3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
2E2HI 3HOVI 3S2HI 4NBAA 5C44I 2R7ZI 1ML8A 3S15I 5CM2M 1LQLA 4NBBA 2JS4A 3GTOI 2K5RA 1TWFI 1N2FA 2NVTI 4BY7I 2NVXI 3GTLI 3H3VJ 3H0GI 2BJOA 3GCFA 4BBSI 1QYPA 3HOUI 3EERA 3I07A 5C4JI 1X3ZA 2DE7A 2AKLA 4A3JI 3GTMS 5IP7I 4A3GI 1RLYA 4MH4A 4NBDA 2JA8I 4A3DI 2JA6I 1Y1VI 3FKII 3M4OI 4NBFA 5C4XI 2P3YA 3ESWA 4NOZA 1WW9A 1SFOI 4A3KI 1Y1WI 4X6AI 1USPB 2JA5I 3HOZI 3CQZI 3I4NI 1ZB9A 3GTMI 2JA7I 1TFIA 2JR6A 4NB8A 4A3BI 1VLAA 2JNYA 2KPIA 3GTKI 4QTUA 3D6WA 3S16I 4A3MI 2R93I 2NVYI 2VUMI 4Y52I 3RZDI 3S1QI 1L1OC 3PO3S 3VMHA 4A3CI 1Y1VS 3S2DI 4QTTA 1TWHI 4A93I 4NBCA 2RBLA 1USPA 3M3YI 4A3FI 1DL6A 4Y7NI 4A3II 2J6AA 3HOXI 4NBEA 1RO4A 2E2JI 3GTGI 3PO2I 1TWCI 1K83I 2R92I 3S17I 2DE5A 4BBRI 1ZB8A 4NBGA 3Q87A 5FLMI 3S1NI 3GTJI 1I6HI 2YU9I 5IP9I 1TWAI 5C3EI 3I4MI 1TWGI 3RZOI 1I50I 2E2II 3HOWI 2DE6A 3PO3I 2HF1A 3GTPI 3LUSA 4A3LI 2B63I 3VB9A 1R9TI 2F4OA 1YUAA 3K7AI 3S1RI 4A3EI 3VMGA 4BY1I 1I3QI 1X3WA 3HOYI 2NVQI 1PFTA 1NUIA 3VMIA 4NBHA 4BXXI 3S14I 3U50C 3GTQI 3S1MI 2F4MA 4NB9A 3GKQA 2PK7A 1WCMI 4XX2A
chains in the Genus database with same CATH superfamily
2E2HI 3HOVI 4MD7A 2V45A 1ML8A 1LQLA 5D1OA 2QRCB 3CCQZ 3CC71 3G6EZ 2NVTI 2OTLZ 3H0GI 3H3VJ 3GCFA 3NDJA 1QYPA 3HOUI 1WZNA 3CXCZ 2VPYA 1VQ61 3GTMS 3CMA1 5T6BA 1S72Z 1K8A1 1VQOZ 2JA6I 5C4XI 4MXUA 2P3YA 4RVDA 3CC2Z 1VQ81 3CCE1 3CD61 1KD11 1TFIA 2JR6A 4NB8A 3J81f 1VLAA 2JNYA 3JAMb 2V3VA 4QTUA 1M1K2 3D6WA 3KIHA 3S16I 4A3MI 2O4HA 3CCQ1 3CC7Z 1VQKZ 1RQFA 1Y1VS 1Z01A 3G6E1 4QTTA 4A93I 2RBLA 2OTL1 4Y7NI 5D1OB 2RT9A 2E2JI 1Z02A 3EEDA 1K83I 2JIOA 1RO2A 3JAMf 1Q16A 3CD6Z 3I4MI 1TWGI 4RV9A 1I50I 2E2II 2P28A 3FQQA 3MONA 3HOWI 2HF1A 3CCEZ 2QA41 4MONA 1Q861 2OZKA 5FLXb 2F4OA 3OW2Y 1WJ2A 3CC21 2PMZA 3F3PC 1YJ9Z 3G711 2V8JA 3CC4Z 2H85A 1KQSZ 4BY1I 4NFRA 2JMOA 4E33A 2VPZA 1YJWZ 3D2LA 2JIMA 1X3WA 1JJ2Z 1KD12 3CCS1 2NVQI 4E2WA 3QWUA 2YADA 3TDHB 1PFTA 3VMIA 3CXCY 3CPWY 2M6NA 1WIIA 2IV2X 2GTIA 1VQL1 4XX2A 1VQLZ 5C44I 3CCJZ 4EWCA 5IT9b 2JS4A 2E7ZA 2VPWA 3CCJ1 1TWFI 1N2FA 4BY7I 3GTLI 1QXFA 3NH4A 3EERA 3I07A 1M901 2LIYA 1YHQ1 1M1K1 4A3JI 2NAPA 1Z03A 2JA8I 2Q4ZA 4NBDA 3IFUA 1VQ9Z 1Y1VI 3FKII 3CCMZ 