3CQZI

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 14
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cqzI02
3RZDI 3GTPI 3LUSA 3PO3I 3M3YI 3GKQA 4NBDA 3S1RI 4BY1I 4QTTA 1X3WA 4A3CI 3HOXI 4NBHA 1I6HI 4BY7I 3HOWI 4NBBA 3S14I 1TWAI 1L1OC 3GTMS 3VMIA 3HOUI 2JS4A 4NBAA 3K7AI 2JR6A 2KPIA 2R93I 2JA7I 3GTQI 3FKII 2VUMI 3S16I 1WW9A 1LQLA 3S2HI 4NB8A 1Y1WI 1PFTA 5IP9I 1Y1VI 2NVYI 2JNYA 4A3EI 4A3DI 3HOYI 5IP7I 4BBRI 4A3GI 1R9TI 1SFOI 3HOVI 3S1QI 4BXXI 2NVXI 2YU9I 4NOZA 2E2II 1TWFI 2BJOA 3H0GI 4A93I 1VLAA 2J6AA 2R92I 2PK7A 4QTUA 2NVQI 2JA6I 2AKLA 4A3LI 4A3JI 3HOZI 3I4NI 2JA5I 1TWHI 3D6WA 3PO3S 3VMHA 2P3YA 3I4MI 4MH4A 1N2FA 1TFIA 5FLMI 4Y7NI 5C3EI 3Q87A 3GTKI 3M4OI 1RLYA 3GTOI 1I50I 2HF1A 3S2DI 3GTGI 1USPA 2DE6A 1ML8A 2NVTI 2F4OA 4NBGA 4A3BI 1X3ZA 1ZB8A 3RZOI 3S1MI 2K5RA 3S15I 3U50C 1Y1VS 1I3QI 1DL6A 4XX2A 3GTMI 3PO2I 4NBEA 1ZB9A 5C4JI 4A3MI 3GTLI 3VMGA 3VB9A 4BBSI 1QYPA 4A3II 1RO4A 2JA8I 2B63I 4NB9A 3S17I 1TWCI 5C44I 5CM2M 2E2HI 3GCFA 1USPB 1K83I 1WCMI 2R7ZI 3ESWA 3EERA 3I07A 2DE5A 1NUIA 3H3VJ 4NBFA 4A3KI 2RBLA 3S1NI 3GTJI 1YUAA 4A3FI 1TWGI 4NBCA 2E2JI 3CQZI 2F4MA 2DE7A 4X6AI 4Y52I 5C4XI
chains in the Genus database with same CATH superfamily
2JIQA 1Y8CA 3RZDI 4HH4A 2NAPA 1K9M2 4E31A 4BY1I 1VQ6Z 1X0TA 1X3WA 1I6HI 3HOWI 3HOUI 3CC41 3TE5B 2QA41 2EGTA 1AA6A 1VQO1 2VUMI 1YJ9Z 4NB8A 1YIT1 3CCE1 3CCR1 1PFTA 5IP9I 1JJ2Z 4A3DI 4BBRI 3CD6Z 1M1K1 3CCJZ 3S1QI 2NVXI 2YU9I 3CC2Z 3NH8A 2BJOA 3H0GI 2IZ3A 1K732 2O53A 1VLAA 2R92I 1YJNZ 3G6E1 4A3LI 3IFUA 3I4NI 2JA5I 3I4MI 4MH4A 1VQ4Z 2P28A 3CMAZ 3J81f 5FLMI 1Z02A 4E2YA 1YJWZ 2PM9A 1W2BY 3GTKI 1NP6A 1RLYA 1M902 1I50I 3S2DI 2IV2X 3GTGI 2W03A 5AN9F 4E30A 3EEDA 1VQN1 4A3BI 3S1MI 1K9M1 2VF1A 1YIJ1 5LL6f 3CCU1 3CC7Z 3CC4Z 1Q861 4A3MI 3VB9A 1RNIA 3J80b 1QYPA 3I561 1VQOZ 1YITZ 4RVHA 3CCEZ 3CCRZ 3I551 1USPB 2R7ZI 3EERA 3I07A 3IF8A 3H3VJ 1S721 4NBFA 1ZH1A 4A3KI 1VQK1 3GTJI 1W2BZ 2E2JI 2JIPA 2JIMA 1YHQ1 3G6EZ 2DE7A 3T4NB 1KQSY 4Y52I 2LFUA 3NFZA 4RVFA 1Q16A 1RO0A 3PO3I 4NBDA 3J7A4 5A2Qf 1L1OC 3GTMS 2V45A 3MZLB 1N8R1 2QRDB 1S7MA 2KPIA 2AYDA 1VQNZ 1M901 2JIOA 4EWCA 4E32A 3S16I 1YIJZ 1WW9A 1LQLA 1Q812 2V8KA 4E33A 1Y1WI 3CCUZ 2VPZA 