3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
1VLAA 3GTOI 3PO3I 3VMHA 4A3CI 1QYPA 4X6AI 3S14I 4BY1I 3HOXI 3S17I 3Q87A 5C44I 5FLMI 2VUMI 3H0GI 2K5RA 1Y1VS 3GTPI 2E2JI 1I6HI 3GKQA 3RZDI 1RO4A 4A3DI 2R93I 5C4JI 3GTMS 3VMGA 2R7ZI 4A3MI 2E2HI 3H3VJ 4QTUA 1PFTA 3S1NI 3RZOI 2PK7A 4NBAA 1WW9A 1TWAI 3K7AI 2NVYI 2NVTI 1I50I 3VB9A 3S15I 1DL6A 1TWGI 1K83I 4A3FI 1TWFI 1X3WA 4A3LI 3I07A 4NBGA 1Y1WI 4A93I 4NBHA 4BY7I 1RLYA 3GTLI 5C3EI 2J6AA 2B63I 1ML8A 4A3II 3S1RI 1USPB 3ESWA 1USPA 2YU9I 1ZB8A 2HF1A 4BBRI 2JNYA 4A3JI 1N2FA 4NB9A 5C4XI 4A3KI 1X3ZA 4BXXI 1I3QI 3FKII 3HOUI 4A3BI 3GCFA 2NVXI 5IP7I 2JA8I 3U50C 4MH4A 1TWCI 2DE7A 2AKLA 1YUAA 2KPIA 2JA5I 1TWHI 3PO3S 1Y1VI 4NBDA 5CM2M 3M3YI 3GTJI 2DE6A 2JS4A 4NBBA 3D6WA 1L1OC 4Y7NI 3GTQI 4A3EI 3HOZI 4NB8A 1LQLA 3HOYI 3S1MI 3LUSA 4NBEA 3S16I 1ZB9A 3CQZI 4A3GI 2JR6A 1NUIA 2JA6I 3S2DI 1TFIA 3GTGI 2BJOA 3EERA 4BBSI 2F4MA 1R9TI 2NVQI 3I4MI 3PO2I 3HOVI 2P3YA 2R92I 4XX2A 4NBFA 3S2HI 3S1QI 2DE5A 1WCMI 4NBCA 3GTMI 5IP9I 2E2II 3GTKI 4QTTA 1SFOI 2JA7I 3VMIA 4Y52I 2F4OA 3I4NI 3HOWI 2RBLA 3M4OI 4NOZA
chains in the Genus database with same CATH superfamily
1K8A2 2RPRA 1W2BY 1RO0A 1YJWZ 4X6AI 1Q16A 3CCVZ 2LEXA 3CC7Z 1KD12 5FLMI 3CC21 1K732 1KRLA 4E2XA 3RZDI 2R93I 2IV2X 3GTMS 1VQ6Z 2E2HI 2PM9A 1Q822 1K9M1 4HH4A 3RZOI 1VQ81 3CCR1 1JJ2Z 1WW9A 1I50I 3NFZA 3S15I 3J81f 3CC2Z 1K8A1 1X3WA 1Y1WI 4NBGA 2VPYA 3CMA1 3JAMf 4RVGA 2G2KA 2VUGA 2B63I 1ML8A 2YU9I 1K731 1VQ8Z 3CCRZ 4NB9A 4RV9A 1VQL1 5C4XI 2H85A 3HOUI 2NVXI 5IP7I 2JA8I 3U50C 1Z01A 4MH4A 1Q821 2GTIA 3CMAZ 1KQSZ 1VQK1 5FLXb 1S7MA 5CM2M 2JS4A 4NBBA 4S1TA 1Q812 3NH8A 1AA6A 4A3EI 1VQ51 1LQLA 1VQLZ 2Y0SA 1QVGY 2QRDB 3HOYI 3CCL1 3S16I 3CQZI 1VQKZ 1NUIA 2JA6I 3S2DI 1TFIA 3EERA 2VPWA 3I4MI 2NVQI 2JIMA 4MRIA 2E7ZA 2P3YA 3BG0B 1VQ5Z 2Q51A 5A2Qf 3S1QI 2GTHA 3CCLZ 3TDHB 2E2II 1SFOI 2JA7I 1JJ2Y 4MD7A 3HOWI 3CCS1 1YJ91 2VF1A 1QXFA 1VLAA 1VQ4Z 3J7A4 1JWHC 4A3CI 1QYPA 4BY1I 3S17I 2VUMI 2K5RA 3J80f 1QF8A 3GTPI 1NJI2 1I6HI 4AYBA 3CCSZ 3GKQA 1RO4A 1YJ9Z 4A3DI 2JIPA 3I561 3NDJA 4QTUA 4E32A 1PFTA 4EWCA 3FQMA 3NDIA 3MZLB 1KQSY 4HGYA 2PK7A 2EGTA 2LFUA 2NVYI 3NH5A 3P5JB 1TWGI 2WB1A 1S721 1TWFI 2V8IA 