3ESWA 1M902 4E2XA 4E31A 1YUKA 3GTMI 2JA7I 4A3BI 4RVFA 1SIWA 4MD8A 1N8R1 2NVYI 4Y52I 2G2KA 5AN9F 4A3CI 1RO0A 3MZLB 1NP6A 1TWHI 2VPXA 1YJN1 1RO4A 3PO2I 2R92I 3S17I 1YJNZ 1YJW1 2DE5A 1ZB8A 3Q87A 5FLMI 4HGYA 3S1NI 3GTJI 2OOXB 1I6HI 1Q7Y2 3RZOI 3IR7A 3IX0A 1QVGZ 3PO3I 3FQMA 4A3LI 2B63I 2VUGA 2E9HA 3CCRZ 2KI7B 1YUAA 3NFZA 3S1RI 1QF8A 3VMGA 4E2YA 1RNIA 4RVHA 4E32A 1NUIA 2V8KA 2HU9A 1ZH1A 3CCM1 2EGTA 3IF8A 1X0TA 3HKZA 3NDIA 4MRIA 5A2Qf 4NB9A 3GKQA 3CPWZ 3J80f 2QR1B 3CCU1 2JIRA 5FLXf 3CCV1 3CCUZ 3S2HI 2R7ZI 5CM2M 3GTOI 2BJOA 2OTJZ 5C4JI 4RS4A 2DE7A 2AKLA 1JWHC 4A3GI 1RLYA 4MH4A 4A3DI 2QKDA 4NOZA 4X6AI 3VTNA 4DGLA 2JA5I 4TNUA 3TE5B 3I4NI 3J7A4 3I55Z 3GTKI 1YIT1 2RPRA 1FDIA 3MZKB 3F3FC 2R93I 1YHQZ 2VUMI 3P5JB 4NH1C 1L1OC 3PO3S 3VMHA 2OOYB 3CCL1 2JIQA 2K3RA 2IZ4A 2JIPA 1USPA 1QVGY 3M3YI 4A3FI 3BG1B 1N8R2 3HOXI 4NBEA 3T4NB 1NJI1 2ZAEB 2IZ3A 3NH5A 4NBGA 2GU2A 2W03A 4E30A 2YU9I 1TWAI 2JUBA 2I3CA 4HGZA 1YI2Z 2DE6A 3GTPI 1VQM1 3LUSA 3I551 3G4SZ 1R9TI 2Q51A 1Q812 1QVFZ 3K7AI 2QEXZ 1VQPZ 4A3EI 1QVFY 1I3QI 1VQ91 2QREB 3HOYI 4E2ZA 2LEXA 3CCVZ 1KRLA 1K731 4NBHA 3CME1 4BXXI 1P9NA 1S7MA 3CMEZ 1KQSY 1KC82 1YI21 2RIQA 4NBAA 3I56Z 3S15I 4NBBA 2K5RA 1YITZ 2W04A 2Y0SA 5T67A 2NVXI 1Q821 3OW2Z 4BBSI 3G4S1 3J81b 2QEX1 1X3ZA 4DK1A 1YJ91 4S1TA 5IP7I 3CC41 3CCLZ 1Q862 3M4OI 4NBFA 3KIFA 1W2BY 1WW9A 1SFOI 4A3KI 1Y1WI 1USPB 3HOZI 3CQZI 1K9M2 4MD9A 1ZB9A 2GTHA 2KPIA 3BG0B 2OTJ1 1VQ5Z 3CCR1 1VQMZ 2VF1A 3RZDI 1K9M1 3S1QI 3S2DI 1VQ41 5IT9f 4NBCA 3J80b 1Q7Y1 1Y8CA 1DL6A 4A3II 2J6AA 4RVGA 1VQNZ 3GTGI 1TWCI 3G71Z 2M48A 2RHBA 4BBRI 5IP9I 5C3EI 4AYBA 2AYDA 1YIJZ 2WB1A 2QRDB 1Q822 1VQP1 2R6MA 1YIJ1 1W2BZ 1VQO1 1KC81 1VQK1 2PM9A 1K8A2 3NH8A 3VB9A 1VQ51 1VQ7Z 3D9XA 1AA6A 1VQ71 1VQ8Z 5A2Qb 4DQYB 1K732 1VQ6Z 3CMAZ 1NJI2 2QLVB 1S721 5T64A 4CL1A 5LL6f 1VQN1 4HH4A 1JJ2Y 2V8IA 3I561 2LFUA 3S14I 3U50C 1VQ4Z 3GTQI 2WAQA 2QA4Z 3S1MI 5D1PA 2F4MA 3CCSZ 1Q811 2PK7A 1WCMI 1FDOA 2O53A
chains in the Genus database with same CATH topology