1VQL1 1YUKA 2OTJ1 2JNYA 4MONA 5IP7I 3I56Z 2E9HA 1SFOI 3HOVI 2V8IA 4NOZA 1K8A1 1TWFI 1KQSZ 2E2II 3I55Z 4DGLA 1Z03A 2M48A 3NDIA 2JA6I 2AKLA 1TWHI 3D6WA 1S72Z 1VQKZ 1WIIA 1N2FA 2JMOA 3BG0B 1RQFA 1TFIA 1YHQZ 1Q7Y1 3M4OI 3D2LA 1USPA 2DE6A 2LEXA 2VUGA 4HGZA 3NDJA 4NBGA 1X3ZA 1ZB8A 2VPXA 3RZOI 3J81b 3U50C 1JWHC 4XX2A 3CCV1 4RVDA 3MONA 2RT9A 3CCM1 2K3RA 1KC82 3BG1B 1RO4A 4NB9A 3S17I 1TWCI 2JIRA 4MD9A 3CPWY 1Q822 1KD12 2GTHA 2QRCB 5D1PA 2Y0SA 1VQLZ 2OTJZ 2YADA 3NH5A 2GTIA 1Q811 3MZKB 2RBLA 3S1NI 1YI21 1TWGI 1QF8A 4NBCA 1WJ2A 3CQZI 2F4MA 1KRLA 2Q51A 2R6MA 4X6AI 5C4XI 3TDHB 4CL1A 2QA4Z 3M3YI 3GKQA 3S1RI 1VQ51 4A3CI 3HOXI 4NBHA 4BY7I 2WAQA 2W04A 1TWAI 3VMIA 2JS4A 3K7AI 2JR6A 2R93I 2OOXB 3GTQI 3CPWZ 2E7ZA 3FKII 3S2HI 5A2Qb 2G2KA 1Y1VI 3CCVZ 1K731 3CCL1 2NVYI 5T6BA 3CCMZ 3NH4A 4A3GI 1R9TI 2OTL1 4BXXI 2ZAEB 4DQYB 3D9XA 4MRIA 2GU2A 2J6AA 4MD8A 4QTUA 4DK1A 2NVQI 5FLXf 1M1K2 3HOZI 1Z01A 1VQM1 3PO3S 1YI2Z 5D1OB 3HKZA 4Y7NI 4MXUA 2HF1A 2RPRA 4TNUA 3CXCY 2RHBA 4E2XA 3CCS1 1ML8A 2NVTI 1VQ5Z 4E2ZA 4MD7A 3QWUA 3CME1 3S15I 1FDIA 4S1TA 1QVGY 3JAMf 3PO2I 2V8JA 3F3FC 4NBEA 3GTLI 3VMGA 3CCQ1 2QEX1 3F3PC 4A3II 2VPYA 1NJI2 3CCLZ 2E2HI 1Q862 1SIWA 5IT9b 3ESWA 1QXFA 2PMZA 3IR7A 4RV9A 3CC71 2QKDA 2OTLZ 2QR1B 4A3FI 3CXCZ 1FDOA 5IT9f 4RVGA 2QREB 2H85A 1VQMZ 3GTPI 3LUSA 3G4S1 4QTTA 1QVGZ 1VQ91 3FQQA 4NBBA 2IZ4A 3S14I 3KIHA 2OZKA 4NBAA 3CCSZ 3OW2Y 1VQ81 2JA7I 3IX0A 4NH1C 3CMEZ 1QVFY 5D1OA 1N8R2 4RS4A 3G711 1VQP1 4A3EI 3HOYI 2KI7B 3CCQZ 2QEXZ 2QLVB 1VQ71 4NFRA 3FQMA 4A93I 2PK7A 2LIYA 4A3JI 1NJI1 2JUBA 3VMHA 2P3YA 1K8A2 2I3CA 5T67A 1VQ61 5C3EI 3Q87A 2V3VA 3OW2Z 3GTOI 5FLXb 2O4HA 2VPWA 3J80f 1QVFZ 2F4OA 3G4SZ 4E2WA 1Q7Y2 1VQ9Z 1KC81 2K5RA 1YJ91 1Y1VS 1I3QI 2OOYB 1DL6A 1Q821 1KD11 3GTMI 1ZB9A 5C4JI 1VQ8Z 3P5JB 2HU9A 4BBSI 3CD61 2JA8I 3VTNA 2B63I 3CCJ1 3CC21 5T64A 5C44I 5CM2M 1WZNA 3GCFA 3G71Z 1VQPZ 1YJN1 3JAMb 1K83I 1WCMI 3KIFA 2DE5A 1NUIA 1JJ2Y 2M6NA 1P9NA 1VQ7Z 4AYBA 1RO2A 1VQ41 3CMA1 2WB1A 1YUAA 2RIQA 2Q4ZA 4HGYA 1YJW1
chains in the Genus database with same CATH topology