3I07A 4BY7I 3FQQA 2YADA 3I56Z 5C3EI 3IR7A 3ESWA 2JIQA 4BBRI 2Q4ZA 2RIQA 1NJI1 1RO2A 1X3ZA 1I3QI 3G711 1S72Z 2DE7A 2AKLA 2JA5I 3PO3S 4RVFA 1WIIA 2M48A 4NBDA 5T64A 3CCJ1 2DE6A 3MZKB 1Q862 3I551 2V8JA 3S1MI 4NH1C 4NBEA 1VQ61 1ZB9A 2O53A 4A3GI 2KI7B 1QVFZ 2F4MA 3PO2I 3T4NB 3HOVI 3CCJZ 4TNUA 3I55Z 3CCU1 2V8KA 2R92I 1VQ91 4NBFA 5AN9F 3IFUA 2DE5A 1WCMI 4NBCA 3GTMI 2JUBA 4MONA 4Y52I 1Y8CA 2F4OA 1Q861 1M1K1 1RQFA 5IT9f 2R6MA 3GTOI 3PO3I 2K3RA 2RHBA 3CPWZ 3CCUZ 1VQM1 3CD61 1VQ9Z 3HOXI 3IX0A 5C44I 2QREB 5D1PA 3H0GI 2E2JI 3J81b 2QA41 5C4JI 3G6E1 4A3MI 3JAMb 3CME1 3S1NI 1VQMZ 1VQP1 4NBAA 3K7AI 4E31A 1DL6A 2ZAEB 2HU9A 3F3FC 4A3LI 4MD8A 2AYDA 2QA4Z 4E2ZA 3CCM1 3CXCZ 1VQO1 2J6AA 3BG1B 3G6EZ 3KIFA 3S1RI 1USPB 1USPA 1NP6A 3CMEZ 3VTNA 2HF1A 1YIT1 1VQPZ 1N2FA 1QVFY 4E33A 4BXXI 3G4S1 1ZH1A 2JIRA 3IF8A 1YIJ1 3CC71 3CCMZ 1VQOZ 2QKDA 1N8R2 1Z03A 3GTJI 3D6WA 1L1OC 1YITZ 3TE5B 2O4HA 3QWUA 5FLXf 3G4SZ 2V45A 3LUSA 3CPWY 5A2Qb 2JR6A 3GTGI 2BJOA 3D9XA 2WAQA 2QR1B 4XX2A 1RNIA 2P28A 2JMOA 1N8R1 1M1K2 4QTTA 1VQN1 2QRCB 3G71Z 3OW2Y 3M4OI 3J80b 5LL6f 1FDIA 4NOZA 1YI21 3NH4A 3VMHA 1YJN1 2IZ4A 2NAPA 3CXCY 3S14I 3Q87A 4E2YA 2LIYA 1X0TA 1Y1VS 1VQNZ 1KD11 2OOYB 2GU2A 3VMGA 2R7ZI 4E30A 1YI2Z 1VQ71 3H3VJ 4DK1A 5T6BA 1WJ2A 2JIOA 1YUKA 2E9HA 1YJNZ 2OOXB 1TWAI 4MD9A 4DGLA 1KC82 2NVTI 3VB9A 5D1OB 1K83I 5D1OA 5T67A 4A3FI 2RT9A 1W2BZ 3D2LA 2W03A 4A93I 2OZKA 2V3VA 4NBHA 2I3CA 1RLYA 3GTLI 4HGZA 4RS4A 3CCQ1 3MONA 1VQ7Z 4A3II 2OTJ1 1YHQ1 1ZB8A 4MXUA 2JNYA 4A3JI 2W04A 1FDOA 4A3KI 1Z02A 2OTL1 2QEX1 4E2WA 3FKII 2VPXA 4A3BI 3GCFA 3OW2Z 3CD6Z 4DQYB 1TWCI 1YUAA 2KPIA 1TWHI 1VQ41 3CCQZ 1Y1VI 1KC81 3CC41 2OTJZ 2M6NA 3M3YI 3KIHA 1YHQZ 2PMZA 4Y7NI 3GTQI 3HOZI 4NB8A 1Q7Y2 1M902 2OTLZ 3HKZA 1Q811 2QEXZ 2IZ3A 3EEDA 4NFRA 4CL1A 1SIWA 1P9NA 4BBSI 1WZNA 1R9TI 3CCE1 3CC4Z 5IT9b 1YJW1 4RVHA 3S2HI 3CCV1 1K9M2 5IP9I 2QLVB 3GTKI 3VMIA 2VPZA 3I4NI 2RBLA 1Q7Y1 1QVGZ 3CCEZ 1M901 1YIJZ 4RVDA 3F3PC
chains in the Genus database with same CATH topology