2E2HI 3HOVI 4MD7A 1ML8A 1LQLA 5D1OA 2QRCB 3CCQZ 3CC71 3G6EZ 2NVTI 2OTLZ 3H0GI 3H3VJ 3GCFA 3NDJA 1QYPA 3HOUI 3CXCZ 1VQ61 3GTMS 3CMA1 5T6BA 1S72Z 1K8A1 1VQOZ 2JA6I 5C4XI 4MXUA 2P3YA 4RVDA 3CC2Z 1VQ81 3CCE1 3CD61 1KD11 1TFIA 2JR6A 4NB8A 3J81f 1VLAA 2JNYA 3JAMb 4QTUA 1M1K2 3D6WA 3KIHA 3S16I 4A3MI 2O4HA 3CCQ1 3CC7Z 1VQKZ 1RQFA 1Y1VS 1Z01A 3G6E1 4QTTA 4A93I 2RBLA 2OTL1 4Y7NI 5D1OB 2RT9A 2E2JI 1Z02A 3EEDA 1K83I 1RO2A 3JAMf 3CD6Z 3I4MI 1TWGI 4RV9A 1I50I 2E2II 2P28A 3FQQA 3MONA 3HOWI 2HF1A 3CCEZ 2QA41 4MONA 1Q861 2OZKA 5FLXb 2F4OA 3OW2Y 3CC21 2PMZA 3F3PC 1YJ9Z 3G711 2V8JA 3CC4Z 2H85A 1KQSZ 4BY1I 4NFRA 2JMOA 4E33A 1YJWZ 1X3WA 1JJ2Z 1KD12 3CCS1 2NVQI 4E2WA 3QWUA 2YADA 3TDHB 1PFTA 3VMIA 3CXCY 3CPWY 2M6NA 1WIIA 2GTIA 1VQL1 4XX2A 1VQLZ 5C44I 3CCJZ 4EWCA 5IT9b 2JS4A 3CCJ1 1TWFI 1N2FA 4BY7I 3GTLI 3NH4A 3EERA 3I07A 1M901 2LIYA 1YHQ1 1M1K1 4A3JI 1Z03A 2JA8I 2Q4ZA 4NBDA 3IFUA 1VQ9Z 1Y1VI 3FKII 3CCMZ 3ESWA 1M902 4E2XA 4E31A 1YUKA 3GTMI 2JA7I 4A3BI 4RVFA 4MD8A 1N8R1 2NVYI 4Y52I 2G2KA 5AN9F 4A3CI 1RO0A 3MZLB 1NP6A 1TWHI 1YJN1 1RO4A 3PO2I 2R92I 3S17I 1YJNZ 1YJW1 2DE5A 1ZB8A 3Q87A 5FLMI 4HGYA 3S1NI 3GTJI 2OOXB 1I6HI 1Q7Y2 3RZOI 1QVGZ 3IX0A 3PO3I 3FQMA 4A3LI 2B63I 2VUGA 2E9HA 3CCRZ 2KI7B 1YUAA 3NFZA 3S1RI 1QF8A 3VMGA 4E2YA 1RNIA 4RVHA 4E32A 1NUIA 2V8KA 2HU9A 1ZH1A 3CCM1 2EGTA 3IF8A 1X0TA 3HKZA 3NDIA 4MRIA 5A2Qf 4NB9A 3GKQA 3CPWZ 3J80f 2QR1B 3CCU1 5FLXf 3CCV1 3CCUZ 3S2HI 2R7ZI 5CM2M 3GTOI 2BJOA 2OTJZ 5C4JI 4RS4A 2DE7A 2AKLA 1JWHC 4A3GI 1RLYA 4MH4A 4A3DI 2QKDA 4NOZA 4X6AI 3VTNA 4DGLA 2JA5I 4TNUA 3TE5B 3I4NI 3J7A4 3I55Z 3GTKI 1YIT1 2RPRA 3MZKB 3F3FC 2R93I 1YHQZ 2VUMI 3P5JB 4NH1C 1L1OC 3PO3S 3VMHA 2OOYB 3CCL1 2K3RA 2IZ4A 1USPA 1QVGY 3M3YI 4A3FI 3BG1B 1N8R2 3HOXI 4NBEA 3T4NB 1NJI1 2ZAEB 2IZ3A 3NH5A 4NBGA 2GU2A 2W03A 4E30A 2YU9I 1TWAI 2JUBA 2I3CA 4HGZA 1YI2Z 2DE6A 3GTPI 1VQM1 3LUSA 3I551 3G4SZ 1R9TI 2Q51A 1Q812 1QVFZ 3K7AI 2QEXZ 1VQPZ 4A3EI 1QVFY 1I3QI 1VQ91 2QREB 3HOYI 4E2ZA 3CCVZ 1KRLA 1K731 4NBHA 3CME1 4BXXI 1P9NA 1S7MA 3CMEZ 1KQSY 1KC82 1YI21 2RIQA 4NBAA 3I56Z 3S15I 4NBBA 2K5RA 1YITZ 2W04A 2Y0SA 5T67A 2NVXI 1Q821 3OW2Z 4BBSI 3G4S1 3J81b 2QEX1 1X3ZA 4DK1A 1YJ91 4S1TA 5IP7I 3CC41 3CCLZ 1Q862 3M4OI 4NBFA 3KIFA 1W2BY 1WW9A 1SFOI 4A3KI 1Y1WI 1USPB 3HOZI 3CQZI 1K9M2 4MD9A 1ZB9A 2GTHA 2KPIA 3BG0B 2OTJ1 1VQ5Z 3CCR1 1VQMZ 2VF1A 3RZDI 1K9M1 