3J81 b;  1K8A 1;  1VQO 1;  1YHQ 1;  2O53 A;  2OTJ 1;  2JA6 I;  2OTL Z;  3CCM Z;  3ESW A;  2BJO A;  4A3K I;  1RO4 A;  4EWC A;  2WAQ A;  2HU9 A;  3F3F C;  1Z03 A;  3CC2 Z;  5D1O A;  5T64 A;  3S1Q I;  1YIT 1;  3S1N I;  4MD8 A;  1R9T I;  3GTG I;  1VQ8 Z;  1TWA I;  4NBE A;  3VMG A;  1I3Q I;  3I55 Z;  3CC7 1;  2OOY B;  4HH4 A;  2YU9 I;  1YJ9 Z;  1VQ4 Z;  1Q81 1;  3J7A 4;  3GTL I;  1Q7Y 2;  3GTM S;  3CD6 Z;  3IFU A;  4E33 A;  3CCJ 1;  3NH8 A;  2F4M A;  5IP9 I;  2QR1 B;  4BY7 I;  2PM9 A;  4MD7 A;  1QVF Z;  1VQO Z;  2DE6 A;  1TWF I;  2K5R A;  4A3L I;  1YUA A;  1QVG Y;  1VQ9 Z;  4RVH A;  1I6H I;  1RQF A;  1Q86 2;  1YIJ 1;  2QRE B;  2NVT I;  3MZK B;  2QA4 Z;  1X0T A;  4RVD A;  3LUS A;  3I56 Z;  1YIT Z;  3D6W A;  4QTU A;  1WW9 A;  2LFU A;  1KD1 1;  1VQK 1;  3GTK I;  5C4J I;  2E2J I;  5IT9 b;  1TFI A;  1I50 I;  3G6E Z;  4BBS I;  2O4H A;  3OW2 Y;  4Y7N I;  2ZAE B;  3CCM 1;  4QTT A;  1K73 2;  3TE5 B;  3QWU A;  2RT9 A;  1K9M 2;  3BG1 B;  3K7A I;  3CC2 1;  1USP B;  4DGL A;  4A93 I;  3CCJ Z;  3CCS 1;  4TNU A;  4MXU A;  1M90 1;  5AN9 F;  3VB9 A;  2GTH A;  3IX0 A;  3CC4 Z;  3CXC Z;  1Z02 A;  4E30 A;  3G4S Z;  3CPW Z;  3S1M I;  1YJ9 1;  1NJI 1;  3Q87 A;  1VQ4 1;  1YJN Z;  3EED A;  2JUB A;  2IZ4 A;  3CD6 1;  2EGT A;  2NVY I;  2OZK A;  4A3F I;  1VLA A;  1NUI A;  4A3J I;  1W2B Z;  4E2Z A;  2VUG A;  5CM2 M;  3U50 C;  4A3I I;  5FLM I;  3S2D I;  2R92 I;  3HOV I;  4A3E I;  3KIF A;  1VQ9 1;  3M3Y I;  1VQ5 Z;  1WII A;  2QLV B;  2R7Z I;  2F4O A;  3CCE Z;  4A3M I;  1SFO I;  2QA4 1;  5LL6 f;  4AYB A;  3I56 1;  1USP A;  3CCS Z;  1KC8 1;  4X6A I;  5T6B A;  1JJ2 Y;  3JAM f;  2KI7 B;  3GTQ I;  4A3B I;  4RVG A;  3GKQ A;  4S1T A;  3G6E 1;  3GTP I;  2IZ3 A;  1S7M A;  1N8R 1;  3S15 I;  3I07 A;  3PO2 I;  3D9X A;  3M4O I;  2PK7 A;  1RLY A;  2YAD A;  4RVF A;  1TWC I;  2GTI A;  3GTO I;  1Y1W I;  2R6M A;  3T4N B;  3GTJ I;  3CCU 1;  4DQY B;  3J80 f;  2RPR A;  4MD9 A;  