1K8A2 2RPRA 1W2BY 1RO0A 1YJWZ 4X6AI 3CCVZ 1KD12 5FLMI 3CC21 1K732 1KRLA 4E2XA 3RZDI 2R93I 3GTMS 1VQ6Z 2E2HI 2PM9A 1Q822 1K9M1 4HH4A 3RZOI 1VQ81 3CCR1 1JJ2Z 1WW9A 1I50I 3NFZA 3S15I 3J81f 3CC2Z 1K8A1 1X3WA 1Y1WI 4NBGA 3CMA1 3JAMf 4RVGA 2G2KA 2VUGA 2B63I 1ML8A 2YU9I 1K731 1VQ8Z 3CCRZ 4NB9A 4RV9A 1VQL1 5C4XI 2H85A 3HOUI 2NVXI 5IP7I 2JA8I 3U50C 1Z01A 4MH4A 1Q821 2GTIA 3CMAZ 1KQSZ 1VQK1 5FLXb 1S7MA 5CM2M 2JS4A 4NBBA 4S1TA 1Q812 3NH8A 4A3EI 1VQ51 1LQLA 1VQLZ 2Y0SA 1QVGY 2QRDB 3HOYI 3CCL1 3S16I 3CQZI 1VQKZ 1NUIA 2JA6I 3S2DI 1TFIA 3EERA 3I4MI 2NVQI 4MRIA 2P3YA 3BG0B 1VQ5Z 2Q51A 5A2Qf 3S1QI 2GTHA 3CCLZ 3TDHB 2E2II 1SFOI 2JA7I 1JJ2Y 4MD7A 3HOWI 3CCS1 1YJ91 2VF1A 1VLAA 1VQ4Z 3J7A4 1JWHC 4A3CI 1QYPA 4BY1I 3S17I 2VUMI 2K5RA 3J80f 1QF8A 3GTPI 1NJI2 1I6HI 4AYBA 3CCSZ 3GKQA 1RO4A 1YJ9Z 4A3DI 3I561 3NDJA 4QTUA 4E32A 1PFTA 4EWCA 3FQMA 3NDIA 3MZLB 1KQSY 4HGYA 2PK7A 2EGTA 2LFUA 2NVYI 3NH5A 3P5JB 1TWGI 2WB1A 1S721 1TWFI 2V8IA 3I07A 4BY7I 3FQQA 2YADA 3I56Z 5C3EI 3ESWA 4BBRI 2Q4ZA 2RIQA 1NJI1 1RO2A 1X3ZA 1I3QI 3G711 1S72Z 2DE7A 2AKLA 2JA5I 3PO3S 4RVFA 1WIIA 2M48A 4NBDA 5T64A 3CCJ1 2DE6A 3MZKB 1Q862 3I551 2V8JA 3S1MI 4NH1C 4NBEA 4RVDA 1VQ61 1ZB9A 2O53A 4A3GI 2KI7B 1QVFZ 2F4MA 3PO2I 3T4NB 3HOVI 3CCJZ 4TNUA 3I55Z 3CCU1 2V8KA 2R92I 1VQ91 4NBFA 5AN9F 3IFUA 2DE5A 1WCMI 4NBCA 3GTMI 2JUBA 4MONA 4Y52I 2F4OA 1Q861 1M1K1 1RQFA 5IT9f 2R6MA 3GTOI 3PO3I 2K3RA 2RHBA 3CPWZ 3CCUZ 1VQM1 3CD61 1VQ9Z 3HOXI 3IX0A 5C44I 2QREB 5D1PA 3H0GI 2E2JI 3J81b 2QA41 5C4JI 3G6E1 4A3MI 3JAMb 3CME1 3S1NI 1VQMZ 1VQP1 4NBAA 3K7AI 4E31A 1DL6A 2ZAEB 2HU9A 3F3FC 4A3LI 4MD8A 2QA4Z 4E2ZA 3CCM1 3CXCZ 1VQO1 2J6AA 3BG1B 3G6EZ 3KIFA 3S1RI 1USPB 1USPA 1NP6A 3CMEZ 3VTNA 2HF1A 1YIT1 1VQPZ 1N2FA 1QVFY 4E33A 4BXXI 3G4S1 1ZH1A 3IF8A 1YIJ1 3CC71 3CCMZ 1VQOZ 2QKDA 1N8R2 1Z03A 3GTJI 3D6WA 1L1OC 1YITZ 3TE5B 2O4HA 3QWUA 5FLXf 3G4SZ 3LUSA 3CPWY 5A2Qb 2JR6A 3GTGI 2BJOA 3D9XA 2WAQA 2QR1B 4XX2A 1RNIA 2P28A 2JMOA 1N8R1 1M1K2 4QTTA 1VQN1 2QRCB 3G71Z 3OW2Y 3M4OI 3J80b 5LL6f 4NOZA 1YI21 3NH4A 3VMHA 1YJN1 2IZ4A 3CXCY 3S14I 3Q87A 4E2YA 2LIYA 1X0TA 1Y1VS 1VQNZ 1KD11 2OOYB 2GU2A 3VMGA 2R7ZI 4E30A 1YI2Z 1VQ71 3H3VJ 4DK1A 5T6BA 1YUKA 2E9HA 1YJNZ 2OOXB 1TWAI 4MD9A 4DGLA 1KC82 2NVTI 3VB9A 5D1OB 1K83I 5D1OA 5T67A 4A3FI 2RT9A 1W2BZ 2W03A 4A93I 2OZKA 4NBHA 2I3CA 1RLYA 3GTLI 4HGZA 4RS4A 3CCQ1 3MONA 1VQ7Z 