3S1QI 3S2DI 1VQ41 5IT9f 4NBCA 3J80b 1Q7Y1 1DL6A 4A3II 2J6AA 4RVGA 1VQNZ 3GTGI 1TWCI 3G71Z 2M48A 2RHBA 4BBRI 5IP9I 5C3EI 4AYBA 1YIJZ 1Q822 2QRDB 2WB1A 1VQP1 2R6MA 1YIJ1 1W2BZ 1VQO1 1KC81 1VQK1 2PM9A 1K8A2 3NH8A 3VB9A 1VQ51 1VQ7Z 3D9XA 1VQ71 1VQ8Z 5A2Qb 4DQYB 1K732 1VQ6Z 3CMAZ 1NJI2 2QLVB 1S721 5T64A 4CL1A 5LL6f 1VQN1 4HH4A 1JJ2Y 2V8IA 3I561 2LFUA 3S14I 3U50C 1VQ4Z 3GTQI 2WAQA 2QA4Z 3S1MI 5D1PA 2F4MA 3CCSZ 1Q811 2PK7A 1WCMI 2O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  3HOV I;  3S2H I;  4NBA A;  5C44 I;  2R7Z I;  1ML8 A;  3S15 I;  5CM2 M;  1LQL A;  4NBB A;  2JS4 A;  3GTO I;  2K5R A;  1TWF I;  1N2F A;  2NVT I;  4BY7 I;  2NVX I;  3GTL I;  3H3V J;  3H0G I;  2BJO A;  3GCF A;  4BBS I;  1QYP A;  3HOU I;  3EER A;  3I07 A;  5C4J I;  1X3Z A;  2DE7 A;  2AKL A;  4A3J I;  3GTM S;  5IP7 I;  4A3G I;  1RLY A;  4MH4 A;  4NBD A;  2JA8 I;  4A3D I;  2JA6 I;  1Y1V I;  3FKI I;  3M4O I;  4NBF A;  5C4X I;  2P3Y A;  3ESW A;  4NOZ A;  1WW9 A;  1SFO I;  4A3K I;  1Y1W I;  4X6A I;  1USP B;  2JA5 I;  3HOZ I;  3CQZ I;  3I4N I;  1ZB9 A;  3GTM I;  2JA7 I;  1TFI A;  2JR6 A;  4NB8 A;  4A3B I;  1VLA A;  2JNY A;  2KPI A;  3GTK I;  4QTU A;  3D6W A;  3S16 I;  4A3M I;  2R93 I;  2NVY I;  2VUM I;  4Y52 I;  3RZD I;  3S1Q I;  1L1O C;  3PO3 S;  3VMH A;  4A3C I;  1Y1V S;  3S2D I;  4QTT A;  1TWH I;  4A93 I;  4NBC A;  2RBL A;  1USP A;  3M3Y I;  4A3F I;  1DL6 A;  4Y7N I;  4A3I I;  2J6A A;  3HOX I;  4NBE A;  1RO4 A;  2E2J I;  3GTG I;  3PO2 I;  1TWC I;  1K83 I;  2R92 I;  3S17 I;  2DE5 A;  4BBR I;  1ZB8 A;  4NBG A;  3Q87 A;  5FLM I;  3S1N I;  3GTJ I;  1I6H I;  2YU9 I;  5IP9 I;  1TWA I;  5C3E I;  3I4M I;  1TWG I;  3RZO I;  1I50 I;  2E2I I;  3HOW I;  2DE6 A;  3PO3 I;  2HF1 A;  3GTP I;  3LUS A;  4A3L I;  2B63 I;  3VB9 A;  1R9T I;  2F4O A;  1YUA A;  3K7A I;  3S1R I;  4A3E I;  3VMG A;  4BY1 I;  1I3Q I;  1X3W A;  3HOY I;  2NVQ I;  1PFT A;  1NUI A;  3VMI A;  4NBH A;  4BXX I;  3S14 I;  3U50 C;  3GTQ I;  3S1M I;  2F4M A;  4NB9 A;  3GKQ A;  2PK7 A;  1WCM I;  4XX2 A; 
#chains in the Genus database with same CATH topology