3RZDI 4HH4A 1K9M2 4E31A 4BY1I 1VQ6Z 1X0TA 1X3WA 1I6HI 3HOWI 3HOUI 3CC41 3TE5B 2QA41 2EGTA 1VQO1 2VUMI 1YJ9Z 4NB8A 1YIT1 3CCE1 3CCR1 1PFTA 5IP9I 1JJ2Z 4A3DI 4BBRI 3CD6Z 1M1K1 3CCJZ 3S1QI 2NVXI 2YU9I 3CC2Z 3NH8A 2BJOA 3H0GI 2IZ3A 1K732 2O53A 1VLAA 2R92I 1YJNZ 3G6E1 4A3LI 3IFUA 3I4NI 2JA5I 3I4MI 4MH4A 1VQ4Z 2P28A 3CMAZ 3J81f 5FLMI 1Z02A 4E2YA 1YJWZ 2PM9A 1W2BY 3GTKI 1NP6A 1RLYA 1M902 1I50I 3S2DI 3GTGI 2W03A 5AN9F 4E30A 3EEDA 1VQN1 4A3BI 3S1MI 1K9M1 2VF1A 1YIJ1 5LL6f 3CCU1 3CC7Z 3CC4Z 1Q861 4A3MI 3VB9A 1RNIA 3J80b 1QYPA 3I561 1VQOZ 1YITZ 4RVHA 3CCEZ 3CCRZ 3I551 1USPB 2R7ZI 3EERA 3I07A 3IF8A 3H3VJ 1S721 4NBFA 1ZH1A 4A3KI 1VQK1 3GTJI 1W2BZ 2E2JI 1YHQ1 3G6EZ 2DE7A 3T4NB 1KQSY 4Y52I 2LFUA 3NFZA 4RVFA 1RO0A 3PO3I 4NBDA 3J7A4 5A2Qf 1L1OC 3GTMS 3MZLB 1N8R1 2QRDB 1S7MA 2KPIA 1VQNZ 1M901 4EWCA 4E32A 3S16I 1YIJZ 1WW9A 1LQLA 1Q812 2V8KA 4E33A 1Y1WI 3CCUZ 1VQL1 1YUKA 2OTJ1 2JNYA 4MONA 5IP7I 3I56Z 2E9HA 1SFOI 3HOVI 2V8IA 4NOZA 1K8A1 1TWFI 1KQSZ 2E2II 3I55Z 4DGLA 1Z03A 2M48A 3NDIA 2JA6I 2AKLA 1TWHI 3D6WA 1S72Z 1VQKZ 1WIIA 1N2FA 2JMOA 3BG0B 1RQFA 1TFIA 1YHQZ 1Q7Y1 3M4OI 1USPA 2DE6A 2VUGA 4HGZA 3NDJA 4NBGA 1X3ZA 1ZB8A 3RZOI 3J81b 3U50C 1JWHC 4XX2A 3CCV1 4RVDA 3MONA 2RT9A 3CCM1 2K3RA 1KC82 3BG1B 1RO4A 4NB9A 3S17I 1TWCI 4MD9A 3CPWY 1Q822 1KD12 2GTHA 2QRCB 5D1PA 2Y0SA 1VQLZ 2OTJZ 2YADA 3NH5A 2GTIA 1Q811 3MZKB 2RBLA 3S1NI 1YI21 1TWGI 1QF8A 4NBCA 3CQZI 2F4MA 1KRLA 2Q51A 2R6MA 4X6AI 5C4XI 3TDHB 4CL1A 2QA4Z 3M3YI 3GKQA 3S1RI 1VQ51 4A3CI 3HOXI 4NBHA 4BY7I 2WAQA 2W04A 1TWAI 3VMIA 2JS4A 3K7AI 2JR6A 2R93I 2OOXB 3GTQI 3CPWZ 3FKII 3S2HI 5A2Qb 2G2KA 1Y1VI 3CCVZ 1K731 3CCL1 2NVYI 5T6BA 3CCMZ 3NH4A 4A3GI 1R9TI 2OTL1 4BXXI 2ZAEB 4DQYB 3D9XA 4MRIA 2GU2A 2J6AA 4MD8A 4QTUA 4DK1A 2NVQI 5FLXf 1M1K2 3HOZI 1Z01A 1VQM1 3PO3S 1YI2Z 5D1OB 3HKZA 4Y7NI 4MXUA 2HF1A 2RPRA 4TNUA 3CXCY 2RHBA 4E2XA 3CCS1 1ML8A 2NVTI 1VQ5Z 4E2ZA 4MD7A 3QWUA 3CME1 3S15I 4S1TA 1QVGY 3JAMf 3PO2I 2V8JA 3F3FC 4NBEA 3GTLI 3VMGA 3CCQ1 2QEX1 3F3PC 4A3II 1NJI2 3CCLZ 2E2HI 1Q862 5IT9b 3ESWA 2PMZA 4RV9A 3CC71 2QKDA 2OTLZ 2QR1B 4A3FI 3CXCZ 5IT9f 4RVGA 2QREB 2H85A 1VQMZ 3GTPI 3LUSA 3G4S1 4QTTA 1QVGZ 1VQ91 3FQQA 4NBBA 2IZ4A 3S14I 3KIHA 2OZKA 4NBAA 3CCSZ 3OW2Y 1VQ81 2JA7I 3IX0A 4NH1C 3CMEZ 1QVFY 5D1OA 1N8R2 4RS4A 3G711 1VQP1 4A3EI 3HOYI 2KI7B 3CCQZ 