4A3II 2OTJ1 1YHQ1 1ZB8A 4MXUA 2JNYA 4A3JI 2W04A 4A3KI 1Z02A 2OTL1 2QEX1 4E2WA 3FKII 4A3BI 3GCFA 3OW2Z 3CD6Z 4DQYB 1TWCI 1YUAA 2KPIA 1TWHI 1VQ41 3CCQZ 1Y1VI 1KC81 3CC41 2OTJZ 2M6NA 3M3YI 3KIHA 1YHQZ 2PMZA 4Y7NI 3GTQI 3HOZI 4NB8A 1Q7Y2 1M902 2OTLZ 3HKZA 1Q811 2QEXZ 2IZ3A 3EEDA 4NFRA 4CL1A 1P9NA 4BBSI 1R9TI 3CCE1 3CC4Z 5IT9b 1YJW1 4RVHA 3S2HI 3CCV1 1K9M2 5IP9I 2QLVB 3GTKI 3VMIA 3I4NI 2RBLA 1Q7Y1 1QVGZ 3CCEZ 1M901 1YIJZ 3CC7Z 3F3PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  3GTO I;  3PO3 I;  3VMH A;  4A3C I;  1QYP A;  4X6A I;  3S14 I;  4BY1 I;  3HOX I;  3S17 I;  3Q87 A;  5C44 I;  5FLM I;  2VUM I;  3H0G I;  2K5R A;  1Y1V S;  3GTP I;  2E2J I;  1I6H I;  3GKQ A;  3RZD I;  1RO4 A;  4A3D I;  2R93 I;  5C4J I;  3GTM S;  3VMG A;  2R7Z I;  4A3M I;  2E2H I;  3H3V J;  4QTU A;  1PFT A;  3S1N I;  3RZO I;  2PK7 A;  4NBA A;  1WW9 A;  1TWA I;  3K7A I;  2NVY I;  2NVT I;  1I50 I;  3VB9 A;  3S15 I;  1DL6 A;  1TWG I;  1K83 I;  4A3F I;  1TWF I;  1X3W A;  4A3L I;  3I07 A;  4NBG A;  1Y1W I;  4A93 I;  4NBH A;  4BY7 I;  1RLY A;  3GTL I;  5C3E I;  2J6A A;  2B63 I;  1ML8 A;  4A3I I;  3S1R I;  1USP B;  3ESW A;  1USP A;  2YU9 I;  1ZB8 A;  2HF1 A;  4BBR I;  2JNY A;  4A3J I;  1N2F A;  4NB9 A;  5C4X I;  4A3K I;  1X3Z A;  4BXX I;  1I3Q I;  3FKI I;  3HOU I;  4A3B I;  3GCF A;  2NVX I;  5IP7 I;  2JA8 I;  3U50 C;  4MH4 A;  1TWC I;  2DE7 A;  2AKL A;  1YUA A;  2KPI A;  2JA5 I;  1TWH I;  3PO3 S;  1Y1V I;  4NBD A;  5CM2 M;  3M3Y I;  3GTJ I;  2DE6 A;  2JS4 A;  4NBB A;  3D6W A;  1L1O C;  4Y7N I;  3GTQ I;  4A3E I;  3HOZ I;  4NB8 A;  1LQL A;  3HOY I;  3S1M I;  3LUS A;  4NBE A;  3S16 I;  1ZB9 A;  3CQZ I;  4A3G I;  2JR6 A;  1NUI A;  2JA6 I;  3S2D I;  1TFI A;  3GTG I;  2BJO A;  3EER A;  4BBS I;  2F4M A;  1R9T I;  2NVQ I;  3I4M I;  3PO2 I;  3HOV I;  2P3Y A;  2R92 I;  4XX2 A;  4NBF A;  3S2H I;  3S1Q I;  2DE5 A;  1WCM I;  4NBC A;  3GTM I;  5IP9 I;  2E2I I;  3GTK I;  4QTT A;  1SFO I;  2JA7 I;  3VMI A;  4Y52 I;  2F4O A;  3I4N I;  3HOW I;  2RBL A;  3M4O I;  4NOZ A; 
#chains in the Genus database with same CATH topology