 2E2H I;  3HOV I;  4MD7 A;  2V45 A;  1ML8 A;  1LQL A;  5D1O A;  2QRC B;  3CCQ Z;  3CC7 1;  3G6E Z;  2NVT I;  2OTL Z;  3H0G I;  3H3V J;  3GCF A;  3NDJ A;  1QYP A;  3HOU I;  1WZN A;  3CXC Z;  2VPY A;  1VQ6 1;  3GTM S;  3CMA 1;  5T6B A;  1S72 Z;  1K8A 1;  1VQO Z;  2JA6 I;  5C4X I;  4MXU A;  2P3Y A;  4RVD A;  3CC2 Z;  1VQ8 1;  3CCE 1;  3CD6 1;  1KD1 1;  1TFI A;  2JR6 A;  4NB8 A;  3J81 f;  1VLA A;  2JNY A;  3JAM b;  2V3V A;  4QTU A;  1M1K 2;  3D6W A;  3KIH A;  3S16 I;  4A3M I;  2O4H A;  3CCQ 1;  3CC7 Z;  1VQK Z;  1RQF A;  1Y1V S;  1Z01 A;  3G6E 1;  4QTT A;  4A93 I;  2RBL A;  2OTL 1;  4Y7N I;  5D1O B;  2RT9 A;  2E2J I;  1Z02 A;  3EED A;  1K83 I;  2JIO A;  1RO2 A;  3JAM f;  1Q16 A;  3CD6 Z;  3I4M I;  1TWG I;  4RV9 A;  1I50 I;  2E2I I;  2P28 A;  3FQQ A;  3MON A;  3HOW I;  2HF1 A;  3CCE Z;  2QA4 1;  4MON A;  1Q86 1;  2OZK A;  5FLX b;  2F4O A;  3OW2 Y;  1WJ2 A;  3CC2 1;  2PMZ A;  3F3P C;  1YJ9 Z;  3G71 1;  2V8J A;  3CC4 Z;  2H85 A;  1KQS Z;  4BY1 I;  4NFR A;  2JMO A;  4E33 A;  2VPZ A;  1YJW Z;  3D2L A;  2JIM A;  1X3W A;  1JJ2 Z;  1KD1 2;  3CCS 1;  2NVQ I;  4E2W A;  3QWU A;  2YAD A;  3TDH B;  1PFT A;  3VMI A;  3CXC Y;  3CPW Y;  2M6N A;  1WII A;  2IV2 X;  2GTI A;  1VQL 1;  4XX2 A;  1VQL Z;  5C44 I;  3CCJ Z;  4EWC A;  5IT9 b;  2JS4 A;  2E7Z A;  2VPW A;  3CCJ 1;  1TWF I;  1N2F A;  4BY7 I;  3GTL I;  1QXF A;  3NH4 A;  3EER A;  3I07 A;  1M90 1;  2LIY A;  1YHQ 1;  1M1K 1;  4A3J I;  2NAP A;  1Z03 A;  2JA8 I;  2Q4Z A;  4NBD A;  3IFU A;  1VQ9 Z;  1Y1V I;  3FKI I;  3CCM Z;  3ESW A;  1M90 2;  4E2X A;  4E31 A;  1YUK A;  3GTM I;  2JA7 I;  4A3B I;  4RVF A;  1SIW A;  4MD8 A;  1N8R 1;  2NVY I;  4Y52 I;  2G2K A;  5AN9 F;  4A3C I;  1RO0 A;  3MZL B;  1NP6 A;  1TWH I;  2VPX A;  1YJN 1;  1RO4 A;  3PO2 I;  2R92 I;  3S17 I;  1YJN Z;  1YJW 1;  2DE5 A;  1ZB8 A;  3Q87 A;  5FLM I;  4HGY A;  3S1N I;  3GTJ I;  2OOX B;  1I6H I;  1Q7Y 2;  3RZO I;  3IR7 A;  3IX0 A;  1QVG Z;  3PO3 I;  3FQM A;  4A3L I;  2B63 I;  2VUG A;  2E9H A;  3CCR Z;  2KI7 B;  1YUA A;  3NFZ A;  3S1R I;  1QF8 A;  3VMG A;  4E2Y A;  1RNI A;  4RVH A;  4E32 A;  1NUI A;  2V8K A;  2HU9 A;  1ZH1 A;  3CCM 1;  2EGT A;  3IF8 A;  1X0T A;  3HKZ A;  3NDI A;  4MRI A;  5A2Q f;  4NB9 A;  3GKQ A;  3CPW