2QEXZ 2QLVB 1VQ71 4NFRA 3FQMA 4A93I 2PK7A 2LIYA 4A3JI 1NJI1 2JUBA 3VMHA 2P3YA 1K8A2 2I3CA 5T67A 1VQ61 5C3EI 3Q87A 3OW2Z 3GTOI 5FLXb 2O4HA 3J80f 1QVFZ 2F4OA 3G4SZ 4E2WA 1Q7Y2 1VQ9Z 1KC81 2K5RA 1YJ91 1Y1VS 1I3QI 2OOYB 1DL6A 1Q821 1KD11 3GTMI 1ZB9A 5C4JI 1VQ8Z 3P5JB 2HU9A 4BBSI 3CD61 2JA8I 3VTNA 2B63I 3CCJ1 3CC21 5T64A 5C44I 5CM2M 3GCFA 3G71Z 1VQPZ 1YJN1 3JAMb 1K83I 1WCMI 3KIFA 2DE5A 1NUIA 1JJ2Y 2M6NA 1P9NA 1VQ7Z 4AYBA 1RO2A 1VQ41 3CMA1 2WB1A 1YUAA 2RIQA 2Q4ZA 4HGYA 1YJW1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD I;  3GTP I;  3LUS A;  3PO3 I;  3M3Y I;  3GKQ A;  4NBD A;  3S1R I;  4BY1 I;  4QTT A;  1X3W A;  4A3C I;  3HOX I;  4NBH A;  1I6H I;  4BY7 I;  3HOW I;  4NBB A;  3S14 I;  1TWA I;  1L1O C;  3GTM S;  3VMI A;  3HOU I;  2JS4 A;  4NBA A;  3K7A I;  2JR6 A;  2KPI A;  2R93 I;  2JA7 I;  3GTQ I;  3FKI I;  2VUM I;  3S16 I;  1WW9 A;  1LQL A;  3S2H I;  4NB8 A;  1Y1W I;  1PFT A;  5IP9 I;  1Y1V I;  2NVY I;  2JNY A;  4A3E I;  4A3D I;  3HOY I;  5IP7 I;  4BBR I;  4A3G I;  1R9T I;  1SFO I;  3HOV I;  3S1Q I;  4BXX I;  2NVX I;  2YU9 I;  4NOZ A;  2E2I I;  1TWF I;  2BJO A;  3H0G I;  4A93 I;  1VLA A;  2J6A A;  2R92 I;  2PK7 A;  4QTU A;  2NVQ I;  2JA6 I;  2AKL A;  4A3L I;  4A3J I;  3HOZ I;  3I4N I;  2JA5 I;  1TWH I;  3D6W A;  3PO3 S;  3VMH A;  2P3Y A;  3I4M I;  4MH4 A;  1N2F A;  1TFI A;  5FLM I;  4Y7N I;  5C3E I;  3Q87 A;  3GTK I;  3M4O I;  1RLY A;  3GTO I;  1I50 I;  2HF1 A;  3S2D I;  3GTG I;  1USP A;  2DE6 A;  1ML8 A;  2NVT I;  2F4O A;  4NBG A;  4A3B I;  1X3Z A;  1ZB8 A;  3RZO I;  3S1M I;  2K5R A;  3S15 I;  3U50 C;  1Y1V S;  1I3Q I;  1DL6 A;  4XX2 A;  3GTM I;  3PO2 I;  4NBE A;  1ZB9 A;  5C4J I;  4A3M I;  3GTL I;  3VMG A;  3VB9 A;  4BBS I;  1QYP A;  4A3I I;  1RO4 A;  2JA8 I;  2B63 I;  4NB9 A;  3S17 I;  1TWC I;  5C44 I;  5CM2 M;  2E2H I;  3GCF A;  1USP B;  1K83 I;  1WCM I;  2R7Z I;  3ESW A;  3EER A;  3I07 A;  2DE5 A;  1NUI A;  3H3V J;  4NBF A;  4A3K I;  2RBL A;  3S1N I;  3GTJ I;  1YUA A;  4A3F I;  1TWG I;  4NBC A;  2E2J I;  3CQZ I;  2F4M A;  2DE7 A;  4X6A I;  4Y52 I;  5C4X I; 
#chains in the Genus database with same CATH topology