 1K8A 2;  2RPR A;  1W2B Y;  1RO0 A;  1YJW Z;  4X6A I;  1Q16 A;  3CCV Z;  2LEX A;  3CC7 Z;  1KD1 2;  5FLM I;  3CC2 1;  1K73 2;  1KRL A;  4E2X A;  3RZD I;  2R93 I;  2IV2 X;  3GTM S;  1VQ6 Z;  2E2H I;  2PM9 A;  1Q82 2;  1K9M 1;  4HH4 A;  3RZO I;  1VQ8 1;  3CCR 1;  1JJ2 Z;  1WW9 A;  1I50 I;  3NFZ A;  3S15 I;  3J81 f;  3CC2 Z;  1K8A 1;  1X3W A;  1Y1W I;  4NBG A;  2VPY A;  3CMA 1;  3JAM f;  4RVG A;  2G2K A;  2VUG A;  2B63 I;  1ML8 A;  2YU9 I;  1K73 1;  1VQ8 Z;  3CCR Z;  4NB9 A;  4RV9 A;  1VQL 1;  5C4X I;  2H85 A;  3HOU I;  2NVX I;  5IP7 I;  2JA8 I;  3U50 C;  1Z01 A;  4MH4 A;  1Q82 1;  2GTI A;  3CMA Z;  1KQS Z;  1VQK 1;  5FLX b;  1S7M A;  5CM2 M;  2JS4 A;  4NBB A;  4S1T A;  1Q81 2;  3NH8 A;  1AA6 A;  4A3E I;  1VQ5 1;  1LQL A;  1VQL Z;  2Y0S A;  1QVG Y;  2QRD B;  3HOY I;  3CCL 1;  3S16 I;  3CQZ I;  1VQK Z;  1NUI A;  2JA6 I;  3S2D I;  1TFI A;  3EER A;  2VPW A;  3I4M I;  2NVQ I;  2JIM A;  4MRI A;  2E7Z A;  2P3Y A;  3BG0 B;  1VQ5 Z;  2Q51 A;  5A2Q f;  3S1Q I;  2GTH A;  3CCL Z;  3TDH B;  2E2I I;  1SFO I;  2JA7 I;  1JJ2 Y;  4MD7 A;  3HOW I;  3CCS 1;  1YJ9 1;  2VF1 A;  1QXF A;  1VLA A;  1VQ4 Z;  3J7A 4;  1JWH C;  4A3C I;  1QYP A;  4BY1 I;  3S17 I;  2VUM I;  2K5R A;  3J80 f;  1QF8 A;  3GTP I;  1NJI 2;  1I6H I;  4AYB A;  3CCS Z;  3GKQ A;  1RO4 A;  1YJ9 Z;  4A3D I;  2JIP A;  3I56 1;  3NDJ A;  4QTU A;  4E32 A;  1PFT A;  4EWC A;  3FQM A;  3NDI A;  3MZL B;  1KQS Y;  4HGY A;  2PK7 A;  2EGT A;  2LFU A;  2NVY I;  3NH5 A;  3P5J B;  1TWG I;  2WB1 A;  1S72 1;  1TWF I;  2V8I A;  3I07 A;  4BY7 I;  3FQQ A;  2YAD A;  3I56 Z;  5C3E I;  3IR7 A;  3ESW A;  2JIQ A;  4BBR I;  2Q4Z A;  2RIQ A;  1NJI 1;  1RO2 A;  1X3Z A;  1I3Q I;  3G71 1;  1S72 Z;  2DE7 A;  2AKL A;  2JA5 I;  3PO3 S;  4RVF A;  1WII A;  2M48 A;  4NBD A;  5T64 A;  3CCJ 1;  2DE6 A;  3MZK B;  1Q86 2;  3I55 1;  2V8J A;  3S1M I;  4NH1 C;  4NBE A;  1VQ6 1;  1ZB9 A;  2O53 A;  4A3G I;  2KI7 B;  1QVF Z;  2F4M A;  3PO2 I;  3T4N B;  3HOV I;  3CCJ Z;  4TNU A;  3I55 Z;  3CCU 1;  2V8K A;  2R92 I;  1VQ9 1;  4NBF A;  5AN9 F;  3IFU A;  2DE5 A;  1WCM I;  4NBC A;  3GTM I;  2JUB A;  4MON A;  4Y52 I;  1Y8C A;  2F4O A;  1Q86 1;  1M1K 1;  1RQF A;  5IT9 f;  2R6M A;  3GTO I;  3PO3 I;  2K3R A;  2RHB A;  3CPW