Z;  3J80 f;  2QR1 B;  3CCU 1;  2JIR A;  5FLX f;  3CCV 1;  3CCU Z;  3S2H I;  2R7Z I;  5CM2 M;  3GTO I;  2BJO A;  2OTJ Z;  5C4J I;  4RS4 A;  2DE7 A;  2AKL A;  1JWH C;  4A3G I;  1RLY A;  4MH4 A;  4A3D I;  2QKD A;  4NOZ A;  4X6A I;  3VTN A;  4DGL A;  2JA5 I;  4TNU A;  3TE5 B;  3I4N I;  3J7A 4;  3I55 Z;  3GTK I;  1YIT 1;  2RPR A;  1FDI A;  3MZK B;  3F3F C;  2R93 I;  1YHQ Z;  2VUM I;  3P5J B;  4NH1 C;  1L1O C;  3PO3 S;  3VMH A;  2OOY B;  3CCL 1;  2JIQ A;  2K3R A;  2IZ4 A;  2JIP A;  1USP A;  1QVG Y;  3M3Y I;  4A3F I;  3BG1 B;  1N8R 2;  3HOX I;  4NBE A;  3T4N B;  1NJI 1;  2ZAE B;  2IZ3 A;  3NH5 A;  4NBG A;  2GU2 A;  2W03 A;  4E30 A;  2YU9 I;  1TWA I;  2JUB A;  2I3C A;  4HGZ A;  1YI2 Z;  2DE6 A;  3GTP I;  1VQM 1;  3LUS A;  3I55 1;  3G4S Z;  1R9T I;  2Q51 A;  1Q81 2;  1QVF Z;  3K7A I;  2QEX Z;  1VQP Z;  4A3E I;  1QVF Y;  1I3Q I;  1VQ9 1;  2QRE B;  3HOY I;  4E2Z A;  2LEX A;  3CCV Z;  1KRL A;  1K73 1;  4NBH A;  3CME 1;  4BXX I;  1P9N A;  1S7M A;  3CME Z;  1KQS Y;  1KC8 2;  1YI2 1;  2RIQ A;  4NBA A;  3I56 Z;  3S15 I;  4NBB A;  2K5R A;  1YIT Z;  2W04 A;  2Y0S A;  5T67 A;  2NVX I;  1Q82 1;  3OW2 Z;  4BBS I;  3G4S 1;  3J81 b;  2QEX 1;  1X3Z A;  4DK1 A;  1YJ9 1;  4S1T A;  5IP7 I;  3CC4 1;  3CCL Z;  1Q86 2;  3M4O I;  4NBF A;  3KIF A;  1W2B Y;  1WW9 A;  1SFO I;  4A3K I;  1Y1W I;  1USP B;  3HOZ I;  3CQZ I;  1K9M 2;  4MD9 A;  1ZB9 A;  2GTH A;  2KPI A;  3BG0 B;  2OTJ 1;  1VQ5 Z;  3CCR 1;  1VQM Z;  2VF1 A;  3RZD I;  1K9M 1;  3S1Q I;  3S2D I;  1VQ4 1;  5IT9 f;  4NBC A;  3J80 b;  1Q7Y 1;  1Y8C A;  1DL6 A;  4A3I I;  2J6A A;  4RVG A;  1VQN Z;  3GTG I;  1TWC I;  3G71 Z;  2M48 A;  2RHB A;  4BBR I;  5IP9 I;  5C3E I;  4AYB A;  2AYD A;  1YIJ Z;  2WB1 A;  2QRD B;  1Q82 2;  1VQP 1;  2R6M A;  1YIJ 1;  1W2B Z;  1VQO 1;  1KC8 1;  1VQK 1;  2PM9 A;  1K8A 2;  3NH8 A;  3VB9 A;  1VQ5 1;  1VQ7 Z;  3D9X A;  1AA6 A;  1VQ7 1;  1VQ8 Z;  5A2Q b;  4DQY B;  1K73 2;  1VQ6 Z;  3CMA Z;  1NJI 2;  2QLV B;  1S72 1;  5T64 A;  4CL1 A;  5LL6 f;  1VQN 1;  4HH4 A;  1JJ2 Y;  2V8I A;  3I56 1;  2LFU A;  3S14 I;  3U50 C;  1VQ4 Z;  3GTQ I;  2WAQ A;  2QA4 Z;  3S1M I;  5D1P A;  2F4M A;  3CCS Z;  1Q81 1;  2PK7 A;  1WCM I;  1FDO A;  2O53 A; 