 2JIQ A;  1Y8C A;  3RZD I;  4HH4 A;  2NAP A;  1K9M 2;  4E31 A;  4BY1 I;  1VQ6 Z;  1X0T A;  1X3W A;  1I6H I;  3HOW I;  3HOU I;  3CC4 1;  3TE5 B;  2QA4 1;  2EGT A;  1AA6 A;  1VQO 1;  2VUM I;  1YJ9 Z;  4NB8 A;  1YIT 1;  3CCE 1;  3CCR 1;  1PFT A;  5IP9 I;  1JJ2 Z;  4A3D I;  4BBR I;  3CD6 Z;  1M1K 1;  3CCJ Z;  3S1Q I;  2NVX I;  2YU9 I;  3CC2 Z;  3NH8 A;  2BJO A;  3H0G I;  2IZ3 A;  1K73 2;  2O53 A;  1VLA A;  2R92 I;  1YJN Z;  3G6E 1;  4A3L I;  3IFU A;  3I4N I;  2JA5 I;  3I4M I;  4MH4 A;  1VQ4 Z;  2P28 A;  3CMA Z;  3J81 f;  5FLM I;  1Z02 A;  4E2Y A;  1YJW Z;  2PM9 A;  1W2B Y;  3GTK I;  1NP6 A;  1RLY A;  1M90 2;  1I50 I;  3S2D I;  2IV2 X;  3GTG I;  2W03 A;  5AN9 F;  4E30 A;  3EED A;  1VQN 1;  4A3B I;  3S1M I;  1K9M 1;  2VF1 A;  1YIJ 1;  5LL6 f;  3CCU 1;  3CC7 Z;  3CC4 Z;  1Q86 1;  4A3M I;  3VB9 A;  1RNI A;  3J80 b;  1QYP A;  3I56 1;  1VQO Z;  1YIT Z;  4RVH A;  3CCE Z;  3CCR Z;  3I55 1;  1USP B;  2R7Z I;  3EER A;  3I07 A;  3IF8 A;  3H3V J;  1S72 1;  4NBF A;  1ZH1 A;  4A3K I;  1VQK 1;  3GTJ I;  1W2B Z;  2E2J I;  2JIP A;  2JIM A;  1YHQ 1;  3G6E Z;  2DE7 A;  3T4N B;  1KQS Y;  4Y52 I;  2LFU A;  3NFZ A;  4RVF A;  1Q16 A;  1RO0 A;  3PO3 I;  4NBD A;  3J7A 4;  5A2Q f;  1L1O C;  3GTM S;  2V45 A;  3MZL B;  1N8R 1;  2QRD B;  1S7M A;  2KPI A;  2AYD A;  1VQN Z;  1M90 1;  2JIO A;  4EWC A;  4E32 A;  3S16 I;  1YIJ Z;  1WW9 A;  1LQL A;  1Q81 2;  2V8K A;  4E33 A;  1Y1W I;  3CCU Z;  2VPZ A;  1VQL 1;  1YUK A;  2OTJ 1;  2JNY A;  4MON A;  5IP7 I;  3I56 Z;  2E9H A;  1SFO I;  3HOV I;  2V8I A;  4NOZ A;  1K8A 1;  1TWF I;  1KQS Z;  2E2I I;  3I55 Z;  4DGL A;  1Z03 A;  2M48 A;  3NDI A;  2JA6 I;  2AKL A;  1TWH I;  3D6W A;  1S72 Z;  1VQK Z;  1WII A;  1N2F A;  2JMO A;  3BG0 B;  1RQF A;  1TFI A;  1YHQ Z;  1Q7Y 1;  3M4O I;  3D2L A;  1USP A;  2DE6 A;  2LEX A;  2VUG A;  4HGZ A;  3NDJ A;  4NBG A;  1X3Z A;  1ZB8 A;  2VPX A;  3RZO I;  3J81 b;  3U50 C;  1JWH C;  4XX2 A;  3CCV 1;  4RVD A;  3MON A;  2RT9 A;  3CCM 1;  2K3R A;  1KC8 2;  3BG1 B;  1RO4 A;  4NB9 A;  3S17 I;  1TWC I;  2JIR A;  4MD9 A;  3CPW Y;  1Q82 2;  1KD1 2;  2GTH A;  2QRC B;  5D1P A;  2Y0S A;  1VQL Z;  2OTJ Z;  2YAD A;  3NH5 A;  2GTI A;  1Q81 1;  3MZK B;  2RBL A;  3S1N