Z;  3CCU Z;  1VQM 1;  3CD6 1;  1VQ9 Z;  3HOX I;  3IX0 A;  5C44 I;  2QRE B;  5D1P A;  3H0G I;  2E2J I;  3J81 b;  2QA4 1;  5C4J I;  3G6E 1;  4A3M I;  3JAM b;  3CME 1;  3S1N I;  1VQM Z;  1VQP 1;  4NBA A;  3K7A I;  4E31 A;  1DL6 A;  2ZAE B;  2HU9 A;  3F3F C;  4A3L I;  4MD8 A;  2AYD A;  2QA4 Z;  4E2Z A;  3CCM 1;  3CXC Z;  1VQO 1;  2J6A A;  3BG1 B;  3G6E Z;  3KIF A;  3S1R I;  1USP B;  1USP A;  1NP6 A;  3CME Z;  3VTN A;  2HF1 A;  1YIT 1;  1VQP Z;  1N2F A;  1QVF Y;  4E33 A;  4BXX I;  3G4S 1;  1ZH1 A;  2JIR A;  3IF8 A;  1YIJ 1;  3CC7 1;  3CCM Z;  1VQO Z;  2QKD A;  1N8R 2;  1Z03 A;  3GTJ I;  3D6W A;  1L1O C;  1YIT Z;  3TE5 B;  2O4H A;  3QWU A;  5FLX f;  3G4S Z;  2V45 A;  3LUS A;  3CPW Y;  5A2Q b;  2JR6 A;  3GTG I;  2BJO A;  3D9X A;  2WAQ A;  2QR1 B;  4XX2 A;  1RNI A;  2P28 A;  2JMO A;  1N8R 1;  1M1K 2;  4QTT A;  1VQN 1;  2QRC B;  3G71 Z;  3OW2 Y;  3M4O I;  3J80 b;  5LL6 f;  1FDI A;  4NOZ A;  1YI2 1;  3NH4 A;  3VMH A;  1YJN 1;  2IZ4 A;  2NAP A;  3CXC Y;  3S14 I;  3Q87 A;  4E2Y A;  2LIY A;  1X0T A;  1Y1V S;  1VQN Z;  1KD1 1;  2OOY B;  2GU2 A;  3VMG A;  2R7Z I;  4E30 A;  1YI2 Z;  1VQ7 1;  3H3V J;  4DK1 A;  5T6B A;  1WJ2 A;  2JIO A;  1YUK A;  2E9H A;  1YJN Z;  2OOX B;  1TWA I;  4MD9 A;  4DGL A;  1KC8 2;  2NVT I;  3VB9 A;  5D1O B;  1K83 I;  5D1O A;  5T67 A;  4A3F I;  2RT9 A;  1W2B Z;  3D2L A;  2W03 A;  4A93 I;  2OZK A;  2V3V A;  4NBH A;  2I3C A;  1RLY A;  3GTL I;  4HGZ A;  4RS4 A;  3CCQ 1;  3MON A;  1VQ7 Z;  4A3I I;  2OTJ 1;  1YHQ 1;  1ZB8 A;  4MXU A;  2JNY A;  4A3J I;  2W04 A;  1FDO A;  4A3K I;  1Z02 A;  2OTL 1;  2QEX 1;  4E2W A;  3FKI I;  2VPX A;  4A3B I;  3GCF A;  3OW2 Z;  3CD6 Z;  4DQY B;  1TWC I;  1YUA A;  2KPI A;  1TWH I;  1VQ4 1;  3CCQ Z;  1Y1V I;  1KC8 1;  3CC4 1;  2OTJ Z;  2M6N A;  3M3Y I;  3KIH A;  1YHQ Z;  2PMZ A;  4Y7N I;  3GTQ I;  3HOZ I;  4NB8 A;  1Q7Y 2;  1M90 2;  2OTL Z;  3HKZ A;  1Q81 1;  2QEX Z;  2IZ3 A;  3EED A;  4NFR A;  4CL1 A;  1SIW A;  1P9N A;  4BBS I;  1WZN A;  1R9T I;  3CCE 1;  3CC4 Z;  5IT9 b;  1YJW 1;  4RVH A;  3S2H I;  3CCV 1;  1K9M 2;  5IP9 I;  2QLV B;  3GTK I;  3VMI A;  2VPZ A;  3I4N I;  2RBL A;  1Q7Y 1;  1QVG Z;  3CCE Z;  1M90 1;  1YIJ Z;  4RVD A;  3F3P C; 