5C3E I;  3CCV 1;  2B63 I;  3S16 I;  3CCL 1;  2P28 A;  4BBR I;  4A3C I;  3CC4 1;  2RIQ A;  3G4S 1;  1Q82 1;  1YJN 1;  5IT9 f;  1QYP A;  2W03 A;  2QEX Z;  4RS4 A;  1KQS Z;  3PO3 S;  1M1K 2;  3F3P C;  5FLX f;  4NB9 A;  1Z01 A;  5T67 A;  4MRI A;  2M48 A;  1K8A 2;  1VQ5 1;  3P5J B;  3CCE 1;  3S17 I;  3GCF A;  1QVF Y;  1ZB8 A;  1VQP 1;  5IP7 I;  3FKI I;  4NBF A;  3TDH B;  2DE7 A;  2OOX B;  3GTM I;  3CQZ I;  3HOU I;  3CCU Z;  3CCQ Z;  4NOZ A;  4CL1 A;  3CCV Z;  1Q7Y 1;  3RZO I;  3CCL Z;  1VQM 1;  4E2Y A;  3S14 I;  4MON A;  2NVQ I;  3J81 f;  4MH4 A;  2J6A A;  3VMH A;  3VTN A;  3HOZ I;  3G71 1;  3NH4 A;  2DE5 A;  1TWH I;  1K83 I;  2E2H I;  4A3D I;  3H0G I;  3VMI A;  4E2X A;  1Q81 2;  1Y1V S;  2AKL A;  3NH5 A;  2K3R A;  1S72 Z;  4E32 A;  2R93 I;  1RNI A;  1ML8 A;  4NBG A;  3NFZ A;  4Y52 I;  3MZL B;  3I4N I;  1JJ2 Z;  1JWH C;  4NBB A;  1YJW Z;  1VQ6 1;  3RZD I;  5A2Q b;  1YI2 Z;  4NH1 C;  4RV9 A;  2QEX 1;  2QRC B;  3CXC Y;  2Q4Z A;  1VQP Z;  1K73 1;  3CPW Y;  1VQN Z;  4NBC A;  1K9M 1;  4NB8 A;  2M6N A;  3CCR Z;  1NP6 A;  2RBL A;  1KD1 2;  1VQM Z;  5C44 I;  2W04 A;  1WCM I;  1W2B Y;  2PMZ A;  2E9H A;  2JR6 A;  1QF8 A;  2G2K A;  3G71 Z;  4DK1 A;  1RO2 A;  3NDI A;  1QVG Z;  1RO0 A;  3CCQ 1;  3IF8 A;  1Y1V I;  2HF1 A;  1M90 2;  2QKD A;  3JAM b;  3CMA Z;  1TWG I;  3CME 1;  3S2H I;  2VF1 A;  1VQ6 Z;  4XX2 A;  3BG0 B;  3OW2 Z;  2V8K A;  3I4M I;  1NJI 2;  3FQM A;  2GU2 A;  4NBA A;  2NVX I;  2Y0S A;  2KPI A;  4E2W A;  1S72 1;  3FQQ A;  1X3Z A;  2JS4 A;  3MON A;  4E31 A;  1YHQ Z;  2P3Y A;  2OTJ Z;  2I3C A;  2Q51 A;  1PFT A;  4NBD A;  3J80 b;  1VQL 1;  1YJW 1;  1YUK A;  1N2F A;  1VQ7 1;  4BY1 I;  3S1R I;  3KIH A;  1YI2 1;  2JMO A;  2JA8 I;  1P9N A;  2V8I A;  2V8J A;  5D1P A;  2WB1 A;  1VQN 1;  1ZB9 A;  2JA7 I;  2JNY A;  2OTL 1;  1ZH1 A;  3CC7 Z;  1KC8 2;  3CCR 1;  5C4X I;  2QRD B;  1KQS Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...