I;  1YI2 1;  1TWG I;  1QF8 A;  4NBC A;  1WJ2 A;  3CQZ I;  2F4M A;  1KRL A;  2Q51 A;  2R6M A;  4X6A I;  5C4X I;  3TDH B;  4CL1 A;  2QA4 Z;  3M3Y I;  3GKQ A;  3S1R I;  1VQ5 1;  4A3C I;  3HOX I;  4NBH A;  4BY7 I;  2WAQ A;  2W04 A;  1TWA I;  3VMI A;  2JS4 A;  3K7A I;  2JR6 A;  2R93 I;  2OOX B;  3GTQ I;  3CPW Z;  2E7Z A;  3FKI I;  3S2H I;  5A2Q b;  2G2K A;  1Y1V I;  3CCV Z;  1K73 1;  3CCL 1;  2NVY I;  5T6B A;  3CCM Z;  3NH4 A;  4A3G I;  1R9T I;  2OTL 1;  4BXX I;  2ZAE B;  4DQY B;  3D9X A;  4MRI A;  2GU2 A;  2J6A A;  4MD8 A;  4QTU A;  4DK1 A;  2NVQ I;  5FLX f;  1M1K 2;  3HOZ I;  1Z01 A;  1VQM 1;  3PO3 S;  1YI2 Z;  5D1O B;  3HKZ A;  4Y7N I;  4MXU A;  2HF1 A;  2RPR A;  4TNU A;  3CXC Y;  2RHB A;  4E2X A;  3CCS 1;  1ML8 A;  2NVT I;  1VQ5 Z;  4E2Z A;  4MD7 A;  3QWU A;  3CME 1;  3S15 I;  1FDI A;  4S1T A;  1QVG Y;  3JAM f;  3PO2 I;  2V8J A;  3F3F C;  4NBE A;  3GTL I;  3VMG A;  3CCQ 1;  2QEX 1;  3F3P C;  4A3I I;  2VPY A;  1NJI 2;  3CCL Z;  2E2H I;  1Q86 2;  1SIW A;  5IT9 b;  3ESW A;  1QXF A;  2PMZ A;  3IR7 A;  4RV9 A;  3CC7 1;  2QKD A;  2OTL Z;  2QR1 B;  4A3F I;  3CXC Z;  1FDO A;  5IT9 f;  4RVG A;  2QRE B;  2H85 A;  1VQM Z;  3GTP I;  3LUS A;  3G4S 1;  4QTT A;  1QVG Z;  1VQ9 1;  3FQQ A;  4NBB A;  2IZ4 A;  3S14 I;  3KIH A;  2OZK A;  4NBA A;  3CCS Z;  3OW2 Y;  1VQ8 1;  2JA7 I;  3IX0 A;  4NH1 C;  3CME Z;  1QVF Y;  5D1O A;  1N8R 2;  4RS4 A;  3G71 1;  1VQP 1;  4A3E I;  3HOY I;  2KI7 B;  3CCQ Z;  2QEX Z;  2QLV B;  1VQ7 1;  4NFR A;  3FQM A;  4A93 I;  2PK7 A;  2LIY A;  4A3J I;  1NJI 1;  2JUB A;  3VMH A;  2P3Y A;  1K8A 2;  2I3C A;  5T67 A;  1VQ6 1;  5C3E I;  3Q87 A;  2V3V A;  3OW2 Z;  3GTO I;  5FLX b;  2O4H A;  2VPW A;  3J80 f;  1QVF Z;  2F4O A;  3G4S Z;  4E2W A;  1Q7Y 2;  1VQ9 Z;  1KC8 1;  2K5R A;  1YJ9 1;  1Y1V S;  1I3Q I;  2OOY B;  1DL6 A;  1Q82 1;  1KD1 1;  3GTM I;  1ZB9 A;  5C4J I;  1VQ8 Z;  3P5J B;  2HU9 A;  4BBS I;  3CD6 1;  2JA8 I;  3VTN A;  2B63 I;  3CCJ 1;  3CC2 1;  5T64 A;  5C44 I;  5CM2 M;  1WZN A;  3GCF A;  3G71 Z;  1VQP Z;  1YJN 1;  3JAM b;  1K83 I;  1WCM I;  3KIF A;  2DE5 A;  1NUI A;  1JJ2 Y;  2M6N A;  1P9N A;  1VQ7 Z;  4AYB A;  1RO2 A;  1VQ4 1;  3CMA 1;  2WB1 A;  1YUA A;  2RIQ A;  2Q4Z A;  4HGY A;  1YJW 1; 