#chains in the Genus database with same CATH homology
 1K8A 2;  2RPR A;  1W2B Y;  1RO0 A;  1YJW Z;  4X6A I;  3CCV Z;  1KD1 2;  5FLM I;  3CC2 1;  1K73 2;  1KRL A;  4E2X A;  3RZD I;  2R93 I;  3GTM S;  1VQ6 Z;  2E2H I;  2PM9 A;  1Q82 2;  1K9M 1;  4HH4 A;  3RZO I;  1VQ8 1;  3CCR 1;  1JJ2 Z;  1WW9 A;  1I50 I;  3NFZ A;  3S15 I;  3J81 f;  3CC2 Z;  1K8A 1;  1X3W A;  1Y1W I;  4NBG A;  3CMA 1;  3JAM f;  4RVG A;  2G2K A;  2VUG A;  2B63 I;  1ML8 A;  2YU9 I;  1K73 1;  1VQ8 Z;  3CCR Z;  4NB9 A;  4RV9 A;  1VQL 1;  5C4X I;  2H85 A;  3HOU I;  2NVX I;  5IP7 I;  2JA8 I;  3U50 C;  1Z01 A;  4MH4 A;  1Q82 1;  2GTI A;  3CMA Z;  1KQS Z;  1VQK 1;  5FLX b;  1S7M A;  5CM2 M;  2JS4 A;  4NBB A;  4S1T A;  1Q81 2;  3NH8 A;  4A3E I;  1VQ5 1;  1LQL A;  1VQL Z;  2Y0S A;  1QVG Y;  2QRD B;  3HOY I;  3CCL 1;  3S16 I;  3CQZ I;  1VQK Z;  1NUI A;  2JA6 I;  3S2D I;  1TFI A;  3EER A;  3I4M I;  2NVQ I;  4MRI A;  2P3Y A;  3BG0 B;  1VQ5 Z;  2Q51 A;  5A2Q f;  3S1Q I;  2GTH A;  3CCL Z;  3TDH B;  2E2I I;  1SFO I;  2JA7 I;  1JJ2 Y;  4MD7 A;  3HOW I;  3CCS 1;  1YJ9 1;  2VF1 A;  1VLA A;  1VQ4 Z;  3J7A 4;  1JWH C;  4A3C I;  1QYP A;  4BY1 I;  3S17 I;  2VUM I;  2K5R A;  3J80 f;  1QF8 A;  3GTP I;  1NJI 2;  1I6H I;  4AYB A;  3CCS Z;  3GKQ A;  1RO4 A;  1YJ9 Z;  4A3D I;  3I56 1;  3NDJ A;  4QTU A;  4E32 A;  1PFT A;  4EWC A;  3FQM A;  3NDI A;  3MZL B;  1KQS Y;  4HGY A;  2PK7 A;  2EGT A;  2LFU A;  2NVY I;  3NH5 A;  3P5J B;  1TWG I;  2WB1 A;  1S72 1;  1TWF I;  2V8I A;  3I07 A;  4BY7 I;  3FQQ A;  2YAD A;  3I56 Z;  5C3E I;  3ESW A;  4BBR I;  2Q4Z A;  2RIQ A;  1NJI 1;  1RO2 A;  1X3Z A;  1I3Q I;  3G71 1;  1S72 Z;  2DE7 A;  2AKL A;  2JA5 I;  3PO3 S;  4RVF A;  1WII A;  2M48 A;  4NBD A;  5T64 A;  3CCJ 1;  2DE6 A;  3MZK B;  1Q86 2;  3I55 1;  2V8J A;  3S1M I;  4NH1 C;  4NBE A;  4RVD A;  1VQ6 1;  1ZB9 A;  2O53 A;  4A3G I;  2KI7 B;  1QVF Z;  2F4M A;  3PO2 I;  3T4N B;  3HOV I;  3CCJ Z;  4TNU A;  3I55 Z;  3CCU 1;  2V8K A;  2R92 I;  1VQ9 1;  4NBF A;  5AN9 F;  3IFU A;  2DE5 A;  1WCM I;  4NBC A;  3GTM I;  2JUB A;  4MON A;  4Y52 I;  2F4O A;  1Q86 1;  1M1K 1;  1RQF A;  5IT9 f;  2R6M A;  