#chains in the Genus database with same CATH homology
 2E2H I;  3HOV I;  4MD7 A;  1ML8 A;  1LQL A;  5D1O A;  2QRC B;  3CCQ Z;  3CC7 1;  3G6E Z;  2NVT I;  2OTL Z;  3H0G I;  3H3V J;  3GCF A;  3NDJ A;  1QYP A;  3HOU I;  3CXC Z;  1VQ6 1;  3GTM S;  3CMA 1;  5T6B A;  1S72 Z;  1K8A 1;  1VQO Z;  2JA6 I;  5C4X I;  4MXU A;  2P3Y A;  4RVD A;  3CC2 Z;  1VQ8 1;  3CCE 1;  3CD6 1;  1KD1 1;  1TFI A;  2JR6 A;  4NB8 A;  3J81 f;  1VLA A;  2JNY A;  3JAM b;  4QTU A;  1M1K 2;  3D6W A;  3KIH A;  3S16 I;  4A3M I;  2O4H A;  3CCQ 1;  3CC7 Z;  1VQK Z;  1RQF A;  1Y1V S;  1Z01 A;  3G6E 1;  4QTT A;  4A93 I;  2RBL A;  2OTL 1;  4Y7N I;  5D1O B;  2RT9 A;  2E2J I;  1Z02 A;  3EED A;  1K83 I;  1RO2 A;  3JAM f;  3CD6 Z;  3I4M I;  1TWG I;  4RV9 A;  1I50 I;  2E2I I;  2P28 A;  3FQQ A;  3MON A;  3HOW I;  2HF1 A;  3CCE Z;  2QA4 1;  4MON A;  1Q86 1;  2OZK A;  5FLX b;  2F4O A;  3OW2 Y;  3CC2 1;  2PMZ A;  3F3P C;  1YJ9 Z;  3G71 1;  2V8J A;  3CC4 Z;  2H85 A;  1KQS Z;  4BY1 I;  4NFR A;  2JMO A;  4E33 A;  1YJW Z;  1X3W A;  1JJ2 Z;  1KD1 2;  3CCS 1;  2NVQ I;  4E2W A;  3QWU A;  2YAD A;  3TDH B;  1PFT A;  3VMI A;  3CXC Y;  3CPW Y;  2M6N A;  1WII A;  2GTI A;  1VQL 1;  4XX2 A;  1VQL Z;  5C44 I;  3CCJ Z;  4EWC A;  5IT9 b;  2JS4 A;  3CCJ 1;  1TWF I;  1N2F A;  4BY7 I;  3GTL I;  3NH4 A;  3EER A;  3I07 A;  1M90 1;  2LIY A;  1YHQ 1;  1M1K 1;  4A3J I;  1Z03 A;  2JA8 I;  2Q4Z A;  4NBD A;  3IFU A;  1VQ9 Z;  1Y1V I;  3FKI I;  3CCM Z;  3ESW A;  1M90 2;  4E2X A;  4E31 A;  1YUK A;  3GTM I;  2JA7 I;  4A3B I;  4RVF A;  4MD8 A;  1N8R 1;  2NVY I;  4Y52 I;  2G2K A;  5AN9 F;  4A3C I;  1RO0 A;  3MZL B;  1NP6 A;  1TWH I;  1YJN 1;  1RO4 A;  3PO2 I;  2R92 I;  3S17 I;  1YJN Z;  1YJW 1;  2DE5 A;  1ZB8 A;  3Q87 A;  5FLM I;  4HGY A;  3S1N I;  3GTJ I;  2OOX B;  1I6H I;  1Q7Y 2;  3RZO I;  1QVG Z;  3IX0 A;  3PO3 I;  3FQM A;  4A3L I;  2B63 I;  2VUG A;  2E9H A;  3CCR Z;  2KI7 B;  1YUA A;  3NFZ A;  3S1R I;  1QF8 A;  3VMG A;  4E2Y A;  1RNI A;  4RVH A;  4E32 A;  1NUI A;  2V8K A;  2HU9 A;  1ZH1 A;  3CCM 1;  2EGT A;  3IF8 A;  1X0T A;  3HKZ A;  3NDI A;  4MRI A;  5A2Q f;  4NB9 A;  3GKQ A;  3CPW