#chains in the Genus database with same CATH homology
 3RZD I;  4HH4 A;  1K9M 2;  4E31 A;  4BY1 I;  1VQ6 Z;  1X0T A;  1X3W A;  1I6H I;  3HOW I;  3HOU I;  3CC4 1;  3TE5 B;  2QA4 1;  2EGT A;  1VQO 1;  2VUM I;  1YJ9 Z;  4NB8 A;  1YIT 1;  3CCE 1;  3CCR 1;  1PFT A;  5IP9 I;  1JJ2 Z;  4A3D I;  4BBR I;  3CD6 Z;  1M1K 1;  3CCJ Z;  3S1Q I;  2NVX I;  2YU9 I;  3CC2 Z;  3NH8 A;  2BJO A;  3H0G I;  2IZ3 A;  1K73 2;  2O53 A;  1VLA A;  2R92 I;  1YJN Z;  3G6E 1;  4A3L I;  3IFU A;  3I4N I;  2JA5 I;  3I4M I;  4MH4 A;  1VQ4 Z;  2P28 A;  3CMA Z;  3J81 f;  5FLM I;  1Z02 A;  4E2Y A;  1YJW Z;  2PM9 A;  1W2B Y;  3GTK I;  1NP6 A;  1RLY A;  1M90 2;  1I50 I;  3S2D I;  3GTG I;  2W03 A;  5AN9 F;  4E30 A;  3EED A;  1VQN 1;  4A3B I;  3S1M I;  1K9M 1;  2VF1 A;  1YIJ 1;  5LL6 f;  3CCU 1;  3CC7 Z;  3CC4 Z;  1Q86 1;  4A3M I;  3VB9 A;  1RNI A;  3J80 b;  1QYP A;  3I56 1;  1VQO Z;  1YIT Z;  4RVH A;  3CCE Z;  3CCR Z;  3I55 1;  1USP B;  2R7Z I;  3EER A;  3I07 A;  3IF8 A;  3H3V J;  1S72 1;  4NBF A;  1ZH1 A;  4A3K I;  1VQK 1;  3GTJ I;  1W2B Z;  2E2J I;  1YHQ 1;  3G6E Z;  2DE7 A;  3T4N B;  1KQS Y;  4Y52 I;  2LFU A;  3NFZ A;  4RVF A;  1RO0 A;  3PO3 I;  4NBD A;  3J7A 4;  5A2Q f;  1L1O C;  3GTM S;  3MZL B;  1N8R 1;  2QRD B;  1S7M A;  2KPI A;  1VQN Z;  1M90 1;  4EWC A;  4E32 A;  3S16 I;  1YIJ Z;  1WW9 A;  1LQL A;  1Q81 2;  2V8K A;  4E33 A;  1Y1W I;  3CCU Z;  1VQL 1;  1YUK A;  2OTJ 1;  2JNY A;  4MON A;  5IP7 I;  3I56 Z;  2E9H A;  1SFO I;  3HOV I;  2V8I A;  4NOZ A;  1K8A 1;  1TWF I;  1KQS Z;  2E2I I;  3I55 Z;  4DGL A;  1Z03 A;  2M48 A;  3NDI A;  2JA6 I;  2AKL A;  1TWH I;  3D6W A;  1S72 Z;  1VQK Z;  1WII A;  1N2F A;  2JMO A;  3BG0 B;  1RQF A;  1TFI A;  1YHQ Z;  1Q7Y 1;  3M4O I;  1USP A;  2DE6 A;  2VUG A;  4HGZ A;  3NDJ A;  4NBG A;  1X3Z A;  1ZB8 A;  3RZO I;  3J81 b;  3U50 C;  1JWH C;  4XX2 A;  3CCV 1;  4RVD A;  3MON A;  2RT9 A;  3CCM 1;  2K3R A;  1KC8 2;  3BG1 B;  1RO4 A;  4NB9 A;  3S17 I;  1TWC I;  4MD9 A;  3CPW Y;  1Q82 2;  1KD1 2;  2GTH A;  2QRC B;  5D1P A;  2Y0S A;  1VQL Z;  2OTJ Z;  2YAD A;  3NH5 A;  2GTI A;  1Q81 1;  3MZK B;  2RBL A;  3S1N I;  