3GTO I;  3PO3 I;  2K3R A;  2RHB A;  3CPW Z;  3CCU Z;  1VQM 1;  3CD6 1;  1VQ9 Z;  3HOX I;  3IX0 A;  5C44 I;  2QRE B;  5D1P A;  3H0G I;  2E2J I;  3J81 b;  2QA4 1;  5C4J I;  3G6E 1;  4A3M I;  3JAM b;  3CME 1;  3S1N I;  1VQM Z;  1VQP 1;  4NBA A;  3K7A I;  4E31 A;  1DL6 A;  2ZAE B;  2HU9 A;  3F3F C;  4A3L I;  4MD8 A;  2QA4 Z;  4E2Z A;  3CCM 1;  3CXC Z;  1VQO 1;  2J6A A;  3BG1 B;  3G6E Z;  3KIF A;  3S1R I;  1USP B;  1USP A;  1NP6 A;  3CME Z;  3VTN A;  2HF1 A;  1YIT 1;  1VQP Z;  1N2F A;  1QVF Y;  4E33 A;  4BXX I;  3G4S 1;  1ZH1 A;  3IF8 A;  1YIJ 1;  3CC7 1;  3CCM Z;  1VQO Z;  2QKD A;  1N8R 2;  1Z03 A;  3GTJ I;  3D6W A;  1L1O C;  1YIT Z;  3TE5 B;  2O4H A;  3QWU A;  5FLX f;  3G4S Z;  3LUS A;  3CPW Y;  5A2Q b;  2JR6 A;  3GTG I;  2BJO A;  3D9X A;  2WAQ A;  2QR1 B;  4XX2 A;  1RNI A;  2P28 A;  2JMO A;  1N8R 1;  1M1K 2;  4QTT A;  1VQN 1;  2QRC B;  3G71 Z;  3OW2 Y;  3M4O I;  3J80 b;  5LL6 f;  4NOZ A;  1YI2 1;  3NH4 A;  3VMH A;  1YJN 1;  2IZ4 A;  3CXC Y;  3S14 I;  3Q87 A;  4E2Y A;  2LIY A;  1X0T A;  1Y1V S;  1VQN Z;  1KD1 1;  2OOY B;  2GU2 A;  3VMG A;  2R7Z I;  4E30 A;  1YI2 Z;  1VQ7 1;  3H3V J;  4DK1 A;  5T6B A;  1YUK A;  2E9H A;  1YJN Z;  2OOX B;  1TWA I;  4MD9 A;  4DGL A;  1KC8 2;  2NVT I;  3VB9 A;  5D1O B;  1K83 I;  5D1O A;  5T67 A;  4A3F I;  2RT9 A;  1W2B Z;  2W03 A;  4A93 I;  2OZK A;  4NBH A;  2I3C A;  1RLY A;  3GTL I;  4HGZ A;  4RS4 A;  3CCQ 1;  3MON A;  1VQ7 Z;  4A3I I;  2OTJ 1;  1YHQ 1;  1ZB8 A;  4MXU A;  2JNY A;  4A3J I;  2W04 A;  4A3K I;  1Z02 A;  2OTL 1;  2QEX 1;  4E2W A;  3FKI I;  4A3B I;  3GCF A;  3OW2 Z;  3CD6 Z;  4DQY B;  1TWC I;  1YUA A;  2KPI A;  1TWH I;  1VQ4 1;  3CCQ Z;  1Y1V I;  1KC8 1;  3CC4 1;  2OTJ Z;  2M6N A;  3M3Y I;  3KIH A;  1YHQ Z;  2PMZ A;  4Y7N I;  3GTQ I;  3HOZ I;  4NB8 A;  1Q7Y 2;  1M90 2;  2OTL Z;  3HKZ A;  1Q81 1;  2QEX Z;  2IZ3 A;  3EED A;  4NFR A;  4CL1 A;  1P9N A;  4BBS I;  1R9T I;  3CCE 1;  3CC4 Z;  5IT9 b;  1YJW 1;  4RVH A;  3S2H I;  3CCV 1;  1K9M 2;  5IP9 I;  2QLV B;  3GTK I;  3VMI A;  3I4N I;  2RBL A;  1Q7Y 1;  1QVG Z;  3CCE Z;  1M90 1;  1YIJ Z;  3CC7 Z;  3F3P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...