Z;  3J80 f;  2QR1 B;  3CCU 1;  5FLX f;  3CCV 1;  3CCU Z;  3S2H I;  2R7Z I;  5CM2 M;  3GTO I;  2BJO A;  2OTJ Z;  5C4J I;  4RS4 A;  2DE7 A;  2AKL A;  1JWH C;  4A3G I;  1RLY A;  4MH4 A;  4A3D I;  2QKD A;  4NOZ A;  4X6A I;  3VTN A;  4DGL A;  2JA5 I;  4TNU A;  3TE5 B;  3I4N I;  3J7A 4;  3I55 Z;  3GTK I;  1YIT 1;  2RPR A;  3MZK B;  3F3F C;  2R93 I;  1YHQ Z;  2VUM I;  3P5J B;  4NH1 C;  1L1O C;  3PO3 S;  3VMH A;  2OOY B;  3CCL 1;  2K3R A;  2IZ4 A;  1USP A;  1QVG Y;  3M3Y I;  4A3F I;  3BG1 B;  1N8R 2;  3HOX I;  4NBE A;  3T4N B;  1NJI 1;  2ZAE B;  2IZ3 A;  3NH5 A;  4NBG A;  2GU2 A;  2W03 A;  4E30 A;  2YU9 I;  1TWA I;  2JUB A;  2I3C A;  4HGZ A;  1YI2 Z;  2DE6 A;  3GTP I;  1VQM 1;  3LUS A;  3I55 1;  3G4S Z;  1R9T I;  2Q51 A;  1Q81 2;  1QVF Z;  3K7A I;  2QEX Z;  1VQP Z;  4A3E I;  1QVF Y;  1I3Q I;  1VQ9 1;  2QRE B;  3HOY I;  4E2Z A;  3CCV Z;  1KRL A;  1K73 1;  4NBH A;  3CME 1;  4BXX I;  1P9N A;  1S7M A;  3CME Z;  1KQS Y;  1KC8 2;  1YI2 1;  2RIQ A;  4NBA A;  3I56 Z;  3S15 I;  4NBB A;  2K5R A;  1YIT Z;  2W04 A;  2Y0S A;  5T67 A;  2NVX I;  1Q82 1;  3OW2 Z;  4BBS I;  3G4S 1;  3J81 b;  2QEX 1;  1X3Z A;  4DK1 A;  1YJ9 1;  4S1T A;  5IP7 I;  3CC4 1;  3CCL Z;  1Q86 2;  3M4O I;  4NBF A;  3KIF A;  1W2B Y;  1WW9 A;  1SFO I;  4A3K I;  1Y1W I;  1USP B;  3HOZ I;  3CQZ I;  1K9M 2;  4MD9 A;  1ZB9 A;  2GTH A;  2KPI A;  3BG0 B;  2OTJ 1;  1VQ5 Z;  3CCR 1;  1VQM Z;  2VF1 A;  3RZD I;  1K9M 1;  3S1Q I;  3S2D I;  1VQ4 1;  5IT9 f;  4NBC A;  3J80 b;  1Q7Y 1;  1DL6 A;  4A3I I;  2J6A A;  4RVG A;  1VQN Z;  3GTG I;  1TWC I;  3G71 Z;  2M48 A;  2RHB A;  4BBR I;  5IP9 I;  5C3E I;  4AYB A;  1YIJ Z;  1Q82 2;  2QRD B;  2WB1 A;  1VQP 1;  2R6M A;  1YIJ 1;  1W2B Z;  1VQO 1;  1KC8 1;  1VQK 1;  2PM9 A;  1K8A 2;  3NH8 A;  3VB9 A;  1VQ5 1;  1VQ7 Z;  3D9X A;  1VQ7 1;  1VQ8 Z;  5A2Q b;  4DQY B;  1K73 2;  1VQ6 Z;  3CMA Z;  1NJI 2;  2QLV B;  1S72 1;  5T64 A;  4CL1 A;  5LL6 f;  1VQN 1;  4HH4 A;  1JJ2 Y;  2V8I A;  3I56 1;  2LFU A;  3S14 I;  3U50 C;  1VQ4 Z;  3GTQ I;  2WAQ A;  2QA4 Z;  3S1M I;  5D1P A;  2F4M A;  3CCS Z;  1Q81 1;  2PK7 A;  1WCM I;  2O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...