1YI2 1;  1TWG I;  1QF8 A;  4NBC A;  3CQZ I;  2F4M A;  1KRL A;  2Q51 A;  2R6M A;  4X6A I;  5C4X I;  3TDH B;  4CL1 A;  2QA4 Z;  3M3Y I;  3GKQ A;  3S1R I;  1VQ5 1;  4A3C I;  3HOX I;  4NBH A;  4BY7 I;  2WAQ A;  2W04 A;  1TWA I;  3VMI A;  2JS4 A;  3K7A I;  2JR6 A;  2R93 I;  2OOX B;  3GTQ I;  3CPW Z;  3FKI I;  3S2H I;  5A2Q b;  2G2K A;  1Y1V I;  3CCV Z;  1K73 1;  3CCL 1;  2NVY I;  5T6B A;  3CCM Z;  3NH4 A;  4A3G I;  1R9T I;  2OTL 1;  4BXX I;  2ZAE B;  4DQY B;  3D9X A;  4MRI A;  2GU2 A;  2J6A A;  4MD8 A;  4QTU A;  4DK1 A;  2NVQ I;  5FLX f;  1M1K 2;  3HOZ I;  1Z01 A;  1VQM 1;  3PO3 S;  1YI2 Z;  5D1O B;  3HKZ A;  4Y7N I;  4MXU A;  2HF1 A;  2RPR A;  4TNU A;  3CXC Y;  2RHB A;  4E2X A;  3CCS 1;  1ML8 A;  2NVT I;  1VQ5 Z;  4E2Z A;  4MD7 A;  3QWU A;  3CME 1;  3S15 I;  4S1T A;  1QVG Y;  3JAM f;  3PO2 I;  2V8J A;  3F3F C;  4NBE A;  3GTL I;  3VMG A;  3CCQ 1;  2QEX 1;  3F3P C;  4A3I I;  1NJI 2;  3CCL Z;  2E2H I;  1Q86 2;  5IT9 b;  3ESW A;  2PMZ A;  4RV9 A;  3CC7 1;  2QKD A;  2OTL Z;  2QR1 B;  4A3F I;  3CXC Z;  5IT9 f;  4RVG A;  2QRE B;  2H85 A;  1VQM Z;  3GTP I;  3LUS A;  3G4S 1;  4QTT A;  1QVG Z;  1VQ9 1;  3FQQ A;  4NBB A;  2IZ4 A;  3S14 I;  3KIH A;  2OZK A;  4NBA A;  3CCS Z;  3OW2 Y;  1VQ8 1;  2JA7 I;  3IX0 A;  4NH1 C;  3CME Z;  1QVF Y;  5D1O A;  1N8R 2;  4RS4 A;  3G71 1;  1VQP 1;  4A3E I;  3HOY I;  2KI7 B;  3CCQ Z;  2QEX Z;  2QLV B;  1VQ7 1;  4NFR A;  3FQM A;  4A93 I;  2PK7 A;  2LIY A;  4A3J I;  1NJI 1;  2JUB A;  3VMH A;  2P3Y A;  1K8A 2;  2I3C A;  5T67 A;  1VQ6 1;  5C3E I;  3Q87 A;  3OW2 Z;  3GTO I;  5FLX b;  2O4H A;  3J80 f;  1QVF Z;  2F4O A;  3G4S Z;  4E2W A;  1Q7Y 2;  1VQ9 Z;  1KC8 1;  2K5R A;  1YJ9 1;  1Y1V S;  1I3Q I;  2OOY B;  1DL6 A;  1Q82 1;  1KD1 1;  3GTM I;  1ZB9 A;  5C4J I;  1VQ8 Z;  3P5J B;  2HU9 A;  4BBS I;  3CD6 1;  2JA8 I;  3VTN A;  2B63 I;  3CCJ 1;  3CC2 1;  5T64 A;  5C44 I;  5CM2 M;  3GCF A;  3G71 Z;  1VQP Z;  1YJN 1;  3JAM b;  1K83 I;  1WCM I;  3KIF A;  2DE5 A;  1NUI A;  1JJ2 Y;  2M6N A;  1P9N A;  1VQ7 Z;  4AYB A;  1RO2 A;  1VQ4 1;  3CMA 1;  2WB1 A;  1YUA A;  2RIQ A;  2Q4Z A;  4HGY A;  1YJW 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...